4WXTA

X-ray crystal structure of thioredoxin from mycobacterium avium
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
108
structure length
108
Chain Sequence
IATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDANPETAQNFQVVSIPTLILFKDGQPVKRIVGAKGKAALLRELSDAVPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title X-ray crystal structure of thioredoxin from Mycobacterium avium
rcsb
source organism Mycobacterium avium subsp. hominissuis 3388
molecule tags Hydrolase
total genus 32
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4wxtA00
2VD1A 3VWXA 1LU4A 2WULA 3GA4A 5IMDA 3H93A 2YZUA 2ZCTA 5IMAA 1KEBA 4HOJA 5A4UA 4TRXA 2M80A 4KA0A 2GZPA 1UN2A 3D6IA 1M9AA 2C0DA 1XBSA 4HQZA 2K18A 2PMTA 3F8UA 3LQ7A 3PGTA 2FLSA 4MCUA 1PSQA 4ZXGA 1GSFA 3KTLA 4WXTA 4DVCA 4BWSA 1WE0A 2VCTA 3L9SA 5J41A 2R2JA 2JZTA 3LXTA 3MNGA 5DJLA 3P8WA 3FZ9A 1QXHA 4DEJA 1OC9A 3ZLPA 4KSMA 5KN2A 2HE3A 4YQUA 1OE8A 4E8HA 1BAYA 1GUMA 1EZKA 1XVWA 5IO2A 1PRXA 4CDOA 4MH3A 2CV4A 1WJKA 3U6VA 3C71A 4O7HA 4GQFA 2B1KA 2H6XA 2OJLA 3GFKA 1AW9A 3I9V2 5J9BA 3H79A 3HKRA 2LTKA 3DD3A 4JE1A 2B6MA 4BA7A 1GUKA 2F8AA 3IE3A 1S3CA 1OC8A 4WEYA 3QOUA 4MMMA 1XWKA 3APSA 5IOXA 3HDCA 4OO5A 3L9UA 3GX8A 2L6CA 2O8VB 3LSZA 2GLRA 3TJFA 3F4TA 3D5JA 3FW2A 3I43A 4MPGA 1HQOA 3FZAA 5CP1A 3NZNA 2B5EA 1B9YC 5CRDA 3QFBC 4GRFA 2KP2A 4YAPA 3LXZA 4ZL9A 4EDZA 4LLRA 4JR6A 5JCGA 5EL8A 2H66A 3UBKA 3KTBA 3MDKA 2D2ZA 1IYHA 4FYBA 6GSWA 3EMXA 3G7JA 5IMFA 2B1LA 2FGXA 2PPTA 5CRGA 2R5GA 1SL1B 1QUWA 1ZYEA 2DJ2A 2H73A 5B6MA 2GQLA 3I6AA 3KZQA 2IIYA 2P31A 4KE3A 4XTSA 5GSSA 1FB6A 2H6YA 2EIQA 1AUCA 2WS2A 2H01A 3D22A 1TRSA 1OC9B 1XIYA 5DQYA 3EINA 5FWGA 3RPPA 3BBYA 1X5CA 4PGTA 5G2ZA 3ZIVA 2XHFA 2TRXA 4ECIA 1EV9A 5ECMB 4IELA 2PUKC 4XRDA 1OKTA 1JFUA 4TR3A 1H75A 2FD3A 2IL3A 2NTOA 4BPYA 5ECSA 3IXRA 3EURA 2OBIA 2AUVA 3M8NA 3V1WA 1K0MA 2YANA 3ME8A 2FA4A 1A2MA 1B48A 6GSYA 5IMCA 2HI7A 4HDEA 1Q4JA 2R4VA 4GTUA 3ZMKA 4ZB9A 1U6TA 1MDIA 4GSSA 4CHSA 4FYCA 2CVDA 3F0IA 3IA1A 2GZYA 2VL3A 3I69A 2PN8A 2LNTA 1TXXA 2HYXA 1V98A 4K8MA 2VOCA 1TP9A 2N5AA 2WB9A 4OFNA 5D9WA 2YWOA 5GZZB 3CRTA 1HYUA 2G2QA 2RM6A 2H74A 2A2RA 4WBRD 1XVQA 1AIUA 1O7UA 1GTIA 3CTFA 2X99A 1YF1A 2FY6A 3VI7A 4IKHA 3UIWA 1PGTA 2O85A 3QCPA 4I2UA 2PERA 1J0FA 1JLVA 1O81A 2MZCA 2P0GA 2HRNA 4YQVA 4F82A 2I3YA 3DKSA 2VIMA 4D73A 12GSA 4ML1A 3L78A 1BQ7A 2GSSA 4X0XA 3QAVA 1A2JA 4HJMA 2KLXA 3Q19A 5ECIB 4AJ7A 2VO4A 4YAVA 2H71A 2WGRA 1X9WB 1K0BA 1M2DA 3F6DA 3HCZA 1XW6A 5ABRA 1SYRA 1Y6EA 1WPIA 4L5OA 1Z7RA 3HXSA 4XCSA 4ZBAA 2YV7A 5HR0A 1V9WA 2C0EA 3D4TA 3F6FA 3RPNA 3KM6A 3DEXA 1WOUA 3MAKA 2GSQA 3F3RA 3TDGA 3LG6A 2XC2A 3N5OA 2JZRA 6GSXA 3UBLA 2CA8A 3UVTA 1GRXA 4K7NA 4F0CA 1IYIA 1AXDA 2DMMA 4POLA 1RQMA 2J23A 2H0IA 4IBPA 5C04A 4IQ1A 2NDOA 1R7HA 2LSTA 2HZFA 1UA5A 1TRUA 4TN8A 4GF0A 2A4VA 4LL4B 1WMJA 1J9BA 1TJDA 4DSSB 4D73B 4PQ1A 1EOGA 1OKDA 2RLIA 1T8EB 3HYPA 1Z6MA 3P7XA 2LJKA 1X5DA 2VLUA 1BEDA 4TR4A 2QKEA 4ZILA 2GDRA 5G1LA 1TDIA 3BOAA 1JLWA 4FIWA 4AJ8A 2VCXA 3LYKA 2JL4A 4Q5FA 2AYTA 4TXOA 1BJXA 1ZMAA 3TB2A 5COHA 2R3XA 3DIEA 3GL5A 4F03A 4I5QA 3C1SA 2C4JA 3GHAA 4XIHA 3G7YA 3D21A 1SK0A 1F6MC 1SU9A 2NBSA 2M46A 3TKSE 2MBSA 1J08A 2DIZA 2MMNA 2I9HA 3WGDA 1ZOFA 1SL0B 3FEUA 3D0ZA 3GH6A 4K0NA 1FG4A 5CNWA 2XPEA 3TKRA 4ZL7A 3WT2A 4ZBBA 2E2MA 2LRTA 4KH7A 2BTOT 1FVKA 2K8VA 2GGTA 1FAAA 3SWLA 1A23A 3WGXA 4Q5QA 2AAWA 5B6NA 3LJRA 3DGQA 4WKWA 4EKZA 2IMEA 1F2EA 1MDKA 2GT5A 3FR9A 1U87A 1R4WA 2GVPA 2GS3A 3C8EA 3O6TA 2KUCA 1TW9A 3TKQA 1AQVA 5JWOB 1MDJA 3DXBA 4KDUA 1EWXA 4MP4A 1GTUA 1TRVA 4G9HA 4JEDA 1XOAA 4TXOB 2BMXA 1GTBA 1SD8A 1K0OA 4N10A 2J9HA 4P3YB 1V58A 4KNDA 3US3A 3GURA 2IMDA 1TTZA 1QFNA 3LYPA 2RUEA 4HU9A 4LMVA 2OBKA 2VL2A 3FK8A 4HUAA 2YNXA 4BVYA 3DWVA 5LNKe 1K0CA 3OR5A 3M0FA 2C1YA 10GSA 1EGRA 4N30A 2HSYA 1R5PA 1ZYQB 3C73A 4V2NA 1F37A 2VCWA 3RAZA 3W8JA 3M9KA 1TKDB 2WZ9A 3KEBA 1DSBA 3Q18A 2REMA 4AGSA 4POMA 5ID2A 3UARA 1U3AA 2O87A 3SBCA 3ME7A 2IMKA 2AHEA 4FH8A 1XW9A 4IP6A 4BL7A 4DSRA 1X9MB 3GKKA 3Q6OA 4BVXA 3F4RA 2CAIA 3RHBA 3IAM2 5D73A 4I2TA 3KD0A 3CYNA 3MWHA 5G1KA 3DMLA 1YEPA 5CAXA 1MTCA 3PH9A 1HNAA 3DVXA 16GSA 3GV1A 5CRHA 1SK1A 3KMOA 1QQ2A 1SK2A 3QD9A 4EO3A 1ZCPA 4YQMA 4PQHA 5KN0A 1EP8A 2H0HA 4KGIA 3FZ5A 4ECCA 1WWJA 3KGKA 3VWUA 5B8BA 4TOPA 2LV3A 2OE3A 4Z7XA 3P90A 5HQPA 2H1BA 2IFQA 1JZOA 5DCGA 3FYGA 4GLTA 2EC4A 5DJMA 1G6YA 2C3QA 4MJCA 2IMFA 3KP8A 5A4VA 4N0ZA 5IMZA 3F63A 4XRAA 4MJAA 4FO5A 4IVFA 5GAND 1TK5B 1PL2A 2GQMA 2ES7A 3VFIA 1M7TA 2LUSA 2MBTA 3HZ8A 2E7PA 1SD9A 3TKSA 6GSTA 4GXZA 1QMVA 1T4ZA 1T4YA 4KUNA 2FNOA 1F3BA 3M1GA 1K0NA 1SKWB 2I4AA 4TR1A 1GULA 2HZEA 2H6ZA 2F9SA 19GSA 5ID2B 4GSTA 4NWYA 3ZRDA 4I8BA 1PN9A 2GQKA 2DJ3A 1MEKA 3ZYWA 1CQGA 2DC5A 4K6XA 2TRCP 2OADA 2C3NA 1U3IA 5HFIA 1O8WA 4K0GA 1A8LA 1EOHA 4ULXA 2B7JA 1YZXA 3U5RE 3WT1A 1NW2A 1F3AA 1PA3A 3KMNA 4KX4A 5IIZA 2I81A 1PD21 3CMIA 1W4VA 2DLXA 2L57A 4TW5A 2CT6A 1B4QA 2IMIA 1A0RP 2K9FA 2YWIA 2C8UA 4DSQA 1OYJA 1THXA 2H70A 1XZOA 3IV4A 3RDWA 3QFAC 1ST9A 5LD0A 5ECNB 1DBYA 2LRNA 3HJPA 3ZREA 3NIVA 2YZHA 5HFKA 5EY6A 1PX6A 1ERWA 18GSA 2B5YA 2DIYA 3PR8A 5J4UA 2I1UA 1T00A 5E59A 3QAGA 1Q98A 2CZ3A 3C7MA 2NPBA 4OD7A 3WGEA 2F3MA 3R2QA 2HRFA 4HI7A 2DMLA 4HEA2 4NHZA 3BCIA 3FR3A 1K3OA 2HLSA 4TXVA 2JSYA 3TRPA 1G6WA 3VI5A 1TI3A 3HD5A 2JZSA 5AISA 2VCZA 4KW6A 3S9FA 3GKXA 1ACVA 4TR1B 2HZEB 4NV2A 4KSOA 2P5QA 1GSEA 4F0BA 5G5EA 2VL9A 5DALA 1O73A 2CX4A 3UOMA 3ZVJD 4HZ2A 3HVSA 2E0QA 4IGJA 4QL9A 4GQCA 4QL7A 1TU8A 3J7Yb 1OVNA 3AY8A 3UAPA 5ECKB 3LGCA 3N9JA 8GSSA 4MZWA 3TJGA 2K8SA 5L71A 2FWGA 1T1VA 1VRSD 3E0UA 1FOVA 3APOA 1A24A 1VGLA 3TKPA 3HY2A 3A2WA 3FKFA 4IS0A 2DJJA 5AGYA 2ALBA 1HNCA 4G19A 2V2GA 3UL3A 2V6KA 5DDLA 5A4WA 1TRWA 3O3TA 1WRYA 1PX7A 4PUAA 5DAKA 3KH7A 5G30A 2R6KA 4MH2A 3VWVA 5F07A 4PURA 4OCEA 6GSSA 3FY7A 3IRAA 1GWCA 2V1MA 1BYEA 2VAFA 3CXGA 4RQXA 1GP1A 1TK0B 5DBQA 2IN3A 1VF2A 3GSSA 5C00A 2C0FA 3GSTA 1W89A 1M9BA 4OMVA 1G7EA 1PKWA 4GCIA 4ECBA 1V57A 1ZZYA 1NHOA 1FHEA 1NSWA 2PBJA 4OWYA 3HVXA 6GSVA 3ZL5A 4POKA 1AAZA 4KB3A 2L4CA 3WD6A 3KXOA 1OAZA 5DALB 1DUGA 5FT3A 1V2AA 4ML6A 2L5OA 1FW1A 1QK8A 1RK4A 1DE2A 5HR3A 1VF3A 1TI1A 5KN1A 3VPTA 1K0AA 5EVOA 4LMWA 2CVKA 4F9ZA 3D4MA 1JZWA 1E2YA 4LA1A 4NXIA 5DQSA 3IDVA 4MJEA 2F51A 1SL2B 3QR6A 2IPAA 3LEFA 5H5QA 1QGVA 1UVZA 2LQOA 2VCQA 4J57E 3MSZA 3PINA 2HFDA 1RW1A 3A2XA 1USBA 5DAKB 1Y25A 1CQHA 5CREA 1SJIA 3KP9A 2CAQA 1ERUA 4YH2A 3FRCA 2L5LA 2B3SA 3RHCA 4J56E 1G0TA 2FUG2 4PNFA 4QQ7A 5F06A 1H4OA 1N8JA 5E4WA 3GH9A 1ERVA 1XW5A 3IOSA 3KCMA 5D8IA 2C3TA 1XWGA 4PXOA 2FWFA 2YWMA 2N5BA 2LRCA 3EWLA 3IBHA 3UJ1A 2RM5A 5D9VA 1ERTA 2XBQA 2B5XA 3EVIA 4OFMA 1XCCA 4K7IA 3LWAA 1G7OA 4O32A 5JWRB 3LORA 4WETA 1XWBA 1SENA 2H1AA 4I97A 3HJOA 4EDYA 5ELAA 1JZDA 4EXJA 3ZZXA 4MPFA 2CQ9A 1Z3EA 3CSIA 2YJ7A 4JR4A 2KHPA 4J2FA 2VM1A 3IPZA 4H86A 17GSA 4MZBA 2V6OA 2CZ2A 4JZQA 1AQWA 2WFCA 4ACSA 11GSA 2A2SA 3GTUA 4MF5A 3CBUA 1Z7PA 4OFTA 1YF0A 2X64A 5DVBA 2O89A 1ZGNA 2M72A 3ZFLA 3APQA 2LEGA 5J3RA 1HNBA 4O5RA 2VCVA 1M2AA 2VLTA 3M3MA 1SJ6A 3ZVJA 5IPHA 4KDXA 4KDYA 1GUHA 1WP0A 5JCWA 2VD0A 3TKSC 4E8EA 1DE1A 1GSDA 1SJZA 3BCKA 2WCIA 3E9JB 4HS1A 1GSUA 2PU9C 3VWWA 1EEJA 5HFGA 4I6XA 2DBCA 1KBNA 2WDUA 4IW9A 3VK9A 2OKAA 1BG5A 2KOKA 5KEJA 4RQRA 5ECHB 3E3EA 5ECQB 5CO3A 3ERFA 2K6VA 5F05A 1X5EA 5F0GA 3L0HA 1R26A 4L0WA 5G5FA 2JU5A 4LL1B 2F8FA 2LQQA 4JU5A 4MF6A 4XS6A 1PKZA 3IK7A 3O76A 3TJKA 2PWJA 4MDCA 1YQ1A 4Q5NA 3ED3A 1A2LA 3M9JA 2MMAA 3EYTA 2H1GA 1GNWA 1FO5A 3GKNA 4K1FA 1PMTA 4TR0A 5J5NA 4NAXA 1XPVA 3GTUB 1SYXA 2ON5A 4MA9A 1Z5YE 3TJBA 5IM9A 2YOIA 4KCAA 3GUSA 2RIIA 2GZZA 2HT9A 2R37A 5IO0A 2IJYA 3CRUA 4ZL8A 1A8YA 2FCHA 1OE7A 4OO4A 1EGOA 2LJRA 1MD3A 1T3BA 2LJAA 1XWAA 4N0VA 1B9XC 2QC7A 1URMA 1O8XA 4N11A 2BJXA 1GTAA 2H72A 2WRTA 1FB0A 4FYUA 1AC1A 1M0UA 3K8NA 1YKAA 4ZIJA 3ZMLA 2H75A 1MD4A 3W6GA 1TOFA 4MLYA 5ECPB 5JCUA 1YKCA 2PVQA 3L4NA 3KH9A 4IHUA 9GSSA 4MF7A 3IK9A 2CX3A 3HA9A 5IPGA 1K3YA 3G7IA 2VUPA 4PNGA 2O7KA 1ML6A 1X0RA 5ECOB 1YJ6A 3CSJA 3CTGA 4PUFC 5ELGA 1LJRA 5ECLB 2H8LA 4V1Ag 4TKYA 1U88A 1VF4A 4GSNA 4WR4A 2QGVA 2VLVA 3F4SA 2E2GA 1NHYA 2EIOA 2MMOA 2HNLA 2YV9A 6GSUA 1GSQA 1YEXA 3GIXA 2DJ1A 4EF0A 3RBTA 1I9DA 1ZL9A 3QPMA 2IFQB 3TGZA 3HJMA 1LBKA 5AN1A 4ID0A 1NM3A 3EC3A 1FVJA 5J9CA 3VLNA 3A5WA 4IP1A 3FZ4A 5IOWA 2L4QA 3TRQA 1PL1A 2JACA 2G0FA 7GSSA 5FHIA 4RI6A 4V2MA 2JSZA 4OCFA 2V32A 1AQXA 4XS4A 3VURA 3CSHA 1A0FA 4G2EA 4NMUA 1EV4A 5D9XA 2LS5A 4WF5A 1BX9A 4X43A 3F3QA 3BJ5A 1THOA 1GH2A 4CW9A 2GT6A 5D93A 3ERGA 1T7PB 1EP7A 3GYKA 1ILOA 4V1Ap 3UVHA 2HXKA 2OACA 2H19A 2GTUA 3TUEA 5B8AA 1GLPA 2N5FA 1M2BA 5CYYA 3QDNA 4XHMA 1I5GA 3EMPA 2WJUA 4DSSA 1TK8B 2LNSA 5LCZA 3TOUA 3H4KA 5EPFA 3GMFA 1PQNA 1Z9HA 4WBJA 4IJ3A 4O92A 1GNEA 4JBBA 20GSA 5F8BA 4EE0A 2FA8A 1GLQA 3W8SA 1YY7A 3TCOA 4K7OA 2H30A 5IMVA 1VF1A 5KN3A 4L0UA 1OC3A 3FR6A 4HQSA 2C0GA 14GSA 3WYWA 2OE1A 2VM2A 3UEMA 2V41A 1V40A 1O85A 3HZ4A 5AIVA 4NV5A 3TRXA 22GSA 1KTEA 4BWQA 4AF2A 5B7CA 1SKSB 4MABA 3TOTA 2X8GA 2DSAA 4XS4B 4WR5A 2NVLA 5AIXA 4MJBA 1S3AA 2ZUPA 1YDKA 2PGTA 4POBA 4KAEA 4F2IA 2AB6A 2ON7A 3ZFBA 1JHBA 1KNGA 2B7KA 4AJ6A 1ON4A 5GAPD 1F9MA 1EEMA 5HR1A 4HU7A 2L59A 2FWHA 2YWNA 4GWRA 2QSIA 4TVEA 1HD2A 2HSHA 5INYA 3GL3A 13GSA 1K3LA 3DYRA 3HVVA 4EVMA 1XWCA 4K9ZA 2AJQB 4PX1A 3NOFA 1E6BA 3A2VA 3A3TA 3LFLA 4EUYA 3ZIJA 3BD2A 5D96A 3P2AA 2OE0A 5DCHA 2YCDA 3GRXA 3KJYA 4JRRA 4X1UA 1JZRA 3VPQA 3ZTLA 2JADA 2H0GA 1ABAA 1XXUA 5ENUA 3JCML 1B8XA 2FHEA 3GKMA 3IHQA 4IJIA 1SKRB 4L5LA 3C1RA 2MMZA 1GSSA 3KIJA 5GSTA 3EU3A 2CVBA 2EIRA 3IC4A 2YN1A 3ISOA 4HZ4A 4ZB6A 4NPBA 2TIRA 2VL2C 4V2LA 3QMXA 2RUFA 3H1NA 5H5RA 4HJ2A 2YJHA 2C80A 4IQAA 2MYGA 3DVWA 4ECJA 2YPMA 3EU4A 2ZNMA 4PQIA 2XBIA 3QAWA 3HHVA 3ZITA 1O6JA 4RUVA 2DJ0A 5D9TA 2XPDA 5CRWA 1XOBA 2KP1A 4MZCA 1Z6NA 4IN0A 3IR4A 4RI7A 1XFLA 2LKUA 2P5RA 2H76A 4Q5RA 4NHWA 3ERWA 2DJKA 4ILFA 3F9UA 4K2DA 2L6DA 4G10A 1TU7A 4L8EA 2X8HA 3EE2A 3UMAA 5H5SA 2GSTA 3J7Yk 4WF4A 4ZB8A 5ECRB 1M99A 1K0DA 3L9VA 4ISDA 1S3DA 2AV4A 4MK3A 1UC7A 1N2AA 2OA7A 2X8CA 2GSRA 3GX0A 3DRNA 2PVOC 1X9SB 1C72A 4XS1A 3G9BA 1GSYA 3Q74A 2FWEA 3TJJA 4KCEA 1B4PA 1R5AA 5A5KA 5HR2A 3IAS2 2IWTA 5IQYA 4ZBDA 3H8QA 3GN3A 4EL1A 2Z9SA 2H1DA 5G31A 1WIKA 2YP6A 5JWQB 3FHKA 4EC0A 3GNJA 1GL8A
chains in the Genus database with same CATH superfamily
2VD1A 3VWXA 1LU4A 2WULA 3GA4A 5IMDA 3H93A 2YZUA 2ZCTA 5IMAA 1KEBA 4HOJA 5A4UA 4TRXA 2M80A 4KA0A 2GZPA 3FMWA 1UN2A 3D6IA 1M9AA 2C0DA 1XBSA 4HQZA 2K18A 2PMTA 3F8UA 3LQ7A 3PGTA 2FLSA 4MCUA 1PSQA 4ZXGA 1GSFA 3KTLA 4WXTA 4DVCA 4BWSA 1WE0A 2VCTA 3L9SA 5J41A 2R2JA 2JZTA 3LXTA 3MNGA 5DJLA 3P8WA 3FZ9A 1QXHA 4DEJA 1OC9A 3ZLPA 4KSMA 5KN2A 2HE3A 4YQUA 1OE8A 4E8HA 1BAYA 1GUMA 4K5RA 1EZKA 1XVWA 5IO2A 1PRXA 4CDOA 4MH3A 2CV4A 1WJKA 3U6VA 3C71A 4O7HA 4GQFA 2B1KA 2H6XA 2OJLA 3GFKA 1AW9A 3I9V2 5J9BA 3H79A 3HKRA 2LTKA 3CQFA 3DD3A 4JE1A 2B6MA 4BA7A 1GUKA 2F8AA 3IE3A 1S3CA 1OC8A 4WEYA 3QOUA 4MMMA 1XWKA 3APSA 5IOXA 3HDCA 4OO5A 3L9UA 3GX8A 2L6CA 2O8VB 3LSZA 2GLRA 3TJFA 3F4TA 3D5JA 3FW2A 3I43A 4MPGA 1HQOA 3FZAA 4YKFA 5CP1A 3NZNA 2B5EA 1B9YC 5CRDA 3QFBC 4GRFA 2KP2A 4YAPA 3LXZA 4ZL9A 4EDZA 4LLRA 4JR6A 5JCGA 5EL8A 2H66A 3UBKA 3KTBA 3MDKA 2D2ZA 1IYHA 4FYBA 6GSWA 3EMXA 3G7JA 5IMFA 2B1LA 2FGXA 2PPTA 5CRGA 2R5GA 1SL1B 1QUWA 1ZYEA 2DJ2A 2H73A 5B6MA 2GQLA 3I6AA 3KZQA 2IIYA 2P31A 4KE3A 4XTSA 5GSSA 1FB6A 2H6YA 2EIQA 1AUCA 2WS2A 2H01A 3D22A 1TRSA 1OC9B 1XIYA 5DQYA 3EINA 5FWGA 3RPPA 3BBYA 1X5CA 4PGTA 5G2ZA 3ZIVA 2XHFA 2TRXA 4ECIA 1EV9A 5ECMB 4IELA 2PUKC 4XRDA 4CY8A 1OKTA 1JFUA 4TR3A 1H75A 2FD3A 2IL3A 2NTOA 4BPYA 5ECSA 3IXRA 3EURA 2OBIA 2AUVA 3M8NA 3V1WA 1K0MA 2YANA 3ME8A 2FA4A 1A2MA 1B48A 6GSYA 1XG8A 5IMCA 2HI7A 4HDEA 1Q4JA 2R4VA 4GTUA 3ZMKA 4ZB9A 1U6TA 1MDIA 4GSSA 4CHSA 4FYCA 2HSMA 2CVDA 3F0IA 3IA1A 2GZYA 2VL3A 3I69A 2PN8A 2LNTA 1TXXA 2HYXA 1V98A 4K8MA 2VOCA 1TP9A 2N5AA 2WB9A 4OFNA 5D9WA 2YWOA 5GZZB 3CRTA 1HYUA 2G2QA 4G0LA 2RM6A 2H74A 2A2RA 4WBRD 1XVQA 1AIUA 1O7UA 1GTIA 3CTFA 2X99A 1YF1A 2FY6A 3VI7A 4IKHA 3UIWA 1PGTA 2O85A 3QCPA 4I2UA 2PERA 1J0FA 1JLVA 1O81A 2MZCA 2P0GA 2HRNA 4G0KA 4YQVA 4F82A 2I3YA 3DKSA 2VIMA 4D73A 12GSA 4ML1A 3L78A 1BQ7A 2GSSA 4X0XA 3QAVA 1A2JA 4HJMA 2KLXA 4G0IA 3Q19A 5ECIB 4AJ7A 2VO4A 2A4HA 4YAVA 2H71A 2WGRA 1X9WB 1K0BA 1M2DA 3F6DA 3HCZA 1XW6A 5ABRA 4A5PA 1SYRA 3PPUA 1Y6EA 1WPIA 4L5OA 1Z7RA 3HXSA 4XCSA 4ZBAA 2YV7A 5HR0A 1V9WA 2C0EA 3D4TA 3F6FA 3RPNA 3KM6A 3DEXA 1WOUA 3MAKA 2GSQA 3F3RA 2R0CA 3TDGA 3LG6A 2XC2A 3N5OA 2JZRA 6GSXA 3UBLA 2CA8A 3UVTA 3A5IA 1GRXA 4K7NA 4F0CA 1IYIA 1AXDA 2DMMA 4POLA 1RQMA 2J23A 2H0IA 4IBPA 5C04A 4IQ1A 2NDOA 1R7HA 2LSTA 2HZFA 1UA5A 2QA2A 1TRUA 4TN8A 4GF0A 2A4VA 4LL4B 1WMJA 1J9BA 1TJDA 4DSSB 4D73B 4PQ1A 1EOGA 1OKDA 2RLIA 1T8EB 3HYPA 1Z6MA 3P7XA 2LJKA 1X5DA 2VLUA 1BEDA 4TR4A 2QKEA 4ZILA 2GDRA 5G1LA 1TDIA 3BOAA 1JLWA 4FIWA 4AJ8A 2VCXA 3LYKA 2JL4A 4Q5FA 2AYTA 4TXOA 1BJXA 1ZMAA 3TB2A 5COHA 2R3XA 3DIEA 3GL5A 4F03A 4I5QA 3C1SA 2C4JA 3GHAA 4XIHA 3G7YA 3D21A 1SK0A 1F6MC 1SU9A 2NBSA 2M46A 4YKGA 3TKSE 2MBSA 1J08A 2DIZA 2MMNA 2I9HA 3WGDA 1ZOFA 1SL0B 3FEUA 3D0ZA 3GH6A 4K0NA 1FG4A 5CNWA 2XPEA 3TKRA 4ZL7A 3WT2A 4ZBBA 2E2MA 2LRTA 4KH7A 2BTOT 1FVKA 2K8VA 2GGTA 1FOHA 1FAAA 3SWLA 1A23A 3WGXA 4Q5QA 2AAWA 5B6NA 3LJRA 3DGQA 4WKWA 4EKZA 2IMEA 1F2EA 1MDKA 2GT5A 3FR9A 1U87A 1R4WA 2GVPA 2GS3A 3C8EA 3O6TA 2KUCA 1TW9A 3TKQA 1AQVA 2X49A 2HRAA 5JWOB 1MDJA 3DXBA 4KDUA 1EWXA 4MP4A 1GTUA 1TRVA 4G9HA 4JEDA 1XOAA 4TXOB 2BMXA 1GTBA 1SD8A 1K0OA 4N10A 2J9HA 4P3YB 1V58A 4KNDA 3US3A 3GURA 2IMDA 1TTZA 1QFNA 3LYPA 2RUEA 4HU9A 4LMVA 2OBKA 2VL2A 3FK8A 4HUAA 2YNXA 4BVYA 3DWVA 5LNKe 1K0CA 3OR5A 3M0FA 2C1YA 10GSA 1EGRA 4N30A 2HSYA 1R5PA 1ZYQB 3C73A 4V2NA 1F37A 2VCWA 3RAZA 3W8JA 2DKIA 3M9KA 1TKDB 4PTSA 2WZ9A 3KEBA 1DSBA 3Q18A 2REMA 4AGSA 4POMA 5KOXA 5ID2A 3UARA 1U3AA 2O87A 3SBCA 3ME7A 2IMKA 2AHEA 4FH8A 1XW9A 4IP6A 4BL7A 4DSRA 1X9MB 3GKKA 3Q6OA 4BVXA 3F4RA 2CAIA 3RHBA 3IAM2 5D73A 4I2TA 3KD0A 5BMUA 3CYNA 3MWHA 5G1KA 3DMLA 1YEPA 5CAXA 1MTCA 3PH9A 1HNAA 3DVXA 16GSA 3GV1A 5CRHA 1SK1A 3KMOA 1QQ2A 1SK2A 2UZ8A 3QD9A 4EO3A 1ZCPA 4YQMA 4PQHA 5KN0A 1EP8A 2H0HA 4KGIA 3FZ5A 4ECCA 1WWJA 3KGKA 3VWUA 5B8BA 4TOPA 2LV3A 2OE3A 4Z7XA 3P90A 5HQPA 3IC8A 1M3IA 2H1BA 2IFQA 1JZOA 5DCGA 3FYGA 4GLTA 2EC4A 5DJMA 1G6YA 2C3QA 4MJCA 2IMFA 3KP8A 5A4VA 4N0ZA 5IMZA 3F63A 4XRAA 4MJAA 4FO5A 4IVFA 5GAND 1TK5B 1PL2A 2GQMA 2ES7A 4ICYA 3VFIA 1M7TA 4BVYB 2LUSA 2MBTA 3HZ8A 2E7PA 1SD9A 3TKSA 6GSTA 4GXZA 1QMVA 1T4ZA 1T4YA 4KUNA 2FNOA 1F3BA 3M1GA 1K0NA 1SKWB 2I4AA 4TR1A 1GULA 2HZEA 2H6ZA 2F9SA 19GSA 5ID2B 4GSTA 3HVNA 4NWYA 3ZRDA 4I8BA 1PN9A 2GQKA 4BL7B 2DJ3A 1MEKA 3ZYWA 1CQGA 2DC5A 4K6XA 2TRCP 2OADA 2C3NA 1U3IA 5HFIA 1O8WA 4K0GA 1A8LA 1EOHA 4ULXA 2B7JA 4X4JA 1YZXA 3U5RE 3WT1A 1NW2A 1F3AA 1PA3A 3KMNA 4KX4A 5IIZA 2I81A 1PD21 3CMIA 1W4VA 2DLXA 2L57A 4TW5A 2CT6A 1B4QA 2IMIA 1A0RP 2K9FA 2YWIA 2C8UA 2R0GA 4DSQA 1OYJA 1THXA 2H70A 4FQUA 1XZOA 3IV4A 3RDWA 3QFAC 1ST9A 5LD0A 5ECNB 1DBYA 2LRNA 3HJPA 3ZREA 3NIVA 2YZHA 5HFKA 5EY6A 1PX6A 1ERWA 18GSA 2B5YA 2DIYA 3PR8A 5J4UA 2I1UA 1T00A 5E59A 3QAGA 1Q98A 2CZ3A 3C7MA 2NPBA 4OD7A 3WGEA 2F3MA 3R2QA 2HRFA 4HI7A 2DMLA 4HEA2 4NHZA 3BCIA 3FR3A 1K3OA 2HLSA 4TXVA 2JSYA 3TRPA 1G6WA 3VI5A 1TI3A 3HD5A 2JZSA 5AISA 2VCZA 4KW6A 3S9FA 3GKXA 1ACVA 4TR1B 2HZEB 4NV2A 2A2PA 4KSOA 2P5QA 1GSEA 4F0BA 5G5EA 2VL9A 5DALA 1O73A 2CX4A 3UOMA 3ZVJD 4HZ2A 3HVSA 2E0QA 4IGJA 4QL9A 4GQCA 4QL7A 1TU8A 3J7Yb 3EPTA 1OVNA 3AY8A 3UAPA 5ECKB 3LGCA 3N9JA 8GSSA 4MZWA 3TJGA 2K8SA 5L71A 2FWGA 1T1VA 1VRSD 3E0UA 1FOVA 3APOA 1A24A 1VGLA 3TKPA 3HY2A 1ZYNA 3A2WA 3FKFA 4IS0A 2DJJA 5AGYA 2ALBA 1HNCA 4G19A 2V2GA 4EIPA 3UL3A 2V6KA 5DDLA 5A4WA 1TRWA 3O3TA 1WRYA 1PX7A 4PUAA 1M3JA 5DAKA 3KH7A 5G30A 2R6KA 4MH2A 3VWVA 5F07A 4PURA 4OCEA 4KF9A 6GSSA 3FY7A 3IRAA 1GWCA 4K2XA 2V1MA 1BYEA 2VAFA 3CXGA 4RQXA 1GP1A 1TK0B 5DBQA 2IN3A 1VF2A 3GSSA 5C00A 2C0FA 3GSTA 1W89A 1M9BA 4OMVA 1G7EA 1PKWA 4GCIA 4ECBA 1V57A 1ZZYA 1NHOA 1FHEA 1NSWA 2PBJA 4OWYA 3HVXA 6GSVA 3ZL5A 4POKA 1AAZA 4KB3A 2L4CA 3WD6A 3KXOA 1OAZA 5DALB 1DUGA 5FT3A 1V2AA 4ML6A 2L5OA 1FW1A 1QK8A 1RK4A 2X4AA 1DE2A 5HR3A 2HRKA 1VF3A 1TI1A 5KN1A 3VPTA 1K0AA 5EVOA 4LMWA 2CVKA 4F9ZA 3D4MA 1JZWA 1E2YA 4LA1A 3MYDA 4NXIA 5DQSA 3IDVA 4MJEA 2F51A 1SL2B 3QR6A 2IPAA 3LEFA 4Z2UA 5H5QA 1QGVA 1UVZA 2LQOA 2VCQA 4J57E 3MSZA 3PINA 2HFDA 1RW1A 3A2XA 1USBA 5DAKB 1Y25A 1CQHA 5CREA 1SJIA 3KP9A 2CAQA 1ERUA 4YH2A 3FRCA 2L5LA 4EIQA 2B3SA 3RHCA 4J56E 1G0TA 2FUG2 4PNFA 4QQ7A 5F06A 1H4OA 1N8JA 5E4WA 3GH9A 1ERVA 1XW5A 3IOSA 3KCMA 5D8IA 2C3TA 1XWGA 4PXOA 2FWFA 2YWMA 2N5BA 2LRCA 3EWLA 3IBHA 3UJ1A 2RM5A 5D9VA 1ERTA 4BIKA 4K5SA 2XBQA 2B5XA 3EVIA 4OFMA 1XCCA 4K7IA 3LWAA 1G7OA 4O32A 5JWRB 3LORA 4WETA 1XWBA 1SENA 2H1AA 4I97A 3HJOA 4EDYA 5ELAA 1JZDA 4EXJA 3ZZXA 4MPFA 2CQ9A 1Z3EA 3CSIA 2YJ7A 4JR4A 2KHPA 4J2FA 2VM1A 3IPZA 4H86A 17GSA 4MZBA 2V6OA 2CZ2A 4JZQA 1AQWA 2WFCA 4ACSA 11GSA 2A2SA 3GTUA 4MF5A 3CBUA 1Z7PA 4OFTA 1YF0A 2X64A 4USSA 5DVBA 2O89A 1ZGNA 2M72A 3ZFLA 3APQA 2LEGA 5J3RA 1HNBA 4O5RA 2VCVA 1M2AA 2VLTA 3M3MA 4HSCX 1SJ6A 3ZVJA 5IPHA 4KDXA 4KDYA 1GUHA 1WP0A 5JCWA 2VD0A 3TKSC 4E8EA 1DE1A 1GSDA 1SJZA 3BCKA 2WCIA 2QA1A 3E9JB 4HS1A 1GSUA 2PU9C 3VWWA 1EEJA 5HFGA 4I6XA 2DBCA 1KBNA 2WDUA 4IW9A 3VK9A 2OKAA 1BG5A 2KOKA 5KEJA 4RQRA 5ECHB 3E3EA 5ECQB 5CO3A 3ERFA 2K6VA 5F05A 1X5EA 3L0HA 5F0GA 1R26A 4L0WA 5G5FA 2JU5A 4LL1B 2F8FA 2LQQA 4JU5A 4MF6A 4XS6A 1PKZA 3IK7A 3O76A 3TJKA 2PWJA 4MDCA 1YQ1A 4Q5NA 3ED3A 1A2LA 3M9JA 2MMAA 3EYTA 2H1GA 1GNWA 1FO5A 3GKNA 4K1FA 1PMTA 4TR0A 5J5NA 4NAXA 1XPVA 3GTUB 1SYXA 2ON5A 4MA9A 1Z5YE 3TJBA 5IM9A 2YOIA 4KCAA 3GUSA 2RIIA 2GZZA 2HT9A 2R37A 5IO0A 2IJYA 3CRUA 4ZL8A 1A8YA 2FCHA 1OE7A 4OO4A 1EGOA 2LJRA 1MD3A 1T3BA 2LJAA 1XWAA 4N0VA 1B9XC 2QC7A 4MNNA 1URMA 1O8XA 4N11A 2BJXA 1GTAA 2H72A 2WRTA 1FB0A 4FYUA 1AC1A 1M0UA 3K8NA 1YKAA 4ZIJA 3ZMLA 2H75A 1MD4A 3W6GA 1TOFA 4MLYA 5ECPB 5JCUA 1YKCA 2PVQA 3L4NA 3KH9A 4IHUA 9GSSA 4MF7A 4BVXB 3IK9A 2CX3A 3HA9A 5IPGA 1K3YA 3G7IA 2VUPA 4PNGA 2O7KA 1ML6A 1X0RA 5ECOB 1YJ6A 3CSJA 3CTGA 4PUFC 5ELGA 1LJRA 5ECLB 2H8LA 4V1Ag 4TKYA 1U88A 1VF4A 4GSNA 4WR4A 4O5QA 2QGVA 2VLVA 3F4SA 2E2GA 1NHYA 2EIOA 2MMOA 2HNLA 2YV9A 6GSUA 1GSQA 1YEXA 3GIXA 2DJ1A 4EF0A 3RBTA 1I9DA 1ZL9A 3QPMA 2IFQB 3TGZA 3HJMA 1LBKA 5AN1A 4ID0A 1NM3A 3EC3A 1FVJA 5J9CA 3VLNA 3A5WA 4IP1A 1S3RA 3FZ4A 5IOWA 2L4QA 3TRQA 1PL1A 2JACA 2G0FA 7GSSA 5FHIA 4RI6A 4V2MA 2JSZA 4OCFA 2V32A 1AQXA 1ZYPA 4XS4A 3VURA 3CSHA 1A0FA 4G2EA 4NMUA 1EV4A 5D9XA 2LS5A 4WF5A 1BX9A 4X43A 3F3QA 3BJ5A 1THOA 1GH2A 4CW9A 2GT6A 5D93A 3ERGA 1T7PB 1EP7A 3GYKA 1ILOA 4V1Ap 3UVHA 2R0PA 2HXKA 2OACA 2H19A 2GTUA 4Z2RA 3TUEA 5B8AA 1GLPA 2N5FA 3R3EA 1M2BA 5CYYA 3QDNA 4XHMA 1I5GA 3EMPA 2WJUA 4DSSA 5KOWA 2LNSA 5LCZA 1TK8B 3TOUA 3H4KA 5EPFA 3GMFA 4Z2TA 1PQNA 1Z9HA 4WBJA 4IJ3A 4O92A 1GNEA 4JBBA 20GSA 5F8BA 4EE0A 2FA8A 1GLQA 3W8SA 1YY7A 3LW9A 3TCOA 4K7OA 2H30A 5IMVA 1VF1A 5KN3A 4L0UA 1OC3A 3FR6A 4HQSA 2C0GA 14GSA 3WYWA 2OE1A 2VM2A 3UEMA 2V41A 1V40A 1O85A 3HZ4A 5AIVA 4NV5A 3TRXA 22GSA 1KTEA 4BWQA 4AF2A 5B7CA 1SKSB 4MABA 3TOTA 2X8GA 2DSAA 4XS4B 4WR5A 2NVLA 5AIXA 4MJBA 1S3AA 2ZUPA 1YDKA 2PGTA 4POBA 4KAEA 4F2IA 2AB6A 2ON7A 3ZFBA 1JHBA 1KNGA 2B7KA 4AJ6A 1ON4A 5GAPD 1F9MA 1EEMA 5HR1A 4HU7A 2L59A 2FWHA 2YWNA 4GWRA 1PN0A 4O5UA 2QSIA 4TVEA 4CY6A 1HD2A 2HSHA 5INYA 3GL3A 13GSA 1K3LA 3DYRA 3HVVA 4EVMA 1XWCA 4K9ZA 2AJQB 4PX1A 3NOFA 1E6BA 3A2VA 3A3TA 3LFLA 4EUYA 3ZIJA 3BD2A 5D96A 3P2AA 2OE0A 5DCHA 2YCDA 3GRXA 5BRTA 3KJYA 4JRRA 4X1UA 1JZRA 3VPQA 3ZTLA 2JADA 2H0GA 1ABAA 1XXUA 5ENUA 3JCML 1B8XA 2FHEA 3GKMA 3IHQA 4IJIA 1SKRB 4L5LA 3C1RA 2MMZA 1GSSA 3KIJA 5GSTA 3EU3A 2CVBA 2EIRA 3IC4A 2YN1A 3ISOA 4HZ4A 4ZB6A 4NPBA 2TIRA 2VL2C 4V2LA 3QMXA 2RUFA 3H1NA 5H5RA 4HJ2A 2YJHA 2C80A 4IQAA 2MYGA 3DVWA 4ECJA 2YPMA 3EU4A 2ZNMA 4PQIA 2XBIA 3QAWA 3HHVA 3ZITA 1O6JA 4RUVA 2DJ0A 5D9TA 2XPDA 5CRWA 1XOBA 2KP1A 4MZCA 1Z6NA 4IN0A 3IR4A 4RI7A 1XFLA 2LKUA 2P5RA 2H76A 4Q5RA 4NHWA 3ERWA 2DJKA 4ILFA 3F9UA 4K2DA 2L6DA 3IHGA 3MIXA 4G10A 1TU7A 4L8EA 2X8HA 3EE2A 3UMAA 5H5SA 2GSTA 3J7Yk 2DKHA 4WF4A 4ZB8A 5ECRB 1M99A 1K0DA 3L9VA 4ISDA 1S3DA 2AV4A 4MK3A 1UC7A 1N2AA 2OA7A 2X8CA 2GSRA 3GX0A 3DRNA 2PVOC 1X9SB 1C72A 4XS1A 3G9BA 1GSYA 3Q74A 2FWEA 3TJJA 4KCEA 1B4PA 1R5AA 5A5KA 5HR2A 3IAS2 2IWTA 5IQYA 4ZBDA 3H8QA 3GN3A 4EL1A 2Z9SA 1PFOA 2H1DA 5G31A 1WIKA 2YP6A 5JWQB 3FHKA 4EC0A 3GNJA 1GL8A
chains in the Genus database with same CATH topology
2VD1A 3VWXA 1LU4A 2WULA 3GA4A 5IMDA 3H93A 2YZUA 2ZCTA 5IMAA 1KEBA 4HOJA 5A4UA 4TRXA 2M80A 4KA0A 2GZPA 3FMWA 1UN2A 3D6IA 1M9AA 2C0DA 1XBSA 4HQZA 2K18A 2PMTA 3F8UA 3LQ7A 3PGTA 2FLSA 4MCUA 1PSQA 4ZXGA 1GSFA 3KTLA 4WXTA 4DVCA 4BWSA 1WE0A 2VCTA 3L9SA 5J41A 2R2JA 2JZTA 3LXTA 3MNGA 5DJLA 3P8WA 3FZ9A 1QXHA 4DEJA 1OC9A 3ZLPA 4KSMA 5KN2A 2HE3A 4YQUA 1OE8A 4E8HA 1BAYA 1GUMA 4K5RA 1EZKA 1XVWA 5IO2A 1PRXA 4CDOA 4MH3A 2CV4A 1WJKA 3U6VA 3C71A 4O7HA 4GQFA 2B1KA 2H6XA 2OJLA 3GFKA 1AW9A 3I9V2 5J9BA 3H79A 3HKRA 2LTKA 3DD3A 4JE1A 2B6MA 4BA7A 1GUKA 2F8AA 3IE3A 1S3CA 1OC8A 4WEYA 3QOUA 4MMMA 1XWKA 3APSA 5IOXA 3HDCA 4OO5A 3L9UA 3GX8A 2L6CA 2O8VB 3LSZA 2GLRA 3TJFA 3F4TA 3D5JA 3FW2A 3I43A 4MPGA 1HQOA 3FZAA 4YKFA 5CP1A 3NZNA 2B5EA 1B9YC 5CRDA 3QFBC 4GRFA 2KP2A 4YAPA 3LXZA 4ZL9A 4EDZA 4LLRA 4JR6A 5JCGA 5EL8A 2H66A 3UBKA 3KTBA 3MDKA 2D2ZA 1IYHA 4FYBA 6GSWA 3EMXA 3G7JA 5IMFA 2B1LA 2FGXA 2PPTA 5CRGA 2R5GA 1SL1B 1QUWA 1ZYEA 2DJ2A 2H73A 5B6MA 2GQLA 3I6AA 3KZQA 2IIYA 2P31A 4KE3A 4XTSA 5GSSA 1FB6A 2H6YA 2EIQA 1AUCA 2WS2A 2H01A 3D22A 1TRSA 1OC9B 1XIYA 5DQYA 3EINA 5FWGA 3RPPA 3BBYA 1X5CA 4PGTA 5G2ZA 3ZIVA 2XHFA 2TRXA 4ECIA 1EV9A 5ECMB 4IELA 2PUKC 4XRDA 4CY8A 1OKTA 1JFUA 4TR3A 1H75A 2FD3A 2IL3A 2NTOA 4BPYA 5ECSA 3IXRA 3EURA 2OBIA 2AUVA 3M8NA 3V1WA 1K0MA 2YANA 3ME8A 2FA4A 1A2MA 1B48A 6GSYA 5IMCA 2HI7A 4HDEA 1Q4JA 2R4VA 4GTUA 3ZMKA 4ZB9A 1U6TA 1MDIA 4GSSA 4CHSA 4FYCA 2HSMA 2CVDA 3F0IA 3IA1A 2GZYA 2VL3A 3I69A 2PN8A 2LNTA 1TXXA 2HYXA 1V98A 4K8MA 2VOCA 1TP9A 2N5AA 2WB9A 4OFNA 5D9WA 2YWOA 5GZZB 3CRTA 1HYUA 2G2QA 4G0LA 2RM6A 2H74A 2A2RA 4WBRD 1XVQA 1AIUA 1O7UA 1GTIA 3CTFA 2X99A 1YF1A 2FY6A 3VI7A 4IKHA 3UIWA 1PGTA 2O85A 3QCPA 4I2UA 2PERA 1J0FA 1JLVA 1O81A 2MZCA 2P0GA 2HRNA 4G0KA 4YQVA 4F82A 2I3YA 3DKSA 2VIMA 4D73A 12GSA 4ML1A 3L78A 1BQ7A 2GSSA 4X0XA 3QAVA 1A2JA 4HJMA 2KLXA 4G0IA 3Q19A 5ECIB 4AJ7A 2VO4A 2A4HA 4YAVA 2H71A 2WGRA 1X9WB 1K0BA 1M2DA 3F6DA 3HCZA 1XW6A 5ABRA 4A5PA 1SYRA 3PPUA 1Y6EA 1WPIA 4L5OA 1Z7RA 3HXSA 4XCSA 4ZBAA 2YV7A 5HR0A 1V9WA 2C0EA 3D4TA 3F6FA 3RPNA 3KM6A 3DEXA 1WOUA 3MAKA 2GSQA 3F3RA 2R0CA 3TDGA 3LG6A 2XC2A 3N5OA 2JZRA 6GSXA 3UBLA 2CA8A 3UVTA 3A5IA 1GRXA 4K7NA 4F0CA 1IYIA 1AXDA 2DMMA 4POLA 1RQMA 2J23A 2H0IA 4IBPA 5C04A 4IQ1A 2NDOA 1R7HA 2LSTA 2HZFA 1UA5A 2QA2A 1TRUA 4TN8A 4GF0A 2A4VA 4LL4B 1WMJA 1J9BA 1TJDA 4DSSB 4D73B 4PQ1A 1EOGA 1OKDA 2RLIA 1T8EB 3HYPA 1Z6MA 3P7XA 2LJKA 1X5DA 2VLUA 1BEDA 4TR4A 2QKEA 4ZILA 2GDRA 5G1LA 1TDIA 3BOAA 1JLWA 4FIWA 4AJ8A 2VCXA 3LYKA 2JL4A 4Q5FA 2AYTA 4TXOA 1BJXA 1ZMAA 3TB2A 5COHA 2R3XA 3DIEA 3GL5A 4F03A 4I5QA 3C1SA 2C4JA 3GHAA 4XIHA 3G7YA 3D21A 1SK0A 1F6MC 1SU9A 2NBSA 2M46A 4YKGA 3TKSE 2MBSA 1J08A 2DIZA 2MMNA 2I9HA 3WGDA 1ZOFA 1SL0B 3FEUA 3D0ZA 3GH6A 4K0NA 1FG4A 5CNWA 2XPEA 3TKRA 4ZL7A 3WT2A 4ZBBA 2E2MA 2LRTA 4KH7A 2BTOT 1FVKA 2K8VA 2GGTA 1FOHA 1FAAA 3SWLA 1A23A 3WGXA 4Q5QA 2AAWA 5B6NA 3LJRA 3DGQA 4WKWA 4EKZA 2IMEA 1F2EA 1MDKA 2GT5A 3FR9A 1U87A 1R4WA 2GVPA 2GS3A 3C8EA 3O6TA 2KUCA 1TW9A 3TKQA 1AQVA 2X49A 2HRAA 5JWOB 1MDJA 3DXBA 4KDUA 1EWXA 4MP4A 1GTUA 1TRVA 4G9HA 4JEDA 1XOAA 4TXOB 2BMXA 1GTBA 1SD8A 1K0OA 4N10A 2J9HA 4P3YB 1V58A 4KNDA 3US3A 3GURA 2IMDA 1TTZA 1QFNA 3LYPA 2RUEA 4HU9A 4LMVA 2OBKA 2VL2A 3FK8A 4HUAA 2YNXA 4BVYA 3DWVA 5LNKe 1K0CA 3OR5A 3M0FA 2C1YA 10GSA 1EGRA 4N30A 2HSYA 1R5PA 1ZYQB 3C73A 4V2NA 1F37A 2VCWA 3RAZA 3W8JA 2DKIA 3M9KA 1TKDB 4PTSA 2WZ9A 3KEBA 1DSBA 3Q18A 2REMA 4AGSA 4POMA 5KOXA 5ID2A 3UARA 1U3AA 2O87A 3SBCA 3ME7A 2IMKA 2AHEA 4FH8A 1XW9A 4IP6A 4BL7A 4DSRA 1X9MB 3GKKA 3Q6OA 4BVXA 3F4RA 2CAIA 3RHBA 3IAM2 5D73A 4I2TA 3KD0A 5BMUA 3CYNA 3MWHA 5G1KA 3DMLA 1YEPA 5CAXA 1MTCA 3PH9A 1HNAA 3DVXA 16GSA 3GV1A 5CRHA 1SK1A 3KMOA 1QQ2A 1SK2A 2UZ8A 3QD9A 4EO3A 1ZCPA 4YQMA 4PQHA 5KN0A 1EP8A 2H0HA 4KGIA 3FZ5A 4ECCA 1WWJA 3KGKA 3VWUA 5B8BA 4TOPA 2LV3A 2OE3A 4Z7XA 3P90A 5HQPA 3IC8A 2H1BA 2IFQA 1JZOA 5DCGA 3FYGA 4GLTA 2EC4A 5DJMA 1G6YA 2C3QA 4MJCA 2IMFA 3KP8A 5A4VA 4N0ZA 5IMZA 3F63A 4XRAA 4MJAA 4FO5A 4IVFA 5GAND 1TK5B 1PL2A 2GQMA 2ES7A 4ICYA 3VFIA 1M7TA 4BVYB 2LUSA 2MBTA 3HZ8A 2E7PA 1SD9A 3TKSA 6GSTA 4GXZA 1QMVA 1T4ZA 1T4YA 4KUNA 2FNOA 1F3BA 3M1GA 1K0NA 1SKWB 2I4AA 4TR1A 1GULA 2HZEA 2H6ZA 2F9SA 19GSA 5ID2B 4GSTA 4NWYA 3ZRDA 4I8BA 1PN9A 2GQKA 4BL7B 2DJ3A 1MEKA 3ZYWA 1CQGA 2DC5A 4K6XA 2TRCP 2OADA 2C3NA 1U3IA 5HFIA 1O8WA 4K0GA 1A8LA 1EOHA 4ULXA 2B7JA 4X4JA 1YZXA 3U5RE 3WT1A 1NW2A 1F3AA 1PA3A 3KMNA 4KX4A 5IIZA 2I81A 1PD21 3CMIA 1W4VA 2DLXA 2L57A 4TW5A 2CT6A 1B4QA 2IMIA 1A0RP 2K9FA 2YWIA 2C8UA 2R0GA 4DSQA 1OYJA 1THXA 2H70A 4FQUA 1XZOA 3IV4A 3RDWA 3QFAC 1ST9A 5LD0A 5ECNB 1DBYA 2LRNA 3HJPA 3ZREA 3NIVA 2YZHA 5HFKA 5EY6A 1PX6A 1ERWA 18GSA 2B5YA 2DIYA 3PR8A 5J4UA 2I1UA 1T00A 5E59A 3QAGA 1Q98A 2CZ3A 3C7MA 2NPBA 4OD7A 3WGEA 2F3MA 3R2QA 2HRFA 4HI7A 2DMLA 4HEA2 4NHZA 3BCIA 3FR3A 1K3OA 2HLSA 4TXVA 2JSYA 3TRPA 1G6WA 3VI5A 1TI3A 3HD5A 2JZSA 5AISA 2VCZA 4KW6A 3S9FA 3GKXA 1ACVA 4TR1B 2HZEB 4NV2A 2A2PA 4KSOA 2P5QA 1GSEA 4F0BA 5G5EA 2VL9A 5DALA 1O73A 2CX4A 3UOMA 3ZVJD 4HZ2A 3HVSA 2E0QA 4IGJA 4QL9A 4GQCA 4QL7A 1TU8A 3J7Yb 3EPTA 1OVNA 3AY8A 3UAPA 5ECKB 3LGCA 3N9JA 8GSSA 4MZWA 3TJGA 2K8SA 5L71A 2FWGA 1T1VA 1VRSD 3E0UA 1FOVA 3APOA 1A24A 1VGLA 3TKPA 3HY2A 1ZYNA 3A2WA 3FKFA 4IS0A 2DJJA 5AGYA 2ALBA 1HNCA 4G19A 2V2GA 4EIPA 3UL3A 2V6KA 5DDLA 5A4WA 1TRWA 3O3TA 1WRYA 1PX7A 4PUAA 5DAKA 3KH7A 5G30A 2R6KA 4MH2A 3VWVA 5F07A 4PURA 4OCEA 4KF9A 6GSSA 3FY7A 3IRAA 1GWCA 4K2XA 2V1MA 1BYEA 2VAFA 3CXGA 4RQXA 1GP1A 1TK0B 5DBQA 2IN3A 1VF2A 3GSSA 5C00A 2C0FA 3GSTA 1W89A 1M9BA 4OMVA 1G7EA 1PKWA 4GCIA 4ECBA 1V57A 1ZZYA 1NHOA 1FHEA 1NSWA 2PBJA 4OWYA 3HVXA 6GSVA 3ZL5A 4POKA 1AAZA 4KB3A 2L4CA 3WD6A 3KXOA 1OAZA 5DALB 1DUGA 5FT3A 1V2AA 4ML6A 2L5OA 1FW1A 1QK8A 1RK4A 2X4AA 1DE2A 5HR3A 2HRKA 1VF3A 1TI1A 5KN1A 3VPTA 1K0AA 5EVOA 4LMWA 2CVKA 4F9ZA 3D4MA 1JZWA 1E2YA 4LA1A 3MYDA 4NXIA 5DQSA 3IDVA 4MJEA 2F51A 1SL2B 3QR6A 2IPAA 3LEFA 4Z2UA 5H5QA 1QGVA 1UVZA 2LQOA 2VCQA 4J57E 3MSZA 3PINA 2HFDA 1RW1A 3A2XA 1USBA 5DAKB 1Y25A 1CQHA 5CREA 1SJIA 3KP9A 2CAQA 1ERUA 4YH2A 3FRCA 2L5LA 4EIQA 2B3SA 3RHCA 4J56E 1G0TA 2FUG2 4PNFA 4QQ7A 5F06A 1H4OA 1N8JA 5E4WA 3GH9A 1ERVA 1XW5A 3IOSA 3KCMA 5D8IA 2C3TA 1XWGA 4PXOA 2FWFA 2YWMA 2N5BA 2LRCA 3EWLA 3IBHA 3UJ1A 2RM5A 5D9VA 1ERTA 4K5SA 2XBQA 2B5XA 3EVIA 4OFMA 1XCCA 4K7IA 3LWAA 1G7OA 4O32A 5JWRB 3LORA 4WETA 1XWBA 1SENA 2H1AA 4I97A 3HJOA 4EDYA 5ELAA 1JZDA 4EXJA 3ZZXA 4MPFA 2CQ9A 1Z3EA 3CSIA 2YJ7A 4JR4A 2KHPA 4J2FA 2VM1A 3IPZA 4H86A 17GSA 4MZBA 2V6OA 2CZ2A 4JZQA 1AQWA 2WFCA 4ACSA 11GSA 2A2SA 3GTUA 4MF5A 3CBUA 1Z7PA 4OFTA 1YF0A 2X64A 4USSA 5DVBA 2O89A 1ZGNA 2M72A 3ZFLA 3APQA 2LEGA 5J3RA 1HNBA 4O5RA 2VCVA 1M2AA 2VLTA 3M3MA 1SJ6A 3ZVJA 5IPHA 4KDXA 4KDYA 1GUHA 1WP0A 5JCWA 2VD0A 3TKSC 4E8EA 1DE1A 1GSDA 1SJZA 3BCKA 2WCIA 2QA1A 3E9JB 4HS1A 1GSUA 2PU9C 3VWWA 1EEJA 5HFGA 4I6XA 2DBCA 1KBNA 2WDUA 4IW9A 3VK9A 2OKAA 1BG5A 2KOKA 5KEJA 4RQRA 5ECHB 3E3EA 5ECQB 5CO3A 3ERFA 2K6VA 5F05A 1X5EA 3L0HA 5F0GA 1R26A 4L0WA 5G5FA 2JU5A 4LL1B 2F8FA 2LQQA 4JU5A 4MF6A 4XS6A 1PKZA 3IK7A 3O76A 3TJKA 2PWJA 4MDCA 1YQ1A 4Q5NA 3ED3A 1A2LA 3M9JA 2MMAA 3EYTA 2H1GA 1GNWA 1FO5A 3GKNA 4K1FA 1PMTA 4TR0A 5J5NA 4NAXA 1XPVA 3GTUB 1SYXA 2ON5A 4MA9A 1Z5YE 3TJBA 5IM9A 2YOIA 4KCAA 3GUSA 2RIIA 2GZZA 2HT9A 2R37A 5IO0A 2IJYA 3CRUA 4ZL8A 1A8YA 2FCHA 1OE7A 4OO4A 1EGOA 2LJRA 1MD3A 1T3BA 2LJAA 1XWAA 4N0VA 1B9XC 2QC7A 4MNNA 1URMA 1O8XA 4N11A 2BJXA 1GTAA 2H72A 2WRTA 1FB0A 4FYUA 1AC1A 1M0UA 3K8NA 1YKAA 4ZIJA 3ZMLA 2H75A 1MD4A 3W6GA 1TOFA 4MLYA 5ECPB 5JCUA 1YKCA 2PVQA 3L4NA 3KH9A 4IHUA 9GSSA 4MF7A 4BVXB 3IK9A 2CX3A 3HA9A 5IPGA 1K3YA 3G7IA 2VUPA 4PNGA 2O7KA 1ML6A 1X0RA 5ECOB 1YJ6A 3CSJA 3CTGA 4PUFC 5ELGA 1LJRA 5ECLB 2H8LA 4V1Ag 4TKYA 1U88A 1VF4A 4GSNA 4WR4A 4O5QA 2QGVA 2VLVA 3F4SA 2E2GA 1NHYA 2EIOA 2MMOA 2HNLA 2YV9A 6GSUA 1GSQA 1YEXA 3GIXA 2DJ1A 4EF0A 3RBTA 1I9DA 1ZL9A 3QPMA 2IFQB 3TGZA 3HJMA 1LBKA 5AN1A 4ID0A 1NM3A 3EC3A 1FVJA 5J9CA 3VLNA 3A5WA 4IP1A 3FZ4A 5IOWA 2L4QA 3TRQA 1PL1A 2JACA 2G0FA 7GSSA 5FHIA 4RI6A 4V2MA 2JSZA 4OCFA 2V32A 1AQXA 1ZYPA 4XS4A 3VURA 3CSHA 1A0FA 4G2EA 4NMUA 1EV4A 5D9XA 2LS5A 4WF5A 1BX9A 4X43A 3F3QA 3BJ5A 1THOA 1GH2A 4CW9A 2GT6A 5D93A 3ERGA 1T7PB 1EP7A 3GYKA 1ILOA 4V1Ap 3UVHA 2R0PA 2HXKA 2OACA 2H19A 2GTUA 4Z2RA 3TUEA 5B8AA 1GLPA 2N5FA 3R3EA 1M2BA 5CYYA 3QDNA 4XHMA 1I5GA 3EMPA 2WJUA 4DSSA 5KOWA 2LNSA 5LCZA 1TK8B 3TOUA 3H4KA 5EPFA 3GMFA 4Z2TA 1PQNA 1Z9HA 4WBJA 4IJ3A 4O92A 1GNEA 4JBBA 20GSA 5F8BA 4EE0A 2FA8A 1GLQA 3W8SA 1YY7A 3LW9A 3TCOA 4K7OA 2H30A 5IMVA 1VF1A 5KN3A 4L0UA 1OC3A 3FR6A 4HQSA 2C0GA 14GSA 3WYWA 2OE1A 2VM2A 3UEMA 2V41A 1V40A 1O85A 3HZ4A 5AIVA 4NV5A 3TRXA 22GSA 1KTEA 4BWQA 4AF2A 5B7CA 1SKSB 4MABA 3TOTA 2X8GA 2DSAA 4XS4B 4WR5A 2NVLA 5AIXA 4MJBA 1S3AA 2ZUPA 1YDKA 2PGTA 4POBA 4KAEA 4F2IA 2AB6A 2ON7A 3ZFBA 1JHBA 1KNGA 2B7KA 4AJ6A 1ON4A 5GAPD 1F9MA 1EEMA 5HR1A 4HU7A 2L59A 2FWHA 2YWNA 4GWRA 1PN0A 4O5UA 2QSIA 4TVEA 4CY6A 1HD2A 2HSHA 5INYA 3GL3A 13GSA 1K3LA 3DYRA 3HVVA 4EVMA 1XWCA 4K9ZA 2AJQB 4PX1A 3NOFA 1E6BA 3A2VA 3A3TA 3LFLA 4EUYA 3ZIJA 3BD2A 5D96A 3P2AA 2OE0A 5DCHA 2YCDA 3GRXA 5BRTA 3KJYA 4JRRA 4X1UA 1JZRA 3VPQA 3ZTLA 2JADA 2H0GA 1ABAA 1XXUA 5ENUA 3JCML 1B8XA 2FHEA 3GKMA 3IHQA 4IJIA 1SKRB 4L5LA 3C1RA 2MMZA 1GSSA 3KIJA 5GSTA 3EU3A 2CVBA 2EIRA 3IC4A 2YN1A 3ISOA 4HZ4A 4ZB6A 4NPBA 2TIRA 2VL2C 4V2LA 3QMXA 2RUFA 3H1NA 5H5RA 4HJ2A 2YJHA 2C80A 4IQAA 2MYGA 3DVWA 4ECJA 2YPMA 3EU4A 2ZNMA 4PQIA 2XBIA 3QAWA 3HHVA 3ZITA 1O6JA 4RUVA 2DJ0A 5D9TA 2XPDA 5CRWA 1XOBA 2KP1A 4MZCA 1Z6NA 4IN0A 3IR4A 4RI7A 1XFLA 2LKUA 2P5RA 2H76A 4Q5RA 4NHWA 3ERWA 2DJKA 4ILFA 3F9UA 4K2DA 2L6DA 3IHGA 3MIXA 4G10A 1TU7A 4L8EA 2X8HA 3EE2A 3UMAA 5H5SA 2GSTA 3J7Yk 2DKHA 4WF4A 4ZB8A 5ECRB 1M99A 1K0DA 3L9VA 4ISDA 1S3DA 2AV4A 4MK3A 1UC7A 1N2AA 2OA7A 2X8CA 2GSRA 3GX0A 3DRNA 2PVOC 1X9SB 1C72A 4XS1A 3G9BA 1GSYA 3Q74A 2FWEA 3TJJA 4KCEA 1B4PA 1R5AA 5A5KA 5HR2A 3IAS2 2IWTA 5IQYA 4ZBDA 3H8QA 3GN3A 4EL1A 2Z9SA 2H1DA 5G31A 1WIKA 2YP6A 5JWQB 3FHKA 4EC0A 3GNJA 1GL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VD1 A;  3VWX A;  1LU4 A;  2WUL A;  3GA4 A;  5IMD A;  3H93 A;  2YZU A;  2ZCT A;  5IMA A;  1KEB A;  4HOJ A;  5A4U A;  4TRX A;  2M80 A;  4KA0 A;  2GZP A;  1UN2 A;  3D6I A;  1M9A A;  2C0D A;  1XBS A;  4HQZ A;  2K18 A;  2PMT A;  3F8U A;  3LQ7 A;  3PGT A;  2FLS A;  4MCU A;  1PSQ A;  4ZXG A;  1GSF A;  3KTL A;  4WXT A;  4DVC A;  4BWS A;  1WE0 A;  2VCT A;  3L9S A;  5J41 A;  2R2J A;  2JZT A;  3LXT A;  3MNG A;  5DJL A;  3P8W A;  3FZ9 A;  1QXH A;  4DEJ A;  1OC9 A;  3ZLP A;  4KSM A;  5KN2 A;  2HE3 A;  4YQU A;  1OE8 A;  4E8H A;  1BAY A;  1GUM A;  1EZK A;  1XVW A;  5IO2 A;  1PRX A;  4CDO A;  4MH3 A;  2CV4 A;  1WJK A;  3U6V A;  3C71 A;  4O7H A;  4GQF A;  2B1K A;  2H6X A;  2OJL A;  3GFK A;  1AW9 A;  3I9V 2;  5J9B A;  3H79 A;  3HKR A;  2LTK A;  3DD3 A;  4JE1 A;  2B6M A;  4BA7 A;  1GUK A;  2F8A A;  3IE3 A;  1S3C A;  1OC8 A;  4WEY A;  3QOU A;  4MMM A;  1XWK A;  3APS A;  5IOX A;  3HDC A;  4OO5 A;  3L9U A;  3GX8 A;  2L6C A;  2O8V B;  3LSZ A;  2GLR A;  3TJF A;  3F4T A;  3D5J A;  3FW2 A;  3I43 A;  4MPG A;  1HQO A;  3FZA A;  5CP1 A;  3NZN A;  2B5E A;  1B9Y C;  5CRD A;  3QFB C;  4GRF A;  2KP2 A;  4YAP A;  3LXZ A;  4ZL9 A;  4EDZ A;  4LLR A;  4JR6 A;  5JCG A;  5EL8 A;  2H66 A;  3UBK A;  3KTB A;  3MDK A;  2D2Z A;  1IYH A;  4FYB A;  6GSW A;  3EMX A;  3G7J A;  5IMF A;  2B1L A;  2FGX A;  2PPT A;  5CRG A;  2R5G A;  1SL1 B;  1QUW A;  1ZYE A;  2DJ2 A;  2H73 A;  5B6M A;  2GQL A;  3I6A A;  3KZQ A;  2IIY A;  2P31 A;  4KE3 A;  4XTS A;  5GSS A;  1FB6 A;  2H6Y A;  2EIQ A;  1AUC A;  2WS2 A;  2H01 A;  3D22 A;  1TRS A;  1OC9 B;  1XIY A;  5DQY A;  3EIN A;  5FWG A;  3RPP A;  3BBY A;  1X5C A;  4PGT A;  5G2Z A;  3ZIV A;  2XHF A;  2TRX A;  4ECI A;  1EV9 A;  5ECM B;  4IEL A;  2PUK C;  4XRD A;  1OKT A;  1JFU A;  4TR3 A;  1H75 A;  2FD3 A;  2IL3 A;  2NTO A;  4BPY A;  5ECS A;  3IXR A;  3EUR A;  2OBI A;  2AUV A;  3M8N A;  3V1W A;  1K0M A;  2YAN A;  3ME8 A;  2FA4 A;  1A2M A;  1B48 A;  6GSY A;  5IMC A;  2HI7 A;  4HDE A;  1Q4J A;  2R4V A;  4GTU A;  3ZMK A;  4ZB9 A;  1U6T A;  1MDI A;  4GSS A;  4CHS A;  4FYC A;  2CVD A;  3F0I A;  3IA1 A;  2GZY A;  2VL3 A;  3I69 A;  2PN8 A;  2LNT A;  1TXX A;  2HYX A;  1V98 A;  4K8M A;  2VOC A;  1TP9 A;  2N5A A;  2WB9 A;  4OFN A;  5D9W A;  2YWO A;  5GZZ B;  3CRT A;  1HYU A;  2G2Q A;  2RM6 A;  2H74 A;  2A2R A;  4WBR D;  1XVQ A;  1AIU A;  1O7U A;  1GTI A;  3CTF A;  2X99 A;  1YF1 A;  2FY6 A;  3VI7 A;  4IKH A;  3UIW A;  1PGT A;  2O85 A;  3QCP A;  4I2U A;  2PER A;  1J0F A;  1JLV A;  1O81 A;  2MZC A;  2P0G A;  2HRN A;  4YQV A;  4F82 A;  2I3Y A;  3DKS A;  2VIM A;  4D73 A;  12GS A;  4ML1 A;  3L78 A;  1BQ7 A;  2GSS A;  4X0X A;  3QAV A;  1A2J A;  4HJM A;  2KLX A;  3Q19 A;  5ECI B;  4AJ7 A;  2VO4 A;  4YAV A;  2H71 A;  2WGR A;  1X9W B;  1K0B A;  1M2D A;  3F6D A;  3HCZ A;  1XW6 A;  5ABR A;  1SYR A;  1Y6E A;  1WPI A;  4L5O A;  1Z7R A;  3HXS A;  4XCS A;  4ZBA A;  2YV7 A;  5HR0 A;  1V9W A;  2C0E A;  3D4T A;  3F6F A;  3RPN A;  3KM6 A;  3DEX A;  1WOU A;  3MAK A;  2GSQ A;  3F3R A;  3TDG A;  3LG6 A;  2XC2 A;  3N5O A;  2JZR A;  6GSX A;  3UBL A;  2CA8 A;  3UVT A;  1GRX A;  4K7N A;  4F0C A;  1IYI A;  1AXD A;  2DMM A;  4POL A;  1RQM A;  2J23 A;  2H0I A;  4IBP A;  5C04 A;  4IQ1 A;  2NDO A;  1R7H A;  2LST A;  2HZF A;  1UA5 A;  1TRU A;  4TN8 A;  4GF0 A;  2A4V A;  4LL4 B;  1WMJ A;  1J9B A;  1TJD A;  4DSS B;  4D73 B;  4PQ1 A;  1EOG A;  1OKD A;  2RLI A;  1T8E B;  3HYP A;  1Z6M A;  3P7X A;  2LJK A;  1X5D A;  2VLU A;  1BED A;  4TR4 A;  2QKE A;  4ZIL A;  2GDR A;  5G1L A;  1TDI A;  3BOA A;  1JLW A;  4FIW A;  4AJ8 A;  2VCX A;  3LYK A;  2JL4 A;  4Q5F A;  2AYT A;  4TXO A;  1BJX A;  1ZMA A;  3TB2 A;  5COH A;  2R3X A;  3DIE A;  3GL5 A;  4F03 A;  4I5Q A;  3C1S A;  2C4J A;  3GHA A;  4XIH A;  3G7Y A;  3D21 A;  1SK0 A;  1F6M C;  1SU9 A;  2NBS A;  2M46 A;  3TKS E;  2MBS A;  1J08 A;  2DIZ A;  2MMN A;  2I9H A;  3WGD A;  1ZOF A;  1SL0 B;  3FEU A;  3D0Z A;  3GH6 A;  4K0N A;  1FG4 A;  5CNW A;  2XPE A;  3TKR A;  4ZL7 A;  3WT2 A;  4ZBB A;  2E2M A;  2LRT A;  4KH7 A;  2BTO T;  1FVK A;  2K8V A;  2GGT A;  1FAA A;  3SWL A;  1A23 A;  3WGX A;  4Q5Q A;  2AAW A;  5B6N A;  3LJR A;  3DGQ A;  4WKW A;  4EKZ A;  2IME A;  1F2E A;  1MDK A;  2GT5 A;  3FR9 A;  1U87 A;  1R4W A;  2GVP A;  2GS3 A;  3C8E A;  3O6T A;  2KUC A;  1TW9 A;  3TKQ A;  1AQV A;  5JWO B;  1MDJ A;  3DXB A;  4KDU A;  1EWX A;  4MP4 A;  1GTU A;  1TRV A;  4G9H A;  4JED A;  1XOA A;  4TXO B;  2BMX A;  1GTB A;  1SD8 A;  1K0O A;  4N10 A;  2J9H A;  4P3Y B;  1V58 A;  4KND A;  3US3 A;  3GUR A;  2IMD A;  1TTZ A;  1QFN A;  3LYP A;  2RUE A;  4HU9 A;  4LMV A;  2OBK A;  2VL2 A;  3FK8 A;  4HUA A;  2YNX A;  4BVY A;  3DWV A;  5LNK e;  1K0C A;  3OR5 A;  3M0F A;  2C1Y A;  10GS A;  1EGR A;  4N30 A;  2HSY A;  1R5P A;  1ZYQ B;  3C73 A;  4V2N A;  1F37 A;  2VCW A;  3RAZ A;  3W8J A;  3M9K A;  1TKD B;  2WZ9 A;  3KEB A;  1DSB A;  3Q18 A;  2REM A;  4AGS A;  4POM A;  5ID2 A;  3UAR A;  1U3A A;  2O87 A;  3SBC A;  3ME7 A;  2IMK A;  2AHE A;  4FH8 A;  1XW9 A;  4IP6 A;  4BL7 A;  4DSR A;  1X9M B;  3GKK A;  3Q6O A;  4BVX A;  3F4R A;  2CAI A;  3RHB A;  3IAM 2;  5D73 A;  4I2T A;  3KD0 A;  3CYN A;  3MWH A;  5G1K A;  3DML A;  1YEP A;  5CAX A;  1MTC A;  3PH9 A;  1HNA A;  3DVX A;  16GS A;  3GV1 A;  5CRH A;  1SK1 A;  3KMO A;  1QQ2 A;  1SK2 A;  3QD9 A;  4EO3 A;  1ZCP A;  4YQM A;  4PQH A;  5KN0 A;  1EP8 A;  2H0H A;  4KGI A;  3FZ5 A;  4ECC A;  1WWJ A;  3KGK A;  3VWU A;  5B8B A;  4TOP A;  2LV3 A;  2OE3 A;  4Z7X A;  3P90 A;  5HQP A;  2H1B A;  2IFQ A;  1JZO A;  5DCG A;  3FYG A;  4GLT A;  2EC4 A;  5DJM A;  1G6Y A;  2C3Q A;  4MJC A;  2IMF A;  3KP8 A;  5A4V A;  4N0Z A;  5IMZ A;  3F63 A;  4XRA A;  4MJA A;  4FO5 A;  4IVF A;  5GAN D;  1TK5 B;  1PL2 A;  2GQM A;  2ES7 A;  3VFI A;  1M7T A;  2LUS A;  2MBT A;  3HZ8 A;  2E7P A;  1SD9 A;  3TKS A;  6GST A;  4GXZ A;  1QMV A;  1T4Z A;  1T4Y A;  4KUN A;  2FNO A;  1F3B A;  3M1G A;  1K0N A;  1SKW B;  2I4A A;  4TR1 A;  1GUL A;  2HZE A;  2H6Z A;  2F9S A;  19GS A;  5ID2 B;  4GST A;  4NWY A;  3ZRD A;  4I8B A;  1PN9 A;  2GQK A;  2DJ3 A;  1MEK A;  3ZYW A;  1CQG A;  2DC5 A;  4K6X A;  2TRC P;  2OAD A;  2C3N A;  1U3I A;  5HFI A;  1O8W A;  4K0G A;  1A8L A;  1EOH A;  4ULX A;  2B7J A;  1YZX A;  3U5R E;  3WT1 A;  1NW2 A;  1F3A A;  1PA3 A;  3KMN A;  4KX4 A;  5IIZ A;  2I81 A;  1PD2 1;  3CMI A;  1W4V A;  2DLX A;  2L57 A;  4TW5 A;  2CT6 A;  1B4Q A;  2IMI A;  1A0R P;  2K9F A;  2YWI A;  2C8U A;  4DSQ A;  1OYJ A;  1THX A;  2H70 A;  1XZO A;  3IV4 A;  3RDW A;  3QFA C;  1ST9 A;  5LD0 A;  5ECN B;  1DBY A;  2LRN A;  3HJP A;  3ZRE A;  3NIV A;  2YZH A;  5HFK A;  5EY6 A;  1PX6 A;  1ERW A;  18GS A;  2B5Y A;  2DIY A;  3PR8 A;  5J4U A;  2I1U A;  1T00 A;  5E59 A;  3QAG A;  1Q98 A;  2CZ3 A;  3C7M A;  2NPB A;  4OD7 A;  3WGE A;  2F3M A;  3R2Q A;  2HRF A;  4HI7 A;  2DML A;  4HEA 2;  4NHZ A;  3BCI A;  3FR3 A;  1K3O A;  2HLS A;  4TXV A;  2JSY A;  3TRP A;  1G6W A;  3VI5 A;  1TI3 A;  3HD5 A;  2JZS A;  5AIS A;  2VCZ A;  4KW6 A;  3S9F A;  3GKX A;  1ACV A;  4TR1 B;  2HZE B;  4NV2 A;  4KSO A;  2P5Q A;  1GSE A;  4F0B A;  5G5E A;  2VL9 A;  5DAL A;  1O73 A;  2CX4 A;  3UOM A;  3ZVJ D;  4HZ2 A;  3HVS A;  2E0Q A;  4IGJ A;  4QL9 A;  4GQC A;  4QL7 A;  1TU8 A;  3J7Y b;  1OVN A;  3AY8 A;  3UAP A;  5ECK B;  3LGC A;  3N9J A;  8GSS A;  4MZW A;  3TJG A;  2K8S A;  5L71 A;  2FWG A;  1T1V A;  1VRS D;  3E0U A;  1FOV A;  3APO A;  1A24 A;  1VGL A;  3TKP A;  3HY2 A;  3A2W A;  3FKF A;  4IS0 A;  2DJJ A;  5AGY A;  2ALB A;  1HNC A;  4G19 A;  2V2G A;  3UL3 A;  2V6K A;  5DDL A;  5A4W A;  1TRW A;  3O3T A;  1WRY A;  1PX7 A;  4PUA A;  5DAK A;  3KH7 A;  5G30 A;  2R6K A;  4MH2 A;  3VWV A;  5F07 A;  4PUR A;  4OCE A;  6GSS A;  3FY7 A;  3IRA A;  1GWC A;  2V1M A;  1BYE A;  2VAF A;  3CXG A;  4RQX A;  1GP1 A;  1TK0 B;  5DBQ A;  2IN3 A;  1VF2 A;  3GSS A;  5C00 A;  2C0F A;  3GST A;  1W89 A;  1M9B A;  4OMV A;  1G7E A;  1PKW A;  4GCI A;  4ECB A;  1V57 A;  1ZZY A;  1NHO A;  1FHE A;  1NSW A;  2PBJ A;  4OWY A;  3HVX A;  6GSV A;  3ZL5 A;  4POK A;  1AAZ A;  4KB3 A;  2L4C A;  3WD6 A;  3KXO A;  1OAZ A;  5DAL B;  1DUG A;  5FT3 A;  1V2A A;  4ML6 A;  2L5O A;  1FW1 A;  1QK8 A;  1RK4 A;  1DE2 A;  5HR3 A;  1VF3 A;  1TI1 A;  5KN1 A;  3VPT A;  1K0A A;  5EVO A;  4LMW A;  2CVK A;  4F9Z A;  3D4M A;  1JZW A;  1E2Y A;  4LA1 A;  4NXI A;  5DQS A;  3IDV A;  4MJE A;  2F51 A;  1SL2 B;  3QR6 A;  2IPA A;  3LEF A;  5H5Q A;  1QGV A;  1UVZ A;  2LQO A;  2VCQ A;  4J57 E;  3MSZ A;  3PIN A;  2HFD A;  1RW1 A;  3A2X A;  1USB A;  5DAK B;  1Y25 A;  1CQH A;  5CRE A;  1SJI A;  3KP9 A;  2CAQ A;  1ERU A;  4YH2 A;  3FRC A;  2L5L A;  2B3S A;  3RHC A;  4J56 E;  1G0T A;  2FUG 2;  4PNF A;  4QQ7 A;  5F06 A;  1H4O A;  1N8J A;  5E4W A;  3GH9 A;  1ERV A;  1XW5 A;  3IOS A;  3KCM A;  5D8I A;  2C3T A;  1XWG A;  4PXO A;  2FWF A;  2YWM A;  2N5B A;  2LRC A;  3EWL A;  3IBH A;  3UJ1 A;  2RM5 A;  5D9V A;  1ERT A;  2XBQ A;  2B5X A;  3EVI A;  4OFM A;  1XCC A;  4K7I A;  3LWA A;  1G7O A;  4O32 A;  5JWR B;  3LOR A;  4WET A;  1XWB A;  1SEN A;  2H1A A;  4I97 A;  3HJO A;  4EDY A;  5ELA A;  1JZD A;  4EXJ A;  3ZZX A;  4MPF A;  2CQ9 A;  1Z3E A;  3CSI A;  2YJ7 A;  4JR4 A;  2KHP A;  4J2F A;  2VM1 A;  3IPZ A;  4H86 A;  17GS A;  4MZB A;  2V6O A;  2CZ2 A;  4JZQ A;  1AQW A;  2WFC A;  4ACS A;  11GS A;  2A2S A;  3GTU A;  4MF5 A;  3CBU A;  1Z7P A;  4OFT A;  1YF0 A;  2X64 A;  5DVB A;  2O89 A;  1ZGN A;  2M72 A;  3ZFL A;  3APQ A;  2LEG A;  5J3R A;  1HNB A;  4O5R A;  2VCV A;  1M2A A;  2VLT A;  3M3M A;  1SJ6 A;  3ZVJ A;  5IPH A;  4KDX A;  4KDY A;  1GUH A;  1WP0 A;  5JCW A;  2VD0 A;  3TKS C;  4E8E A;  1DE1 A;  1GSD A;  1SJZ A;  3BCK A;  2WCI A;  3E9J B;  4HS1 A;  1GSU A;  2PU9 C;  3VWW A;  1EEJ A;  5HFG A;  4I6X A;  2DBC A;  1KBN A;  2WDU A;  4IW9 A;  3VK9 A;  2OKA A;  1BG5 A;  2KOK A;  5KEJ A;  4RQR A;  5ECH B;  3E3E A;  5ECQ B;  5CO3 A;  3ERF A;  2K6V A;  5F05 A;  1X5E A;  5F0G A;  3L0H A;  1R26 A;  4L0W A;  5G5F A;  2JU5 A;  4LL1 B;  2F8F A;  2LQQ A;  4JU5 A;  4MF6 A;  4XS6 A;  1PKZ A;  3IK7 A;  3O76 A;  3TJK A;  2PWJ A;  4MDC A;  1YQ1 A;  4Q5N A;  3ED3 A;  1A2L A;  3M9J A;  2MMA A;  3EYT A;  2H1G A;  1GNW A;  1FO5 A;  3GKN A;  4K1F A;  1PMT A;  4TR0 A;  5J5N A;  4NAX A;  1XPV A;  3GTU B;  1SYX A;  2ON5 A;  4MA9 A;  1Z5Y E;  3TJB A;  5IM9 A;  2YOI A;  4KCA A;  3GUS A;  2RII A;  2GZZ A;  2HT9 A;  2R37 A;  5IO0 A;  2IJY A;  3CRU A;  4ZL8 A;  1A8Y A;  2FCH A;  1OE7 A;  4OO4 A;  1EGO A;  2LJR A;  1MD3 A;  1T3B A;  2LJA A;  1XWA A;  4N0V A;  1B9X C;  2QC7 A;  1URM A;  1O8X A;  4N11 A;  2BJX A;  1GTA A;  2H72 A;  2WRT A;  1FB0 A;  4FYU A;  1AC1 A;  1M0U A;  3K8N A;  1YKA A;  4ZIJ A;  3ZML A;  2H75 A;  1MD4 A;  3W6G A;  1TOF A;  4MLY A;  5ECP B;  5JCU A;  1YKC A;  2PVQ A;  3L4N A;  3KH9 A;  4IHU A;  9GSS A;  4MF7 A;  3IK9 A;  2CX3 A;  3HA9 A;  5IPG A;  1K3Y A;  3G7I A;  2VUP A;  4PNG A;  2O7K A;  1ML6 A;  1X0R A;  5ECO B;  1YJ6 A;  3CSJ A;  3CTG A;  4PUF C;  5ELG A;  1LJR A;  5ECL B;  2H8L A;  4V1A g;  4TKY A;  1U88 A;  1VF4 A;  4GSN A;  4WR4 A;  2QGV A;  2VLV A;  3F4S A;  2E2G A;  1NHY A;  2EIO A;  2MMO A;  2HNL A;  2YV9 A;  6GSU A;  1GSQ A;  1YEX A;  3GIX A;  2DJ1 A;  4EF0 A;  3RBT A;  1I9D A;  1ZL9 A;  3QPM A;  2IFQ B;  3TGZ A;  3HJM A;  1LBK A;  5AN1 A;  4ID0 A;  1NM3 A;  3EC3 A;  1FVJ A;  5J9C A;  3VLN A;  3A5W A;  4IP1 A;  3FZ4 A;  5IOW A;  2L4Q A;  3TRQ A;  1PL1 A;  2JAC A;  2G0F A;  7GSS A;  5FHI A;  4RI6 A;  4V2M A;  2JSZ A;  4OCF A;  2V32 A;  1AQX A;  4XS4 A;  3VUR A;  3CSH A;  1A0F A;  4G2E A;  4NMU A;  1EV4 A;  5D9X A;  2LS5 A;  4WF5 A;  1BX9 A;  4X43 A;  3F3Q A;  3BJ5 A;  1THO A;  1GH2 A;  4CW9 A;  2GT6 A;  5D93 A;  3ERG A;  1T7P B;  1EP7 A;  3GYK A;  1ILO A;  4V1A p;  3UVH A;  2HXK A;  2OAC A;  2H19 A;  2GTU A;  3TUE A;  5B8A A;  1GLP A;  2N5F A;  1M2B A;  5CYY A;  3QDN A;  4XHM A;  1I5G A;  3EMP A;  2WJU A;  4DSS A;  1TK8 B;  2LNS A;  5LCZ A;  3TOU A;  3H4K A;  5EPF A;  3GMF A;  1PQN A;  1Z9H A;  4WBJ A;  4IJ3 A;  4O92 A;  1GNE A;  4JBB A;  20GS A;  5F8B A;  4EE0 A;  2FA8 A;  1GLQ A;  3W8S A;  1YY7 A;  3TCO A;  4K7O A;  2H30 A;  5IMV A;  1VF1 A;  5KN3 A;  4L0U A;  1OC3 A;  3FR6 A;  4HQS A;  2C0G A;  14GS A;  3WYW A;  2OE1 A;  2VM2 A;  3UEM A;  2V41 A;  1V40 A;  1O85 A;  3HZ4 A;  5AIV A;  4NV5 A;  3TRX A;  22GS A;  1KTE A;  4BWQ A;  4AF2 A;  5B7C A;  1SKS B;  4MAB A;  3TOT A;  2X8G A;  2DSA A;  4XS4 B;  4WR5 A;  2NVL A;  5AIX A;  4MJB A;  1S3A A;  2ZUP A;  1YDK A;  2PGT A;  4POB A;  4KAE A;  4F2I A;  2AB6 A;  2ON7 A;  3ZFB A;  1JHB A;  1KNG A;  2B7K A;  4AJ6 A;  1ON4 A;  5GAP D;  1F9M A;  1EEM A;  5HR1 A;  4HU7 A;  2L59 A;  2FWH A;  2YWN A;  4GWR A;  2QSI A;  4TVE A;  1HD2 A;  2HSH A;  5INY A;  3GL3 A;  13GS A;  1K3L A;  3DYR A;  3HVV A;  4EVM A;  1XWC A;  4K9Z A;  2AJQ B;  4PX1 A;  3NOF A;  1E6B A;  3A2V A;  3A3T A;  3LFL A;  4EUY A;  3ZIJ A;  3BD2 A;  5D96 A;  3P2A A;  2OE0 A;  5DCH A;  2YCD A;  3GRX A;  3KJY A;  4JRR A;  4X1U A;  1JZR A;  3VPQ A;  3ZTL A;  2JAD A;  2H0G A;  1ABA A;  1XXU A;  5ENU A;  3JCM L;  1B8X A;  2FHE A;  3GKM A;  3IHQ A;  4IJI A;  1SKR B;  4L5L A;  3C1R A;  2MMZ A;  1GSS A;  3KIJ A;  5GST A;  3EU3 A;  2CVB A;  2EIR A;  3IC4 A;  2YN1 A;  3ISO A;  4HZ4 A;  4ZB6 A;  4NPB A;  2TIR A;  2VL2 C;  4V2L A;  3QMX A;  2RUF A;  3H1N A;  5H5R A;  4HJ2 A;  2YJH A;  2C80 A;  4IQA A;  2MYG A;  3DVW A;  4ECJ A;  2YPM A;  3EU4 A;  2ZNM A;  4PQI A;  2XBI A;  3QAW A;  3HHV A;  3ZIT A;  1O6J A;  4RUV A;  2DJ0 A;  5D9T A;  2XPD A;  5CRW A;  1XOB A;  2KP1 A;  4MZC A;  1Z6N A;  4IN0 A;  3IR4 A;  4RI7 A;  1XFL A;  2LKU A;  2P5R A;  2H76 A;  4Q5R A;  4NHW A;  3ERW A;  2DJK A;  4ILF A;  3F9U A;  4K2D A;  2L6D A;  4G10 A;  1TU7 A;  4L8E A;  2X8H A;  3EE2 A;  3UMA A;  5H5S A;  2GST A;  3J7Y k;  4WF4 A;  4ZB8 A;  5ECR B;  1M99 A;  1K0D A;  3L9V A;  4ISD A;  1S3D A;  2AV4 A;  4MK3 A;  1UC7 A;  1N2A A;  2OA7 A;  2X8C A;  2GSR A;  3GX0 A;  3DRN A;  2PVO C;  1X9S B;  1C72 A;  4XS1 A;  3G9B A;  1GSY A;  3Q74 A;  2FWE A;  3TJJ A;  4KCE A;  1B4P A;  1R5A A;  5A5K A;  5HR2 A;  3IAS 2;  2IWT A;  5IQY A;  4ZBD A;  3H8Q A;  3GN3 A;  4EL1 A;  2Z9S A;  2H1D A;  5G31 A;  1WIK A;  2YP6 A;  5JWQ B;  3FHK A;  4EC0 A;  3GNJ A;  1GL8 A; 
#chains in the Genus database with same CATH topology
 2VD1 A;  3VWX A;  1LU4 A;  2WUL A;  3GA4 A;  5IMD A;  3H93 A;  2YZU A;  2ZCT A;  5IMA A;  1KEB A;  4HOJ A;  5A4U A;  4TRX A;  2M80 A;  4KA0 A;  2GZP A;  3FMW A;  1UN2 A;  3D6I A;  1M9A A;  2C0D A;  1XBS A;  4HQZ A;  2K18 A;  2PMT A;  3F8U A;  3LQ7 A;  3PGT A;  2FLS A;  4MCU A;  1PSQ A;  4ZXG A;  1GSF A;  3KTL A;  4WXT A;  4DVC A;  4BWS A;  1WE0 A;  2VCT A;  3L9S A;  5J41 A;  2R2J A;  2JZT A;  3LXT A;  3MNG A;  5DJL A;  3P8W A;  3FZ9 A;  1QXH A;  4DEJ A;  1OC9 A;  3ZLP A;  4KSM A;  5KN2 A;  2HE3 A;  4YQU A;  1OE8 A;  4E8H A;  1BAY A;  1GUM A;  4K5R A;  1EZK A;  1XVW A;  5IO2 A;  1PRX A;  4CDO A;  4MH3 A;  2CV4 A;  1WJK A;  3U6V A;  3C71 A;  4O7H A;  4GQF A;  2B1K A;  2H6X A;  2OJL A;  3GFK A;  1AW9 A;  3I9V 2;  5J9B A;  3H79 A;  3HKR A;  2LTK A;  3CQF A;  3DD3 A;  4JE1 A;  2B6M A;  4BA7 A;  1GUK A;  2F8A A;  3IE3 A;  1S3C A;  1OC8 A;  4WEY A;  3QOU A;  4MMM A;  1XWK A;  3APS A;  5IOX A;  3HDC A;  4OO5 A;  3L9U A;  3GX8 A;  2L6C A;  2O8V B;  3LSZ A;  2GLR A;  3TJF A;  3F4T A;  3D5J A;  3FW2 A;  3I43 A;  4MPG A;  1HQO A;  3FZA A;  4YKF A;  5CP1 A;  3NZN A;  2B5E A;  1B9Y C;  5CRD A;  3QFB C;  4GRF A;  2KP2 A;  4YAP A;  3LXZ A;  4ZL9 A;  4EDZ A;  4LLR A;  4JR6 A;  5JCG A;  5EL8 A;  2H66 A;  3UBK A;  3KTB A;  3MDK A;  2D2Z A;  1IYH A;  4FYB A;  6GSW A;  3EMX A;  3G7J A;  5IMF A;  2B1L A;  2FGX A;  2PPT A;  5CRG A;  2R5G A;  1SL1 B;  1QUW A;  1ZYE A;  2DJ2 A;  2H73 A;  5B6M A;  2GQL A;  3I6A A;  3KZQ A;  2IIY A;  2P31 A;  4KE3 A;  4XTS A;  5GSS A;  1FB6 A;  2H6Y A;  2EIQ A;  1AUC A;  2WS2 A;  2H01 A;  3D22 A;  1TRS A;  1OC9 B;  1XIY A;  5DQY A;  3EIN A;  5FWG A;  3RPP A;  3BBY A;  1X5C A;  4PGT A;  5G2Z A;  3ZIV A;  2XHF A;  2TRX A;  4ECI A;  1EV9 A;  5ECM B;  4IEL A;  2PUK C;  4XRD A;  4CY8 A;  1OKT A;  1JFU A;  4TR3 A;  1H75 A;  2FD3 A;  2IL3 A;  2NTO A;  4BPY A;  5ECS A;  3IXR A;  3EUR A;  2OBI A;  2AUV A;  3M8N A;  3V1W A;  1K0M A;  2YAN A;  3ME8 A;  2FA4 A;  1A2M A;  1B48 A;  6GSY A;  1XG8 A;  5IMC A;  2HI7 A;  4HDE A;  1Q4J A;  2R4V A;  4GTU A;  3ZMK A;  4ZB9 A;  1U6T A;  1MDI A;  4GSS A;  4CHS A;  4FYC A;  2HSM A;  2CVD A;  3F0I A;  3IA1 A;  2GZY A;  2VL3 A;  3I69 A;  2PN8 A;  2LNT A;  1TXX A;  2HYX A;  1V98 A;  4K8M A;  2VOC A;  1TP9 A;  2N5A A;  2WB9 A;  4OFN A;  5D9W A;  2YWO A;  5GZZ B;  3CRT A;  1HYU A;  2G2Q A;  4G0L A;  2RM6 A;  2H74 A;  2A2R A;  4WBR D;  1XVQ A;  1AIU A;  1O7U A;  1GTI A;  3CTF A;  2X99 A;  1YF1 A;  2FY6 A;  3VI7 A;  4IKH A;  3UIW A;  1PGT A;  2O85 A;  3QCP A;  4I2U A;  2PER A;  1J0F A;  1JLV A;  1O81 A;  2MZC A;  2P0G A;  2HRN A;  4G0K A;  4YQV A;  4F82 A;  2I3Y A;  3DKS A;  2VIM A;  4D73 A;  12GS A;  4ML1 A;  3L78 A;  1BQ7 A;  2GSS A;  4X0X A;  3QAV A;  1A2J A;  4HJM A;  2KLX A;  4G0I A;  3Q19 A;  5ECI B;  4AJ7 A;  2VO4 A;  2A4H A;  4YAV A;  2H71 A;  2WGR A;  1X9W B;  1K0B A;  1M2D A;  3F6D A;  3HCZ A;  1XW6 A;  5ABR A;  4A5P A;  1SYR A;  3PPU A;  1Y6E A;  1WPI A;  4L5O A;  1Z7R A;  3HXS A;  4XCS A;  4ZBA A;  2YV7 A;  5HR0 A;  1V9W A;  2C0E A;  3D4T A;  3F6F A;  3RPN A;  3KM6 A;  3DEX A;  1WOU A;  3MAK A;  2GSQ A;  3F3R A;  2R0C A;  3TDG A;  3LG6 A;  2XC2 A;  3N5O A;  2JZR A;  6GSX A;  3UBL A;  2CA8 A;  3UVT A;  3A5I A;  1GRX A;  4K7N A;  4F0C A;  1IYI A;  1AXD A;  2DMM A;  4POL A;  1RQM A;  2J23 A;  2H0I A;  4IBP A;  5C04 A;  4IQ1 A;  2NDO A;  1R7H A;  2LST A;  2HZF A;  1UA5 A;  2QA2 A;  1TRU A;  4TN8 A;  4GF0 A;  2A4V A;  4LL4 B;  1WMJ A;  1J9B A;  1TJD A;  4DSS B;  4D73 B;  4PQ1 A;  1EOG A;  1OKD A;  2RLI A;  1T8E B;  3HYP A;  1Z6M A;  3P7X A;  2LJK A;  1X5D A;  2VLU A;  1BED A;  4TR4 A;  2QKE A;  4ZIL A;  2GDR A;  5G1L A;  1TDI A;  3BOA A;  1JLW A;  4FIW A;  4AJ8 A;  2VCX A;  3LYK A;  2JL4 A;  4Q5F A;  2AYT A;  4TXO A;  1BJX A;  1ZMA A;  3TB2 A;  5COH A;  2R3X A;  3DIE A;  3GL5 A;  4F03 A;  4I5Q A;  3C1S A;  2C4J A;  3GHA A;  4XIH A;  3G7Y A;  3D21 A;  1SK0 A;  1F6M C;  1SU9 A;  2NBS A;  2M46 A;  4YKG A;  3TKS E;  2MBS A;  1J08 A;  2DIZ A;  2MMN A;  2I9H A;  3WGD A;  1ZOF A;  1SL0 B;  3FEU A;  3D0Z A;  3GH6 A;  4K0N A;  1FG4 A;  5CNW A;  2XPE A;  3TKR A;  4ZL7 A;  3WT2 A;  4ZBB A;  2E2M A;  2LRT A;  4KH7 A;  2BTO T;  1FVK A;  2K8V A;  2GGT A;  1FOH A;  1FAA A;  3SWL A;  1A23 A;  3WGX A;  4Q5Q A;  2AAW A;  5B6N A;  3LJR A;  3DGQ A;  4WKW A;  4EKZ A;  2IME A;  1F2E A;  1MDK A;  2GT5 A;  3FR9 A;  1U87 A;  1R4W A;  2GVP A;  2GS3 A;  3C8E A;  3O6T A;  2KUC A;  1TW9 A;  3TKQ A;  1AQV A;  2X49 A;  2HRA A;  5JWO B;  1MDJ A;  3DXB A;  4KDU A;  1EWX A;  4MP4 A;  1GTU A;  1TRV A;  4G9H A;  4JED A;  1XOA A;  4TXO B;  2BMX A;  1GTB A;  1SD8 A;  1K0O A;  4N10 A;  2J9H A;  4P3Y B;  1V58 A;  4KND A;  3US3 A;  3GUR A;  2IMD A;  1TTZ A;  1QFN A;  3LYP A;  2RUE A;  4HU9 A;  4LMV A;  2OBK A;  2VL2 A;  3FK8 A;  4HUA A;  2YNX A;  4BVY A;  3DWV A;  5LNK e;  1K0C A;  3OR5 A;  3M0F A;  2C1Y A;  10GS A;  1EGR A;  4N30 A;  2HSY A;  1R5P A;  1ZYQ B;  3C73 A;  4V2N A;  1F37 A;  2VCW A;  3RAZ A;  3W8J A;  2DKI A;  3M9K A;  1TKD B;  4PTS A;  2WZ9 A;  3KEB A;  1DSB A;  3Q18 A;  2REM A;  4AGS A;  4POM A;  5KOX A;  5ID2 A;  3UAR A;  1U3A A;  2O87 A;  3SBC A;  3ME7 A;  2IMK A;  2AHE A;  4FH8 A;  1XW9 A;  4IP6 A;  4BL7 A;  4DSR A;  1X9M B;  3GKK A;  3Q6O A;  4BVX A;  3F4R A;  2CAI A;  3RHB A;  3IAM 2;  5D73 A;  4I2T A;  3KD0 A;  5BMU A;  3CYN A;  3MWH A;  5G1K A;  3DML A;  1YEP A;  5CAX A;  1MTC A;  3PH9 A;  1HNA A;  3DVX A;  16GS A;  3GV1 A;  5CRH A;  1SK1 A;  3KMO A;  1QQ2 A;  1SK2 A;  2UZ8 A;  3QD9 A;  4EO3 A;  1ZCP A;  4YQM A;  4PQH A;  5KN0 A;  1EP8 A;  2H0H A;  4KGI A;  3FZ5 A;  4ECC A;  1WWJ A;  3KGK A;  3VWU A;  5B8B A;  4TOP A;  2LV3 A;  2OE3 A;  4Z7X A;  3P90 A;  5HQP A;  3IC8 A;  1M3I A;  2H1B A;  2IFQ A;  1JZO A;  5DCG A;  3FYG A;  4GLT A;  2EC4 A;  5DJM A;  1G6Y A;  2C3Q A;  4MJC A;  2IMF A;  3KP8 A;  5A4V A;  4N0Z A;  5IMZ A;  3F63 A;  4XRA A;  4MJA A;  4FO5 A;  4IVF A;  5GAN D;  1TK5 B;  1PL2 A;  2GQM A;  2ES7 A;  4ICY A;  3VFI A;  1M7T A;  4BVY B;  2LUS A;  2MBT A;  3HZ8 A;  2E7P A;  1SD9 A;  3TKS A;  6GST A;  4GXZ A;  1QMV A;  1T4Z A;  1T4Y A;  4KUN A;  2FNO A;  1F3B A;  3M1G A;  1K0N A;  1SKW B;  2I4A A;  4TR1 A;  1GUL A;  2HZE A;  2H6Z A;  2F9S A;  19GS A;  5ID2 B;  4GST A;  3HVN A;  4NWY A;  3ZRD A;  4I8B A;  1PN9 A;  2GQK A;  4BL7 B;  2DJ3 A;  1MEK A;  3ZYW A;  1CQG A;  2DC5 A;  4K6X A;  2TRC P;  2OAD A;  2C3N A;  1U3I A;  5HFI A;  1O8W A;  4K0G A;  1A8L A;  1EOH A;  4ULX A;  2B7J A;  4X4J A;  1YZX A;  3U5R E;  3WT1 A;  1NW2 A;  1F3A A;  1PA3 A;  3KMN A;  4KX4 A;  5IIZ A;  2I81 A;  1PD2 1;  3CMI A;  1W4V A;  2DLX A;  2L57 A;  4TW5 A;  2CT6 A;  1B4Q A;  2IMI A;  1A0R P;  2K9F A;  2YWI A;  2C8U A;  2R0G A;  4DSQ A;  1OYJ A;  1THX A;  2H70 A;  4FQU A;  1XZO A;  3IV4 A;  3RDW A;  3QFA C;  1ST9 A;  5LD0 A;  5ECN B;  1DBY A;  2LRN A;  3HJP A;  3ZRE A;  3NIV A;  2YZH A;  5HFK A;  5EY6 A;  1PX6 A;  1ERW A;  18GS A;  2B5Y A;  2DIY A;  3PR8 A;  5J4U A;  2I1U A;  1T00 A;  5E59 A;  3QAG A;  1Q98 A;  2CZ3 A;  3C7M A;  2NPB A;  4OD7 A;  3WGE A;  2F3M A;  3R2Q A;  2HRF A;  4HI7 A;  2DML A;  4HEA 2;  4NHZ A;  3BCI A;  3FR3 A;  1K3O A;  2HLS A;  4TXV A;  2JSY A;  3TRP A;  1G6W A;  3VI5 A;  1TI3 A;  3HD5 A;  2JZS A;  5AIS A;  2VCZ A;  4KW6 A;  3S9F A;  3GKX A;  1ACV A;  4TR1 B;  2HZE B;  4NV2 A;  2A2P A;  4KSO A;  2P5Q A;  1GSE A;  4F0B A;  5G5E A;  2VL9 A;  5DAL A;  1O73 A;  2CX4 A;  3UOM A;  3ZVJ D;  4HZ2 A;  3HVS A;  2E0Q A;  4IGJ A;  4QL9 A;  4GQC A;  4QL7 A;  1TU8 A;  3J7Y b;  3EPT A;  1OVN A;  3AY8 A;  3UAP A;  5ECK B;  3LGC A;  3N9J A;  8GSS A;  4MZW A;  3TJG A;  2K8S A;  5L71 A;  2FWG A;  1T1V A;  1VRS D;  3E0U A;  1FOV A;  3APO A;  1A24 A;  1VGL A;  3TKP A;  3HY2 A;  1ZYN A;  3A2W A;  3FKF A;  4IS0 A;  2DJJ A;  5AGY A;  2ALB A;  1HNC A;  4G19 A;  2V2G A;  4EIP A;  3UL3 A;  2V6K A;  5DDL A;  5A4W A;  1TRW A;  3O3T A;  1WRY A;  1PX7 A;  4PUA A;  1M3J A;  5DAK A;  3KH7 A;  5G30 A;  2R6K A;  4MH2 A;  3VWV A;  5F07 A;  4PUR A;  4OCE A;  4KF9 A;  6GSS A;  3FY7 A;  3IRA A;  1GWC A;  4K2X A;  2V1M A;  1BYE A;  2VAF A;  3CXG A;  4RQX A;  1GP1 A;  1TK0 B;  5DBQ A;  2IN3 A;  1VF2 A;  3GSS A;  5C00 A;  2C0F A;  3GST A;  1W89 A;  1M9B A;  4OMV A;  1G7E A;  1PKW A;  4GCI A;  4ECB A;  1V57 A;  1ZZY A;  1NHO A;  1FHE A;  1NSW A;  2PBJ A;  4OWY A;  3HVX A;  6GSV A;  3ZL5 A;  4POK A;  1AAZ A;  4KB3 A;  2L4C A;  3WD6 A;  3KXO A;  1OAZ A;  5DAL B;  1DUG A;  5FT3 A;  1V2A A;  4ML6 A;  2L5O A;  1FW1 A;  1QK8 A;  1RK4 A;  2X4A A;  1DE2 A;  5HR3 A;  2HRK A;  1VF3 A;  1TI1 A;  5KN1 A;  3VPT A;  1K0A A;  5EVO A;  4LMW A;  2CVK A;  4F9Z A;  3D4M A;  1JZW A;  1E2Y A;  4LA1 A;  3MYD A;  4NXI A;  5DQS A;  3IDV A;  4MJE A;  2F51 A;  1SL2 B;  3QR6 A;  2IPA A;  3LEF A;  4Z2U A;  5H5Q A;  1QGV A;  1UVZ A;  2LQO A;  2VCQ A;  4J57 E;  3MSZ A;  3PIN A;  2HFD A;  1RW1 A;  3A2X A;  1USB A;  5DAK B;  1Y25 A;  1CQH A;  5CRE A;  1SJI A;  3KP9 A;  2CAQ A;  1ERU A;  4YH2 A;  3FRC A;  2L5L A;  4EIQ A;  2B3S A;  3RHC A;  4J56 E;  1G0T A;  2FUG 2;  4PNF A;  4QQ7 A;  5F06 A;  1H4O A;  1N8J A;  5E4W A;  3GH9 A;  1ERV A;  1XW5 A;  3IOS A;  3KCM A;  5D8I A;  2C3T A;  1XWG A;  4PXO A;  2FWF A;  2YWM A;  2N5B A;  2LRC A;  3EWL A;  3IBH A;  3UJ1 A;  2RM5 A;  5D9V A;  1ERT A;  4BIK A;  4K5S A;  2XBQ A;  2B5X A;  3EVI A;  4OFM A;  1XCC A;  4K7I A;  3LWA A;  1G7O A;  4O32 A;  5JWR B;  3LOR A;  4WET A;  1XWB A;  1SEN A;  2H1A A;  4I97 A;  3HJO A;  4EDY A;  5ELA A;  1JZD A;  4EXJ A;  3ZZX A;  4MPF A;  2CQ9 A;  1Z3E A;  3CSI A;  2YJ7 A;  4JR4 A;  2KHP A;  4J2F A;  2VM1 A;  3IPZ A;  4H86 A;  17GS A;  4MZB A;  2V6O A;  2CZ2 A;  4JZQ A;  1AQW A;  2WFC A;  4ACS A;  11GS A;  2A2S A;  3GTU A;  4MF5 A;  3CBU A;  1Z7P A;  4OFT A;  1YF0 A;  2X64 A;  4USS A;  5DVB A;  2O89 A;  1ZGN A;  2M72 A;  3ZFL A;  3APQ A;  2LEG A;  5J3R A;  1HNB A;  4O5R A;  2VCV A;  1M2A A;  2VLT A;  3M3M A;  4HSC X;  1SJ6 A;  3ZVJ A;  5IPH A;  4KDX A;  4KDY A;  1GUH A;  1WP0 A;  5JCW A;  2VD0 A;  3TKS C;  4E8E A;  1DE1 A;  1GSD A;  1SJZ A;  3BCK A;  2WCI A;  2QA1 A;  3E9J B;  4HS1 A;  1GSU A;  2PU9 C;  3VWW A;  1EEJ A;  5HFG A;  4I6X A;  2DBC A;  1KBN A;  2WDU A;  4IW9 A;  3VK9 A;  2OKA A;  1BG5 A;  2KOK A;  5KEJ A;  4RQR A;  5ECH B;  3E3E A;  5ECQ B;  5CO3 A;  3ERF A;  2K6V A;  5F05 A;  1X5E A;  3L0H A;  5F0G A;  1R26 A;  4L0W A;  5G5F A;  2JU5 A;  4LL1 B;  2F8F A;  2LQQ A;  4JU5 A;  4MF6 A;  4XS6 A;  1PKZ A;  3IK7 A;  3O76 A;  3TJK A;  2PWJ A;  4MDC A;  1YQ1 A;  4Q5N A;  3ED3 A;  1A2L A;  3M9J A;  2MMA A;  3EYT A;  2H1G A;  1GNW A;  1FO5 A;  3GKN A;  4K1F A;  1PMT A;  4TR0 A;  5J5N A;  4NAX A;  1XPV A;  3GTU B;  1SYX A;  2ON5 A;  4MA9 A;  1Z5Y E;  3TJB A;  5IM9 A;  2YOI A;  4KCA A;  3GUS A;  2RII A;  2GZZ A;  2HT9 A;  2R37 A;  5IO0 A;  2IJY A;  3CRU A;  4ZL8 A;  1A8Y A;  2FCH A;  1OE7 A;  4OO4 A;  1EGO A;  2LJR A;  1MD3 A;  1T3B A;  2LJA A;  1XWA A;  4N0V A;  1B9X C;  2QC7 A;  4MNN A;  1URM A;  1O8X A;  4N11 A;  2BJX A;  1GTA A;  2H72 A;  2WRT A;  1FB0 A;  4FYU A;  1AC1 A;  1M0U A;  3K8N A;  1YKA A;  4ZIJ A;  3ZML A;  2H75 A;  1MD4 A;  3W6G A;  1TOF A;  4MLY A;  5ECP B;  5JCU A;  1YKC A;  2PVQ A;  3L4N A;  3KH9 A;  4IHU A;  9GSS A;  4MF7 A;  4BVX B;  3IK9 A;  2CX3 A;  3HA9 A;  5IPG A;  1K3Y A;  3G7I A;  2VUP A;  4PNG A;  2O7K A;  1ML6 A;  1X0R A;  5ECO B;  1YJ6 A;  3CSJ A;  3CTG A;  4PUF C;  5ELG A;  1LJR A;  5ECL B;  2H8L A;  4V1A g;  4TKY A;  1U88 A;  1VF4 A;  4GSN A;  4WR4 A;  4O5Q A;  2QGV A;  2VLV A;  3F4S A;  2E2G A;  1NHY A;  2EIO A;  2MMO A;  2HNL A;  2YV9 A;  6GSU A;  1GSQ A;  1YEX A;  3GIX A;  2DJ1 A;  4EF0 A;  3RBT A;  1I9D A;  1ZL9 A;  3QPM A;  2IFQ B;  3TGZ A;  3HJM A;  1LBK A;  5AN1 A;  4ID0 A;  1NM3 A;  3EC3 A;  1FVJ A;  5J9C A;  3VLN A;  3A5W A;  4IP1 A;  1S3R A;  3FZ4 A;  5IOW A;  2L4Q A;  3TRQ A;  1PL1 A;  2JAC A;  2G0F A;  7GSS A;  5FHI A;  4RI6 A;  4V2M A;  2JSZ A;  4OCF A;  2V32 A;  1AQX A;  1ZYP A;  4XS4 A;  3VUR A;  3CSH A;  1A0F A;  4G2E A;  4NMU A;  1EV4 A;  5D9X A;  2LS5 A;  4WF5 A;  1BX9 A;  4X43 A;  3F3Q A;  3BJ5 A;  1THO A;  1GH2 A;  4CW9 A;  2GT6 A;  5D93 A;  3ERG A;  1T7P B;  1EP7 A;  3GYK A;  1ILO A;  4V1A p;  3UVH A;  2R0P A;  2HXK A;  2OAC A;  2H19 A;  2GTU A;  4Z2R A;  3TUE A;  5B8A A;  1GLP A;  2N5F A;  3R3E A;  1M2B A;  5CYY A;  3QDN A;  4XHM A;  1I5G A;  3EMP A;  2WJU A;  4DSS A;  5KOW A;  2LNS A;  5LCZ A;  1TK8 B;  3TOU A;  3H4K A;  5EPF A;  3GMF A;  4Z2T A;  1PQN A;  1Z9H A;  4WBJ A;  4IJ3 A;  4O92 A;  1GNE A;  4JBB A;  20GS A;  5F8B A;  4EE0 A;  2FA8 A;  1GLQ A;  3W8S A;  1YY7 A;  3LW9 A;  3TCO A;  4K7O A;  2H30 A;  5IMV A;  1VF1 A;  5KN3 A;  4L0U A;  1OC3 A;  3FR6 A;  4HQS A;  2C0G A;  14GS A;  3WYW A;  2OE1 A;  2VM2 A;  3UEM A;  2V41 A;  1V40 A;  1O85 A;  3HZ4 A;  5AIV A;  4NV5 A;  3TRX A;  22GS A;  1KTE A;  4BWQ A;  4AF2 A;  5B7C A;  1SKS B;  4MAB A;  3TOT A;  2X8G A;  2DSA A;  4XS4 B;  4WR5 A;  2NVL A;  5AIX A;  4MJB A;  1S3A A;  2ZUP A;  1YDK A;  2PGT A;  4POB A;  4KAE A;  4F2I A;  2AB6 A;  2ON7 A;  3ZFB A;  1JHB A;  1KNG A;  2B7K A;  4AJ6 A;  1ON4 A;  5GAP D;  1F9M A;  1EEM A;  5HR1 A;  4HU7 A;  2L59 A;  2FWH A;  2YWN A;  4GWR A;  1PN0 A;  4O5U A;  2QSI A;  4TVE A;  4CY6 A;  1HD2 A;  2HSH A;  5INY A;  3GL3 A;  13GS A;  1K3L A;  3DYR A;  3HVV A;  4EVM A;  1XWC A;  4K9Z A;  2AJQ B;  4PX1 A;  3NOF A;  1E6B A;  3A2V A;  3A3T A;  3LFL A;  4EUY A;  3ZIJ A;  3BD2 A;  5D96 A;  3P2A A;  2OE0 A;  5DCH A;  2YCD A;  3GRX A;  5BRT A;  3KJY A;  4JRR A;  4X1U A;  1JZR A;  3VPQ A;  3ZTL A;  2JAD A;  2H0G A;  1ABA A;  1XXU A;  5ENU A;  3JCM L;  1B8X A;  2FHE A;  3GKM A;  3IHQ A;  4IJI A;  1SKR B;  4L5L A;  3C1R A;  2MMZ A;  1GSS A;  3KIJ A;  5GST A;  3EU3 A;  2CVB A;  2EIR A;  3IC4 A;  2YN1 A;  3ISO A;  4HZ4 A;  4ZB6 A;  4NPB A;  2TIR A;  2VL2 C;  4V2L A;  3QMX A;  2RUF A;  3H1N A;  5H5R A;  4HJ2 A;  2YJH A;  2C80 A;  4IQA A;  2MYG A;  3DVW A;  4ECJ A;  2YPM A;  3EU4 A;  2ZNM A;  4PQI A;  2XBI A;  3QAW A;  3HHV A;  3ZIT A;  1O6J A;  4RUV A;  2DJ0 A;  5D9T A;  2XPD A;  5CRW A;  1XOB A;  2KP1 A;  4MZC A;  1Z6N A;  4IN0 A;  3IR4 A;  4RI7 A;  1XFL A;  2LKU A;  2P5R A;  2H76 A;  4Q5R A;  4NHW A;  3ERW A;  2DJK A;  4ILF A;  3F9U A;  4K2D A;  2L6D A;  3IHG A;  3MIX A;  4G10 A;  1TU7 A;  4L8E A;  2X8H A;  3EE2 A;  3UMA A;  5H5S A;  2GST A;  3J7Y k;  2DKH A;  4WF4 A;  4ZB8 A;  5ECR B;  1M99 A;  1K0D A;  3L9V A;  4ISD A;  1S3D A;  2AV4 A;  4MK3 A;  1UC7 A;  1N2A A;  2OA7 A;  2X8C A;  2GSR A;  3GX0 A;  3DRN A;  2PVO C;  1X9S B;  1C72 A;  4XS1 A;  3G9B A;  1GSY A;  3Q74 A;  2FWE A;  3TJJ A;  4KCE A;  1B4P A;  1R5A A;  5A5K A;  5HR2 A;  3IAS 2;  2IWT A;  5IQY A;  4ZBD A;  3H8Q A;  3GN3 A;  4EL1 A;  2Z9S A;  1PFO A;  2H1D A;  5G31 A;  1WIK A;  2YP6 A;  5JWQ B;  3FHK A;  4EC0 A;  3GNJ A;  1GL8 A; 
#chains in the Genus database with same CATH homology
 2VD1 A;  3VWX A;  1LU4 A;  2WUL A;  3GA4 A;  5IMD A;  3H93 A;  2YZU A;  2ZCT A;  5IMA A;  1KEB A;  4HOJ A;  5A4U A;  4TRX A;  2M80 A;  4KA0 A;  2GZP A;  3FMW A;  1UN2 A;  3D6I A;  1M9A A;  2C0D A;  1XBS A;  4HQZ A;  2K18 A;  2PMT A;  3F8U A;  3LQ7 A;  3PGT A;  2FLS A;  4MCU A;  1PSQ A;  4ZXG A;  1GSF A;  3KTL A;  4WXT A;  4DVC A;  4BWS A;  1WE0 A;  2VCT A;  3L9S A;  5J41 A;  2R2J A;  2JZT A;  3LXT A;  3MNG A;  5DJL A;  3P8W A;  3FZ9 A;  1QXH A;  4DEJ A;  1OC9 A;  3ZLP A;  4KSM A;  5KN2 A;  2HE3 A;  4YQU A;  1OE8 A;  4E8H A;  1BAY A;  1GUM A;  4K5R A;  1EZK A;  1XVW A;  5IO2 A;  1PRX A;  4CDO A;  4MH3 A;  2CV4 A;  1WJK A;  3U6V A;  3C71 A;  4O7H A;  4GQF A;  2B1K A;  2H6X A;  2OJL A;  3GFK A;  1AW9 A;  3I9V 2;  5J9B A;  3H79 A;  3HKR A;  2LTK A;  3DD3 A;  4JE1 A;  2B6M A;  4BA7 A;  1GUK A;  2F8A A;  3IE3 A;  1S3C A;  1OC8 A;  4WEY A;  3QOU A;  4MMM A;  1XWK A;  3APS A;  5IOX A;  3HDC A;  4OO5 A;  3L9U A;  3GX8 A;  2L6C A;  2O8V B;  3LSZ A;  2GLR A;  3TJF A;  3F4T A;  3D5J A;  3FW2 A;  3I43 A;  4MPG A;  1HQO A;  3FZA A;  4YKF A;  5CP1 A;  3NZN A;  2B5E A;  1B9Y C;  5CRD A;  3QFB C;  4GRF A;  2KP2 A;  4YAP A;  3LXZ A;  4ZL9 A;  4EDZ A;  4LLR A;  4JR6 A;  5JCG A;  5EL8 A;  2H66 A;  3UBK A;  3KTB A;  3MDK A;  2D2Z A;  1IYH A;  4FYB A;  6GSW A;  3EMX A;  3G7J A;  5IMF A;  2B1L A;  2FGX A;  2PPT A;  5CRG A;  2R5G A;  1SL1 B;  1QUW A;  1ZYE A;  2DJ2 A;  2H73 A;  5B6M A;  2GQL A;  3I6A A;  3KZQ A;  2IIY A;  2P31 A;  4KE3 A;  4XTS A;  5GSS A;  1FB6 A;  2H6Y A;  2EIQ A;  1AUC A;  2WS2 A;  2H01 A;  3D22 A;  1TRS A;  1OC9 B;  1XIY A;  5DQY A;  3EIN A;  5FWG A;  3RPP A;  3BBY A;  1X5C A;  4PGT A;  5G2Z A;  3ZIV A;  2XHF A;  2TRX A;  4ECI A;  1EV9 A;  5ECM B;  4IEL A;  2PUK C;  4XRD A;  4CY8 A;  1OKT A;  1JFU A;  4TR3 A;  1H75 A;  2FD3 A;  2IL3 A;  2NTO A;  4BPY A;  5ECS A;  3IXR A;  3EUR A;  2OBI A;  2AUV A;  3M8N A;  3V1W A;  1K0M A;  2YAN A;  3ME8 A;  2FA4 A;  1A2M A;  1B48 A;  6GSY A;  5IMC A;  2HI7 A;  4HDE A;  1Q4J A;  2R4V A;  4GTU A;  3ZMK A;  4ZB9 A;  1U6T A;  1MDI A;  4GSS A;  4CHS A;  4FYC A;  2HSM A;  2CVD A;  3F0I A;  3IA1 A;  2GZY A;  2VL3 A;  3I69 A;  2PN8 A;  2LNT A;  1TXX A;  2HYX A;  1V98 A;  4K8M A;  2VOC A;  1TP9 A;  2N5A A;  2WB9 A;  4OFN A;  5D9W A;  2YWO A;  5GZZ B;  3CRT A;  1HYU A;  2G2Q A;  4G0L A;  2RM6 A;  2H74 A;  2A2R A;  4WBR D;  1XVQ A;  1AIU A;  1O7U A;  1GTI A;  3CTF A;  2X99 A;  1YF1 A;  2FY6 A;  3VI7 A;  4IKH A;  3UIW A;  1PGT A;  2O85 A;  3QCP A;  4I2U A;  2PER A;  1J0F A;  1JLV A;  1O81 A;  2MZC A;  2P0G A;  2HRN A;  4G0K A;  4YQV A;  4F82 A;  2I3Y A;  3DKS A;  2VIM A;  4D73 A;  12GS A;  4ML1 A;  3L78 A;  1BQ7 A;  2GSS A;  4X0X A;  3QAV A;  1A2J A;  4HJM A;  2KLX A;  4G0I A;  3Q19 A;  5ECI B;  4AJ7 A;  2VO4 A;  2A4H A;  4YAV A;  2H71 A;  2WGR A;  1X9W B;  1K0B A;  1M2D A;  3F6D A;  3HCZ A;  1XW6 A;  5ABR A;  4A5P A;  1SYR A;  3PPU A;  1Y6E A;  1WPI A;  4L5O A;  1Z7R A;  3HXS A;  4XCS A;  4ZBA A;  2YV7 A;  5HR0 A;  1V9W A;  2C0E A;  3D4T A;  3F6F A;  3RPN A;  3KM6 A;  3DEX A;  1WOU A;  3MAK A;  2GSQ A;  3F3R A;  2R0C A;  3TDG A;  3LG6 A;  2XC2 A;  3N5O A;  2JZR A;  6GSX A;  3UBL A;  2CA8 A;  3UVT A;  3A5I A;  1GRX A;  4K7N A;  4F0C A;  1IYI A;  1AXD A;  2DMM A;  4POL A;  1RQM A;  2J23 A;  2H0I A;  4IBP A;  5C04 A;  4IQ1 A;  2NDO A;  1R7H A;  2LST A;  2HZF A;  1UA5 A;  2QA2 A;  1TRU A;  4TN8 A;  4GF0 A;  2A4V A;  4LL4 B;  1WMJ A;  1J9B A;  1TJD A;  4DSS B;  4D73 B;  4PQ1 A;  1EOG A;  1OKD A;  2RLI A;  1T8E B;  3HYP A;  1Z6M A;  3P7X A;  2LJK A;  1X5D A;  2VLU A;  1BED A;  4TR4 A;  2QKE A;  4ZIL A;  2GDR A;  5G1L A;  1TDI A;  3BOA A;  1JLW A;  4FIW A;  4AJ8 A;  2VCX A;  3LYK A;  2JL4 A;  4Q5F A;  2AYT A;  4TXO A;  1BJX A;  1ZMA A;  3TB2 A;  5COH A;  2R3X A;  3DIE A;  3GL5 A;  4F03 A;  4I5Q A;  3C1S A;  2C4J A;  3GHA A;  4XIH A;  3G7Y A;  3D21 A;  1SK0 A;  1F6M C;  1SU9 A;  2NBS A;  2M46 A;  4YKG A;  3TKS E;  2MBS A;  1J08 A;  2DIZ A;  2MMN A;  2I9H A;  3WGD A;  1ZOF A;  1SL0 B;  3FEU A;  3D0Z A;  3GH6 A;  4K0N A;  1FG4 A;  5CNW A;  2XPE A;  3TKR A;  4ZL7 A;  3WT2 A;  4ZBB A;  2E2M A;  2LRT A;  4KH7 A;  2BTO T;  1FVK A;  2K8V A;  2GGT A;  1FOH A;  1FAA A;  3SWL A;  1A23 A;  3WGX A;  4Q5Q A;  2AAW A;  5B6N A;  3LJR A;  3DGQ A;  4WKW A;  4EKZ A;  2IME A;  1F2E A;  1MDK A;  2GT5 A;  3FR9 A;  1U87 A;  1R4W A;  2GVP A;  2GS3 A;  3C8E A;  3O6T A;  2KUC A;  1TW9 A;  3TKQ A;  1AQV A;  2X49 A;  2HRA A;  5JWO B;  1MDJ A;  3DXB A;  4KDU A;  1EWX A;  4MP4 A;  1GTU A;  1TRV A;  4G9H A;  4JED A;  1XOA A;  4TXO B;  2BMX A;  1GTB A;  1SD8 A;  1K0O A;  4N10 A;  2J9H A;  4P3Y B;  1V58 A;  4KND A;  3US3 A;  3GUR A;  2IMD A;  1TTZ A;  1QFN A;  3LYP A;  2RUE A;  4HU9 A;  4LMV A;  2OBK A;  2VL2 A;  3FK8 A;  4HUA A;  2YNX A;  4BVY A;  3DWV A;  5LNK e;  1K0C A;  3OR5 A;  3M0F A;  2C1Y A;  10GS A;  1EGR A;  4N30 A;  2HSY A;  1R5P A;  1ZYQ B;  3C73 A;  4V2N A;  1F37 A;  2VCW A;  3RAZ A;  3W8J A;  2DKI A;  3M9K A;  1TKD B;  4PTS A;  2WZ9 A;  3KEB A;  1DSB A;  3Q18 A;  2REM A;  4AGS A;  4POM A;  5KOX A;  5ID2 A;  3UAR A;  1U3A A;  2O87 A;  3SBC A;  3ME7 A;  2IMK A;  2AHE A;  4FH8 A;  1XW9 A;  4IP6 A;  4BL7 A;  4DSR A;  1X9M B;  3GKK A;  3Q6O A;  4BVX A;  3F4R A;  2CAI A;  3RHB A;  3IAM 2;  5D73 A;  4I2T A;  3KD0 A;  5BMU A;  3CYN A;  3MWH A;  5G1K A;  3DML A;  1YEP A;  5CAX A;  1MTC A;  3PH9 A;  1HNA A;  3DVX A;  16GS A;  3GV1 A;  5CRH A;  1SK1 A;  3KMO A;  1QQ2 A;  1SK2 A;  2UZ8 A;  3QD9 A;  4EO3 A;  1ZCP A;  4YQM A;  4PQH A;  5KN0 A;  1EP8 A;  2H0H A;  4KGI A;  3FZ5 A;  4ECC A;  1WWJ A;  3KGK A;  3VWU A;  5B8B A;  4TOP A;  2LV3 A;  2OE3 A;  4Z7X A;  3P90 A;  5HQP A;  3IC8 A;  2H1B A;  2IFQ A;  1JZO A;  5DCG A;  3FYG A;  4GLT A;  2EC4 A;  5DJM A;  1G6Y A;  2C3Q A;  4MJC A;  2IMF A;  3KP8 A;  5A4V A;  4N0Z A;  5IMZ A;  3F63 A;  4XRA A;  4MJA A;  4FO5 A;  4IVF A;  5GAN D;  1TK5 B;  1PL2 A;  2GQM A;  2ES7 A;  4ICY A;  3VFI A;  1M7T A;  4BVY B;  2LUS A;  2MBT A;  3HZ8 A;  2E7P A;  1SD9 A;  3TKS A;  6GST A;  4GXZ A;  1QMV A;  1T4Z A;  1T4Y A;  4KUN A;  2FNO A;  1F3B A;  3M1G A;  1K0N A;  1SKW B;  2I4A A;  4TR1 A;  1GUL A;  2HZE A;  2H6Z A;  2F9S A;  19GS A;  5ID2 B;  4GST A;  4NWY A;  3ZRD A;  4I8B A;  1PN9 A;  2GQK A;  4BL7 B;  2DJ3 A;  1MEK A;  3ZYW A;  1CQG A;  2DC5 A;  4K6X A;  2TRC P;  2OAD A;  2C3N A;  1U3I A;  5HFI A;  1O8W A;  4K0G A;  1A8L A;  1EOH A;  4ULX A;  2B7J A;  4X4J A;  1YZX A;  3U5R E;  3WT1 A;  1NW2 A;  1F3A A;  1PA3 A;  3KMN A;  4KX4 A;  5IIZ A;  2I81 A;  1PD2 1;  3CMI A;  1W4V A;  2DLX A;  2L57 A;  4TW5 A;  2CT6 A;  1B4Q A;  2IMI A;  1A0R P;  2K9F A;  2YWI A;  2C8U A;  2R0G A;  4DSQ A;  1OYJ A;  1THX A;  2H70 A;  4FQU A;  1XZO A;  3IV4 A;  3RDW A;  3QFA C;  1ST9 A;  5LD0 A;  5ECN B;  1DBY A;  2LRN A;  3HJP A;  3ZRE A;  3NIV A;  2YZH A;  5HFK A;  5EY6 A;  1PX6 A;  1ERW A;  18GS A;  2B5Y A;  2DIY A;  3PR8 A;  5J4U A;  2I1U A;  1T00 A;  5E59 A;  3QAG A;  1Q98 A;  2CZ3 A;  3C7M A;  2NPB A;  4OD7 A;  3WGE A;  2F3M A;  3R2Q A;  2HRF A;  4HI7 A;  2DML A;  4HEA 2;  4NHZ A;  3BCI A;  3FR3 A;  1K3O A;  2HLS A;  4TXV A;  2JSY A;  3TRP A;  1G6W A;  3VI5 A;  1TI3 A;  3HD5 A;  2JZS A;  5AIS A;  2VCZ A;  4KW6 A;  3S9F A;  3GKX A;  1ACV A;  4TR1 B;  2HZE B;  4NV2 A;  2A2P A;  4KSO A;  2P5Q A;  1GSE A;  4F0B A;  5G5E A;  2VL9 A;  5DAL A;  1O73 A;  2CX4 A;  3UOM A;  3ZVJ D;  4HZ2 A;  3HVS A;  2E0Q A;  4IGJ A;  4QL9 A;  4GQC A;  4QL7 A;  1TU8 A;  3J7Y b;  3EPT A;  1OVN A;  3AY8 A;  3UAP A;  5ECK B;  3LGC A;  3N9J A;  8GSS A;  4MZW A;  3TJG A;  2K8S A;  5L71 A;  2FWG A;  1T1V A;  1VRS D;  3E0U A;  1FOV A;  3APO A;  1A24 A;  1VGL A;  3TKP A;  3HY2 A;  1ZYN A;  3A2W A;  3FKF A;  4IS0 A;  2DJJ A;  5AGY A;  2ALB A;  1HNC A;  4G19 A;  2V2G A;  4EIP A;  3UL3 A;  2V6K A;  5DDL A;  5A4W A;  1TRW A;  3O3T A;  1WRY A;  1PX7 A;  4PUA A;  5DAK A;  3KH7 A;  5G30 A;  2R6K A;  4MH2 A;  3VWV A;  5F07 A;  4PUR A;  4OCE A;  4KF9 A;  6GSS A;  3FY7 A;  3IRA A;  1GWC A;  4K2X A;  2V1M A;  1BYE A;  2VAF A;  3CXG A;  4RQX A;  1GP1 A;  1TK0 B;  5DBQ A;  2IN3 A;  1VF2 A;  3GSS A;  5C00 A;  2C0F A;  3GST A;  1W89 A;  1M9B A;  4OMV A;  1G7E A;  1PKW A;  4GCI A;  4ECB A;  1V57 A;  1ZZY A;  1NHO A;  1FHE A;  1NSW A;  2PBJ A;  4OWY A;  3HVX A;  6GSV A;  3ZL5 A;  4POK A;  1AAZ A;  4KB3 A;  2L4C A;  3WD6 A;  3KXO A;  1OAZ A;  5DAL B;  1DUG A;  5FT3 A;  1V2A A;  4ML6 A;  2L5O A;  1FW1 A;  1QK8 A;  1RK4 A;  2X4A A;  1DE2 A;  5HR3 A;  2HRK A;  1VF3 A;  1TI1 A;  5KN1 A;  3VPT A;  1K0A A;  5EVO A;  4LMW A;  2CVK A;  4F9Z A;  3D4M A;  1JZW A;  1E2Y A;  4LA1 A;  3MYD A;  4NXI A;  5DQS A;  3IDV A;  4MJE A;  2F51 A;  1SL2 B;  3QR6 A;  2IPA A;  3LEF A;  4Z2U A;  5H5Q A;  1QGV A;  1UVZ A;  2LQO A;  2VCQ A;  4J57 E;  3MSZ A;  3PIN A;  2HFD A;  1RW1 A;  3A2X A;  1USB A;  5DAK B;  1Y25 A;  1CQH A;  5CRE A;  1SJI A;  3KP9 A;  2CAQ A;  1ERU A;  4YH2 A;  3FRC A;  2L5L A;  4EIQ A;  2B3S A;  3RHC A;  4J56 E;  1G0T A;  2FUG 2;  4PNF A;  4QQ7 A;  5F06 A;  1H4O A;  1N8J A;  5E4W A;  3GH9 A;  1ERV A;  1XW5 A;  3IOS A;  3KCM A;  5D8I A;  2C3T A;  1XWG A;  4PXO A;  2FWF A;  2YWM A;  2N5B A;  2LRC A;  3EWL A;  3IBH A;  3UJ1 A;  2RM5 A;  5D9V A;  1ERT A;  4K5S A;  2XBQ A;  2B5X A;  3EVI A;  4OFM A;  1XCC A;  4K7I A;  3LWA A;  1G7O A;  4O32 A;  5JWR B;  3LOR A;  4WET A;  1XWB A;  1SEN A;  2H1A A;  4I97 A;  3HJO A;  4EDY A;  5ELA A;  1JZD A;  4EXJ A;  3ZZX A;  4MPF A;  2CQ9 A;  1Z3E A;  3CSI A;  2YJ7 A;  4JR4 A;  2KHP A;  4J2F A;  2VM1 A;  3IPZ A;  4H86 A;  17GS A;  4MZB A;  2V6O A;  2CZ2 A;  4JZQ A;  1AQW A;  2WFC A;  4ACS A;  11GS A;  2A2S A;  3GTU A;  4MF5 A;  3CBU A;  1Z7P A;  4OFT A;  1YF0 A;  2X64 A;  4USS A;  5DVB A;  2O89 A;  1ZGN A;  2M72 A;  3ZFL A;  3APQ A;  2LEG A;  5J3R A;  1HNB A;  4O5R A;  2VCV A;  1M2A A;  2VLT A;  3M3M A;  1SJ6 A;  3ZVJ A;  5IPH A;  4KDX A;  4KDY A;  1GUH A;  1WP0 A;  5JCW A;  2VD0 A;  3TKS C;  4E8E A;  1DE1 A;  1GSD A;  1SJZ A;  3BCK A;  2WCI A;  2QA1 A;  3E9J B;  4HS1 A;  1GSU A;  2PU9 C;  3VWW A;  1EEJ A;  5HFG A;  4I6X A;  2DBC A;  1KBN A;  2WDU A;  4IW9 A;  3VK9 A;  2OKA A;  1BG5 A;  2KOK A;  5KEJ A;  4RQR A;  5ECH B;  3E3E A;  5ECQ B;  5CO3 A;  3ERF A;  2K6V A;  5F05 A;  1X5E A;  3L0H A;  5F0G A;  1R26 A;  4L0W A;  5G5F A;  2JU5 A;  4LL1 B;  2F8F A;  2LQQ A;  4JU5 A;  4MF6 A;  4XS6 A;  1PKZ A;  3IK7 A;  3O76 A;  3TJK A;  2PWJ A;  4MDC A;  1YQ1 A;  4Q5N A;  3ED3 A;  1A2L A;  3M9J A;  2MMA A;  3EYT A;  2H1G A;  1GNW A;  1FO5 A;  3GKN A;  4K1F A;  1PMT A;  4TR0 A;  5J5N A;  4NAX A;  1XPV A;  3GTU B;  1SYX A;  2ON5 A;  4MA9 A;  1Z5Y E;  3TJB A;  5IM9 A;  2YOI A;  4KCA A;  3GUS A;  2RII A;  2GZZ A;  2HT9 A;  2R37 A;  5IO0 A;  2IJY A;  3CRU A;  4ZL8 A;  1A8Y A;  2FCH A;  1OE7 A;  4OO4 A;  1EGO A;  2LJR A;  1MD3 A;  1T3B A;  2LJA A;  1XWA A;  4N0V A;  1B9X C;  2QC7 A;  4MNN A;  1URM A;  1O8X A;  4N11 A;  2BJX A;  1GTA A;  2H72 A;  2WRT A;  1FB0 A;  4FYU A;  1AC1 A;  1M0U A;  3K8N A;  1YKA A;  4ZIJ A;  3ZML A;  2H75 A;  1MD4 A;  3W6G A;  1TOF A;  4MLY A;  5ECP B;  5JCU A;  1YKC A;  2PVQ A;  3L4N A;  3KH9 A;  4IHU A;  9GSS A;  4MF7 A;  4BVX B;  3IK9 A;  2CX3 A;  3HA9 A;  5IPG A;  1K3Y A;  3G7I A;  2VUP A;  4PNG A;  2O7K A;  1ML6 A;  1X0R A;  5ECO B;  1YJ6 A;  3CSJ A;  3CTG A;  4PUF C;  5ELG A;  1LJR A;  5ECL B;  2H8L A;  4V1A g;  4TKY A;  1U88 A;  1VF4 A;  4GSN A;  4WR4 A;  4O5Q A;  2QGV A;  2VLV A;  3F4S A;  2E2G A;  1NHY A;  2EIO A;  2MMO A;  2HNL A;  2YV9 A;  6GSU A;  1GSQ A;  1YEX A;  3GIX A;  2DJ1 A;  4EF0 A;  3RBT A;  1I9D A;  1ZL9 A;  3QPM A;  2IFQ B;  3TGZ A;  3HJM A;  1LBK A;  5AN1 A;  4ID0 A;  1NM3 A;  3EC3 A;  1FVJ A;  5J9C A;  3VLN A;  3A5W A;  4IP1 A;  3FZ4 A;  5IOW A;  2L4Q A;  3TRQ A;  1PL1 A;  2JAC A;  2G0F A;  7GSS A;  5FHI A;  4RI6 A;  4V2M A;  2JSZ A;  4OCF A;  2V32 A;  1AQX A;  1ZYP A;  4XS4 A;  3VUR A;  3CSH A;  1A0F A;  4G2E A;  4NMU A;  1EV4 A;  5D9X A;  2LS5 A;  4WF5 A;  1BX9 A;  4X43 A;  3F3Q A;  3BJ5 A;  1THO A;  1GH2 A;  4CW9 A;  2GT6 A;  5D93 A;  3ERG A;  1T7P B;  1EP7 A;  3GYK A;  1ILO A;  4V1A p;  3UVH A;  2R0P A;  2HXK A;  2OAC A;  2H19 A;  2GTU A;  4Z2R A;  3TUE A;  5B8A A;  1GLP A;  2N5F A;  3R3E A;  1M2B A;  5CYY A;  3QDN A;  4XHM A;  1I5G A;  3EMP A;  2WJU A;  4DSS A;  5KOW A;  2LNS A;  5LCZ A;  1TK8 B;  3TOU A;  3H4K A;  5EPF A;  3GMF A;  4Z2T A;  1PQN A;  1Z9H A;  4WBJ A;  4IJ3 A;  4O92 A;  1GNE A;  4JBB A;  20GS A;  5F8B A;  4EE0 A;  2FA8 A;  1GLQ A;  3W8S A;  1YY7 A;  3LW9 A;  3TCO A;  4K7O A;  2H30 A;  5IMV A;  1VF1 A;  5KN3 A;  4L0U A;  1OC3 A;  3FR6 A;  4HQS A;  2C0G A;  14GS A;  3WYW A;  2OE1 A;  2VM2 A;  3UEM A;  2V41 A;  1V40 A;  1O85 A;  3HZ4 A;  5AIV A;  4NV5 A;  3TRX A;  22GS A;  1KTE A;  4BWQ A;  4AF2 A;  5B7C A;  1SKS B;  4MAB A;  3TOT A;  2X8G A;  2DSA A;  4XS4 B;  4WR5 A;  2NVL A;  5AIX A;  4MJB A;  1S3A A;  2ZUP A;  1YDK A;  2PGT A;  4POB A;  4KAE A;  4F2I A;  2AB6 A;  2ON7 A;  3ZFB A;  1JHB A;  1KNG A;  2B7K A;  4AJ6 A;  1ON4 A;  5GAP D;  1F9M A;  1EEM A;  5HR1 A;  4HU7 A;  2L59 A;  2FWH A;  2YWN A;  4GWR A;  1PN0 A;  4O5U A;  2QSI A;  4TVE A;  4CY6 A;  1HD2 A;  2HSH A;  5INY A;  3GL3 A;  13GS A;  1K3L A;  3DYR A;  3HVV A;  4EVM A;  1XWC A;  4K9Z A;  2AJQ B;  4PX1 A;  3NOF A;  1E6B A;  3A2V A;  3A3T A;  3LFL A;  4EUY A;  3ZIJ A;  3BD2 A;  5D96 A;  3P2A A;  2OE0 A;  5DCH A;  2YCD A;  3GRX A;  5BRT A;  3KJY A;  4JRR A;  4X1U A;  1JZR A;  3VPQ A;  3ZTL A;  2JAD A;  2H0G A;  1ABA A;  1XXU A;  5ENU A;  3JCM L;  1B8X A;  2FHE A;  3GKM A;  3IHQ A;  4IJI A;  1SKR B;  4L5L A;  3C1R A;  2MMZ A;  1GSS A;  3KIJ A;  5GST A;  3EU3 A;  2CVB A;  2EIR A;  3IC4 A;  2YN1 A;  3ISO A;  4HZ4 A;  4ZB6 A;  4NPB A;  2TIR A;  2VL2 C;  4V2L A;  3QMX A;  2RUF A;  3H1N A;  5H5R A;  4HJ2 A;  2YJH A;  2C80 A;  4IQA A;  2MYG A;  3DVW A;  4ECJ A;  2YPM A;  3EU4 A;  2ZNM A;  4PQI A;  2XBI A;  3QAW A;  3HHV A;  3ZIT A;  1O6J A;  4RUV A;  2DJ0 A;  5D9T A;  2XPD A;  5CRW A;  1XOB A;  2KP1 A;  4MZC A;  1Z6N A;  4IN0 A;  3IR4 A;  4RI7 A;  1XFL A;  2LKU A;  2P5R A;  2H76 A;  4Q5R A;  4NHW A;  3ERW A;  2DJK A;  4ILF A;  3F9U A;  4K2D A;  2L6D A;  3IHG A;  3MIX A;  4G10 A;  1TU7 A;  4L8E A;  2X8H A;  3EE2 A;  3UMA A;  5H5S A;  2GST A;  3J7Y k;  2DKH A;  4WF4 A;  4ZB8 A;  5ECR B;  1M99 A;  1K0D A;  3L9V A;  4ISD A;  1S3D A;  2AV4 A;  4MK3 A;  1UC7 A;  1N2A A;  2OA7 A;  2X8C A;  2GSR A;  3GX0 A;  3DRN A;  2PVO C;  1X9S B;  1C72 A;  4XS1 A;  3G9B A;  1GSY A;  3Q74 A;  2FWE A;  3TJJ A;  4KCE A;  1B4P A;  1R5A A;  5A5K A;  5HR2 A;  3IAS 2;  2IWT A;  5IQY A;  4ZBD A;  3H8Q A;  3GN3 A;  4EL1 A;  2Z9S A;  2H1D A;  5G31 A;  1WIK A;  2YP6 A;  5JWQ B;  3FHK A;  4EC0 A;  3GNJ A;  1GL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...