4WXWA

Sadc (323-487) from pseudomonas aeruginosa pao1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
VATDELTGLFNRRHFMRMASRALEDLLPNRQHGLALIDLDHFKRINDRHGHAAGDRVLQTFAAVARSCLRDGDVLARYGGEEFVLLLPHADAEQLESCCERLRLAFQQAEPVGVTVDTLSLSVGMTLLYADDDLDEALQRADQALYRAKRGGRNRCDATWEVTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of SadC (323-487) from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase
molecule keywords Uncharacterized protein
total genus 56
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wxwA00
4JV1A 4MFBA 3TVKA 1K1QA 4F4WA 2YNFA 1JLGA 1RYRA 4QPXA 2IAJB 4URQU 1JLBA 1RT5A 3BSAA 4WFZA 4KB7A 4WFYA 5C5JA 1S6PB 3ITHB 3JYTB 3FQKA 3KHHA 3GV5B 2WRMA 2FVQA 2I1RA 4ED8A 2FJVA 2YNIA 3M8QA 1HQUB 3PW0A 4KO0B 2W9CA 4KFBA 5I3UA 1T03A 3BGRB 2HMIB 5KFBA 3KLGA 5KG2A 2YKNA 1BQNA 4DL7A 1HYSB 2R2UA 1HNIA 2D41A 3T5LA 2YNGA 3G6YA 5KFIA 4ECVA 1BQMB 1TL3A 4IFYB 2V4QA 3IN5A 5J2PB 3H98A 3IRXB 4TY9A 3KHLA 1T03B 1I6JA 3MEEB 4IH5A 5KT2A 2YNIB 3FQLA 3SFUA 2R8JA 5KFCA 3MFHA 1TVRA 2BRLA 1CSJA 3V6KA 4ID5A 2D3ZA 1JLGB 3CJ0A 2FJWA 1UWBA 3DRSB 3KLIA 2R8GA 2IBKA 4MFBB 1HPZA 1UWBB 3QLHB 3EPGA 3D5MA 3HVTA 4RW9B 1LWEA 1TKXB 4ID5B 1TL1B 3DLEA 3DDKA 3RAQA 3LP0B 1S97A 2GIQA 3CJ4A 5F8HA 4NCGA 1IKXB 4JV0A 4WE1B 4TXSA 2C28A 4TY8B 1BQMA 4IFYA 4R8UB 4O3OA 2AGPA 1HNVA 4H4OA 4O4RA 1JLAA 1RT4A 5DQIA 4J9QA 3V4IA 1C1BA 5HLFB 1TL3B 1DTQA 2B5JB 3BGRA 2IM0A 4IOBA 5F8IA 1KLMB 1JLEA 1JLFA 1HNIB 2XI2A 3PHEA 2R8HA 1SH2A 3PZPA 2XGPA 3KMQA 4PQUB 3MEGA 4Y2CA 3KNAA 1C1CB 3DRPB 3KLGB 2BANA 3DI6A 2R8IA 4F50A 3BSNA 5T14A 4O3RA 3DMJB 1JLBB 1RT5B 2JC1A 4MIBA 3KLFA 1S0NA 1TQLA 3IGVA 4NLUA 2E9TA 4B3OB 3E51A 1HQEB 3G86A 2WHOA 3ITHA 4MK8A 3NGDA 1T05B 3CJ5A 1QE1A 4NLVA 2UUTA 4RNHA 4DEZA 1YVFA 4ICLA 1TL1A 3DLEB 3KK2B 3FSIA 2W9BA 4LQ3A 4NLTA 1LWEB 3RB4A 1REVB 1KHWA 3H40A 3V81A 3LP1B 3N6NA 1HPZB 5KG6A 3KLIB 3DLGB 3I0RB 5KT4A 1N5YB 3OL9A 4MH8A 1S1VA 3QGHA 5KFEA 3BQ2A 4Q8FA 1HARA 4TYBA 4J9LA 2V9WA 2OPQA 4KBIA 4MIAA 4ECQA 4WZQA 2ZE2A 4ED7A 4J9KA 1ZTWA 1S0OA 3OLAA 5KFNA 1DTTA 3T5KA 2JLEA 2HNZA 1S1XA 2VG7B 4QW9A 1C2PA 1JLQA 1NHUA 4I2QB 5DGBA 1RT6A 4QWEA 4ED0A 2AQ4A 4WXOA 2YKNB 3GYNA 3NBPB 1LWCB 4NLPA 4KSEB 3QGGA 4KFBB 2HWIA 1TV6A 4O44A 5I3UB 4WYWA 2IM2A 5CYMB 3BQ0A 3MEDA 3PW7A 2OPPA 1S6PA 1S9FA 2XGQA 5KFRA 1S6QB 4ZVHA 3DOLB 1TV6B 2IAJA 4ZMMA 2UVUA 3FFIA 5KFGA 2D7SA 4RNMA 3ISNC 2VA2A 1C0TB 3UDLA 3LP2B 4ZP8A 5EWFA 3QIPB 2DPIA 4M94A 4IFVB 1LW2A 1S9EA 1RT2A 4PUOA 5J2QB 1JLQB 5KFWA 1MMLA 1T94A 5DGAA 2IM3A 4ZVGA 1RT1A 1ZTTA 4Q43A 5L1IA 4IKAA 3PJXA 3OSNA 2ASJA 2AGOA 4H54A 2HNDA 3I0SA 4O4GA 4RW7B 1RTDB 3FDSA 3N6MA 4M95A 1MU2A 2YNHB 5FDLA 2E9ZA 4J9NA 4NRUA 1FKPA 1QUVA 3V6JA 5KT5A 3CDEA 2F8EX 4EBEA 2FJXA 2RF2A 5F9NA 5J1EB 1RT1B 1OS5A 1RT3A 5KG7A 4YR3A 3QYYA 1REVA 5K14B 3BQ1A 1RDRA 4EYIB 4GC6A 4RW8B 4ECZA 4ED3A 2UVVA 3H5UA 1TKTB 3QZ8A 5KT3A 4IR1A 4H4MA 4IRKA 3GIKA 5F9LA 3H4BA 4U6PA 4IDKB 1LW0A 1XR6A 2IJFA 3LANA 3QIDA 2IC3A 4EBDA 2VG6B 2BANB 3CWJA 5KFHA 5EWEA 1JIHA 5C42A 3KJVA 3MEGB 4I2PA 4NLRA 4PQUA 1RTIB 3I5BA 1SH0A 1KLMA 4O44B 1IKWA 3TQ1A 5D3GA 4Q8EA 5HLFA 5DQHA 2HNYA 1RT4B 2JC0A 3V4IB 4NZ0A 3NL0A 1S1TA 3HVAA 4TY8A 1N6QB 1FKOA 3BJYA 2CKWA 5L1KA 3GIMA 4NCGB 1ZETA 1R0AA 3HHKA 2OPQB 3LP0A 2FVPA 1Z4UA 4NLYA 1K1SA 3DLKB 3MECB 1S1VB 2B6AA 2BRKA 4URSA 4J9PA 2JEFA 5EWGA 4ZPBA 3M9OB 3G6XA 4KHRA 4F4ZA 5DQGA 2JEIA 3E01A 2HWHA 5L1JA 1S9GB 3V81B 4K4UA 1RA7A 3H5SA 4RUCA 3EPIA 1S49A 1TKZA 4ZVFA 2XI3A 3MECA 3V6DA 4PWDB 3LALA 5HP1A 1EETA 5KFXA 2JEGA 4XO0A 2BE2A 4QW8A 3I5CA 2XC9A 1RT7A 3OL7A 1VRUA 4Q44A 3KLVA 1QAIA 5J2PA 1U09A 3PR4A 1J5OA 3KHRA 2VA3A 1C1CA 3DRPA 5EUHA 4IG3A 2RDJA 5KFQA 1BQNB 2EC0A 2GC8A 1RAJA 1S1WA 1JLCB 4KO0A 2W9CB 4H4OB 2XCAA 4ED2A 2RDIA 2AWZA 4YMEA 3BSOA 2FVRA 3KOAA 3KK3B 5I42A 3JSMB 3GIJA 3KJVB 1J5OB 4ECRA 1FK9A 3OL6A 4NLDA 2IC3B 4LQ9A 5DG7A 3KLEA 4IDKA 2BQRA 3BR9A 4G1QA 4IQXA 2YNFB 4EYHB 4ED1A 5J2NA 2D3UA 4G3IA 4R5PB 1S48A 4WXWA 2R2SA 5KG4A 4J9OA 3RB6A 3QLHA 1S0MA 1SV5B 3E01B 1XR5A 2VG5A 3DRSA 4J9RA 1FKPB 5HBMA 2XCPA 4RNOA 3C6TA 1RYSA 1EP4B 2FLNA 3QZ7A 1JKHA 4TYAA 3UQSA 3CJ2A 3SFGA 2B43A 4LSLB 1IM4A 4K4WA 4ECUA 3I0RA 3CO9A 4ZP9A 4IG0B 1RTJB 4PUOB 4K50A 1SH3A 5C25B 1HYSA 2QE5A 3GV8B 5J2MA 2C2EA 1JX4A 3FFIB 4IH6A 2I5JA 5KT6A 2YKMA 2OH2A 4Q0BA 1RTIA 1HQUA 1W25A 2WCXA 4NLSA 3OHBA 3MR2A 1S1UA 4KHMA 3MR3A 4MKAA 2FVCA 2RKIA 3Q8RB 4TQSA 4QWAA 3C6UB 2OPRB 3IG1B 2UVWA 4RZRA 4QWBA 2UVRA 4RW4A 4O3PA 2AU0A 1DLOA 3QO9B 4GC7A 4I2QA 2J6SA 2WK4A 4RNFA 3KHGA 4NLGA 5KFJA 5J1EA 1JXLA 2AX1A 4ECXA 2AX0A 3KLHA 4NLQA 3VQSA 4U7CA 4IRCA 1SUQA 3NKYA 4RUAA 3I0SB 1RTDA 1SUQB 1RTHB 3LAMA 4YQWA 2AGQA 3DYAA 3DRRA 3PR5B 1DLOB 3QO9A 4IRDA 3DM2B 1KHVA 4DL4A 4DL6A 4IH7A 4O3SA 2OPSB 5CYQB 3KK2A 2W9BB 1LW2B 1S9EB 3PJWA 4RW4B 3BREA 4FS2A 2FLLA 3QIPA 2IMWP 3NMAA 4LSNB 4I7FB 4WFXA 4B3OA 1IKVB 5EDWA 5F8MA 3OHAA 3IS9B 4EO8A 2WOMB 4NRTA 5KG3A 3IGNA 2W8KA 5I42B 3KK3A 4K4SA 5C25A 4O3NA 1JLFB 1JLEB 2ATLA 2OPSA 2I5JB 5CYQA 1DTQB 2B5JA 2WTFA 4RW6A 4Q45A 4ECYA 1JLAB 3OL8A 3CDWA 2V4RA 1HNVB 4ECSA 5F8NA 4IG0A 4ZP6A 3H5XA 4DL5A 1EP4A 4YP3A 4LSLA 5KG0A 3C6TB 3G6VA 2R2TA 2ZE2B 3KLHB 4ZP7A 5HP1B 1RA6A 3DOKB 5JUMA 3PVXA 2ASDA 4KKOB 3Q8QB 4K4TA 4ED6A 3MFIA 4K4XA 4MK9A 2OPRA 3IG1A 4RU9A 2C22A 1S10A 5KFAA 3RBEA 1LWFA 2RKIB 4NLWA 5KFPA 1WNEA 4JUZA 5L1LA 4K4VA 1HMVB 1FK9B 1GX5A 4MK7A 1R0AB 1HQEA 1T05A 3MF5A 4G1QB 3D28A 5KG5A 3DMJA 3H2LA 3MEEA 2WONA 2YKMB 4EEYA 3MR6A 1FKOB 3OLBA 5KFMA 4IR9A 4YR2A 3JSMA 5J2MB 1S1TB 3BSCA 3KMSA 3PW2A 2R2RA 2FVSA 4OL8A 5KFSA 3TAMA 2HNYB 1RTJA 1S1WB 2HAIA 3Q8PB 1IKWB 3V6HA 2ILYA 3M8QB 3H59A 4Y34A 4ZPDA 4I2PB 4NLOA 4R8UA 4TLRA 5C42B 4XPCA 2VG6A 3JYTA 1JKHB 1VRUB 1IKYA 1T3NA 3H4DA 1HMVA 1RT7B 2ASLA 1IKXA 3RB0A 4K4YA 3CIZA 5HBMB 4DL3A 3FRZA 2J6UA 1N56A 5F8JA 1EETB 3T1AA 3V6DB 3DOKA 1S4FA 1TKZB 4PWDA 5K14A 3DLKA 1S9GA 3ICLA 5DG8A 1D0EA 3N6LA 5KFFA 5J2NB 5DLFA 3HVWA 4ZVEA 4DL2A 3KLEB 3UPFA 4WYLA 4KE5A 1IKYB 1TVRB 3RAXA 3NAHA 4F4XA 5F8GA 2J6TA 3M9NB 5HROA 2C2RA 2W9AA 1JLCA 3IRXA 4RW6B 5D3GB 2XWYA 2YNGB 5L9XA 1RT2B 3CVKA 2JEJA 3TAMB 4IFVA 4IG3B 2ILZA 3LP2A 2IA6A 3PW4A 4FBUA 2HMIA 2W7PA 2WONB 3CJ3A 3DOLA 3IS9A 3CDUA 1IKVA 1LW0B 2OPPB 5KFKA 2BE2B 4LSNA 5CYMA 3QGIA 4H4MB 1LWFB 4MKBA 3HKWA 4RW8A 4ECTA 4KV8A 3NBPA 3H5YA 2BQUA 4K4ZA 3ISND 2GIRA 3M8PA 4EBCA 4QWDA 3DM2A 4KKOA 1RT6B 1VRTB 4F4YA 5C24B 3DYAB 4TN2A 4EO6A 2B6AB 4ZPCA 2WB4A 5KFOA 1RT3B 4ZHRA 5DLGA 2HNZB 3MTKA 1D1UA 2IM1A 4DG1B 1NHVA 4JV2A 2BR0A 2V0NA 2UUWA 2R8KA 1GX6A 2ZD1A 1N48A 2IJNA 4DG1A 2FLPA 1MU2B 2YNHA 3LAKA 5FDLB 2W8LA 2BQ3A 3MR5A 4NYZA 2HNDB 5KFUA 4ZHRB 4HKQA 2QV6A 2W7OA 5KFDA 1N6QA 5C24A 5J2QA 3PW5A 1VRTA 3GQCA 2ZKUA 3M8PB 4RNNA 4YR0A 3RBDA 3C6UA 5KFYA 4KV8B 5KFLA 4ICLB 3GILA 2ALZA 1QE1B 4O3QA 4QWCA 1XR7A 4J9MA 4FBTA 3UR0A 1C0UA 1C0TA 1S1UB 4TQRA 4FS1A 3KK1B 3MEDB 5KT7A 3OSPA 3KLFB 3M9MB 1S6QA 2WOMA 5KFZA 4J9SA 3DI6B 4Q0BB 3KK1A 3T5HA 1LWCA 4R0EA 4I7FA 3GIIA 1C0UB 4NLXA 3RB3A 4ZPAA 1N4LA 1TKTA 4KAIA 5JXSA 5KG1A 4XPEA 4Y2AA 4HYKA 4Y3CA 1C1BB 3NAIA 5F8LA 1S1XB 2VG7A 5HROB 4X2BA 1TP7A 3T19A 2RF2B 5KFVA 4ECWA 3DRRB 4WZMA 1RTHA 4WE1A 3EZUA 4O4GB 4RW7A 1NNDA 2DPJA 2E9RX 3SI8A 1DTTB 3T5JA 2ZD1B 1N5YA 5DG9A 4URGA 3DLGA 2C2DA 5KFTA 2VG5B 3GV7B 3I5AA 1SV5A 3LP1A 2CJQA 1TKXA 3HVTB 4RW9A 1QAJA 2O5DA 4R5PA 3Q8SB
chains in the Genus database with same CATH superfamily
1G6BA 1ZA2B 2AJQA 4F2RA 2Z4PA 2YNFA 1JLGA 1RYRA 2K1RB 2OFGX 5CHCB 2RQMA 2EI5A 4URQU 3OQ2A 2HK2A 2XSJB 2MDAA 4P74A 3BSAA 1NJZA 1YGYA 4KB7A 1S6PB 4HTIA 1R0CB 5BXIA 3MUTP 4QZVB 1RB0A 3FEYB 3GV5B 4DV3J 2OGUA 2YWFA 3AA9A 4GVBB 4KYZA 3BGRB 4J91A 3OVSA 1CVJA 1L3VA 1QVFR 3BS9A 3K2YA 4NZ6A 3CSKA 3HSZA 3D1OA 4RKUC 2D74B 4ECVA 3T5JA 3T5LA 1AFJA 4X62F 4A8WA 4JV5F 4LIWA 3H98A 3KHLA 4HHHA 4DR1F 3S1TA 3SYZA 1I6JA 2OJ3A 4M5LA 1ZM9A 1I5OB 2MKYA 2JEJA 5H9EJ 5KFCA 3MFHA 1EQ0A 1YJ7A 2BRLA 1VOMA 3VGSA 3W60A 2VODA 5B0BA 3Q24A 1H7WA 2BW7A 1BXNA 4Z37A 2QLFB 4RWWA 4E98A 3K0JA 2DGVA 3MMCB 3KLIA 3TEGA 2LQJA 4ELUA 1UWBB 4JI4J 1V3ZA 1Q8IA 3UDCA 3SZ2A 1Y9OA 2NCKL 3DDKA 2K8GA 3LP0B 1FEHA 2PMZD 5DZ7A 5F8HA 4ELTA 1Q8BA 1XNRJ 3K59A 2EFQA 1KLNA 3CD6S 2C28A 4IFYA 4KGXB 4R8UB 1AA1B 1WJ9A 1RTZA 1VISA 3U1LA 3PX6A 4X4NA 1CEZA 3CJ8A 4CNZA 2DGUA 4OYPA 5HMXA 1DTQA 4Y2MA 4IOBA 3UVJB 4DF8A 2HHQA 3PZPA 4RPFA 2HQIA 5CZXA 3OVAA 2AYBA 3MEGA 2PC6A 3L9ZA 3KNAA 4USMA 4N5SA 3KYLA 2KZMA 2CXEA 3W8GA 3LWLA 4I0WA 1R27B 2PA8D 3DI6A 5LM7E 3AA8A 3SDEA 3QGPA 3JSRA 4DN0A 1S0NA 4WPAA 1TQLA 4OZJA 5D77A 3PX0A 3E51A 2WHOA 1TMMA 2BEFA 4NLVA 3FSIA 1YVFA 4LQ3A 4ZVOB 2KFZA 2V2ZA 1UFLA 2DY1A 4G1IA 1REVB 3HP6A 3TW0A 1D3WA 4UY8T 3LP1B 3N6NA 3FCWA 1HPZB 1RWVB 1SKUB 4PABA 1FERA 4NE9C 2OLWA 3D6MB 4ANEA 2HBYB 1VC0A 3OL9A 3BQ2A 3BR8A 4TYBA 3VVUA 4J9LA 1CJKA 3SEOA 3G82A 1S77D 4OZ5A 1VIOA 5CH7B 1NUEA 4B17A 4ECQA 4WZQA 4ED7A 4ERDA 4CLFA 2APOA 2Z57B 3QWPA 2XO6A 1S1XA 3OFHA 3NOCA 1C2PA 2CQBA 2OMOA 5D4LA 1VQPS 1JLQA 3ENAA 1NHUA 2JWNA 2ZEJA 3PKMA 1D9FA 3I82A 2EFVA 1TZ0A 2C2ZB 2JH3A 2YKNB 4NLPA 1BWEA 1YBUA 1YITS 1NK9A 2HWIA 1A0OB 1VQSA 4WYWA 1MROA 1U1OA 4Y0FA 4WFAQ 1FXLA 1R6VA 3MEDA 2QJ3A 2J8SA 1S6PA 3T3FA 4W98A 3ZO7A 1R89A 2E44A 1RHRB 2HPUA 3DOLB 4ZMMA 1ZM2A 3HT0A 2CPJA 1IQTA 2K1RA 3ISNC 1PJ5A 2VA2A 4BCAA 2CZVC 2G1HA 1OWXA 1KQGB 2WBRA 4ZP8A 4DV0J 2DPIA 1S9EA 3RBXA 2EK6A 1JLQB 1Q8LA 2XB2D 1J5EF 1RKJA 1VQ8S 2KRRA 2QA4G 1RT1A 2EFPA 3HPOA 4ZVSB 2QT7A 2O3DA 3HMJG 2PFFB 4YY3J 1D8ZA 5KOWA 2QEXS 2SXLA 2ASJA 4H54A 1RTDB 8ATCB 3FDSA 3N6MA 3A4TA 5FDLA 2NREA 2DD8S 5H9EK 2IMOA 4F0HA 1EKSA 1TMJA 4J9NA 2IY5B 5KT5A 4B9VA 2F8EX 5J1EB 5ETVA 3CPWR 2EXUA 4MTPA 1REVA 4EYIB 2OELA 4DU7A 3GCXP 1J27A 1TAUA 1LNQA 1RHUB 2DK2A 3H5UA 5KT3A 3MM5B 2K7KA 2VH7A 2ZDOA 5A8KA 4U6PA 1ZBTA 2NXUA 1LW0A 1XR6A 2XULA 4IDKB 3ZTOA 4AFFA 3QIDA 1YRUA 1ULRA 3D0IE 1FVQA 5EWEA 2BANB 2DBBA 1JIHA 3PFEA 3KJVA 4OI4A 2JNJA 2KXNB 3BO4A 4DDFA 3MCMA 1RADB 1S57A 3I5BA 4WF9Q 2DO4A 2F63A 3L7OA 1IKWA 3QPIA 1JJCB 4BWMA 4Q8EA 2AF6A 5IOLA 4F3OA 2ZM6F 2XLJA 2UXCF 2QMWA 1ZAWA 1DAXA 2HURA 4NI2B 1PG5B 1E6VB 4DMZA 1S7IA 2CKWA 1WSRA 3R27A 5L1KA 2H48B 1C4CA 1X8DA 2JLGA 2F4VF 2EFOA 2IHR1 2G9OA 4NCGB 4ALZA 5L9NA 3C2PA 1X9SA 2MEWA 3D54A 3OFGA 2HRUA 2VFSA 5EGYA 3G9CA 4DQIA 7FD1A 1PYOB 1K1SA 3DLKB 1KQFB 1YBTA 4J9PA 2ZH9A 4C0OC 4LF2A 2NPIA 1H73A 2WSCC 4KHRA 4CZCA 5DQGA 3BB5A 3M9OB 4F4ZA 1SQGA 2YWGA 5L1JA 2KYXA 3FVYA 2YQ0A 1OMSA 2J9DA 2Z2LA 3H5SA 2DEJA 4P9SA 4RUCA 3MECA 4JYAF 3V6DA 3LALA 2JEGA 1RAOA 4QU7A 2GO8A 3P8BB 3R1LA 4PG8A 4C8NA 1BMQB 3I5CA 4NA3A 1QAXA 1YJWS 1QAIA 1VFJA 1R8AA 2I9SA 2KJWA 2MY8A 1J5OA 4CCHA 4P75A 3KHRA 1Q7YT 1J2VA 1C1CA 3W5XA 3W2WB 4C9DA 2RDJA 1SL2A 3J7A1 4DLEA 2E1MC 3PFOA 3DU6A 1M90T 5GMEA 3S6EA 1RAGB 2KFYA 1RAJA 1S1WA 2F65A 4IO1A 1B4SA 4H4OB 3DGVA 5EHHA 2RDIA 2ZNZA 4YMEA 2XCAA 4C3KA 2CJBA 2XY5A 3KOAA 3LWMA 2DXFA 2P6SA 1J5OB 1B99A 1XN9A 4TNOA 3OL6A 2RIJA 2IC3B 3NWGA 4NLDA 5DG7A 3GE9A 2CVEA 2YNFB 2VF3A 5J2NA 2D3UA 3NCQA 4DR7J 3TA1A 2B9YA 1A7GE 2ZHAA 2CQ4A 3VGVA 3JB9k 4HLBA 4TU9A 4J9OA 1V3SA 2GAGC 1CG2A 3QLHA 1OY8A 1XR5A 4NYPA 4QJVA 5F41A 1FKPB 3HFZB 4V1Ak 2WVCA 5HBMA 2XCPA 4MYTA 1UZHA 4OJ3A 3KFWX 3SQGB 1PAUB 1SPBP 3QZ7A 1YI2S 2FLOA 5DJBA 3GSIA 1WEYA 1VMBA 1BHNA 2V6AA 3EGWB 4ECUA 2QSWA 4ZP9A 4A8YA 4PUOB 2UZAA 3ISZA 1HYSA 3MM9A 2PD1A 5A8RB 2C2EA 1QSSA 4LF4J 2G2YA 3Q8YA 3MPUB 5SUHA 4ER8A 1LKZA 2I5JA 5KT6A 2YKMA 3EVOA 2UUCJ 2OH2A 3VF0B 1W25A 2WCXA 5K5MA 3A3OB 2CQPA 2VBYA 3R8YA 3CJQA 5HVHA 2HEKA 2ZH4A 3ETMA 3N0VA 4KHMA 1FXRA 4K7QA 4PG5A 4ZJQA 2XNQA 2EKNA 3M2RB 5E2QA 3IWNC 2DCLA 3Q8RB 2BX6A 1PCAA 5F3ZA 1AUDA 2QL9B 4QWAA 4ZVTB 3C6UB 3O8WA 5A8KB 2UUAJ 4RZRA 3CCUS 3C14A 2R42A 3CT9A 2XHCA 5T41A 2VL1A 2AJFE 2X1AA 2BYCA 1EB0A 3M32B 3QT7A 3R5JB 1DRZA 1X4BA 4OX9F 4ZIVA 4RNFA 4IOCQ 4X65J 1TKDA 1CJTB 4NLGA 3HO1A 1SJRA 4ECXA 4A48A 1XNQF 4YB5A 1T3OA 1Y00A 3VQSA 4WKRA 1FJGF 2AZ3A 2VBXA 3MR7A 3KG1A 1HWJA 4A8XA 2YH0A 5B0FA 1SUQB 2DNKA 1SCJB 3UN2A 2B9EA 2LP4A 3W9IA 4F7VA 4YQWA 4AQYF 3M32A 4PQAA 3PR5B 4LF7J 1UVJA 3KJFB 1VBKA 1YLXA 4HHJA 1KHVA 1OSDA 2DIVA 1QAJA 1X4GA 2LQ9A 3D9BA 4NCBA 2ZVIA 3THTA 2XS5A 2DYAA 4DN9A 2HHUA 4RW4B 4FS2A 1NSQA 1U47A 3K17A 3P3DA 2IMWP 4LSNB 3QSYB 4HL9A 4B3OA 3IS9B 3R5CA 3HSJA 1RISA 2LEBA 1HWKA 1DHMA 5KG3A 2UP1A 4HR2A 2B4PA 3NNAA 2J9DE 4ELVA 3Q2TC 4E8UA 3AOCA 2ABYA 2YY3A 3DLBA 1RHQB 1L3UA 4Q45A 1PJ7A 1NO8A 2V4RA 4EZ9A 5F8NA 4IG0A 3TRGA 1M5OC 1I94J 1FWKA 2X7IA 3AJDA 4DL5A 3M8SA 4YP3A 4PWUA 4WP9A 4KTQA 1VQKS 3D3BJ 4UZBA 1Q16B 4F4AA 1WWHA 1W26A 2EG1A 3M30B 4X4TA 1ZOTA 4ZCIA 1QSLA 1KONA 3AD8C 1RA6A 3DOKB 1WG4A 2KG1A 2AV5A 2YQ3A 1Q82T 4QQBA 2Z8QA 3FZ2A 2M88A 3MCNA 4WK3A 3R5DA 4GKJJ 1WNEA 2A2CA 4NLWA 3CTRA 3K5LA 1HMVB 1FK9B 1GX5A 4MK7A 2HFVA 1IWGA 3R97A 1AXQA 3OR2B 3DMJA 4B9LA 3H2LA 4JV5J 2WONA 4EEYA 3MR6A 1FRKA 2RNEA 3MAAB 4L75A 5J2MB 3KMSA 4NL5A 3PW2A 2VB6A 4ETXA 3HHLB 5HVGA 1BD6A 5KOXA 2XMUA 2R7TA 1YRXA 2HFOA 1XERA 1NMEB 1X4EA 2J9CA 3KWMA 2XM3A 3Q8PB 4P2SA 1RGVA 2LLZA 2XMVA 3FK4A 2ILYA 3RYLA 5A6PA 2IRUA 4ZPDA 1LFWA 1U26A 4DSJA 3B78A 3DHWC 2QTWA 4CLKA 4XPCA 1JKHB 2MKCA 4P72A 3MUMP 1T3NA 1GTHA 1UWAA 4DR5J 3NS5A 1Q86T 4K4YA 1KEKA 3FRZA 3QQCD 1N54B 3BKTA 2VQEJ 2J6UA 1VQMS 3L09A 1EETB 5LJ3Y 4KH1B 1NK7A 3FZBA 1BUXA 1Q5VA 1IR1A 1S4FA 2DR5A 1T9WA 2CWXA 1PIEA 3KG4A 4ZVRB 5H9FJ 4A4JA 5DG8A 2QA1A 1D0EA 1ZAXA 3NMRA 5J2NB 5ITHA 4ZIWA 1MMDA 1PKUA 1NHKL 2B7CB 3C15B 3CD0A 5AXMA 2VOOA 3UPFA 4JYAJ 4KE5A 4B9SA 4JOUA 1B3TA 2GS8A 3M2VA 4HT5A 4DV1F 4F4XA 2DXDA 2BJ3A 5DRKA 5E3RA 2XO7A 1F5AA 1RWOB 2M7SA 2HVIA 1TL7A 1B0PA 3R5GA 2QO3A 4NXMF 4L76A 4RW6B 1G1XA 5AJ3J 4OZ2A 3VZHA 3OJSA 4DV5F 3D66A 1QTMA 2COLA 2V34A 3TAMB 4IFVA 1YK9A 4IG3B 4USVA 4FBUA 2W2NP 1NAQA 1FTRA 4FYVB 4ZVUB 4FNIA 2YX7A 1YJVA 2GHVC 3DOLA 1PC4A 4JB8B 3OFEA 3K5MA 1VJQA 1LW0B 2GJFA 1FHTA 5KFKA 3DOMB 2WVEA 4YFUA 3QGIA 2R7OA 4J37A 2Y1JA 4XTTA 4JI2J 1ROFA 1LWFB 3GJRB 4ECTA 3NNHA 3EGVA 4K4ZA 2W4CA 2GIRA 3K57A 2GMHA 2H5IB 1OQ6A 2V2KA 3CIMA 4C0BA 4QWDA 4KKOA 5IT9U 1X4AA 2Z58B 4DHVA 4F4YA 2RE1A 1WHVA 3DYAB 3LA0A 1CLFA 1V6HA 1NH7A 1RT3B 1TAQA 4KGMA 3W5ZA 1HW8A 5DLGA 1KVJA 1T02A 1NHVA 3N5FA 2R8KA 2ZD1A 1N48A 4DQQA 4GO7X 2ZOFA 3DRYA 2BQ3A 5IT9Y 3MR5A 1RWNB 2HNDB 2QLWA 5KFUA 3PV8A 1CQMA 4N41A 2ZH2A 1O8BA 2W7OA 2ZJRQ 3VAHA 3DHXA 5GAGI 1NJXA 3WDOA 4NCAA 3M2UA 3QRRA 3CJRA 3M8YA 4FZVA 3C3LA 2EBEA 3CJKB 2ZKUA 3U1MA 2D3OR 4AE5A 2KM8B 5HJYA 2GVDB 5KFLA 4U7UD 2ALZA 2Y3YA 1IR0A 3BYRA 4J9MA 1RWPB 3UR0A 1JMTA 4DWIA 2GFFA 2PA3A 2KHDA 3MEDB 1R7IA 4LREA 2KM8C 1S6QA 3FEXB 2ZOGA 2QLXA 4S0MA 3RAMA 3Q83A 2BW2A 3DI6B 1KQKA 4P73A 2GZOA 4EI2A 1FVSA 2E5HA 2Z2MA 2ZH6A 4NLXA 3MM8A 4PXDA 1U45A 5LMUJ 1VCTA 5JXSA 1MMNA 3TEHB 4XPEA 4Y3CA 4JI1J 1T9VA 2QG9B 5F8LA 1H38A 2WSFC 2YVSA 1NU4A 3MTJA 5IWAJ 4G6VB 3DRRB 3IM8A 3TVYA 3IBWA 4WZMA 1WG5A 3R7NB 3K5OA 2E9RX 3K5PA 3SI8A 1DTTB 1R43A 3O2IA 1UEVA 4L73A 1GAOA 5CXTA 2BMBA 1XWLA 1FJEB 3T1YJ 1D8YA 4M5DA 4ZOSA 1SV5A 3LP1A 4OYZA 2VC0A 2HHHJ 3M6XA 1HR0F 1UKUA 3I0RA 4Z7CA 1X5OA 2V8GA 2DO0A 4R5PA 4MFBA 3J81Y 3J81U 2EG2A 2MQNA 1XIQA 4DFJA 2FYXA 1R8HA 4NPOA 3WX8A 3F56A 1H72C 2MQQA 1JLBA 4YS2A 4J90A 3EZOA 4ZVQB 5F0UA 1D9AA 3ITHB 1NB7A 5D0HA 4M5NA 5E3QA 3BPDA 1K73T 2FVQA 3NCRA 2LVWA 1S7HA 2FJEB 1HQUB 3TJ8A 2QFJA 1MG7A 4TKTA 5KFBA 3KLGA 1LOUA 5IQQA 5E33A 2GAHC 2YKNA 4LRCA 5HL7Q 5KG2A 1Y11A 2MQLA 5KFIA 3MAAA 3MDFA 1TL3A 1NBEB 4IFYB 3JS9A 5K8MA 3IN5A 2LEPA 2HS3A 4TY9A 1ITPA 2V69A 3BBCA 3MEEB 2DNMA 1FEEA 3R6GB 3SFUA 4C98A 1DARA 3Q86A 4HACB 2QX0A 4ZPWR 2UU9F 1KSPA 1OJ4A 1TVRA 1NJWA 2QSFA 4P10A 4G1PA 4FXDA 1A9NB 3TNVA 1CJKB 1CSJA 1E6YB 1WF1A 2RQ4A 1WC3A 2H3EB 1GMWA 2NLWA 1JLGB 3TOQA 1JWWA 2FJWA 3GCWP 1UWBA 4DPOA 2V4JB 1U02A 2R8GA 1CQNA 1HPZA 1WDDA 2BJ7A 2A1BA 3WZ0A 1EQMA 3NWRA 3IBFB 2DNYA 4U8VA 4EMDA 2CPHA 1MN9A 4NASA 4CLTA 2W2PP 1U1LA 3CJ4A 5IV3A 1S97A 2GVZB 1FNMA 2A2DA 1D09B 5IFMA 2ZBRA 4X84A 2RT3A 3PKYA 1CULB 1MWYA 4JV0A 4WE1B 2UUAF 1NKEA 2AJ0A 2E1PA 2ZITA 3PRDA 1C4AA 4TY8B 3LPYA 2E5LF 3PO5A 4DQPA 3T1HF 2GGPB 3HI9A 2K06A 1OPZA 1HNVA 3FCVA 5ETNA 4O4RA 4HH0A 2DH9A 5DQIA 2AGPA 1K9MT 2BKPA 2P9GA 1CJVB 3BGRA 4HH1A 1YJUA 3MD1A 1HNIB 2XI2A 4PQUB 2EEYA 2H4WB 2R4FA 2XGPA 4YHHF 4YDXA 3DRPB 1H74A 4ZCKA 1F2HA 2M52A 4PG6A 1GXTA 2FC9A 3BSNA 1N5SA 5T14A 2Y1IA 3DMJB 1JLBB 2LXIA 4MIBA 4PXCA 2XMAA 3KLFA 1EIYB 2DGSA 4NLUA 4B3OB 2DNZA 2MXYA 3NGDA 1ZA1B 2J9EA 2XLIA 4OI3A 2EVZA 2RS8A 4DEZA 3ZTQA 2MGZA 3CCMS 3EGZA 2QL5B 1H7XA 3N9UC 1F3VA 1LWEB 3KUHA 3RB4A 4LF8J 3H40A 2K3KA 3ZFVA 4AYBD 3VAFA 3V81A 4LSZB 3KLIB 1HBOB 3DLGB 5KAKA 2HS4A 2XZWA 4W4MA 2QYCA 5K20B 1UW4A 1QDUB 3LF0A 4UT4A 4Q8FA 1B0VA 1HARA 3OT9A 2ZZMA 3BN7A 1FRJA 4ITSA 3ENQA 5L8RC 2OPQA 3R7SB 2DR7A 3W64A 1KOHA 1H6KX 2UUBF 2R7VA 1ZTWA 3CGIA 1IWAA 2FTRA 2B4OA 2OP5A 1R6YA 5HVFA 3OLAA 1S0OA 2HNZA 2ZC3A 2E5LJ 2MZ1A 2ASYA 4DV6J 1B7YB 4DR6F 1JNRB 5CAAA 4ATNA 4HDGA 3B54A 3GYNA 5DZ6A 4M5MA 1F60B 3EXCX 3QGGA 4GVBA 6FDRA 2FJBB 2C3UA 1FT8A 2BJ8A 4R25A 4DV5J 2NXNA 5CYMB 3M05A 2AHOB 1UA1A 3RRHA 3J81j 3C16B 5KFRA 1SC6A 2LKZA 2WVDA 4KRWA 4LR7A 1TV6B 1HHTP 1WSVA 3FUYA 4X65F 1WOSA 2M70A 4ID8A 1K8AT 1C0TB 4ZPTR 5CD4A 3I87A 3JSBA 3AOAA 2E7WA 2V8DA 1RLDA 4QR0A 4PUOA 4CO0A 1FFSB 3CCJS 1T94A 3D4JA 1URRA 5E41A 5A8WB 3BDPA 2LECA 2CA9A 2Y0SD 4YN3B 5J1PA 2FGOA 1ZTTA 4IKAA 2E1AA 2EKYA 2C3OA 2LQBA 1FO1A 2CJXB 3FMBA 3P45B 4O23A 2ZBCA 4WP8A 1OY6A 3V4MA 4RW7B 5JVGQ 3CNQP 3BDEA 3JSYA 1NSKL 4OLPA 2E9ZA 1VLOA 4NRUA 1FKPA 4CLYA 4QYZK 2IVMA 3P49B 3CCVS 1T95A 1SC4B 1BLUA 1HFEL 2L9DA 3ADAC 4FP9A 4ED3A 4X64J 1RLCL 4RU2A 3MUVP 2BVZA 1G2EA 3GJTB 4DV2F 2VC1A 2MLXA 4IRKA 5F0WA 3GIKA 5A2QU 4FPRA 3H4BA 4KPCA 2FDNA 2C1EB 2H5JB 1GTEA 4K2JA 2MSSA 1LXNA 1S72S 1IBKJ 1UEUA 1Q53A 2BE7D 1RAFB 2VG6B 3CWJA 5KFHA 2BBEA 5C42A 2MKHA 2U1AA 3LPEA 4JI3F 4FDFA 4ANCA 4NLRA 5LMNJ 4DS5A 4RL1A 4CT9A 1KLMA 4O44B 1RACB 2B7BB 5HLFA 2HK3A 3V4IB 2JC0A 4NZ0A 3G6ES 1SXLA 2F7VA 1N34F 1HNZJ 4GKKF 3GZ7A 3I9ZA 5F3TA 1FKOA 5JJBA 3TP2A 2CPIA 2RRBA 4UQTA 1L3TA 1ZM4A 2HQ3A 2LXUA 3IFEA 1H0HB 3AJ1A 3HHKA 3UN3A 1R0AA 5HANA 3U1NA 2FVPA 2CJ9A 2V67A 2Q3PA 3BZQA 3DU5A 1FA0A 1OYDA 1S1VB 3A8KA 3C8YA 3MECB 1RWWB 4I4BA 2CPEA 1S4EA 3MI7X 4WWSA 4ZPBA 5EWGA 2KG0A 4LFCJ 2JEIA 3VV2B 5RUBA 2F9DA 1X60A 1S9GB 4ZPVR 2XQCA 1RA7A 3V81B 4B3MF 3E8OA 4I6AA 4ZVFA 2R9LA 3TUIC 4Z2XA 3LUYA 2DCUB 2IYIA 1J5EJ 5KFXA 4XO0A 2BE2A 3HXMA 4QW8A 1UA0A 1UEKA 4OJHA 4K0KF 2FHOB 2PI4A 4TU7A 1VRUA 3NEKA 4Q44A 3CF5Q 5J2PA 1O5JA 3HZEA 2DH7A 2GJ2A 4ED4A 1RU1A 1FX4A 5E3AA 4BS2A 3VVTA 1TK8A 1H98A 1BQNB 2IA0A 3TI0A 2IIHA 2EC0A 2R3VA 1VYAA 4C8YA 1JLCB 2X1BA 2JFDA 5CCMA 4DL0C 3OR2A 2KXFA 3H42A 2FVRA 4C8ZA 1R31A 3KK3B 2VU5A 5I42A 1Q4RA 3KJVB 2CQDA 4F36A 1FK9A 2XMKA 3W5YA 2CQ1A 4DR2F 4WKYA 3NXZA 4G1QA 2CFXA 4R0JA 3EVMA 3WHIA 2CVIA 1FRHA 4B3TF 3AH6A 3LH2S 2MKKA 1M5VC 1WC0A 1S48A 1JNZB 2MKIA 2R2SA 1S0MA 3D67A 2VG5A 3MMAB 4MMOA 3DRSA 2RJZA 3OTDA 4J5OA 4NA2A 5M2PA 3UI3A 1ZM3A 3OTCA 3MOZA 2AYMA 1WI8A 3C6TA 3QRQA 2HWTA 4DUYF 4CLZA 3HVRA 3G8SA 4V19X 1SKWA 1UVLA 3VAGA 4Z7YA 1UETA 2RRNA 2XS2A 5A8WA 3CCRS 1Q1KA 4LSLB 1Q81T 2DXEA 3MPDA 1WEXA 5GAEU 3MOJB 4KHPJ 3BPSP 2D1CA 3CJSA 3PCOB 3H7HB 1U4BA 3CW2C 1N5VA 1XMBA 4X66F 1JJHA 1WC4A 1T9XA 2M0GB 1NH8A 1KR4A 4JI2F 4F25A 2KB2A 1GK8A 3X1LB 4Q0BA 4NLSA 1HQUA 4P6QA 4KH0B 1RJJA 5C2CA 2NYHA 3HLUA 5GAEI 3OVBA 3BEGB 2DT9A 3TUZC 2LA4A 4LUBA 4NEZA 1URNA 1SBRA 4OZLA 4F0MA 2YPZA 3EX7B 2DRDA 2RKIA 3CD5A 2Y1LB 3OR1A 4GVLA 3T9NA 4TQSA 2ROEA 3IG1B 1YTYA 4KY3A 4QIEA 1FDBA 4IOAQ 5M2RA 4O3PA 3QO9B 4LMZA 1H2UX 4DPWA 4FYDA 2DIUA 3F73A 3P5BP 3HZGA 2IRYA 5J1EA 1MLAA 1P6TA 2CDRB 3RW7A 1NK5A 4WIQA 2V8HA 4CP5A 5K8PA 4U7CA 3H90A 3UR3C 2FHMA 3NG8A 2GMJA 2OAUA 2RDDA 3NKYA 3PRVA 2D69A 4J9VA 4RUAA 3MURP 3EZ5A 1RTDA 2A6MA 2R7UA 4CH7A 3DRRA 2VUGA 1DLOB 2VDHA 3DM2B 3R2DJ 4XDDA 2ZUAA 4CLPA 2HHPA 1U48A 4OZ0A 4CO2A 2OD6A 2JHEA 4I1TA 4B9UA 4IH7A 2OPSB 5CYQB 1S9EB 4OV6A 3PJWA 1U25A 2H1YA 3BREA 3U27A 1GFWB 3QIPA 4X4PA 4DV7F 1KKHA 2Z30B 2UU9J 2L3MA 4FKXA 2DNRA 1IKVB 2GQQA 2KRBA 3TZYA 3OHAA 3OTOJ 4B9TA 2GIFA 4DX5A 5HQLA 3GTYX 4NRTA 3LGMA 1JJ2R 1YWXA 2B0GA 1QM9A 4UOGA 2HZCA 5LSRA 3MM9B 4JP8A 2LQ8A 5A8RA 4CH1A 1VBZA 5G0RB 3O1LA 4C7QA 2FHJA 2O66A 5A6WA 1NJIT 4V19J 1DTQB 1LFPA 3UVJA 2BJ9A 2KVQE 1YDLA 5I4MA 1VBXA 3GJSB 3OL8A 3CJKA 2E5IA 1HNVB 2YKOA 3UWTA 1QJHA 3L95X 1IBMF 1S6UA 4ZP6A 5GAHI 5HK4A 1EZZB 2LDIA 1YZ6A 4LF4F 4LSLA 3BO2A 1HR0J 4HT7A 4DBQA 2N3OA 3WBZA 2F4FA 4LT6A 3KLHB 1HHQA 2CJAA 1UFWA 2DHSA 2BABA 3US5A 5LOQA 5HP1B 4QIGA 4PKDB 1WHWA 2YBVA 1PJ6A 5B0DA 4AL6A 3PIPQ 4G65A 4YHHJ 1WF2A 5B09A 2ASDA 4OHYA 2VPWB 3HF5A 4OI6A 2W7AA 1TELA 3W65A 2C22A 2OPRA 1S10A 2HQCA 1GMWD 2B56A 1RKIA 4NMLA 3RBEA 4ZJOA 5KFPA 5L1LA 5HATA 3H2VE 3UW1A 4K4VA 4C8OA 1HQEA 1T05A 2KI2A 2XZDB 3CC4S 2BOAA 1KP6A 2B4UA 3D28A 4PG7A 2G0IA 4BHQA 5KG5A 3J7YI 2QMXA 1FCAA 1HWLA 2NUUG 2O01C 1CBKA 3MEEA 5IZHA 3KXDA 3OLBA 4LR8A 2PSZA 1HD1A 2H4YB 4YR2A 1M5KC 3JSMA 1KVKA 1XQIA 1S1TB 4OL8A 1KWMA 4K2XA 4PAAA 4FYXB 4ETZA 5KFSA 3TAMA 2R2RA 3AT1B 4AQYJ 2HNYB 1RWUA 1XK8A 1RTJA 1WI6A 5G4DA 3G8TA 3IO1A 5CCLA 3CMAS 3K7RA 2MHEA 3A8EA 1HD0A 2EFNA 2FZGB 2Q79A 2QFIA 4UOHA 3V6HA 4UY85 1SVDA 4R8UA 4LVNP 4CLUA 2DITA 1IJFB 2HZAA 1Z2ZA 3NGUA 1B0TA 1VRUB 1IKYA 2AP6A 2YQ1A 4BC9A 4CI0B 3H4DA 2VJUA 2CYYA 2ASLA 4OI0A 1F9EB 3RB0A 2Z0GA 1TL4A 3UE2A 3CIZA 1H2TZ 4FYYB 3T41A 5IQ6A 4F2SA 4ILMA 1T9TA 1X9WA 2GQ2A 1KQSR 1RI7A 4DQSA 4DR3F 1TKZB 1F0XA 2C3MA 1N8RT 1CJUB 3CE8A 3DLKA 4O0NA 4WJBA 3ICLA 2F5GA 4DV2J 5DDOC 3MAQA 1WKJA 5KFFA 1P8GA 2ROPA 1AUSL 1P27B 3PX4A 3B6BA 3KLEB 1RWKB 5I3PA 3WX4A 1IKYB 4LBIA 1HBUB 4HI2A 1Y7PA 4IYQA 3PYFA 5AXLA 4CNYA 4LF9J 2X1FA 1F3FA 4ZN1A 3DC2A 5B08A 2C2RA 1QY7A 5E3PA 4EWTA 1RQ0A 3BYPA 5D3GB 1RT2B 3QNWB 2AW0A 4C2MA 3HHLA 3UDVA 1RP5A 2C2MB 1WD6A 3MM8B 2ILZA 3LP2A 2MQOA 4DR1J 1ZZNA 5A76A 2IA6A 5CZVA 2W24A 4OYMA 2XY7A 2HMIA 4JI8J 4FF3A 2WONB 1N88A 1VS3A 1IKVA 4LRFA 2K7JA 2OPPB 2V63A 4KGVB 3ZZZA 4OYBA 2VQFF 3G2XA 2AIRB 3GYXB 1SL0A 1QAYA 2W4DA 2GQCA 3MM5A 4DSLA 4NWBA 4MKBA 3DLHA 4RW8A 3OXGA 3WQPA 3TJAA 2RRAA 3FRYA 3NBPA 3H5YA 3ELHA 3ISND 1FD2A 1ZS6A 2CPDA 4L3NA 2FQQB 5ETTA 1AZSA 1PSDA 3DM2A 4QYZJ 1GH8A 1RT6B 3QMQA 4CT8A 1YBAA 3PJ9A 4EO6A 5C24B 2B6AB 5GADI 3M8RA 4ZPCA 3KDOA 3PYDA 5KFOA 1VC5A 1ACMB 3MTKA 3G71S 1FESA 2IM1A 3I6PA 3PEJA 1KTVA 4OJ1A 4B3SJ 3JTOA 2MKJA 3M4XA 1YZ7A 2BA9A 1Q79A 1GX6A 2GHWA 2UUWA 4CM2A 8AT1B 3SV3A 1UVNA 1U6ZA 2W8LA 2NXEA 5IV4A 4LVOP 2YH1A 3VR1A 4ZK7M 1N6QA 3MXHP 1NXIA 3IBCB 2Q1LA 1VRTA 2MJUA 3BH7B 4GKKJ 1HBNA 1R0BG 2MZSA 3HHNB 1S6OA 3M8PB 4OFZA 4RNNA 2ZH3A 3CCZA 3I4PA 3ET6A 3R5AA 2QGFB 3DGPA 3MM6A 4I69A 4ICLB 4CDIA 4JI5F 4ZVPB 1QE1B 4O3QA 4QWCA 5C7PA 2MZTA 2H5EA 1Y5LB 4OHZA 2WB1D 1S1UB 3VGTA 3KJNB 2N82B 1VQ4S 3KK1B 3CB4A 1FE0A 3O44A 2HQFA 2KJVA 3R5BA 3W7BA 3U7JA 1RBLA 2Q6CA 2G0CA 4USUA 4Q0BB 1YSJA 4LFBJ 1Y3KA 4CTAB 3TANA 3D2WA 1C0UB 3FNNA 4DX6A 1U0SA 2JJ4D 5IS2A 1TKTA 2QC3A 1V5IB 1FF2A 1WHXA 2DHHA 2RUGA 1PBAA 2HBRB 4EUVA 1UVIA 3NAIA 1S1XB 4N8NA 5HROB 2EPIA 3T19A 1WEZA 3C19A 4P2XA 2HRTA 4YDDB 3I56S 3GLJA 3E2EA 1KN6A 4IUFA 2W01A 1U8WA 2C3YA 1VI7A 4O4GB 5IC4B 1NNDA 4RX6A 4AD6A 1FNXH 2FY1A 1M5SA 1G3OA 4GO5X 4E2FB 4XIUA 4U8YA 1N5YA 2C2DA 1G7CB 5KFTA 7AT1B 2VG5B 3MMAA 3L7UA 5ETRA 2CJQA 3FC9A 3DCAA 3IMQJ 2DGQA 3HVTB 3GJQB 5HO4A 3UD3P 1B64A 4JI3J 2C2OB 2LA6A 3FMWA 1K1QA 4JI5J 1DQ8A 2I0XA 2IAJB 3ILJA 3PM9A 4XAKA 1WUUA 3SDEB 3TARA 4WFZA 3KHHA 2HFSA 3BH6B 4WFYA 2VFUA 2VONA 2AYGA 1VK8A 3FQKA 4B3RF 1U8SA 2I1RA 4DCPB 4ED8A 2YNIA 4OZ3A 3RU0A 4USTA 4KO0B 3TO8A 2W9CA 1SIZA 5I3UA 2M9KA 4DV0F 1FWLA 1NDLA 5B0GA 1U24A 5E0OA 2W2MP 1B70B 1BQNA 3EUNA 3IXQA 1FJ7A 4DL7A 1HYSB 2JSXA 2R2UA 1HNIA 2D41A 5T7LB 3SSSA 1KDNA 3M8WA 3G6YA 1BQMB 2V4QA 1YJ9S 1KD1T 1Q78A 1UFKA 5J2PB 3IRXB 3PHTA 1T03B 1RABB 1PYTA 3BO3A 1NZAA 3GWCA 5KT2A 2YNIB 3FQLA 5HI7A 2R8JA 4LFCF 2MY7A 2YTCA 5ETLA 2RILA 3EYZA 3BGLA 2UXBJ 2GV1A 1EAYC 3WIUA 1XEZA 2KHCA 2KYZA 2YWEA 3OJUA 1F2GA 4UUXA 1RAIB 1Z1ZA 3V6KA 3POTB 4DU8A 5B0CA 4C6AA 3DRSB 3GYGA 3PNIA 2IBKA 2XS7A 1MWZA 3EPGA 1ZYQA 3D5MA 4RW9B 3I31A 1TKXB 3ZZ0A 4ID5B 2M8HA 6FD1A 1TL1B 3EJMA 5LMUF 3RAQA 4A8SA 3ENWA 2ZH1A 4JI1F 2GIQA 1M5PC 2HHSA 3O3LA 2HBZB 1PBUA 2NXJA 1UPPA 2DY9A 5DM6Q 4KGZB 2DRAA 2E29A 1IKXB 2EK1A 2QIFA 2KFNA 4W90B 2GNKA 2GJIA 3VHQA 4USIA 1Y5NB 2L08A 2CIMA 3K8VA 3D1HA 4ZLNA 1SC3B 3IR5B 2XY6A 4O3OA 2IBOA 2QZ8A 4H4OA 3IRWP 1OSCA 1RT4A 2HLTA 4RBVA 3VAIA 1C1BA 3MMBA 4YB7A 4J9QA 2B5JB 3ENVA 1KLMB 2N7YA 2V94A 2Z2YB 3GFHA 5IM0A 3PHEA 2W4PA 3J80U 1P1TA 3CCQS 4LR9A 1VHFA 5ETKA 3MCOA 4P52A 2OI2A 4C11A 3CC2S 2HVHA 1RWMB 1JB0C 5AE2A 4QCLA 3S01A 1WOOA 5DDQC 3FBEA 4O3RA 1O51A 1VQYA 2JC1A 2MZRA 2E9TA 2J7UA 2XLKA 4OHVA 4LFAF 2DNNA 4OZNA 4K8RA 1NZ8A 1UPMB 3CJ5A 4B9NA 1QE1A 2GHPA 3GMGA 3M1VA 4RNHA 4ICLA 1RUSA 3DLEB 5CQGA 3UNGC 4ANDA 4PCQA 3KK2B 2VBWA 4NLTA 4ILRA 4ZCMA 3P4UB 4DUYJ 1KHWA 1U7LA 3SCKE 4QPTA 1K0TA 1M1HA 1HBNB 1LQ9A 3ZZTA 4K5SA 3I0RB 5KT4A 3POTA 3SCIE 1IQZA 1S1VA 3QGHA 5KFEA 2Q66A 3RGIA 2J5AA 3W8PA 5DETA 4JI4F 1HBMA 3GR0A 2DGOA 3BKFA 4WTYA 5L46A 4KBIA 5DM7Q 2V9WA 3LQVA 4FF1A 5B7WA 2ZE2A 3B8HA 4J9KA 2ZJQQ 2XYGB 2QA2A 2QLBB 5KFNA 3R1HA 3H0PA 4IQMA 3QJPA 2VG7B 4L74A 3MPYA 2AYEA 4XK8C 5B0EA 3RTVA 2D3O1 1WELA 3MPWA 3RR8A 2HGLA 4OZ1A 5DGBA 1RT6A 2HFNA 1H2VZ 2F8HA 5LXYA 1AZSB 4QWEA 4ED0A 3JAMU 5K9FA 4FKYA 3EICA 1LWCB 5HMZA 1U0HB 4O44A 4KFBB 1TV6A 3GU0A 3M2RA 4XDCA 2ZKTA 1AT1B 2HQDA 3C16A 5SZTA 3BQ0A 3PW7A 4WBFA 1LK7A 1WHYA 2ZHOA 1S9FA 4F02A 2F40A 3AFGA 4LFAJ 1S6QB 3HKZD 3ILOA 4DUTA 2ERRA 2IAJA 2BR0A 1PC5A 4DV3F 2ZBIA 3FFIA 5KFGA 2D7SA 3RZAA 3UDLA 2KN4A 2PMWA 2YWKA 3CEDA 1WACA 1NDPA 2ATCB 2LDYA 3LP2B 4LF6F 4M94A 1LW2A 3NGRA 1RT2A 2N3LA 5MLCV 2NR0A 5J2QB 5KFWA 3ET6B 1GMUA 1NPPA 5DGAA 2IM3A 3BKUA 1VHIA 2RU3A 2XEXA 3P96A 3A12A 3M2UB 4Q43A 2WW8A 2ACMA 2LFVA 3H8YA 3RBZA 1RAAB 2K3IA 3KUGA 4DPTA 2HNDA 3I0SA 2R7RA 3X3UA 2OD4A 2GMLA 3GFZA 7FDRA 4AXIA 3SV4A 1S59A 5A0YA 5D78A 4EFAC 1VDHA 2B9WA 3OXLA 1IN0A 2B9XA 4N47A 3GG1A 4Y00A 2RF2A 4DF4A 4M5GA 5F9NA 2LU1A 1RT1B 3ZTSA 4YR3A 3KNGA 3BQ1A 5K14B 4ECZA 3EWGA 3B82A 2J0WA 3LOUA 4I6YA 5BYSA 3CXCR 3OFFA 2XTJP 2QN6B 2L9WA 3HFVA 4CO5A 4IR1A 3QT8A 3KKFA 2MPUA 1IBLF 1IJEB 3GSDA 1RK8A 3AQOA 2IC3A 4WIIA 1Q7LB 1QVGR 1MSWD 3ZZOA 4KPYA 4ED5A 3RW6A 3GR1A 1LXJA 4CYUA 4X4RA 4KJIA 1DFDA 3BF4A 1AYEA 4I2PA 4N8OA 4PQUA 3FBBA 1RCOB 1RTIB 1SQEA 1XTZA 2E66A 3BBFA 5ADZA 4Q5VA 3TQ1A 4GKJF 2DISA 3GP9A 1HKAA 2DNHA 3MMBB 4M63A 2CG8A 2FHJD 1RT4B 2HNYA 5D0RA 4C97A 3NL0A 1S1TA 3RUBL 3W9JA 5E3CA 1N6QB 3BJYA 3CMES 1TL7B 4UW2A 1CULA 3PO4A 1AFIA 3GIMA 2XWXA 3CCLS 2HVZA 2KH9A 2OPQB 3SSRA 1U1MA 4B02A 2E7XA 1Z4UA 2WVFA 2BRKA 2B6AA 4FNHA 3BM7A 1S5ZA 3LGHA 2E5GA 2HSEB 3O6QA 2OTLS 2HWHA 3PY8A 4U7UK 1O6XA 2VD3A 2X3GA 3Q0AA 4K4UA 2WZ1A 3NY0A 1TKZA 4CLWA 4PWDB 2XI3A 4MKYA 4DR5F 1IBCB 4UZCA 1RHKB 2BJDA 4H4KC 4HI1A 5HP1A 2UXDJ 2U2FA 1GXLA 1WKKA 2B4VA 1KNZA 1AB8A 4YEAA 1WORA 2CZ9A 3OL7A 3QAEA 4JI6J 1Y0HA 4LRDA 4PPDA 2DNPA 9ATCB 2ZJPQ 1TK0A 2VA3A 2M4MA 3DRPA 3PG9A 3AB2B 3VAJA 3HX9A 1Y10A 3VGUA 1IUJA 2XNRA 1FTCA 4C8MA 5HSPA 1KVIA 3DDNA 2GC8A 2R7XA 3W61A 2G1DA 2HS0A 4BDPA 1UW9A 3R7BB 1RXOB 4KO0A 2W9CB 3W63A 5CA5A 1X5PA 4PYDA 3JSMB 3GIJA 2A6OA 1HBUA 1RAEB 2XSFA 3CO0P 4ECRA 1N5TA 2LYVA 4BLGA 3AHPA 1FRIA 3UNYA 3AY0A 4IDKA 2BQRA 4IQXA 1TR0A 4U96A 4EYHB 1L3SA 1FXDA 2J0XA 4NX9A 4ED1A 3TX0A 4G3IA 4OX9J 4R5PB 3NOGA 1WTBA 1OYEA 1SV5B 1QSYA 3E01B 3ZZRA 2V4JA 1FJGJ 2IPOB 3Q89A 3DXSX 1P9QC 4F67A 1M5HA 1T11A 5LXRA 4RNOA 1F1BB 1RYSA 4YY3F 3J7YU 3QFHA 3UN5A 3UQSA 4JI0F 3CJ2A 5IT0A 2X51A 2J7WA 3J7ZT 4OYIA 1FD8A 3CO9A 2QL7B 2ZDPA 2XMWA 3D1QA 4IG0B 2W1BA 4OMFG 4OYOA 4RR5A 3V2UC 1SH3A 5C25B 2JOQA 2E5JA 3D7SB 4KC5A 4QYRA 4IH6A 3NRBA 4DX7A 4YB6A 3OHBA 3M6VA 5FD1A 2XG8A 4LFBF 1S1UA 4FN5A 4CYUB 1YJTA 3MR3A 4DCOB 2HZVA 1MROB 1N0VC 4OYWA 4F26A 1PO6A 2VQEF 4CH0S 3IP0A 3D3CJ 1SJ3P 5CABA 2IDEA 4F04B 2UVWA 1HL6A 4QWBA 2YX1A 2LXFA 1UVMA 4RW4A 2V2VA 2AU0A 4WFNQ 1HI1A 4UUWA 2HIYA 4I2QA 4MKVA 4WK1A 5HJXA 5ETMA 2ZM6J 4C3LA 2E1CA 4DR7F 1V3RA 2WK4A 1DURA 4Y65A 4CRJA 4DPXA 4RUHA 3M9MB 4AL7A 1JXLA 2AX0A 3KLHA 3DN9A 4PWDA 2OKQA 2Y0BB 3UFCX 3W9HA 1ZPWX 4A8MP 1WF0A 2KDOA 1F5BA 4B9MA 4DV1J 5K8OA 1RTHB 3T9ZA 3S8SA 2OFHX 2AGQA 2AJ2A 4NXMJ 2ZH8A 2WW4A 5IC6B 2MZQA 3NNCA 1CPZA 5AJ3F 1CJTA 4DL4A 3UDEA 4B3TJ 2UV8A 4DL6A 1UP1A 4O3SA 2MMYA 1T9YA 5FIIA 2W9BB 1RHMB 4B3RJ 3C14B 3Q8UA 8RUCA 3ZNUA 2B8QA 2LEAA 4WFXA 2M5YA 3OPKA 4DSKA 4GMKA 4X4QA 3EVWA 3MM7B 2CWKA 2BUNA 2WOMB 3ZC4A 2Y1RI 3F44A 4J9UE 1EKRA 2MTLA 4AXJA 1HW9A 2D9PA 2OEMA 3M6WA 4PG4A 5I42B 3KK3A 2ZH5A 1ICEB 4K4SA 2ATLA 4HHUA 4P2MA 2WAQD 2NQPA 2WTFA 2V8PA 3FKBA 4TVAB 5EX0A 2C2KB 2XMTA 3CDWA 3D6HB 2W25A 4LBHA 1EJ7L 1DBDA 3H5XA 1X0FA 3M2VB 2JL9A 1EP4A 4O0IA 2OHDA 3CD7A 4USKA 3AXKA 5KG0A 2MQPA 4A46A 2VASA 1BQXA 2P2CB 4CQ1A 4DI6A 2ZE2B 3G6VA 1RBAA 4RBUA 2R2TA 1NPRA 4KT0C 4ZP7A 4DX8H 1NK8A 2HHWA 1CJUA 4DSEA 3N79A 1S99A 1GMVA 1NSPA 2ZFHA 3PYGA 3QATA 2VKRA 4GRSA 4KKOB 4K4TA 1VGYA 4ED6A 2CPZA 4DFMA 2XMMA 1K44A 4UF4A 3N4WA 1LWFA 2RAQA 2VDIA 5ETOA 4OJGA 3M6UA 3KDNA 3P5TL 4M5KA 3ZZYA 4G1QB 4N77A 3I55S 4AT1B 3HSDA 4ZS6A 4K5RA 1NKBA 4FF4A 2I38A 3CMQA 1TFWA 1FKOB 4A8KA 2G0JA 5KFMA 3A1YG 2BXJA 2LU2A 3HD2A 1YG0A 1I1GA 4PR6A 3TX8A 1UTAA 2FVSA 3K89A 1G4CA 2AEMA 3AD7C 2VFTA 3HK2A 2UXBF 5FJ4A 3EMTA 2HAIA 1TTHB 2FJAB 5EN1A 1H3DA 2RD5C 3H59A 2AZ1A 4I2PB 4QU6A 3HHLC 4NLOA 4TLRA 2DGXA 3ZTRA 6AT1B 2BJ1A 4LRAA 5K8NA 2O67A 1WKLA 2XSJA 1HMVA 4FVMA 5H9FK 2HVEA 2BKOA 4B08A 3MWBA 4F0KA 3C15A 4DL3A 3ZNJ1 4ZLPA 1N36J 4LF5F 3IM9A 5BJRA 1NM2A 2G2OA 5K14A 3RRKA 1S9GA 3THVA 5E7OB 2B51A 4AL5A 5IXUA 2F8MA 4ZVEA 5A0YB 4WCEQ 4DL2A 1VBYA 4WYLA 3IA0A 1FDNA 2E7VA 2JX2A 4TU8A 1APSA 3CDAA 3RAXA 5C2GA 3NAHA 1MWQA 3AAWB 1W2BR 5F8GA 1FFGB 2J6TA 4RUBA 4ES2A 2G4BA 3I4HX 5AT1B 1HNWF 1GNKA 4NZ7A 2W9AA 1JLCA 1YIJS 1ZH5A 2YNGB 5CYJA 3CVKA 2HGMA 1U1RA 1YKWA 2DEIA 4Y28C 3QT5A 1NPKA 2A3JA 3HHLD 3IWXA 2IDLA 2FUG9 1FFWB 5FLXU 3PW4A 4OYAA 1N32J 2BOPA 1GEHA 4DFKA 3CJ3A 2RSQA 3FEZA 3PXGa 3IS9A 2VBZA 3PIOQ 3WC2A 2JVOA 1GT8A 4MIWA 2JVRA 2BE2B 2A0FB 3DLJA 4LSNA 3D6FB 1HI0P 4H4MB 2RS2A 2KT2A 1N36F 3DXBA 4KV8A 1SJQA 2BQUA 4DPYA 1NLKL 3K5NA 4EBCA 3KMQA 1YX2A 2L9NA 2VPYB 3R9LA 3OBIA 3G87A 3NP5A 2WB4A 1FDDA 2HNZB 1I94F 1D1UA 1KRPA 3J7AN 4DR4J 2C3PA 2CNKB 2DJWA 2FPHX 4DG1B 2V0NA 3NCPA 3D0HE 2HHVA 1HLWA 2IJNA 4PPZA 3LAKA 3OTBA 5FDLB 1SJFA 2YKPA 1F6TA 3HSGA 2HHHF 2UV8G 4ZHRB 5J2QA 4L3KA 2EBGA 1WC5A 3BV8A 3GQCA 1U6BA 3W1YC 3RRGA 2MYFA 3TZWA 4KV8B 4A8OA 1L5UA 2RUSA 1KFSA 3GILA 1D9DA 4I6WA 1DY3A 2MHNA 2PN6A 2VJVA 1O0PA 1N32F 1C0UA 3BN4A 1C0TA 4FXVA 4TQRA 3OSPA 4X4UA 1NK0A 3KLFB 5KFZA 4CWBA 5M2UA 1X5SA 2V2QA 1S12A 1RAHB 2V5HG 5EX3A 3KK1A 1LWCA 4R0EA 2HLUA 3SCJE 2CUYA 3JQKA 2WSEC 5B0AA 4FPIA 3GIIA 3MD3A 2A18A 3DDIA 2VIHA 4LF9F 2ZBPA 1WTFA 2PMHA 4KAIA 4H4KA 5KG1A 5IM0B 3IR6B 2VICA 1KTQA 1R8CA 4HYKA 3NS7B 3TAQA 1C1BB 1N0UA 3OUYB 4P2FA 1JXVA 2RF2B 3BGOP 2GGPA 5KFVA 1UCNA 2VFRA 4LRBA 2Y8WA 5E5NA 4JI6F 3W2VA 2HRYA 2ZZTA 3EZUA 4WE1A 2DPJA 4EK2A 3M7VA 3AOBA 1U2CA 5DG9A 4URGA 4CM0A 1IBLJ 3A8IA 3I5AA 5LSLA 4DR6J 1RE1B 1TKXA 4RW9A 2CRLA 1VRQC 2FZKB 1SI9A 2OMLA 2PDAA 1HBOA 5HAOA 2IRXA 3A13A 3TVKA 4JV1A 4OLOA 2C2NA 4N56A 2OSQA 3R3TA 4L72B 3VTIA 4F4WA 2CAJA 4DCJB 1TUVA 1X4CA 1NK6A 3VCDA 2IFXA 4QPXA 1E6YA 1W7WA 1RT5A 3DNCA 3J80Y 3JYTB 5C5JA 3KJQB 4CIOA 1VK3A 3HM9A 2WRMA 3OD2A 2ZZNA 2FJVA 3SSQA 3M8QA 3UD5A 2P9CA 3VALA 4C8KA 3I9V9 1F9HA 3PW0A 1U1QA 2YXLA 4KFBA 4F3MA 1T03A 9RUBA 2HMIB 3BGFA 2O1PA 3CC7S 2KZZA 2MLZA 5JMNA 1OIAA 4Y6IA 1M1KT 2HHXA 2GW8A 2HBQB 3W3SA 3W2WA 5D6GA 2YNGA 3RB3A 2CPFA 3MHYA 2CQIA 4DUZF 4IH5A 4I56A 1S76D 3ZZPA 2DVIA 3AD9C 2CNLB 1MW7A 4BC7A 3WIVA 4ZA1A 3GIRA 1Q5YA 4UTGA 2YWWA 4ID5A 2XYPB 4DQRA 3TUPA 2D3ZA 1Y4ZB 1HA1A 3CJ0A 1TUWA 1RBOB 4DS4A 4MFBB 2JDJA 3CCES 1PAEX 1V9OA 2NSBA 3QLHB 4U9RA 3HVTA 5GVQA 1LWEA 1RHJB 2H9ZA 2CPYA 2OUGA 1R8PA 2CJYB 5CD4H 3DLEA 2V8VA 1MN7A 5D4OA 3KTQA 3FBCA 3M1VB 3KG0A 4M5DB 1KC8T 2AKWB 5GMDA 4CO1A 3VAMA 3D6TB 2UUBJ 2VOPA 3VZIA 1SIWB 1WOPA 2R7QA 4NCGA 5ETPA 1N5QA 2AEJA 5HN0A 3A3NB 2CQ3A 4TXSA 5LMNF 1EARA 3QAUA 4C0HA 3IAS9 1BQMA 2HFZA 4HACA 4D3GA 4DSIA 1NKCA 1VQ9S 3TJ9A 1JLAA 2YKQA 3V4IA 1GQEA 4FVCA 5HLFB 1TL3B 2IM0A 3HJFA 2XYHB 5F8IA 2JLFA 3UCUP 4JI7J 1JLEA 1JLFA 2R8HA 1S0VA 2J0SD 1SH2A 3FJ2A 2X1GA 2J8AA 3HD1A 4Y2CA 1C1CB 3QSIA 4CTAA 4DUZJ 1U6FA 3GONA 3SXLA 3KLGB 2BANA 4OX6A 5DS7A 2PO4A 2R8IA 4F50A 1SKSA 2KO1A 4KHPF 1NDCA 1RT5B 2P9EA 2W2OP 2BM0A 1UAWA 3IGVA 1LEOA 3ZZUA 3T6JA 3G86A 1HQEB 3ITHA 4MK8A 1T05B 3RJMB 3ULHA 3DFEA 3SQOP 2WVBA 3G8QA 2UUTA 4MT1A 2QMUB 2W9BA 1TL1A 2PT0A 2POKA 3WC0A 1VQ6S 3V6JA 4ZJLA 2B3TB 1Q95G 1K47A 3ETOA 2FHKA 5KG6A 1I51B 2ZBQA 1L3KA 1EHWA 4Q2MA 3MAHA 2DR6A 4UQGA 3N28A 1N5YB 3JQMA 4MH8A 1M1GA 3K8WA 5IWAF 2I2YA 1U1NA 3PDNA 2JZ5A 3NGKA 4MIAA 3W2VB 1QD1A 3T5KA 1DTTA 2JLEA 3AB4B 5FLXY 3FGVA 3OUYA 4QW9A 2QRRA 2OSRA 1X31C 2FIUA 3OXFA 3CCWA 4I2QB 4FF2A 3NS6A 4QIFA 2BV3A 4RO0A 3C46A 3TAPA 2NPFA 2AQ4A 5HQMA 1TL5A 2KU7A 3NBPB 4WXOA 2F4VJ 1X4HA 4KSEB 1HNWJ 1OY9A 2FC8A 1R8BA 2P6TA 2PIIA 5I3UB 4HVZA 3O5TB 2G2ZA 2VPZB 2MQ8A 2ADCA 1CC7A 2IM2A 2OPPA 3JTPA 1U49A 4U95A 2XGQA 4CO3A 4PXEA 1ZPVA 2QYGA 4ZVHA 3TVZA 1NJYA 1YQHA 2M3DA 2UVUA 3NLCA 3DGPB 4RWXA 4RNMA 2C42A 2HIQA 2BKNA 5EWFA 3QIPB 3GG0A 2D9OA 3JQJA 3L7PA 4IFVB 4C4WA 4USWA 3S7RA 5D0GA 1MMLA 4P7TA 5D0EA 4ZVGA 2BDPA 2VFVA 1MNEA 3V5RA 5L1IA 3RG6A 3BBBA 3PACA 3PJXA 2DNOA 1KBRA 2FZCB 4OHWA 3OSNA 3G82B 5HMWA 4O4GA 5MAOA 1U2FA 4M95A 2ZOMA 3QFWA 1MU2A 2YNHB 3TYTA 2M8DB 1A6LA 3IWLA 4QOTA 1QUVA 2BJEA 4NMXA 5D4NA 3CDEA 4CLLA 4DXLA 5A2QY 4EBEA 2FJXA 4Y2KA 4DR4F 2CQCA 1OS5A 1RT3A 5KG7A 3QYYA 2BM1A 4GC6A 1RDRA 2UVVA 2CQGA 4RW8B 4X66J 4ZDNA 2MGZB 1TKTB 2PFDA 2XBPA 3UO0A 4ES1A 3IAM9 4H4MA 3QZ8A 4DV6F 2MB0B 5F9LA 2RH3A 4QBUA 2IJFA 2DH8A 3LANA 3THPA 2DR9A 2ZHBA 1YHQS 4YOEA 3QBCA 4KQZA 5IT4A 4ZKAA 4M1KA 5AXNA 4EBDA 4OQJA 2CPXA 4TLQA 3TZZA 3CDBA 3MEGB 4WU2A 2OEJA 1REGX 5HQ8A 1SH0A 3T1HJ 2GVDA 1U1PA 1FRLA 4F3QA 5D3GA 5DQHA 4X4OA 1AROP 3U02A 2KXHA 3B4MA 4Q7AA 1HWUA 4HEA9 2GO9A 3HVAA 4TY8A 2KKHA 3EDQB 3ZTPA 1TK5A 4ES3A 1VQLS 4U67Q 1ELOA 1JXEA 1KFDA 3QJLA 1DJ0A 4DSFA 1KOOA 1ZETA 5LSOA 5GAGU 5J1NA 3LP0A 1HQ2A 4PYAA 3W66A 4X62J 4NLYA 2P8IA 3G4SS 1CS4A 5JVHQ 4I68A 4P71A 4URSA 2F3JA 4ZLJA 1YRTA 2JEFA 1T8EA 1BGXT 2FD2A 2BZ2A 2IJRA 3G6XA 1X4DA 1P1LA 2KVIA 1SC1B 3E01A 4P7VA 4DPUA 4LF6J 1DQ9A 3EPIA 1NK4A 1S49A 1XBWA 3GFYA 3I32A 1SJ4P 2NZ4A 2CNOB 1FRXA 3MZIA 3SBMA 5GADU 1EETA 1VR6A 3EE3A 3GFXA 2OO4A 3LO3A 2DKOB 3DOMA 4OX7A 3TWZA 3CUNA 3OTOF 2PI5A 5D8HB 2XC9A 2EW9A 2Y8YA 2G13A 1RT7A 1XMOF 2X3DA 3KLVA 1SKRA 1U09A 3PR4A 2CG4A 3AXMA 2AMCB 5EUHA 2CJKA 4IG3A 2CZ4A 3TQEA 5KFQA 4NXNJ 2V50A 4USJC 2CADA 4LJMA 4PWWA 5LL6d 4WFBQ 3FBFA 5LT5A 2PE8A 1XNQJ 2DGTA 4ED2A 2AWZA 3DRXA 3BSOA 4J7CA 1HNZF 2DHGA 4LQ9A 2JFKA 3KLEA 2VHGA 4UOFA 2DRBA 3BR9A 4NEYA 2BACA 2ZWOA 2HKEA 1LV5A 3IR7B 3NGTA 4K59A 2WBMA 2H51B 4WXWA 5LJ5Y 1RCXB 1HHSA 2HHTA 3K58A 1FX2A 4QIVA 2DHAA 4RJVA 2NUHA 3HDSA 5KG4A 2R7WA 2ROGA 3OW2R 1WC1A 3RB6A 2VQFJ 3RR7A 3MMCA 3QJJA 1M0SA 3I96A 4LIRA 4J9RA 2Z2ZA 3H25A 4B3MJ 2N7CA 3EM1A 1V5VA 1EP4B 4Q2LA 2FLNA 1JKHA 2BE9B 4TYAA 2V68A 3SFGA 4WTOB 2B43A 1BE4A 3TUJC 4OYXA 1IM4A 4K4WA 2E1RA 1FWPA 3SMZA 1UJ5A 4NXNF 4N76A 1RTJB 3KUEA 4LF1A 4X64F 4K50A 1QUPA 3TR5A 1VQNS 2DNQA 2QE5A 1AW0A 3GV8B 5J2MA 1JX4A 3ILLA 2GA7A 4YUDA 3EXYA 3FFIB 3J7Z5 2MJNA 3ONQA 4PXBA 1RTIA 1UJ6A 3HHEA 3MM7A 4LF8F 1JQGA 3MR2A 3AQPA 2UXDF 1F9FA 3W62A 3LGNA 2XZTB 1UMJA 4MKAA 2FVCA 2OEKA 5DO2A 1IR2A 2IYGA 1U0HA 4KIAA 3Q8VA 1XNRF 3HHDA 4KGKA 2OPRB 2LQ5A 4QIWD 1UJ4A 1XMQJ 1B7FA 2HQGA 4OX8A 3Q23A 2UVRA 3FCHA 3OTEA 1DLOA 2VPXB 2DNGA 4GC7A 4DFPA 2ADBA 4OHXA 5BYQA 2J6SA 1NEEA 3KHGA 4EU0A 5KFJA 5DDRC 2AX1A 2RHQB 1U1KA 3EDRB 3GB0A 3M30A 3SIPB 1FDAA 4NLQA 2QA4S 2EC2A 2NYIA 3ZXWA 3F0NA 1SUQA 1FRMA 2AGOA 3I0SB 1I3OB 2FB0A 4ZCLA 1NB2A 1X0PA 3LAMA 4DZDA 4DV4F 2R7SA 2YX4A 2HW3A 3DYAA 3MCSA 3QO9A 4IRDA 2NSCA 4OI2A 4LF7F 2YKAA 3QT6A 1XJWB 2K2PA 2MLYA 4DOZA 1VIXA 1DZ5A 3OR1B 2YPYA 5I3QA 1BWVA 3KK2A 3T6BA 1LW2B 2AJ4A 2W2QP 2FGCA 2L48A 4KR0B 5G0RA 5AE3A 2FLLA 1YJRA 2AJ1A 4JI8F 3P6YC 3NMAA 4I7FB 3MEKA 2B8PA 5EDWA 1KS2A 5F8MA 4EO8A 2LCWA 4YB1P 1RU2A 1YJNS 2VKZG 2CQHA 3VQTA 2KL8A 3IGNA 2W8KA 4UOCA 2AD9A 3A3PB 2CQ2A 4PZVA 5C25A 3AODA 4O3NA 4JI0J 1JLFB 1JLEB 2OPSA 2I5JB 5CYQA 2B5JA 1HI8A 1UVKA 4RW6A 4C3MA 4ECYA 1JLAB 3PTWA 4ECSA 2VZ9A 2Q43A 3PEHA 4B3SF 1P9YA 1SJ1A 2OIHA 4BWJA 5D15A 4DJBA 3C6TB 2P5VA 1VJWA 2M2BA 5L38A 2MKSA 3JTNA 4M5JA 5ETQA 4DR2J 1RWXB 3D68A 4DV4J 1TUGB 4DR3J 4MJKA 4QR2A 1HBMB 4WU3A 2ZC4A 4BBYA 1VC6A 3SQGA 4JI7F 1IBKF 3HFKA 4NA1A 3UCGA 5JUMA 3PVXA 3HJVA 1N52B 3Q8QB 1T7PA 3MFIA 3NGSA 4K4XA 3H2UB 3R6LB 4MK9A 3IG1A 4RBTA 3TA0A 4M8LA 4RU9A 3DLLQ 5KFAA 2MQMA 1HIYA 2RKIB 4FYWB 4JUZA 2NXCA 3L3CA 1NDKA 4NOHA 5AE1A 3AJ2A 3VWSA 2RQKA 4MAKA 1R0AB 3LTOA 3MF5A 4DV7J 1N34J 2ACYA 2GX8A 3JAMY 3SCLE 1FJCA 1Y5IB 4L6V3 2YKMB 1ZZFA 4PEOA 4CO4A 5BR8J 4IR9A 2HG4A 4C11B 3BSCA 3M8ZA 1UZDA 1S79A 4OV1A 1Z2LA 1IXKA 1S1WB 4LBPA 2V9KA 4HDHA 5AXKA 1CJVA 2IVFB 1IKWB 1JK9B 4ZITA 2Y9HA 2PGCA 5KTQA 3PRBA 3M8QB 1NSAA 4QR1A 4Y34A 1X4FA 3FSXA 1LK5A 5C42B 4DLGA 4C8LA 2VG6A 3JYTA 2EWHA 1RT7B 3DKDA 1IKXA 2NZCA 1W2IA 5HBMB 2LMIA 3EGNA 1WG1A 2AEFA 1VLYA 1N56A 4X4VA 2H65B 5F8JA 3T1AA 3BGUA 5U47A 1VQ7S 4AUKA 4C48A 4A8FA 2QLJB 3Q22A 3V6DB 2DR8A 4K0KJ 3DOKA 5GMKa 2AT1B 2NS1B 3E3XA 3TZXA 4DZ6A 3N6LA 1N33J 2ZWPA 1Q0NA 5DLFA 1T9UA 3HVWA 1VQ5S 2I6WA 1CS4B 1OO0B 1Q8KA 2EFGA 2N4DA 1QTNB 1SB6A 2VV5A 4JBCA 5THWA 3UD4P 1HNXJ 1FKAF 4W92B 2IVYA 1X7VA 1TVRB 1IM6A 2HGNA 2RU9A 2HFUA 1HWIA 4FXWA 4M5IA 3TA2A 2RQCA 5BR8F 3M9NB 5HROA 4D3HA 3CCSS 1R3NA 2CQ0A 3IRXA 4IO9Q 3L4BC 3MPVA 1JJ4A 1E6VA 1U2RA 2XWYA 3CCTA 4NI2A 5L9XA 2RB7A 1FNOA 3B4DA 5T7LA 2HAFA 1XC9A 4X4SA 1SL1A 2L41A 1X9MA 2KT3A 4F8RA 1UL3A 2F1FA 2XHWA 4F4KA 2HVDA 3GPAA 3N5BA 5D4PA 2W7PA 1SQFA 3CDUA 3MMJA 5ETSA 2FJDB 3T1YF 1ZAVA 4N7TA 1NCLA 5CYMA 2YWHA 1FE4A 1PGZA 1PILA 3IC1A 3HKWA 1LWXA 3R2CJ 3JXOA 5L39A 1T0TV 4NYOA 3M8PA 1BC6A 3ILIA 3Q2SC 1TU0B 1OQ3A 1RZMA 1VRTB 4TN2A 3HCXA 5DDPC 1N33F 3CJTA 4ZHRA 1NRKA 4HTJA 1VQOS 1IBMJ 3QRPA 4I67A 2I8EA 3QWUA 1EX8A 4JV2A 3N01A 4I64A 4EZ6A 1CC8A 2CNNB 3VAKA 4DG1A 1HNXF 1MU2B 2GCFA 2YNHA 2FLPA 2DNLA 1F5CA 4OI1A 4NYZA 3H20A 2RVJA 4HKQA 2QV6A 5KFDA 2H54B 2J0QD 2KT5A 5C24A 3PW5A 2Q6BA 4E0DA 4RLEA 3RBDA 4YR0A 2RHSB 2ZVSA 3C6UA 4OIXA 5KFYA 4CLSA 2ZH7A 4LF5J 1GXUA 3HT3A 2PEBA 4M5HA 3LW5C 2DB1A 2N4CA 2Z56B 1XR7A 1BY9A 4FBTA 3MGJA 1TFYA 1WC6A 3G96A 4FS1A 5KT7A 2DTJA 2OTJS 4ILLA 4A47A 2WOMA 1RSCA 5BYRA 2ZUGA 4J9SA 4ZLLA 1X5TA 2DHXA 2UXCJ 3T5HA 2JRSA 4I7FA 5GAHU 3A8JA 1K0VA 4ZPAA 1N4LA 1Y3JA 2XMJA 3MM6B 1PYSB 4ENOA 4Y2AA 4EGLA 3HULA 3PYEA 2VG7A 2J7KA 1OPIA 2ALYB 4WP3A 4X2BA 1TP7A 2F9JA 4ECWA 1IVZA 1XMQF 2MSTA 1QLNA 5H1SV 2DGWA 1XMOJ 4Y2IA 2HYIB 2KTQA 1RTHA 1DQAA 3C66A 3F41A 4RW7A 1FI4A 4MYUA 3OV7A 5HMYA 2UUCF 3CULA 2J76E 2ZD1B 2GVZA 2RMLA 3DLGA 4A8QA 4PRFA 2A10A 3FSYA 2FY8A 2PEHA 1WDTA 3D0GE 3GV7B 4USHA 3UCZP 2MZJA 4IRCA 4ZN3A 2ZNYA 2O5DA 2CDQA 3Q8SB
chains in the Genus database with same CATH topology
1G6BA 2AJQA 4F2RA 2Z4PA 2YNFA 1JLGA 1RYRA 2K1RB 2OFGX 5CHCB 2RQMA 2EI5A 4URQU 3OQ2A 2XSJB 2MDAA 3BSAA 1NJZA 1YGYA 4KB7A 1S6PB 4HTIA 3MUTP 4QZVB 3FEYB 3GV5B 2YWFA 3AA9A 3BGRB 3OVSA 1CVJA 1L3VA 1QVFR 3BS9A 3K2YA 4NZ6A 3CSKA 4RKUC 3D1OA 3T5LA 2D74B 4ECVA 3T5JA 1AFJA 4X62F 4A8WA 4JV5F 4LIWA 3H98A 3KHLA 4DR1F 3SYZA 3S1TA 1I6JA 1ZM9A 5H9EJ 5KFCA 3MFHA 2BRLA 1VOMA 2VODA 5B0BA 3Q24A 1H7WA 4Z37A 4E98A 4RWWA 3K0JA 2DGVA 3MMCB 3KLIA 2LQJA 4ELUA 1UWBB 1V3ZA 1Q8IA 3UDCA 3SZ2A 1Y9OA 3DDKA 2K8GA 3LP0B 1FEHA 2PMZD 5F8HA 4ELTA 1Q8BA 3K59A 2EFQA 1KLNA 3CD6S 2C28A 4IFYA 4R8UB 3PX6A 4X4NA 3U1LA 1CEZA 4CNZA 2DGUA 4DF8A 5HMXA 1DTQA 4Y2MA 4IOBA 2HHQA 3PZPA 5CZXA 2HQIA 3OVAA 2AYBA 3MEGA 2PC6A 3KNAA 2KZMA 4N5SA 3KYLA 3LWLA 4I0WA 1R27B 2PA8D 3DI6A 3AA8A 3SDEA 3QGPA 3JSRA 4DN0A 1S0NA 1TQLA 4OZJA 5D77A 3PX0A 3E51A 2WHOA 4NLVA 3FSIA 1YVFA 4LQ3A 2KFZA 1UFLA 4G1IA 3HP6A 1REVB 3TW0A 1D3WA 4UY8T 3LP1B 3N6NA 1HPZB 1FERA 2OLWA 1VC0A 3OL9A 3BQ2A 3BR8A 4TYBA 4J9LA 3SEOA 1S77D 4OZ5A 1VIOA 5CH7B 4B17A 4ECQA 4WZQA 4ED7A 4ERDA 2APOA 3QWPA 1S1XA 3OFHA 1C2PA 2CQBA 2OMOA 5D4LA 1VQPS 1JLQA 1NHUA 2JWNA 1D9FA 3I82A 2EFVA 1TZ0A 2JH3A 2YKNB 4NLPA 1BWEA 1YITS 1NK9A 2HWIA 1VQSA 4WYWA 1MROA 1U1OA 4Y0FA 4WFAQ 1FXLA 3MEDA 1S6PA 1R89A 2E44A 2HPUA 3DOLB 4ZMMA 1ZM2A 2CPJA 1IQTA 2K1RA 3ISNC 2VA2A 4BCAA 2CZVC 4ZP8A 1OWXA 1KQGB 2WBRA 2DPIA 1S9EA 2EK6A 1JLQB 1Q8LA 2XB2D 1J5EF 1RKJA 1VQ8S 2KRRA 2QA4G 1RT1A 2EFPA 3HPOA 2QT7A 2O3DA 3HMJG 2PFFB 1D8ZA 5KOWA 2QEXS 2SXLA 2ASJA 4H54A 1RTDB 3FDSA 3N6MA 2NREA 5FDLA 2DD8S 2IMOA 4J9NA 5KT5A 4B9VA 2F8EX 5J1EB 3CPWR 4MTPA 1REVA 4EYIB 1TAUA 3H5UA 2DK2A 5KT3A 3MM5B 2K7KA 2VH7A 2ZDOA 5A8KA 4U6PA 2NXUA 1ZBTA 2XULA 1LW0A 1XR6A 4IDKB 4AFFA 3QIDA 1YRUA 1ULRA 3D0IE 1FVQA 5EWEA 2BANB 2DBBA 1JIHA 3PFEA 3KJVA 4OI4A 2KXNB 3BO4A 4DDFA 3I5BA 4WF9Q 2DO4A 3L7OA 1IKWA 3QPIA 4BWMA 4Q8EA 2AF6A 4F3OA 2ZM6F 2XLJA 2UXCF 2QMWA 1ZAWA 1DAXA 1E6VB 4DMZA 2CKWA 3R27A 5L1KA 2F4VF 1C4CA 1X8DA 2JLGA 2EFOA 2IHR1 2G9OA 4NCGB 4ALZA 5L9NA 3C2PA 3D54A 3OFGA 2HRUA 2VFSA 5EGYA 3G9CA 4DQIA 7FD1A 1K1SA 3DLKB 1KQFB 4J9PA