4WXWA

Sadc (323-487) from pseudomonas aeruginosa pao1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
VATDELTGLFNRRHFMRMASRALEDLLPNRQHGLALIDLDHFKRINDRHGHAAGDRVLQTFAAVARSCLRDGDVLARYGGEEFVLLLPHADAEQLESCCERLRLAFQQAEPVGVTVDTLSLSVGMTLLYADDDLDEALQRADQALYRAKRGGRNRCDATWEVTSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
publication title Crystal structure of SadC (323-487) from Pseudomonas aeruginosa PAO1
rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase
total genus 56
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wxwA00
2FVRA 2FVCA 3CDWA 1SUQB 1RT1A 2AX0A 1RDRA 1S1VA 3ITHB 2JEIA 3QIDA 2BR0A 1U09A 5CYQB 5KT4A 4MFBB 1C1CA 3MTKA 1IKVB 2R2SA 2YNGB 3QGIA 3QO9A 2OPSB 2XGPA 4NLGA 4RW6B 3GIKA 1QUVA 4ZP7A 2V0NA 4QWCA 4DL7A 1SV5B 5DGAA 4IG0B 2WOMA 1D1UA 5EWGA 5J2MA 1JLCB 2E9RX 1RT2B 3QLHB 4NRTA 5HBMB 5FDLA 4ED6A 4O3PA 4RNOA 3QZ8A 3DM2B 3MF5A 1Z4UA 2D3UA 4ZVHA 4EBDA 3QZ7A 2ZE2B 1RTJB 5EUHA 1N6QA 5KFEA 2VA2A 2IAJA 1TKZA 3MECA 5L1LA 4GC6A 4ZPCA 1RAJA 4U6PA 3DMJA 1ZTTA 3OL6A 3GIJA 4ZHRB 4RNFA 2IM1A 5JXSA 1J5OB 1JLAA 3CJ0A 2BANB 5KFUA 1NHUA 3KLEB 5L1JA 4ID5B 1QAIA 4ZMMA 3I0SB 3LP0B 4KHMA 1S6QA 4KSEB 3OL8A 3BSCA 2RF2A 3MR6A 3NGDA 3G86A 3H4DA 2BRKA 4IKAA 5K14A 4OL8A 1FKPB 4J9QA 1DTQB 4U7CA 1IM4A 3ITHA 2WK4A 1RT5A 4TYBA 4JV0A 2OPQB 4RU9A 5KT6A 4IR1A 1RT7B 5CYQA 2HNDA 1DLOB 4MFBA 3EPGA 4O3RA 1S1WB 2XCAA 2FJXA 3OL9A 4Q44A 4URSA 4QW9A 1IKVA 2YNGA 1RTIB 2RKIB 2OPSA 4RW6A 3N6NA 1BQNA 4J9SA 5DQGA 4IG0A 4KO0B 3FFIB 1JLCA 2AX1A 3CJ2A 1RT2A 3QLHA 4IDKB 2JC1A 4MIAA 4LSLB 4RW8B 5HBMA 3MFHA 5KFBA 2W9AA 3G6XA 4J9MA 1K1QA 3DM2A 4NLOA 1K1SA 1S48A 2IM3A 3KHRA 3UPFA 1TKXB 3QYYA 2C22A 2W9BB 4ZP8A 1RTJA 4PUOB 1T05B 4O4RA 5HP1B 1XR7A 4Q8EA 3NKYA 1MU2B 1T94A 3BSNA 1KLMB 4XO0A 2AGQA 2J6SA 2HMIA 2J6TA 4ECRA 3SFGA 4ZHRA 2QE5A 4YR0A 1RYSA 5KFWA 1FK9A 3H2LA 4KKOA 1J5OA 1MMLA 2BANA 3DLGB 2ZD1B 3GIIA 5KG1A 3KLEA 2FJVA 4FBTA 3KNAA 4ID5A 1IKYB 4NLWA 3IS9A 4NLYA 2HAIA 1HPZA 4WYLA 2UVUA 5KFJA 5J2NB 5KFMA 4M94A 3Q8PB 2OPRB 4XPCA 1RA7A 1FKPA 4F4YA 3V6KA 3LP2B 1DTQA 1EETB 2F8EX 3CIZA 1C0UB 3KK2B 3VQSA 2OPQA 3BSAA 2V4RA 4EBEA 1I6JA 2UVWA 1DLOA 4KE5A 3OL7A 1S1WA 1LW0B 1EP4B 3C6TB 1RTIA 4MKAA 3LALA 2JEJA 3BR9A 2IM0A 1SH3A 1S4FA 3UDLA 4K50A 5C24B 3BQ2A 3Q8RB 4ECSA 1N48A 4NLXA 4KO0A 3FFIA 5KFXA 4IDKA 4RW9A 3PJXA 4LSLA 4ECQA 5C42A 5KFKA 3I0RB 4ED7A 3G6VA 1TKXA 1D0EA 3GV5B 2IA6A 2W9BA 1XR5A 3H5UA 4PUOA 1T05A 2YNFB 5C25B 5HP1A 3KJVB 1MU2A 5KFLA 2WONB 1KLMA 2YKMB 1GX5A 4ECZA 3LP1B 3N6MA 3LANA 2XCPA 2WHOA 4QWAA 4HYKA 3LAKA 2UVVA 3NL0A 5DLGA 3KMSA 5DG9A 3DLGA 1S6QB 2ZD1A 1QAJA 2IMWP 4ECXA 3IRXB 1C2PA 1IKYA 3DRSA 2JEGA 5K14B 4MKBA 5J2NA 1SH0A 3M8QB 5J2PB 4IQXA 4R8UB 2R8HA 1S1UB 2OPRA 4QW8A 4QWDA 2QV6A 3OLBA 3FDSA 1RT5B 4PWDB 1GX6A 2CJQA 2JC0A 4ZVGA 3LP2A 2HNDB 1EETA 3NBPB 5F8GA 1C0UA 5L9XA 3UR0A 3KK2A 4F4WA 3PW4A 3RB3A 5DG8A 2W8LA 1S6PB 2V9WA 1JKHB 2ILYA 4F4XA 1LW0A 3IN5A 1EP4A 3C6TA 4NLSA 1VRTA 3MFIA 1BQNB 2AWZA 3BREA 1TKTB 2IJNA 2C2RA 5C24A 1DTTB 3EZUA 1S49A 3M9MB 5KT3A 3GILA 4F4ZA 2FLPA 3RAXA 1HYSB 4LQ9A 3T1AA 4B3OB 3CDUA 4G3IA 2DPIA 3H98A 2IC3B 4ZPBA 5T14A 3C6UB 3TAMB 4J9RA 3RB0A 2BQUA 2FLLA 3I0RA 4K4YA 4WXWA 3I5BA 4WZQA 2XI3A 3PW0A 1WNEA 5KT2A 3NMAA 2HWHA 2OPPB 3MEEA 5HROB 1TP7A 3H5SA 2YNFA 1QE1B 2VG6B 4WE1B 5C25A 3KLFA 4ECWA 2HMIB 3KJVA 4ECVA 3MEGB 3FSIA 1TL1B 2WONA 3D5MA 3DLKB 4NLVA 2YKMA 4EO8A 4PQUA 3DRPB 3E01B 3LP1A 5KG0A 1FK9B 3DRRB 4KKOB 4TQSA 1RT6B 5CYMB 4XPEA 2B5JB 2R2RA 3IS9B 4J9NA 3KHLA 1HPZB 2HNYA 2C2EA 3IRXA 2BQRA 2YKNB 1JLBB 5J2QB 4Q0BB 4WXOA 1KHWA 2IJFA 2GIQA 4TYAA 3QGHA 4F50A 5J2PA 3M8QA 4ECUA 4R8UA 3V4IB 1S1UA 1C1BB 4PWDA 3BJYA 3OSNA 4TLRA 5L1KA 3RB6A 4IRDA 1IKWB 3NBPA 4ZVEA 3DYAB 2UVRA 2R8JA 3H40A 3CJ4A 1S6PA 3CVKA 1JKHA 1HQUB 3PJWA 1NNDA 2HNZB 4DG1B 3KK1B 3HVAA 4URQU 5KFFA 3IGVA 1TV6B 3E51A 4RW4B 4O3NA 5L1IA 1TKTA 3T5KA 1DTTA 1RA6A 5F8NA 1JLEA 4RW9B 1S9GB 2UUTA 1HYSA 5C42B 5EWFA 4K4WA 4B3OA 3FRZA 3OHAA 2IC3A 4J9PA 3C6UA 3TAMA 4DL3A 4KHRA 4Y2CA 4Q43A 1LWCB 4RNHA 5F8JA 2D3ZA 4IRKA 1RTHB 2R2UA 4EEYA 2AQ4A 3NAIA 4Q45A 2OPPA 3PVXA 5HROA 5KFRA 4NLPA 2R8KA 4WE1A 1QE1A 1HNIB 2GIRA 2VG6A 4NCGB 4H4MA 5C5JA 2W9CB 1SH2A 4K4XA 2ILZA 3MEGA 1TL1A 1CSJA 3DLKA 4I2PB 1S0OA 3T19A 4YR3A 5EWEA 2E9TA 4K4UA 5KFIA 3DRPA 3E01A 3BGRB 5KFPA 4IH5A 2YNIA 3DRRA 4J9LA 4DL5A 1HQEB 1RT6A 4QWEA 2IBKA 5CYMA 2B5JA 3CJ3A 4O44B 3DRSB 2FLNA 1FKOB 3D28A 2BE2B 4ECYA 5I3UB 2YKNA 1JLBA 5KT7A 3Q8QB 4TY8B 2W7PA 5J2QA 4Q0BA 4J9KA 3UQSA 3KK3B 4WZMA 1BQMB 4DL4A 3V4IA 3PW5A 4K4TA 1C1BA 3DLEB 5F8LA 5D3GB 4Y2AA 1IKWA 1S0MA 3DYAA 3HHKA 1RT4B 4MK8A 3HVWA 1RYRA 3OHBA 2FJWA 1HQUA 1VRTB 2HNZA 4G1QB 4NLUA 4DG1A 1XR6A 3FQKA 3KLVA 3KK1A 3RBEA 3PZPA 4RZRA 1TV6A 4LSNB 4IFVB 4RW4A 3V81B 2XI2A 4TN2A 2RDJA 1T3NA 3KOAA 2ASLA 3MR3A 2WTFA 3I5AA 1S9GA 4MK9A 2FVSA 4EYIB 3OLAA 3IG1B 3DOLB 3PHEA 1R0AB 4YR2A 4DEZA 4QPXA 1LWCA 1JIHA 1RTHA 3MEEB 2WB4A 3QIPB 4NLTA 3KLFB 3M9OB 3BQ1A 5DQIA 1HNIA 4NCGA 2W9CA 4PQUB 1S1XB 3H5XA 4I2PA 2B6AA 3PW7A 5F9NA 2HWIA 5KFYA 3JSMB 4K4VA 3BGRA 1HQEA 2ALZA 4Q8FA 2HNYB 4I7FA 4ICLB 5I42B 3MEDB 4YMEA 4O44A 1FKOA 5KFDA 3H59A 2BE2A 1RTDB 5I3UA 4K4ZA 4TY8A 5KFQA 5KG7A 5KG2A 3KLHB 3H5YA 3GV8B 3KMQA 2D7SA 5DQHA 3KK3A 1BQMA 4JV1A 4K4SA 4TXSA 5KFTA 1T03B 3DLEA 3ISNC 1ZTWA 5D3GA 4O4GB 2GC8A 4J9OA 4ZPAA 5F8MA 2AGOA 1RT4A 2ZKUA 2W8KA 4IRCA 4G1QA 4I2QA 1VRUB 2W7OA 3G6YA 4IG3B 2OH2A 1S9EB 4LSNA 4IFVA 1JLEB 4ECTA 3V81A 5KFZA 1N5YA 1HARA 3GQCA 2XWYA 4NLRA 3DDKA 3GYNA 3KLGB 1N4LA 1HMVA 4JV2A 3V6JA 1R0AA 2CKWA 3DOLA 3IG1A 4O3OA 5DGBA 2VG7B 3FQLA 3CDEA 1HNVB 4EO6A 3QIPA 4NLQA 4H4MB 4KBIA 4WFZA 2I1RA 1IKXB 4R5PB 1RT3B 4IOBA 1S1XA 4KB7A 1UWBB 3V6HA 4DL2A 3CJ5A 1C0TB 2YNIB 2VA3A 4FS1A 3JSMA 2R2TA 1JLGB 3T5LA 4ICLA 5I42A 1TVRB 3MEDA 3KLIB 4KV8B 3SFUA 3RAQA 2AU0A 4DL6A 3PW2A 1RTDA 3PR4A 3N6LA 4IH7A 5KG6A 2YNHB 3KLHA 2RDIA 1REVB 1T03A 2ASJA 4RUCA 3DOKA 3PR5B 4H4OB 4ZP9A 4O4GA 4Y34A 2FVQA 4ZVFA 3RBDA 4RNMA 3ICLA 1VRUA 5DG7A 1LWEB 4IG3A 1ZETA 4ED8A 2O5DA 1S9EA 1TL3A 4ZP6A 1KHVA 2E9ZA 5F8HA 2UUWA 3Q8SB 3KLGA 4LQ3A 3DI6B 3IGNA 4M95A 3CO9A 2WRMA 3T5HA 1SUQA 1NHVA 4URGA 5F8IA 4RW7B 2AGPA 4HKQA 1S10A 1JLQB 2VG7A 4IFYB 2FVPA 1HNVA 2I5JB 2XC9A 3M8PB 3GIMA 4IR9A 2R8GA 3EPIA 1LW2B 1IKXA 1LWFB 3CWJA 4R5PA 1RT3A 2B6AB 1UWBA 4NLDA 4WYWA 1C0TA 1SV5A 4KFBB 4JUZA 3BQ0A 5HLFB 2DPJA 4FBUA 4I7FB 4NYZA 3HKWA 5KFGA 1S1TB 3BSOA 4H54A 5KFSA 1N56A 1JLGA 4Y3CA 3TVKA 5J1EB 2VG5B 3KHHA 1TVRA 4MIBA 3KLIA 4KV8A 2EC0A 1JXLA 4ED2A 1TQLA 1W25A 2YNHA 2ZE2A 3V6DB 4WFXA 4FS2A 2J6UA 1REVA 3KHGA 4H4OA 1JX4A 2BRLA 4RNNA 5F9LA 4I2QB 4TY9A 4YP3A 1JLFB 4QWBA 5EDWA 3I5CA 5KFOA 4TQRA 3TQ1A 3HVTB 4O3QA 1LWEA 3JYTB 2ATLA 1OS5A 1N5YB 2C28A 3I0SA 3LP0A 3ISND 1HMVB 4KAIA 5JUMA 1RT1B 3DI6A 1S1VB 2V4QA 1C1CB 4RW7A 4IH6A 1JLQA 4IFYA 1RT7A 2IM2A 5KFHA 1YVFA 2D41A 2I5JA 3QO9B 3M8PA 3OSPA 1LW2A 2RKIA 1LWFA 5KFNA 3NAHA 4RUAA 2WOMB 4ED0A 2B43A 3QGGA 5J2MB 2XGQA 2BQ3A 4KFBA 5HLFA 5FDLB 3M9NB 4YQWA 2WCXA 4R0EA 4NZ0A 4RW8A 4ED3A 5KT5A 1S1TA 3GV7B 4EYHB 5DLFA 2C2DA 4MK7A 4ZPDA 5J1EA 2VG5A 1S0NA 5KG3A 3RB4A 1N6QB 1S9FA 2IAJB 3V6DA 2ASDA 1TKZB 3MECB 3DOKB 3DMJB 2R8IA 4EBCA 5KG5A 3MR2A 4ED1A 3SI8A 4X2BA 3T5JA 4GC7A 1JLAB 4WFYA 5KFAA 4O3SA 2JLEA 1JLFA 5KG4A 1S97A 3LAMA 3H4BA 2JEFA 3HVTA 1TL3B 5KFVA 3MR5A 3JYTA 4MH8A 2RF2B 5KFCA 4NRUA
chains in the Genus database with same CATH superfamily
4DR1F 1QAYA 4M63A 5CAAA 4RR5A 2WBMA 2Y1JA 3QGIA 2VICA 2O67A 2XGPA 4DPWA 5GMKa 1QUVA 1NK6A 1HW9A 2B7CB 2WOMA 4OYPA 1RT2B 1VQMS 2BJDA 2HFUA 3MF5A 2ACMA 4ZVHA 4DSJA 1RTJB 5KFEA 5L1LA 4AXIA 1GXTA 3F73A 2BM0A 1J5OB 2BANB 1R0CB 4KIAA 2YKQA 1PAEX 1NDLA 2RJZA 4OL8A 4JV0A 2KFYA 2XCAA 4PXDA 3MM8B 3OFHA 3QRRA 3HX9A 3IP0A 2CPZA 4IG0A 4UOCA 3MFHA 2J7WA 2J0QD 1RHMB 1GEHA 2MHEA 2AGQA 4EUVA 4ECRA 4ZHRA 2CQPA 5LT5A 1RYSA 1FK9A 2MGZB 1RAHB 2HIQA 4ID5A 1LV5A 2PSZA 4JI4F 3VQSA 1I6JA 1YBUA 1VQ4S 1K9MT 1K0TA 2CPFA 2HHPA 2NYIA 2IM0A 4P74A 3AB4B 1VQLS 2FZKB 4NX9A 2JLFA 3FC9A 4DUZF 1QJHA 5A8KA 1L3UA 4EZ6A 3OR1A 2LEPA 3PACA 3GYXB 3DU6A 3IRXB 2W8LA 2ILYA 3VALA 2G9OA 1R43A 1MSWD 1J5EJ 2IYGA 2W1BA 5AXKA 3SCIE 2A1BA 2Z2ZA 5FJ4A 4YHHJ 3CF5Q 4ZVTB 4OYMA 4GVBB 4DFMA 1WNEA 3NMAA 2HFOA 4I64A 1IJFB 1R8PA 2PE8A 3E01B 2K1RB 3MM5B 2V9KA 1Q5YA 2B5JB 4Q0BB 3HZGA 3CJKB 2LQ5A 1YKWA 4LFCF 1XN9A 1NNDA 4URQU 5KFFA 3IGVA 1OJ4A 2D1CA 1CQNA 2CPJA 2LFVA 5H9FJ 3D0GE 5B09A 5L39A 1RAFB 1TK8A 2CAJA 3E8OA 5KFRA 4DZ6A 3TEGA 5LM7E 1CSJA 5KFIA 3ZO7A 5BYQA 1RT6A 3CCWA 1JLBA 2VBXA 3OTBA 3WC0A 3V4IA 1SKSA 2XMWA 5FLXY 1IR1A 1RYRA 1D8ZA 1HFEL 2XWXA 4ED4A 5AJ3J 1XR6A 3KLVA 5E3RA 2UUAJ 1T9TA 4IFVB 4TN2A 3KOAA 2QMUB 4ZA1A 1UCNA 4USWA 3JTPA 2GHWA 3AA9A 3GIRA 2GW8A 3M9OB 3MOJB 4J9UE 5DQIA 2ZZTA 1S1XB 3H5XA 5H9EJ 1N8RT 2DTJA 4NA1A 2BE2A 3R5DA 3KLHB 2QLWA 2K8GA 4JV1A 2F7VA 3TWZA 2W8KA 4I2QA 2JSXA 4DSKA 3JSBA 3JAMY 1U1MA 2ZHOA 5CQGA 2AEFA 1KR4A 1IBMJ 1XMBA 4X62J 3LPYA 1YHQS 3QIPA 2GCFA 1FDBA 2MZTA 3CJ5A 2V2KA 1OO0B 2XMAA 3SZ2A 2ERRA 2HS4A 4OJ3A 1X4EA 2HBRB 4LUBA 3FUYA 3PNIA 1BGXT 2OFHX 1RAOA 4BHQA 5HQLA 4CLZA 3P45B 2VC1A 1QY7A 2RSQA 2IDEA 1N36J 4URGA 1N33J 2FVPA 2X3GA 1Y7PA 5IZHA 2J8SA 4AD6A 5KOWA 1RT3A 5U47A 4NMLA 5A0YA 2C3YA 2Z8QA 4JI3F 4QZVB 3J81Y 1KD1T 2GAGC 4EU0A 1FE4A 2H3EB 4Q7AA 3J80Y 5F9LA 1RWMB 3I5CA 4PG6A 1RT1B 3OW2R 2W25A 3WZ0A 4LFBF 2UU9F 2MZ1A 2C3MA 3RAMA 2ZBCA 1FXLA 4RO0A 3OJSA 2C2DA 3HHLC 5GMDA 4IO1A 4CNYA 3HULA 3Q0AA 2CQ2A 4ED1A 3HPOA 1UZDA 2H5JB 3TUJC 4WFYA 2Z0GA 2KU7A 3O8WA 5KT4A 2P9CA 3QIDA 3UCUP 1U09A 3W2WB 3TZZA 3HHDA 4KGXB 3QO9A 1DURA 1MW7A 4A8YA 3K57A 2ROPA 3ZFVA 2CWKA 4QOTA 1DQAA 2CDQA 1RWUA 1GH8A 2CYYA 2JNJA 2UZAA 4EBDA 3POTB 4UQTA 4PABA 4PPZA 3LGNA 1RAEB 2GO8A 4DR4J 2YQ1A 3QNWB 1IBKJ 4ZMMA 1E6VA 2DIVA 1FKPB 4C11B 2WK4A 1HHTP 1XIQA 4OX6A 1BQNA 3K5MA 4KO0B 1RT2A 4MIAA 4J9MA 1DY3A 1WWHA 4M5LA 3SQGA 4PG4A 1JNZB 3UPFA 2FTRA 3WIUA 3QRPA 3MI7X 3OTCA 1RTJA 3AXMA 1HNZF 2HFZA 3HT0A 4GKJJ 4X66J 3NKYA 1J5OA 2DR7A 2BANA 3GIIA 2CVEA 1F60B 1GMWA 1NM2A 3RBXA 2X51A 4AXJA 2V4RA 2FGCA 2QC3A 5L8RC 1P1TA 4MKAA 3M2UB 1UMJA 3CT9A 2BMBA 2E7XA 3BN4A 2KRRA 5C25B 1C4CA 3HFVA 3DN9A 1PYOB 2MGZA 2BA9A 5HQMA 1Y00A 3M8QB 5J2PB 1KSPA 2FYXA 2LQ9A 5HVHA 5DG8A 3PX4A 4OI0A 1FERA 3FCVA 5EX3A 3M9MB 3GILA 4DLGA 2NXNA 4G3IA 1R7IA 3PW0A 3F56A 4UZCA 4AQYJ 4DWIA 2ATCB 4X4VA 5CZVA 3WDOA 2ZH1A 3IRXA 2IJFA 1CBKA 4TLRA 4WP8A 5H1SV 3CVKA 1RA6A 4LRAA 2CQCA 1KQKA 3Q8UA 4KHRA 5F8JA 1FRJA 2D3ZA 3NXZA 2KJVA 4CLPA 5EX0A 4N47A 1CJUB 1VLYA 4I6WA 5DO2A 3GR0A 3E01A 4J9LA 2K1RA 3MM5A 2CADA 4QPTA 4QWEA 2B5JA 3M7VA 5I3UB 2CUYA 4Q0BA 1QD1A 3CJKA 4V1Ak 3PX6A 5F8LA 4HL9A 2YH1A 2MTLA 5AXLA 5HI7A 3V81B 2RDJA 4FZVA 2ASLA 3MR3A 1U02A 5DM6Q 3OLAA 4QIVA 3T1HF 1JIHA 3EX7B 3WX8A 1NRKA 1NMEB 2ZOGA 3ILJA 3EZ5A 3JSMB 2W7AA 4ICLB 4NYOA 3H59A 1BD6A 4HH1A 1RTDB 2VOPA 1VK8A 3CGIA 1FTCA 4KTQA 4WK1A 1B0TA 1WACA 1S79A 4IFVA 1N5YA 2V6AA 3IRWP 2XWYA 3VAJA 2M4MA 4K5SA 3SYZA 2Z56B 4RBTA 1S1XA 4KB7A 2U2FA 1T9YA 2VQFF 1U2CA 3I55S 3PW2A 2BVZA 2KKHA 2F9JA 3KLHA 2YNHB 3QGPA 3MM7A 1X5SA 4B08A 1HNXJ 4RX6A 4MIWA 2V8GA 3C15B 1N5TA 4ZVFA 3C8YA 4DSFA 2HQGA 2YX4A 4R0JA 4QR2A 2PT0A 3GU0A 3CO9A 1AFIA 5D0RA 3W65A 3GIMA 2UXDJ 3ZTRA 4FXWA 5DS7A 2WW8A 5D4PA 2VG5B 2EC0A 4A8WA 1JXLA 3V6DB 1UVJA 1VI7A 2KL8A 2HPUA 2E1RA 4P7TA 2DNKA 2P6TA 1FEHA 4OI2A 2XEXA 1PYSB 2B3TB 5M2PA 4YOEA 1U1NA 3LP0A 1SQGA 2QL5B 3PRVA 4K2JA 2DITA 4MYUA 1HKAA 1RT7A 1UFLA 2Q66A 4W90B 1UA1A 2RKIA 2XGQA 5A2QY 1Z2ZA 8AT1B 4TU8A 1TMJA 2DGXA 2CJXB 2OSQA 2CPYA 3RB4A 2MZQA 1S5ZA 3CJQA 3AA8A 1YWXA 4OYAA 1HI8A 1FHTA 5G0RB 2LXFA 1JLAB 4HT7A 3RG6A 3KUHA 1RT1A 4DSLA 1B0PA 1XMQJ 2ZJQQ 1WORA 1RKJA 4RW6B 4C8KA 2EW9A 1RLDA 1XBWA 2DR8A 1RBOB 3BKTA 2RQ4A 2MB0B 3SV4A 2QYCA 4N8NA 4F04B 4ZPCA 3KUEA 3VV2B 3OL6A 4FF3A 5L1JA 3CMQA 2FIUA 4QYZJ 5IT9U 2AYMA 1K73T 2ZHAA 1DLOB 3W2WA 4CZCA 4URSA 1WG1A 2IVFB 4YDDB 4TLQA 1NZ8A 2XS2A 2BACA 1UETA 2UXBF 2WSFC 4OYZA 1S48A 1WOSA 2QSWA 1TKXB 3POTA 4O4RA 3MUVP 1KLMB 4XO0A 2LMIA 2DNPA 2J9DE 2ZD1B 4M5NA 5KG1A 5F0WA 5KFJA 3VAHA 1FKPA 4C11A 2UVWA 2D9OA 1LW0B 3C6TB 2RS2A 2P2CB 4ECSA 4KO0A 5KFXA 2CQBA 3EZOA 1HL6A 3A8IA 4C8MA 5ADZA 4MKVA 3MMJA 3H5UA 2YNFB 3MPUB 3N6MA 2ZH8A 4W98A 1QAJA 3PKMA 4F0HA 1SH0A 3UR3C 2GVZB 3OLBA 2GV1A 1BY9A 1FVQA 2RRBA 1WG5A 3C16B 3M2UA 1NU4A 5J1NA 1F0XA 1AROP 2SXLA 3EMTA 4OZ3A 4A47A 4RPFA 3MEEA 1YJVA 4YB7A 2VG6B 2B9WA 5C25A 4ECVA 5CYJA 4U8YA 4KKOB 3ISZA 2P9GA 2VFUA 2V8PA 5J2PA 3M8QA 4N7TA 4WIQA 1S59A 4DG1B 3HT3A 4BC9A 3E51A 4OHYA 1NK4A 1N32J 1RHKB 1RWNB 1TELA 1WC6A 1KS2A 3M6VA 2R2UA 1Q8IA 4FPRA 4X65J 1FFWB 2LXIA 1SB6A 3KG0A 5IM0A 1SJ3P 1UTAA 3CD6S 5KFPA 3BGRB 4WKRA 2YNIA 1NEEA 4FF2A 1D09B 4WCEQ 5KT7A 2RHQB 4DX5A 3PEJA 3KK3B 1BQMB 1T9VA 1M5KC 1F6TA 2HRTA 3HJVA 4NLUA 2UV8G 3AOBA 1VIOA 5D6GA 3L09A 3G8TA 2H1YA 1H72C 1N34J 3PHEA 1X8DA 4DEZA 2XY6A 1DRZA 3PYFA 3PKYA 3K89A 1CJUA 3NCPA 2R42A 1TAUA 4M1KA 3MEDB 2MYFA 5I3UA 1U6FA 1RWXB 4RJVA 5KFQA 2BM1A 1SCJB 1WI8A 2OMOA 2U1AA 4P52A 2JZ5A 3RW6A 2HVDA 2EEYA 3V81A 3ENVA 3VGSA 4NLRA 4KGVB 2CQ4A 4BDPA 2CKWA 2QFJA 2VQEJ 1JJ4A 2VV5A 3JSMA 3IC1A 4WJBA 4ICLA 3DHXA 1U1QA 2ZFHA 1RTDA 3PR4A 2GA7A 2XO6A 3CE8A 2F63A 3OQ2A 3ZZYA 3IGNA 4RW7B 4QIEA 2XC9A 2A0FB 5B0DA 2QA2A 3QSYB 5HANA 1S1TB 2RVJA 2VUGA 1IJEB 4L6V3 1HBMB 2YNHA 4DFJA 3ZZRA 4B9UA 3C15A 4LMZA 3B8HA 3JYTB 2C28A 4TNOA 1QM9A 3R5JB 4GKKF 4ZCKA 2EFNA 5GAEI 4CO2A 3QJPA 1FRKA 2HK3A 2VG5A 3GJRB 1RU2A 3QJJA 3V6DA 2JVOA 3MECB 3R6GB 3DMJB 1VBZA 1HLWA 1X4BA 1NJIT 5KFVA 3UN3A 5D77A 3LF0A 3IMQJ 1G6BA 3FZBA 4B17A 1E6YB 5CD4H 2B8PA 2XMJA 1S7IA 4OYOA 1RKIA 1VQ6S 4DPXA 3HI9A 1AW0A 4C8NA 1GMUA 4C8YA 2K06A 5E3QA 4G65A 1T0TV 2VODA 5G0RA 5JXSA 1JLAA 2DNQA 2DRAA 2EK6A 1S6QA 4U96A 2OUGA 2Z57B 4ETXA 2EFPA 4TYBA 4M5JA 4QW9A 4DV4F 4RW6A 2AZ1A 5DQGA 3U27A 2CFXA 4LSLB 3B78A 1K1QA 4WP9A 1SPBP 2XG8A 1U2FA 4PUOB 3JSYA 1MU2B 3EUNA 2MEWA 2HZVA 3CCLS 2YWHA 1EIYB 1FO1A 1HPZA 4PEOA 2HFSA 2Y1LB 4EBEA 1DLOA 3OL7A 4XDCA 3JQKA 1SH3A 4NLXA 1KP6A 4F67A 4ED7A 1TKXA 2KXHA 3DRYA 2MKHA 5JVHQ 2XYPB 2YX7A 1KLMA 3H42A 2ZD1A 4C3LA 5ETLA 2DVIA 4OV6A 5F8GA 1SIWB 2HNDB 2DO4A 5IT4A 3EVWA 1LW0A 2BV3A 3C6TA 4NLSA 1MMNA 1VRTA 3CJRA 3N28A 3VAIA 5FLXU 3D0IE 3HSGA 4DHVA 1LXJA 2VASA 2E1CA 2F4VJ 2P9EA 1RCOB 3AQPA 1U4BA 3FEZA 1TP7A 2YNFA 2KFZA 3MEGB 1CULB 4NLVA 2VONA 2GJFA 2C2EA 1HR0F 1DZ5A 1Q8KA 1NJZA 2DB1A 2GVZA 2CPDA 4DV0J 3O5TB 4K7QA 3CJ4A 1QAXA 4UUWA 3EGZA 3HVAA 3VVUA 3C16A 5SZTA 5F8NA 3UI3A 4Y2CA 4Q45A 1KFDA 1PKUA 3W5YA 2VG6A 3N5FA 4G6VB 2ZDPA 1UL3A 4KGMA 5D4LA 4DV3J 2BJEA 4WZMA 4DL4A 4JI7J 3MDFA 2HHHF 5D3GB 4DG1A 1X4AA 4LRDA 4O0IA 1DFDA 2MQNA 1T3NA 2FVSA 3UD5A 3IG1B 4OFZA 4C97A 1NPRA 1YJ9S 1KLNA 1Q16B 3R2DJ 3MPDA 2VBZA 1UEVA 1DHMA 3VAKA 1HNWJ 4LT6A 5F9NA 3BGRA 5I42B 2IRXA 3PFEA 5IWAJ 1YBTA 1RISA 1JNRB 3KK3A 1BQMA 4K4SA 2KXFA 1L5UA 4A4JA 5LL6d 3J81U 4ZPAA 4DX6A 2MLYA 5LSRA 2ZKTA 2KZZA 1ZAWA 2PDAA 4ZPTR 3GWCA 4QR1A 1DQ8A 3V6JA 5K8PA 2AJFE 1PIEA 2LDIA 4DI6A 4F0KA 1HI1A 4OZ0A 4DL2A 1VBXA 3MEDA 2Y1IA 3L95X 4M5DB 2ASJA 3DOKA 3K58A 3PR5B 4LREA 1JMTA 1L3VA 2B8QA 4FYYB 1FESA 5F8IA 2ZNZA 4P2XA 1RHQB 1FKAF 1VQNS 2QN6B 2YXLA 4OZJA 1VJWA 4ZS6A 4MT1A 4H54A 5J1EB 3KHHA 4DXLA 4PRFA 4NE9C 4I67A 4DJBA 2DD8S 3A8KA 2LKZA 3KHGA 4RNNA 1QSSA 2FPHX 4ALZA 4QWBA 4NCAA 3MPVA 4CIOA 1U1LA 1C1CB 2F65A 4RW7A 2YKOA 4WPAA 3TW0A 2Q79A 1TUWA 4NXNF 5D0EA 1GMWD 4NCBA 4NZ0A 3AQOA 1S1TA 1GXLA 1TFYA 2J9CA 3I31A 1VR6A 3D3BJ 2EFVA 4GMKA 1FT8A 3UNGC 1HBMA 1S9FA 2ASDA 1OY6A 4DF8A 4A8XA 4AL5A 1HBNB 2HKEA 5KG5A 4DU8A 4X2BA 3X1LB 1VOMA 4AT1B 3JYTA 4BCAA 2FVRA 3T9ZA 5RUBA 2DISA 4HTIA 3EYZA 1IKVB 4UF4A 2R2SA 4JI0F 3QQCD 4OI3A 1O8BA 1QDUB 3A3PB 2DHSA 1S99A 3BDEA 4PXCA 1R8CA 5K8OA 3B54A 1Z4UA 4P7VA 3MMAB 2H4WB 2QL7B 2VA2A 4ES1A 3MECA 2EC2A 1UKUA 2EBGA 3DMJA 1ZTTA 4LF7F 3EGVA 1WJ9A 1H2VZ 5I4MA 4JI1F 1WKKA 1E6YA 4A48A 1RTIB 3TARA 2E1MC 2O3DA 2V4JB 3FFIB 4TU9A 5D0HA 2RUSA 1NUEA 1VS3A 2W9BB 3K7RA 4ZOSA 3KWMA 1RZMA 3UDVA 5KFWA 2BEFA 2ZVSA 2WVEA 3GMGA 4CTAA 1FRHA 2FD2A 4B3RJ 4USVA 1RSCA 3T1HJ 1WC4A 3LALA 4AL6A 3H2UB 4DV7F 3BQ2A 4MTPA 3NGTA 3QT6A 4LSLA 2BKOA 2PGCA 5KFKA 2YWWA 1KVKA 4WK3A 2IA6A 3RRHA 4PUOA 3I32A 1MU2A 2F4FA 1NLKL 1ZPWX 4CWBA 2EG2A 4X4NA 4B3SJ 1C2PA 2KXNB 4JOUA 3MM9B 2FY1A 2KZMA 2ZH3A 3FDSA 1X0FA 2KTQA 3PW4A 3UR0A 1B0VA 3IN5A 2ZBPA 3AFGA 3I82A 5GAEU 2MQ8A 3S01A 3GONA 1DTTB 4WKYA 1HYSB 4JI6F 4ETZA 2I2YA 2AKWB 2ABYA 2XI3A 1JXEA 3R5GA 1YJUA 1WOOA 2H9ZA 2HMIB 4JI2J 1RABB 3ENWA 2A3JA 1KN6A 5LOQA 1V6HA 1N54B 1R0BG 4J9NA 2HS3A 3DYAB 1R27B 2HNZB 2J0SD 2K3IA 1G3OA 1IQTA 3HSDA 3MEGA 2MY7A 1CULA 3D7SB 1FDAA 2CQ1A 3AJ2A 3NWRA 3PW5A 1UEUA 1GQEA 4M8LA 2FJWA 3RRKA 3I6PA 3VZIA 2XI2A 4CNZA 3S6EA 3AJ1A 4NZ7A 4K5RA 4QPXA 4CO1A 4WFBQ 1RWWB 3KLFB 1PC4A 4DU7A 3GZ7A 6AT1B 2QGFB 1V5IB 1R31A 1XNRJ 4K4ZA 1XNQF 1NDCA 3MAAB 1ZM9A 5D3GA 3GJTB 1PJ7A 1FJGF 2ZKUA 2XSJB 1EZZB 4FYWB 4DMZA 3GYNA 1Y4ZB 3IG1A 3TQEA 3WHIA 1ZYQA 2E5LJ 5A8WB 4EGLA 3QAUA 3IBFB 2XQCA 1URNA 4KT0C 2KI2A 3MMCB 1Q4RA 3CC2S 2R2TA 5I42A 3N79A 1U7LA 2PEBA 1YJRA 3AOAA 5A2QU 4RUCA 4CLUA 1UVMA 1TL3A 1KHVA 4F3OA 2BX6A 3S8SA 4EZ9A 2AGPA 4HKQA 1Q7YT 4IFYB 5ETOA 3HF5A 2GMHA 2NPFA 3KG1A 1SV5A 1F2GA 2RQCA 4NYZA 4DR6J 2X1BA 4DF4A 3C2PA 4M5DA 4QBUA 5ETRA 2CZVC 1U0SA 3OD2A 1HWKA 7FDRA 3TQ1A 3IM8A 3G87A 3OFEA 3U02A 3AXKA 3KYLA 3E2EA 1WTFA 4KR0B 4PAAA 2VFSA 5J1EA 4N56A 1UVLA 2MKSA 3O44A 1YDLA 1AB8A 2XBPA 2DY9A 4DUYJ 2GMLA 3I9V9 2Y0BB 1Q79A 2XZTB 4E8UA 4FXDA 4DR5J 2AX0A 2M0GB 1R3NA 1JJHA 4UZBA 2BR0A 1C1CA 5HO4A 3WC2A 2A6OA 3LPEA 1Z1ZA 4ZP7A 2FHJA 1FA0A 2RD5C 5A6WA 1RJJA 4DR3F 4LF5F 2MQPA 3UD3P 4NOHA 5BJRA 2YPYA 3OXGA 1HBNA 1A7GE 2UXCF 1NJXA 2GO9A 4KSEB 3TYTA 2HGLA 5IOLA 3WX4A 1VCTA 1EHWA 4S0MA 4USUA 1IKVA 3TVYA 1ITPA 3N6NA 2VF3A 3CJ2A 4ECUA 4C48A 2EK1A 3D6TB 3VF0B 1WSRA 2KYZA 3QT8A 1K1SA 4J37A 2A2DA 2C22A 3FSYA 2V94A 1T05B 2ZOFA 1RACB 2QLBB 1VJQA 3KNAA 4DV6J 2FJVA 4BC7A 4OJ1A 4J90A 3GFXA 2YY3A 1RA7A 1RE1B 5H9EK 2V67A 3D6MB 1RTIA 4K50A 5AE2A 2HQIA 4UOFA 2V4JA 3FFIA 1T02A 2YWKA 4DS5A 3QT5A 3IR5B 3GV5B 2W9BA 1UAWA 3LANA 5THWA 2VJUA 2FY8A 4UY85 2PEHA 3BN7A 3DRSA 1NPPA 4MKBA 3T6JA 4ZCIA 2NR0A 1JJ2R 2HYIB 2CJQA 2LLZA 2RUGA 4DN9A 2IJNA 2C2RA 1N88A 4LQ9A 5LMNJ 1UA0A 3CJ8A 1EQ0A 3FMBA 4F0MA 5KT2A 2MQOA 1VQPS 5B0FA 4LVNP 1DJ0A 3RR8A 5AE3A 2HNYA 3TVZA 4UUXA 3MM9A 2GJ2A 2Z2LA 5L9NA 3RB6A 3MD1A 2KDOA 4LF8F 2UVRA 3BKFA 2R8JA 2OKQA 2R3VA 5IFMA 1FWKA 4DV1J 1DTTA 1IBLF 1C4AA 1TK5A 1HYSA 5EN1A 4DUTA 1RHJB 4ZVSB 4YY3F 1LWCB 3M2VB 3MZIA 1XMOJ 2QX0A 3NP5A 2QZ8A 3T19A 4YR3A 1SKUB 3F44A 2ZH2A 1HQEB 3CJ3A 2EPIA 3I9ZA 1FKOB 1QVFR 2F40A 1T9WA 2MZSA 3R7SB 1FI4A 4GKKJ 3SEOA 3DYAA 5DZ7A 3TAPA 2HNZA 2DGTA 2BYCA 2PD1A 1WI6A 4EYIB 3BGUA 3GR1A 2APOA 4KH1B 4Z7CA 2BOAA 2HAFA 3HLUA 4QCLA 4PQUB 4NASA 2HWIA 4Q8FA 1KRPA 4RUHA 3NNCA 3TA2A 5KG7A 3BDPA 2DR6A 1IUJA 4J9OA 2ZUAA 4DZDA 1JLEB 2F1FA 3UDEA 1M5PC 2BJ9A 2FHMA 4C7QA 4CH7A 4EO6A 2Q6CA 3EE3A 1YZ7A 4ZKAA 1FTRA 4PG7A 2N3OA 1VGYA 2EKYA 5ITHA 3HJFA 4DQQA 3MAAA 1X5PA 2XSJA 2F3JA 4DV2J 2RQKA 1S10A 1FWLA 5A8WA 1LWFB 2C2KB 2A18A 3MMCA 4I7FB 4QR0A 4X4SA 4ED2A 2Z58B 2V2VA 2WSEC 2NXUA 1WHXA 1JX4A 3QPIA 2HVIA 2AJQA 1AZSB 1NK0A 2VU5A 4O3QA 4JI8J 3HP6A 4KPYA 2DRBA 1NDKA 3UN2A 4UOHA 4IFYA 5CABA 4K0KJ 2XYHB 1ZAXA 1HWJA 2D3OR 4X4OA 2B43A 5ETVA 4CQ1A 2DBBA 2VFRA 3PY8A 4Y28C 2CJAA 4DPTA 3ZTOA 1WD6A 4Z2XA 4LR8A 1JLCB 1YX2A 4AFFA 4XDDA 3I87A 5HMYA 3CPWR 4DR2F 2RILA 4ZLJA 3T3FA 2ZZMA 3AOCA 2FC9A 3I0SB 5K14A 1A0OB 4O3RA 4NXMJ 1IN0A 2QA1A 2HHVA 2OMLA 1S0NA 3LWMA 2XS5A 3GJQB 2I0XA 3M32B 4GO7X 4BWMA 1D9AA 4CH1A 3MUTP 1B7YB 3L7OA 2PA8D 3B4DA 5I3QA 2F9DA 1X0PA 2HHWA 1X31C 4JV5F 2F8EX 2CG8A 3CIZA 4PG5A 1S6OA 4OX9J 1LK5A 1EKSA 1N48A 3PJXA 5C42A 4LFAJ 2UUBJ 3DKDA 2XSFA 1T05A 1SJ4P 3MXHP 2WAQD 3DGVA 1GX5A 1SL1A 5MAOA 4NA2A 3H0PA 5AE1A 4YB1P 2NXCA 2AV5A 3W62A 3RB3A 4F3MA 1S6PB 1RBLA 1RK8A 3K17A 1QSYA 1AYEA 3EZUA 1D3WA 3VR1A 1U49A 3RB0A 2FLLA 2K3KA 5ETQA 4WZQA 2KFNA 1KTVA 3H5SA 4RUBA 3RZAA 3M8SA 4TQSA 3J7AN 1G7CB 3LOUA 1G4CA 3L3CA 4N41A 1SXLA 3DDIA 1K8AT 4IRDA 3BBCA 5E5NA 2LA4A 1S57A 2BDPA 3KK1B 1TTHB 4ITSA 2BJ8A 3SSRA 2KB2A 2FJDB 4J91A 4K4WA 1ULRA 2VD3A 3WBZA 4J9PA 2MQQA 3EGWB 1TUVA 3L7PA 2MLZA 2E9TA 2YPZA 2DKOB 2KJWA 2ZWOA 2ZEJA 1UEKA 4C4WA 4IOAQ 1FD2A 1W7WA 3EXYA 3M6WA 4WIIA 1RT4B 3C3LA 4G1QB 3FQKA 2R4FA 2VBWA 2B51A 1LWCA 2GS8A 5D4NA 1TFWA 1RCXB 3M2VA 1APSA 2GHVC 3CIMA 1HQEA 3Q8YA 2GIFA 1FKOA 3V5RA 3BBBA 2GFFA 4WFAQ 2J9EA 1T03B 4P71A 1U1KA 1U1OA 4NEYA 4IG3B 1R8BA 3ULHA 3KJNB 1HARA 3GSDA 3C14B 4HEA9 4NLQA 3A4TA 1QVGR 3DOMA 1WSVA 4LR7A 4C6AA 4FYVB 4HLBA 2VA3A 5J1PA 1HW8A 4ANDA 1TVRB 1R6YA 4LF7J 5IT0A 4V19X 3CTRA 3NCRA 2D3O1 2ZH7A 2J0WA 1LWEB 4F4KA 1SL2A 1PG5B 1SUQA 8RUCA 1FDDA 1RWOB 1LW2B 2XNRA 4JUZA 3HKWA 1U6BA 3TVKA 2C3PA 5B0EA 2ZE2A 1JQGA 2G4BA 5JMNA 1VQ8S 2QA4S 3MWBA 5MLCV 2C2MB 2L41A 3DXSX 3MCOA 2G1HA 5C2CA 1YVFA 2NZCA 4X4UA 1LWFA 2BQ3A 1FFSB 4YQWA 4R0EA 4PZVA 5DLFA 3WQPA 4AE5A 1VQ9S 2CPIA 2R8IA 3AD7C 1B70B 1YK9A 3CCSS 1AZSA 1FCAA 1OYDA 3MR5A 3S7RA 2Q6BA 4NRUA 2B9YA 1J5EF 2DYAA 4X4RA 4YHHF 3E3XA 2GGPB 3H20A 5DJBA 2FZGB 2V50A 1TAQA 1LFPA 3P96A 2JOQA 5CCMA 1MROA 5HQ8A 3KFWX 1W2BR 3MGJA 3W9JA 3DLBA 4RU9A 2OPQB 4IR1A 1CJTB 3SCLE 1S4EA 2BABA 2M5YA 2C3UA 3WIVA 1JLCA 2J9DA 2OAUA 4RW8B 3DLLQ 4NLOA 2IM3A 3KHRA 4RBVA 4DLEA 1L3TA 3KDOA 1D9FA 1M1KT 1FJ7A 1M0SA 1FWPA 2W2OP 2J6SA 1X4CA 2H54B 2AJ1A 2LECA 1REGX 5M2RA 3M05A 1RWPB 2ZDOA 1DQ9A 2AYBA 3KUGA 1EETB 5AJ3F 2UUAF 4B9NA 1U0HB 2D69A 3EICA 1H2UX 1F9FA 3TX8A 5C24B 3Q8RB 3KKFA 1BXNA 4Z7YA 3I0RB 3M32A 2LA6A 3BO3A 2G13A 3G6VA 1LFWA 4PKDB 2OP5A 4O0NA 1F2HA 2EG1A 3AD8C 2BZ2A 2NPIA 2YKMB 2UVVA 2XHWA 2ZOMA 4R8UB 4QW8A 1RT5B 4ZVGA 5DRKA 3TZYA 2AWZA 4FDFA 1IBMF 4X62F 3PV8A 3NNHA 2F8MA 2HVEA 3PCOB 3LGHA 3Q24A 2DXFA 4X4TA 3UE2A 3D5MA 3BS9A 3GCWP 1R89A 2R2RA 3IS9B 5J2QB 1Q78A 1KHWA 3HFZB 3PHTA 4F4AA 2AEMA 2PI4A 3ET6B 2HHSA 1S6PA 2E1AA 1N36F 1X60A 3CSKA 1N33F 4RW9B 2UUTA 3CO0P 1ZPVA 3M2RB 2XYGB 3QSIA 1WHWA 3RAQA 5C5JA 4OJGA 4I2PB 4K4UA 3K8VA 2RB7A 2BW7A 3TNVA 4TY8B 6FD1A 2N4CA 5K8NA 1CG2A 4YEAA 2NQPA 5LXYA 1MN9A 1SKWA 4ILMA 9RUBA 1PBUA 3KK1A 4P75A 4UT4A 4RZRA 2IYIA 1IBCB 1H7XA 4KY3A 3DOLB 1FRXA 2B6AA 2VL1A 3LUYA 1KVIA 5KFYA 3DXBA 4ZN1A 1BMQB 2JL9A 1FNMA 2GQCA 5KG2A 3U7JA 4CLYA 1U2RA 3KMQA 2D7SA 1I94J 3ISNC 1IWGA 3MPWA 2AGOA 1RT4A 2R7UA 4ZCMA 4K59A 4G1QA 2DGVA 3PYEA 2W7OA 2OI2A 3Q8VA 2V34A 5EHHA 2NXEA 3OUYB 4ES2A 4MYTA 5F0UA 5DGBA 4BS2A 4LR9A 1ROFA 4ZIVA 3NY0A 4H4MB 2I1RA 3RTVA 4WWSA 1AFJA 3IWXA 3Q83A 5ETPA 3SFUA 3D6FB 4CO0A 1SC1B 3TP2A 2JX2A 4DR4F 3M8YA 4YS2A 1T03A 1IBKF 4IO9Q 1XJWB 2FHJD 2RAQA 5A8RB 4IG3A 2O01C 4KHPF 3R1LA 4B3TJ 1NAQA 3Q2SC 5F8HA 3HSZA 3KJFB 4K8RA 1LEOA 3C14A 1YG0A 2M9KA 1QLNA 5DZ6A 3EPIA 2DXDA 2M52A 4U67Q 4KFBB 1UPPA 2CZ4A 4GKJF 2RRAA 3I4HX 3T9NA 4X66F 1TVRA 5B0GA 4KYZA 2J6UA 3OXLA 1SVDA 1Y3KA 2F5GA 4ZJOA 2DHGA 4RL1A 1LWEA 2FZCB 4A8KA 1HMVB 4KAIA 1H6KX 5JUMA 2CWXA 5K8MA 1H73A 1LW2A 4X64J 3MM8A 3NAHA 3IR7B 5J2MB 3QGGA 1MLAA 4EYHB 5IS2A 2UUCJ 2IAJB 1TKZB 2MSSA 4F2SA 3W5XA 1I1GA 1XTZA 1CJVB 2RF2B 5T7LB 2LU1A 3JS9A 5L46A 1RDRA 3ITHB 3J81j 2JEIA 3K5PA 1V3RA 2OPSB 3MAHA 4NRTA 1U48A 2B0GA 2W2NP 3BF4A 3L7UA 4AQYF 5HK4A 4PQAA 3OTEA 3D2WA 4LF8J 5E3CA 4OI6A 4KHMA 2KVIA 3TUPA 3ZZOA 1FX2A 2OGUA 1IBLJ 4ZK7M 3EPGA 3SCJE 3LA0A 1WELA 4FYDA 2PFDA 4XAKA 2W4DA 3FCHA 4DL5A 2GGPA 3I4PA 4OZLA 4ZPWR 3C19A 5E3AA 4GVBA 5CCLA 3VHQA 1T94A 4BBYA 2J6TA 3JTNA 4ILLA 3JSRA 4M5KA 5HL7Q 4LRFA 5KTQA 1S6UA 1Q8LA 1IKYB 1S77D 3RU0A 3PYGA 3Q8PB 4FVMA 2OPQA 1CJTA 2RT3A 3FKBA 3FSXA 3EGNA 3ILLA 3LQVA 2XY7A 4LF1A 3G6ES 4A8SA 2HZCA 2DNRA 5C7PA 4ECZA 3LP1B 1WEYA 4HR2A 2CA9A 2PMHA 2MZJA 3O1LA 4D3GA 4LJMA 3R8YA 4NZ6A 3UCZP 2B4OA 3J7YI 3R1HA 4XPEA 1EETA 5L9XA 1U0HA 3TUIC 1JKHB 1BWEA 2BJ7A 2YQ3A 5C24A 2FLPA 1S49A 3T1AA 4B3OB 4J9VA 3OTOJ 2IC3B 3I0RA 2L9WA 1WF2A 2AJ4A 5ETSA 2HWHA 2OPPB 1WC1A 1T11A 2I6WA 2C2OB 4J7CA 2YKMA 3TRGA 1FK9B 3DRRB 2DGUA 3VGUA 2AW0A 1HNXF 1IR2A 3IFEA 4R8UA 1RP5A 2E7WA 3OSNA 2P6SA 4ZVEA 3H40A 4A8QA 4RW4B 3QFHA 5EWFA 5SUHA 4RNHA 2UXDF 3P5BP 1RTHB 2YX1A 2FUG9 1FJCA 1M1HA 2RDDA 2ILZA 4O23A 2DNMA 4ZVUB 1MMDA 4LF2A 1ZA1B 3S1TA 2N82B 1QSLA 2FLNA 5J2QA 2VZ9A 3UQSA 3PEHA 4RLEA 4ZPVR 3D1OA 3DFEA 4W92B 2IPOB 3ET6A 5D15A 3OHBA 3SDEB 1B64A 1V5VA 2HS0A 5LJ5Y 1R0AB 3MR7A 1OSCA 1Y10A 3M2RA 4NI2B 5IT9Y 4I2PA 5F41A 5EGYA 1KOHA 1X4HA 4DR7J 3BZQA 4TY8A 3H5YA 3R6LB 1FVSA 1PC5A 5D78A 2Y3YA 2CXEA 1XMQF 1NHKL 2HFNA 3AAWB 2ACYA 4JV2A 2Q3PA 3DOLA 3IWNC 1CEZA 2FHKA 4ZVOB 1FE0A 4FF1A 4CP5A 3LH2S 3DNCA 2VJVA 1F1BB 4L3KA 4DR2J 4IOBA 1C0TB 2DHAA 3VTIA 4PR6A 2HBYB 3NS6A 1KBRA 1YRTA 1SC6A 3K2YA 1EAYC 3HFKA 3BGFA 2VB6A 1KOOA 1QTNB 4RNMA 1BUXA 2MLXA 5DG7A 2GHPA 1G2EA 2O5DA 1LXNA 2E9ZA 1PO6A 2D74B 1HA1A 3Q8SB 1H0HB 4OQJA 2AYGA 2ZWPA 2W2MP 4C3KA 4FBUA 5KFGA 1N56A 2LQBA 3BYPA 1CJKB 2MQMA 3J7ZT 2KM8B 5CD4A 4I2QB 2QMXA 5K9FA 3ZTPA 5CXTA 5A8RA 4OI1A 4ZVRB 3DLJA 1F9EB 3CDAA 4B02A 4V19J 1S1VB 3A8JA 4CDIA 5KFHA 4XIUA 3OSPA 2VDHA 2R7OA 1VQKS 3LTOA 4KFBA 2B56A 2R7TA 4G1IA 3NG8A 1RI7A 2ASYA 1SC4B 3OFFA 1NXIA 1YTYA 4GO5X 4JBCA 2GVDB 2JEFA 4MH8A 5KFCA 2DGSA 4QYRA 2OJ3A 1Z2LA 1O5JA 1KWMA 4QIGA 3MTKA 2C3OA 3BB5A 1SJQA 4QWCA 5DGAA 5J2MA 4M5GA 3KTQA 2IAJA 5B08A 1TKZA 1FRLA 5BYSA 4IUFA 1U24A 1MWQA 2KHCA 3PRDA 1CJVA 2RF2A 5T7LA 3ITHA 4FKYA 1ZH5A 3D4JA 1N32F 2KN4A 2OPSA 2CQHA 2IVYA 3B82A 2VPWB 2AT1B 1VDHA 4X65F 4Y65A 1Q81T 3QFWA 2M88A 1VC0A 2HVHA 3PXGa 3D0HE 4YR0A 2V68A 3H2LA 3TA0A 2HAIA 4CCHA 2UVUA 2E5JA 4OHXA 2OPRB 4XPCA 4LF9J 3IBWA 3KK2B 2R7XA 2QLXA 1N34F 3D68A 5D0GA 3UDLA 3OBIA 3M8WA 3R5CA 4ECQA 2AJ0A 4ZCLA 5C2GA 2DEJA 3QRQA 4CH0S 2CRLA 2LDYA 3F41A 1OPIA 4OYBA 4QWAA 5DG9A 1UFWA 1IKYA 3NLCA 2ZNYA 4PWDB 2XMVA 4JYAF 3NWGA 4DR1J 2ZVIA 3VAMA 1ACMB 3MOZA 1BQNB 3D54A 3SQGB 2VQEF 4J9RA 4R25A 5CZXA 1KDNA 1TU0B 4HHJA 3FSIA 3LP1A 3U1LA 1ZAVA 3GP9A 2L9DA 4WXOA 5DM7Q 2R7VA 3W7BA 2ZBQA 2KM8C 2ZBIA 2ZITA 1JKHA 1Q5VA 1TV6B 4WP3A 3SSSA 5L1IA 2BOPA 3P49B 4B3OA 2MKKA 3FRZA 3PIPQ 2IC3A 3PFOA 4C0HA 3Q2TC 4HHUA 1F5AA 3O6QA 2N7YA 2OPPA 1T95A 4NCGB 2MPUA 2OELA 5IQ6A 1UW4A 3MAQA 1TR0A 3DRRA 1IVZA 2P8IA 1WHYA 2KG1A 3HD2A 3EM1A 1KQGB 4OHVA 2P5VA 3HHKA 4LF6F 4B9TA 4PPDA 3RUBL 4JI4J 4RW4A 1KQFB 5HMXA 3I5AA 4OX8A 4Y2IA 1RTHA 2ADCA 5HMZA 1RHUB 4UW2A 4DUZJ 1JXVA 3IM9A 4FXVA 1NKEA 4B9MA 2H5EA 1NB7A 1WOPA 2DGQA 2QLJB 1PYTA 3HHLB 3SDEA 3KLGB 3DDKA 1HI0P 2FJAB 1R0AA 4LRCA 2CPEA 2VG7B 3CDEA 1N52B 4YB6A 1HNVB 4KGZB 2L3MA 4NI2A 4YFUA 4FKXA 3V6HA 5KG6A 1GAOA 2BW2A 1REVB 3J7YU 5FIIA 2EKNA 3H7HB 2RH3A 4LFCJ 2IHR1 4ED8A 3W5ZA 1CLFA 1PJ6A 3DI6B 4W4MA 3N0VA 2VPZB 2OLWA 1UW9A 2CQIA 2FGOA 4C3MA 4P10A 1ZZNA 4NLDA 4HH0A 8ATCB 1C0TA 2NXJA 2CQGA 2EXUA 1X5OA 4ERDA 3TA1A 4TY9A 3DRXA 1N5YB 1LOUA 3C66A 4OYIA 1H7WA 2GNKA 2YWEA 1VRQC 2LYVA 2H5IB 5KFNA 4ED0A 5CHCB 2OD4A 4ED3A 5FD1A 3VCDA 2C2NA 4HI1A 4CLFA 1CJKA 3MM7B 1N6QB 2ZJRQ 4PYAA 2DY1A 3BV8A 4P6QA 1RUSA 2E66A 1AUSL 1O0PA 1NK8A 2V5HG 4J5OA 1NKCA 4DCPB 2FVCA 1M90T 5HAOA 4ED5A 3GCXP 1S1VA 3CCUS 1S12A 2M3DA 2C2ZB 2OTJS 2F4VF 3A1YG 4A46A 4ED6A 1M5OC 2MZRA 2JFKA 1LNQA 3D6HB 3T41A 2DGOA 1SJFA 2IM1A 3RRGA 2GVDA 3PO4A 3LP0B 4USHA 4DV0F 2R7WA 2BRKA 4I56A 1Y9OA 4J9QA 1NSAA 2XLKA 1RT7B 4NA3A 2I38A 4Q44A 4QJVA 2RKIB 2JC1A 4X4PA 2NSCA 2QL9B 2C42A 1KQSR 3KNGA 2KVQE 3JAMU 3N4WA 1I5OB 4JI3J 3A8EA 5HP1B 3CULA 3GG0A 4DV3F 3ILOA 2QE5A 4ZLNA 1NK5A 4KKOA 3DLGB 4QU7A 4JI7F 4FBTA 2CQDA 4NLWA 3HXMA 5J2NB 2IMOA 4X4QA 1UVKA 3CMAS 2W4CA 4L74A 1SJ1A 2OO4A 3TI0A 1Q8BA 2Z30B 1UZHA 1FDNA 2JEJA 4DPUA 4LFBJ 5DDOC 2UU9J 3AT1B 1Q95G 5ETMA 5K5MA 5HMWA 2HVZA 1HNWF 1ZM4A 1DARA 2G0JA 1UVIA 2A10A 5IWAF 2G2YA 2UP1A 1DBDA 2QTWA 1I3OB 1F5BA 3BO4A 4WFNQ 2XMMA 2JEGA 2CZ9A 3FBCA 1S1UB 2OPRA 2IA0A 1GX6A 1H74A 3KK2A 4LIRA 2HQDA 2WB1D 1XQIA 3J80U 2G2ZA 4ANCA 3O2IA 3ZNUA 4ANEA 4WXWA 3I5BA 1IR0A 3ADAC 3VVTA 3DLKB 3R5AA 1SJRA 3UO0A 2QJ3A 1X9MA 2QFIA 2GIQA 2VKRA 4KHPJ 4PWDA 3VAGA 2DHXA 3UN5A 3W9IA 2QRRA 1SQEA 1WKLA 4F26A 2RS8A 3SXLA 4KQZA 3ZZ0A 4EEYA 2AQ4A 3PRBA 5BXIA 4NLPA 2HLTA 1SH2A 1HNZJ 3D1QA 3DHWC 4ECYA 4J9KA 4K4TA 3TJAA 2K7KA 1UFKA 4HTJA 3HVWA 1M1GA 1TV6A 3BO2A 3FZ2A 1PAUB 3FBFA 4HT5A 2YBVA 2HRUA 3NGUA 5F3TA 3ILIA 3MEEB 4NLTA 3HKZD 1Q7LB 4LRBA 2N4DA 4NCGA 2MKYA 3VGVA 4ZLLA 1V3SA 3MTJA 4L73A 2KT3A 4DSEA 1PSDA 2VFTA 4NWBA 3FVYA 2M70A 2MSTA 1FEEA 2DH9A 1P9QC 1YZ6A 1HD1A 1X5TA 3THTA 3IA0A 3GFZA 4O3OA 2M8HA 1M5HA 3FBBA 2YWFA 2CDRB 5IM0B 1M5VC 3US5A 2YNIB 2M7SA 3HCXA 2KT2A 1P6TA 3SV3A 2WSCC 2XO7A 2RDIA 2L08A 1RLCL 4NMXA 2HQCA 1U6ZA 3DCAA 3RBDA 3PIOQ 1Y11A 2B9EA 3HHLA 3KLGA 3OXFA 2PA3A 1NHVA 1WC5A 1JLQB 2VG7A 2XZDB 1HNVA 4IR9A 2YH0A 2K2PA 4WYWA 3BQ0A 3OT9A 1BE4A 1ZBTA 1JB0C 4WFXA 2IRUA 1REVA 4B3MF 3QJLA 3MCNA 5KFOA 1Y3JA 2NS1B 1VC5A 2KHDA 3GE9A 1VC6A 3ISND 4B3RF 1CPZA 3IR6B 3DI6A 1RAGB 3T1YF 1B99A 3JQJA 4A8FA 4KGKA 3TJ8A 2ALYB 1MN7A 3G82B 1X4FA 2CIMA 3TX0A 5LXRA 1GTEA 2H51B 5FDLB 5KT5A 3GV7B 2DNNA 3D66A 3MD3A 2KH9A 2RU9A 1UWAA 2DCLA 4QIFA 1VLOA 2E1PA 4U9RA 4B3SF 3PO5A 3T5JA 2MKCA 4NEZA 5KG4A 5HATA 2WVDA 3CDWA 2RNEA 1N5SA 1CS4B 1FD8A 1N5QA 9ATCB 3PX0A 4HHHA 4E2FB 4EFAC 4RKUC 4ER8A 3ZZZA 3CCTA 2OFGX 3ZZUA 2D3UA 4JI2F 2LVWA 2DJWA 1N6QA 3ELHA 4M5HA 2VQFJ 4DV5F 4DBQA 3OL8A 3BSCA 3CCZA 4DQIA 2J7KA 1QTMA 2HNDA 1S1WB 2WVFA 2V2ZA 2HQ3A 2NUHA 2HHTA 1LK7A 3KG4A 3EDRB 2WVCA 3G4SS 4Z37A 1CVJA 4ZP8A 3NGRA 4JB8B 4Q8EA 5GAHI 3CNQP 4USTA 1HQ2A 2J5AA 2MMYA 2IVMA 1GMVA 4CLTA 4NLYA 4B9SA 5KFMA 2MHNA 4CM2A 3CD0A 2ZM6F 3V6KA 5AT1B 3KJQB 1H98A 4WTOB 3BSAA 2AF6A 1YIJS 3NOCA 3UW1A 3VWSA 4M5MA 4L75A 3SIPB 2YKPA 2G0CA 5HP1A 3TO8A 3KJVB 2WONB 1XNRF 4YUDA 3D67A 1S6QB 3DLGA 1WEZA 2M2BA 5J2NA 4LBHA 4QWDA 2QV6A 2AP6A 1CC7A 5DDPC 4CT8A 1Y5IB 3BREA 5IXUA 4F4ZA 5BYRA 3A12A 3QT7A 2JDJA 2DPIA 3CD7A 4ZPBA 3IAS9 3TAMB 2E5LF 2YWGA 1KKHA 2PN6A 4LF4F 1RBAA 5HROB 4U95A 1TL1B 3IO1A 4F7VA 3FEYB 4EO8A 3M6UA 3PYDA 2NSBA 5CYMB 1HPZB 2BUNA 3Q22A 1U47A 5AXMA 1YLXA 1S1UA 1C1BB 3BJYA 4DX8H 4HVZA 3GSIA 1UJ4A 2HG4A 1TZ0A 2DIUA 1S9GB 2HGMA 1FJEB 2MKIA 2BE7D 2FB0A 4Q43A 4HDGA 2UXBJ 5B7WA 4Q5VA 4ES3A 3AD9C 3DLKA 1S0OA 4DR6F 2NYHA 4LVOP 1JWWA 2M8DB 4WTYA 2PO4A 2DNGA 3PDNA 1ZZFA 4USMA 3K5NA 2W7PA 4DL0C 3M8ZA 4Y2AA 4A8MP 1S0MA 4C0OC 1VRTB 3RBEA 3PZPA 2QG9B 3FNNA 2ZH9A 1X9SA 1NJWA 2DNYA 1N5VA 1NSKL 2X1FA 2HQFA 5L38A 1JJCB 4FNHA 2PIIA 3FCWA 3DGPB 1ZM2A 4OHWA 4DUYF 5D8HB 3VQTA 1NH8A 3CJSA 1ZTWA 1PCAA 4DR5F 2IIHA 5KFZA 3GQCA 3CC7S 1OY9A 1VIXA 2FHOB 2GJIA 4I69A 3X3UA 3FQLA 1S72S 1VYAA 1U1PA 2X3DA 2W4PA 1U45A 4R5PB 3TZWA 4EWTA 4FS1A 2Y8WA 1HBOB 3MMBB 2W01A 2QYGA 4CO5A 1TUGB 1RXOB 3H90A 2AIRB 1TL4A 2FVQA 5H9FK 3P6YC 2UUWA 3DDNA 3TJ9A 3W9HA 2XNQA 1GNKA 3M8PB 4FNIA 5HN0A 3K8WA 3C46A 4OZ5A 4MJKA 5KFSA 4Y3CA 4KPCA 4KRWA 3MMAA 3GG1A 4DV6F 4C8ZA 3OTDA 4TQRA 1RHRB 3EWGA 4F2RA 1FXDA 1K47A 3NS5A 2BBEA 1JLQA 2N3LA 1UP1A 3HZEA 2XTJP 2R7QA 4FYXB 4MK7A 4ILRA 2C1EB 2VDIA 3DOKB 2QMWA 2COLA 3MR2A 3SI8A 4EI2A 4BWJA 1K0VA 4JYAJ 4OHZA 3ZNJ1 1S97A 4I1TA 2CJBA 3ZC4A 1T8EA 2B4VA 4UTGA 4CLLA 2E44A 5LMNF 3G82A 3OVBA 5HBMB 4AYBD 5FDLA 4K2XA 4ENOA 4JI5F 5KOXA 3ENQA 3HM9A 2W24A 2PMZD 3W60A 2QSFA 2EWHA 4C0BA 3K5LA 1ZA2B 2PMWA 7FD1A 3P3DA 2A6MA 2G2OA 3OFGA 3H4DA 1RADB 3L9ZA 1IM4A 1CS4A 4ATNA 4PWWA 4DV1F 2IBOA 2HSEB 4USJC 1SKRA 1IWAA 3SQOP 4L72B 2AMCB 4IDKB 3G6XA 4IOCQ 3NEKA 2G0IA 1XMOF 5ETTA 4D3HA 3JXOA 4ID8A 2HMIA 2XHCA 4DPOA 3R3TA 2BJ1A 4QU6A 3A3OB 4LSZB 3R7NB 1MNEA 4LF6J 4TKTA 5HJYA 4F4YA 1C0UB 3SBMA 3NOGA 4ZVQB 3NNAA 1S1WA 1HHQA 2POKA 3HD1A 1MG7A 4L3NA 3SMZA 3FRYA 2R9LA 3LAKA 4LIWA 7AT1B 3KXDA 1QUPA 3N5BA 4B9VA 3R5BA 3IBCB 2JC0A 4B9LA 2OEJA 1WDTA 2AJ2A 2BKNA 1WF1A 3P8BB 3CDUA 1B7FA 2DHHA 4U7UK 4CLSA 2BQUA 4RBUA 4ZN3A 1MWYA 1PBAA 4FN5A 2HZAA 3VAFA 1UPMB 4EK2A 2ZH6A 1QE1B 3KLFA 4FF4A 3KJVA 1ZM3A 2WONA 1VQOS 2NZ4A 3JB9k 1JK9B 1GT8A 2B4PA 1VBKA 4CTAB 3FMWA 3BYRA 3OV7A 1GK8A 1DAXA 5GMEA 1SBRA 1X4GA 3BR8A 1BHNA 2CG4A 4DV2F 2LXUA 3N01A 1YBAA 4DV4J 3TAMA 4DL3A 4IRKA 2NLWA 3NAIA 2BXJA 5BR8F 2Y9HA 4XTTA 5HROA 1BC6A 1HNIB 2GIRA 2W9CB 1TL1A 3ZXWA 4HACB 4ZDNA 2XLJA 5CYMA 1B3TA 2CPXA 5T41A 1FX4A 2OD6A 1C1BA 2Z2MA 4P2FA 4C98A 2VBYA 2GQ2A 4MK8A 4JI8F 1VHFA 4RWWA 2DNOA 4WBFA 2RU3A 2WTFA 1S9GA 1Q1KA 2WBRA 3ZZTA 4K0KF 4UQGA 4Q2LA 4OZ2A 1CQMA 2XMTA 5DDQC 1WC3A 2LEAA 1YI2S 2J0XA 5GAHU 2ALZA 2E7VA 1XEZA 1NDPA 2HRYA 4WU3A 3UVJB 1OQ6A 1WEXA 5KFTA 2CVIA 1U1RA 2HK2A 5F8MA 4IRCA 3ETOA 4AL7A 4OLPA 1R8HA 1Y0HA 3G9CA 3UCGA 1EX8A 2IY5B 1P1LA 1UJ6A 1IKXB 4DFKA 3I96A 1HHSA 3G8QA 3DGPA 3A3NB 3AB2B 4F3QA 3T5LA 1OWXA 3N6LA 2JWNA 1V3ZA 1NSQA 2W2QP 3BPSP 1HR0J 1ZS6A 1U8WA 4USKA 1Q53A 3ICLA 3M4XA 2DNLA 1YJWS 3Q89A 4NXMF 1VFJA 3TANA 2CJYB 5GADI 1YJ7A 4F02A 3CWJA 4R5PA 3CCMS 1P27B 5IC6B 1OQ3A 1HBOA 3MMBA 4TVAB 1I51B 2DNZA 3NMRA 2J8AA 4FS2A 1PILA 2HHHJ 3FK4A 1EB0A 1NBEB 4MKYA 4IYQA 1VQ7S 4OX9F 2OSRA 2IM2A 5B0AA 2JVRA 3NGKA 3M8PA 3EVMA 4LFAF 4RUAA 2UUBF 2ZJPQ 4ZIWA 1IQZA 2FLOA 4CYUB 4CI0B 1N0VC 3GTYX 2F8HA 3CDBA 3LO3A 3W1YC 3M6XA 3NRBA 3TUZC 1TL3B 4KC5A 2GX8A 1X9WA 1HWLA 1TL5A 3QAEA 5E3PA 1NH7A 1EARA 4CLKA 4NLGA 3GIKA 2RIJA 2V0NA 3GB0A 3SCKE 1SV5B 1D1UA 4OZNA 2E9RX 3QLHB 4RNOA 3QZ8A 3DM2B 3QZ7A 3LWLA 5EUHA 1NCLA 5LMUF 4CLWA 1RAJA 1WHVA 1NPKA 1LWXA 3EXCX 4YDXA 5HVGA 1QAIA 3TOQA 2IFXA 1OY8A 2DCUB 3CB4A 3OJUA 4FP9A 1KVJA 2KT5A 4U7UD 2XY5A 5HBMA 3ONQA 4ELTA 2HBZB 3ENAA 2VH7A 2X1AA 1HBUB 3BSNA 2DXEA 6FDRA 3AY0A 3SFGA 3H25A 1VQSA 4DS4A 1CC8A 1MMLA 1P9YA 4DPYA 5E33A 3AH6A 3MURP 3FJ2A 1EP4B 3BR9A 4DN0A 2MJNA 3UWTA 4IDKA 4E0DA 4NXNJ 3M30B 3BM7A 2V8VA 2QA4G 4H4KC 3N9UC 3KMSA 2ZC4A 4PWUA 2X1GA 1TMMA 3W61A 3AJDA 1BQXA 3NBPB 1C0UA 4Y00A 1TL7B 3MM6B 5HVFA 3DC2A 1TKTB 2IDLA 3K0JA 1H38A 2Y8YA 4JI0J 1ZOTA 5HJXA 2X7IA 1OMSA 2CNKB 4N76A 3D3CJ 3LW5C 4F8RA 3H98A 3K59A 4P2SA 1YRXA 3M8RA 4K4YA 3TEHB 2WW4A 3EJMA 4ECWA 4C2MA 3ZZPA 4HDHA 3TZXA 4PQUA 4QYZK 5KG0A 1P8GA 4OJHA 2N7CA 1BWVA 3KHLA 4F50A 5B0CA 4OIXA 1J27A 2NUUG 2XM3A 4C8LA 1IKWB 4JI1J 2XULA 3PJ9A 2CQ3A 1SL0A 2DH7A 2ZBRA 3UD4P 2DRDA 3HSJA 1JLEA 3Q23A 1UJ5A 1HWUA 1LKZA 3RJMB 1RB0A 4EMDA 1OIAA 3RR7A 2R8KA 1QE1A 3GYGA 1VMBA 3HHLD 3ETMA 1VQ5S 4B3MJ 2QIFA 2ZZNA 4O44B 3DRSB 3GFHA 4DQPA 2KO1A 2V2QA 5IV3A 2XB2D 1F3FA 4USIA 2IJRA 3DLEB 3AODA 3G71S 2E29A 3T1YJ 1WDDA 3GFYA 1KONA 4P9SA 4MK9A 2VIHA 1EQMA 1N0UA 4DV7J 3CCQS 4ZVPB 5DDRC 2OHDA 2MJUA 1TK0A 1HNIA 2EFQA 2W9CA 4OYXA 2YTCA 2EFOA 4K4VA 3D1HA 3JQMA 4HACA 2HNYB 4I7FA 3V2UC 5D4OA 1Q0NA 1FFGB 2DGWA 4TXSA 4O4GB 1A6LA 2GC8A 2OEKA 3GLJA 1VRUB 3F0NA 2I9SA 1S9EB 4L76A 1YSJA 2G1DA 1N4LA 5IV4A 2RRNA 1HD0A 2LQJA 2Q1LA 4GRSA 4ZJLA 4JI6J 3IAM9 3EDQB 3BKUA 2DR5A 4ELUA 1UWBB 2CJ9A 2MY8A 4F25A 1OSDA 4DV5J 2HGNA 3KLIB 4KV8B 1R6VA 4IH7A 3UVJA 1BLUA 1FNOA 2PI5A 5LSLA 1HWIA 4H4OB 2R7RA 1GFWB 3W64A 3FGVA 3DLHA 3CCRS 4M95A 3T5HA 2HIYA 1AT1B 1IKXA 3M1VB 4H4KA 2DPJA 2MKJA 2KG0A 2CNNB 1PGZA 2ZC3A 2Z4PA 2BJ3A 3UFCX 5K20B 1TQLA 5GVQA 2L9NA 5E41A 1GTHA 2ZM6J 2WZ1A 1JLFB 4OI4A 4QQBA 3HVTB 2FC8A 3BEGB 3BGOP 2B9XA 3I0SA 4U8VA 3G96A 2AHOB 4WU2A 1KTQA 4FPIA 2V8DA 5AXNA 3JTOA 2YVSA 3J7A1 1EJ7L 4P72A 3THVA 3NGSA 1O51A 4PCQA 4YB5A 2KRBA 1M5SA 2NCKL 3W8GA 1XNQJ 3CEDA 3SSQA 4GVLA 5I3PA 2JHEA 1FJGJ 2HWTA 1RAIB 2AYEA 1G1XA 5CYQB 4MFBB 2RE1A 3KDNA 2YNGB 4LBIA 2DT9A 5IQQA 4CO3A 4LF4J 4DL7A 3H8YA 4O3PA 4JP8A 4CYUA 1FRIA 2O66A 3PG9A 5GAGI 4GC6A 2H4YB 2DNHA 3CJ0A 5KFUA 3KLEB 5LSOA 3MR6A 4I4BA 4IKAA 1DTQB 4U7CA 3H2VE 3UNYA 3MUMP 2IRYA 3OL9A 1NKBA 2FJXA 5IC4B 3V4MA 2RHSB 3QLHA 2W9AA 5KFBA 3DM2A 3QYYA 2BE9B 1XR7A 3RW7A 2MXYA 2RQMA 3CCVS 3FEXB 3OVAA 3RYLA 1TKDA 2ROEA 4M94A 2QLFB 3NCQA 3CMES 3LP2B 1SI9A 3OVSA 4KE5A 1RQ0A 5GADU 1S4FA 5G4DA 3QBCA 2XMUA 5DETA 1U26A 2AZ3A 1D0EA 2GZOA 3UDCA 5A6PA 1HBUA 5KFLA 3P4UB 3B6BA 2V69A 1WUUA 2WHOA 4HYKA 5DLGA 2IMWP 3HMJG 1I94F 1OYEA 4ECXA 5K14B 3MCSA 5E7OB 2E5GA 3BQ1A 4F4WA 1D8YA 2V9WA 1AXQA 2JJ4D 2PC6A 1WTBA 2LU2A 1EP4A 3MFIA 4PXEA 3RAXA 5T14A 3C6UB 3M30A 3BH7B 4DR3J 4LF5J 3OR2B 4WE1B 2LCWA 4RU2A 2J7UA 1YRUA 3DRPB 3THPA 2YKNB 2UV8A 1S7HA 2UXCJ 2ZUGA 5L1KA 2LEBA 3NBPA 4ELVA 4B3TF 1TL7A 1HQUB 3PJWA 2EVZA 2JH3A 3MM6A 3QMQA 1TKTA 3T5KA 1FRMA 5C42B 4Y6IA 2DK2A 2O1PA 3AHPA 3PVXA 4NYPA 4K4XA 2ZH4A 5EWEA 4UOGA 4IH5A 2IBKA 2AD9A 1WKJA 4NL5A 3D28A 3Q8QB 2FJEB 1U8SA 3HO1A 2CPHA 3GJSB 1IKWA 2ADBA 1W26A 5KAKA 4CRJA 3NS7B 4LSNB 5M2UA 2J76E 2HW3A 4YR2A 4X64F 1F5CA 1D9DA 1AA1B 1YQHA 5CH7B 2QO3A 2UUCF 4YMEA 4O44A 4NPOA 3QATA 1WC0A 3U1NA 3DLEA 4LBPA 3MCMA 2OH2A 4ECTA 1HIYA 2AEJA 2CNLB 4N8OA 3W2VB 4OZ1A 4JI5J 3BBFA 4WFZA 2EI5A 1H2TZ 5LJ3Y 4TU7A 3W3SA 1JLGB 4UY8T 1YJNS 2AU0A 4DL6A 4OMFG 2GQQA 1NJYA 1FNXH 1AUDA 1KNZA 4ZP9A 1T9XA 4O4GA 4ZJQA 1X7VA 4Y2KA 4DQSA 1VRUA 1ZETA 1S9EA 4ZP6A 2W2PP 2LQ8A 2XLIA 1YITS 3T6BA 2DEIA 2Y0SD 3VGTA 3R9LA 2I5JB 2R8GA 2EFGA 4YY3J 1MWZA 1UWBA 1H3DA 5ETKA 3CXCR 5HLFB 2EBEA 3BSOA 4DOZA 4MIBA 3KLIA 4KV8A 3K5OA 1K44A 4ZITA 1URRA 1KEKA 4H4OA 1W2IA 1F9HA 2XMKA 2ATLA 1OS5A 2HHUA 2MQLA 3HHNB 2OEMA 3ZTQA 4IH6A 1NK9A 3MHYA 4I6AA 2D41A 4CT9A 3DOMB 2WOMB 3M1VA 1V9OA 3M9NB 3GPAA 2WCXA 4RW8A 1NZAA 5CA5A 1GXUA 4ZPDA 3HK2A 1FXRA 4EBCA 3MPYA 2JLEA 1JLFA 2JLGA 1RU1A 3LAMA 3HVTA 4PXBA 4OLOA 1SUQB 4E98A 2CQ0A 2V63A 1S0VA 3OTOF 2HLUA 1RWVB 4IG0B 5EWGA 2DO0A 3CCES 2HFVA 2GMJA 3QWUA 1B4SA 2ZE2B 2MDAA 2VOOA 4A8OA 4U6PA 4QIWD 2JRSA 3G2XA 3GIJA 2VC0A 4ZHRB 4RNFA 1NHUA 2E5IA 4ID5B 3NGDA 3G86A 1IM6A 4DQRA 4CM0A 3TR5A 4DFPA 4I0WA 1RT5A 5KT6A 5CYQA 2FQQB 4MFBA 3VZHA 3PM9A 2YNGA 3L4BC 4X84A 3PTWA 5BR8J 4J9SA 4I68A 4KJIA 2AX1A 2WVBA 1U25A 3D9BA 5E0OA 3R2CJ 1VQYA 4HI2A 2I8EA 5A8KB 1Q82T 3OR1B 4Y2MA 1VBYA 2XZWA 3KLEA 3IS9A 3DU5A 3LGMA 4WYLA 2VPXB 4XK8C 2QEXS 1DTQA 2OIHA 4IQMA 4P73A 2FJBB 2RMLA 4RW9A 5JVGQ 4DCJB 1XR5A 3OPKA 2CJKA 3BGLA 3HDSA 1KC8T 1MROB 4F36A 4DR7F 2XCPA 4OV1A 1RGVA 3NL0A 1YGYA 3CC4S 4IQXA 2R8HA 3LP2A 2CNOB 5B0BA 1Y5NB 1X4DA 1FF2A 2R7SA 4P2MA 4F4XA 1NK7A 2BKPA 1Y5LB 2H48B 5KT3A 2GAHC 4PG8A 1XK8A 5ETNA 1Q86T 4I6YA 3MEKA 2HURA 1RT6B 3BPDA 2BQRA 1JLBB 3Q86A 4TYAA 3QGHA 3J7Z5 3V4IB 2VFVA 4CO4A 3BH6B 3I56S 4WF9Q 4DDFA 4O3NA 3CD5A 4M5IA 4OX7A 2QT7A 3IXQA 3W66A 3OUYA 3OHAA 1SC3B 3C6UA 2PFFB 1NSPA 1PJ5A 1T3OA 3OR2A 4WE1A 4H4MA 4DX7A 1R8AA 5GAGU 2LP4A 3DRPA 1L3SA 2HBQB 3O3LA 1NB2A 3U1MA 1WF0A 2BE2B 2YKNA 2ZHBA 1SIZA 1O6XA 1WG4A 1XWLA 1T7PA 1F3VA 2VHGA 4JV5J 2H65B 1HQUA 2VPYB 2Z2YB 2OTLS 1KFSA 4Q2MA 1OPZA 5E2QA 4N5SA 2WB4A 3QIPB 4AUKA 2Q43A 2B4UA 1XC9A 3PW7A 3CJTA 1EKRA 5KFDA 4DSIA 3GV8B 5DQHA 2XS7A 3RBZA 2K7JA 5A76A 3R97A 3G6YA 1T9UA 2A2CA 3IWLA 4LSNA 4BLGA 1HMVA 1YJTA 2DR9A 1UVNA 4YN3B 4PYDA 4ZLPA 4KBIA 1RT3B 2ROGA 5LMUJ 2NREA 1RTZA 5A0YB 5F3ZA 2B7BB 2Y1RI 1ICEB 1A9NB 2VKZG 2E5HA 2D9PA 2JFDA 3CW2C 2ZH5A 2HEKA 3TAQA 4DCOB 4N77A 4Y34A 4C9DA 3QWPA 2YKAA 2KYXA 2V8HA 4LQ3A 1IXKA 2WRMA 1RAAB 1L3KA 3A13A 3G8SA 4RWXA 3R27A 3W2VA 1NO8A 1S76D 2HHXA 3CCJS 3EVOA 2B6AB 2L48A 4MAKA 1J2VA 4KH0B 1JLGA 1LQ9A 1RWKB 3HHEA 1W25A 1VISA 5HSPA 2BRLA 4YP3A 5EDWA 1XERA 4LF9F 1SQFA 4OYWA 4Y0FA 1VK3A 3HVRA 1ELOA 3RGIA 3P5TL 2HHQA 3ZTSA 2V4QA 1VHIA 2DH8A 3FBEA 2YQ0A 2I5JA 3QO9B 5HLFA 5JJBA 5KG3A 4G1PA 4MMOA 4FVCA 3CUNA 4C8OA 4GC7A 2FDNA 5KFAA 4O3SA 3W8PA 3H4BA 1E6VB 3B4MA 3R7BB 3W63A
chains in the Genus database with same CATH topology
2B4VA 2LU1A 4DR1F 4BCAA 2FVRA 1QAYA 3T9ZA 1RDRA 3ITHB 2DISA 2JEIA 4M63A 3K5PA 2WBMA 2Y1JA 4HTIA 3EYZA 1IKVB 2R2SA 1V3RA 3QGIA 4JI0F 4OI3A 2E44A 2O67A 2XGPA 2OPSB 1O8BA 5LMNF 2DHSA 1QUVA 3MAHA 5GMKa 1NK6A 1S99A 1HW9A 2B7CB 2WOMA 3BDEA 4PXCA 1RT2B 4NRTA 1VQMS 2BJDA 1R8CA 4AYBD 5FDLA 5HBMB 5K8OA 1U48A 3MF5A 1Z4UA 4K2XA 4JI5F 2B0GA 4P7VA 3BF4A 4ZVHA 5KOXA 4DSJA 3MMAB 3ENQA 1RTJB 3HM9A 2W24A 4AQYF 2PMZD 5KFEA 2VA2A 2QSFA 4ES1A 3MECA 5L1LA 4AXIA 1UKUA 4PQAA 2EWHA 2EBGA 3DMJA 4C0BA 1ZTTA 1GXTA 3F73A 3K5LA 4LF7F 3OTEA 3D2WA 2BM0A 1J5OB 7FD1A 2BANB 3P3DA 5E3CA 3OFGA 4KIAA 4OI6A 2YKQA 1H2VZ 4KHMA 5I4MA 2KVIA 3H4DA 4JI1F 2RJZA 4OL8A 3ZZOA 1E6YA 1IM4A 4JV0A 4ZK7M 4ATNA 2KFYA 3EPGA 2XCAA 4DV1F 2IBOA 3SCJE 1WELA 4A48A 1RTIB 4PXDA 4FYDA 3MM8B 3OFHA 4USJC 3HX9A 4XAKA 3TARA 2E1MC 1SKRA 2W4DA 3FCHA 2CPZA 2O3DA 4IG0A 2V4JB 4L72B 3FFIB 4TU9A 4DL5A 4UOCA 4IDKB 2GGPA 3MFHA 3I4PA 2J7WA 3G6XA 4OZLA 4IOCQ 1VS3A 4ZPWR 2J0QD 5E3AA 1XMOF 2W9BB 5CCLA 3K7RA 4ZOSA 4D3HA 1T94A 2MHEA 4ID8A 2AGQA 2HMIA 3KWMA 4BBYA 2J6TA 3JTNA 4EUVA 4DPOA 3R3TA 3JSRA 4ECRA 4ILLA 4ZHRA 2CQPA 5LT5A 5HL7Q 5KFWA 1RYSA 1FK9A 5KTQA 4QU6A 2MGZB 1S6UA 1Q8LA 2HIQA 4ID5A 1IKYB 1S77D 1MNEA 3RU0A 2ZVSA 1LV5A 4TKTA 3Q8PB 2PSZA 4FVMA 3GMGA 4CTAA 1FRHA 2FD2A 4F4YA 4JI4F 1C0UB 3VQSA 2OPQA 1I6JA 3NNAA 2RT3A 1VQ4S 1S1WA 1K9MT 1K0TA 2CPFA 2HHPA 2NYIA 3LALA 4AL6A 2IM0A 3H2UB 3FSXA 4DV7F 3EGNA 3BQ2A 2POKA 4MTPA 3AB4B 4LSLA 1VQLS 2PGCA 5KFKA 4NX9A 2JLFA 3LQVA 4WK3A 2XY7A 2IA6A 3RRHA 4PUOA 3G6ES 3I32A 4A8SA 4DUZF 2HZCA 1MU2A 4L3NA 1QJHA 2DNRA 4ECZA 3LP1B 3SMZA 1WEYA 3FRYA 5A8KA 1L3UA 2R9LA 1ZPWX 2PMHA 4EZ6A 2EG2A 2MZJA 3LAKA 3OR1A 4LIWA 4X4NA 3O1LA 2LEPA 3PACA 3GYXB 3DU6A 3IRXB 1C2PA 4D3GA 2KXNB 4LJMA 1QUPA 3MM9B 4JOUA 4NZ6A 3N5BA 4B9VA 2FY1A 2KZMA 3UCZP 2ZH3A 2B4OA 3R5BA 3J7YI 3R1HA 3FDSA 2JC0A 4XPEA 1X0FA 2KTQA 1EETA 3PW4A 4B9LA 5L9XA 3UR0A 3TUIC 1B0VA 2W8LA 1JKHB 2ILYA 3VALA 1BWEA 3IN5A 2YQ3A 2G9OA 1R43A 3I82A 1MSWD 5GAEU 3S01A 2IYGA 5AXKA 5C24A 1DTTB 4WKYA 1S49A 2FLPA 1WF1A 3SCIE 2A1BA 1HYSB 3T1AA 4B3OB 5FJ4A 3CDUA 4JI6F