4WXWA

Sadc (323-487) from pseudomonas aeruginosa pao1
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
165
structure length
165
Chain Sequence
b'VATDELTGLFNRRHFMRMASRALEDLLPNRQHGLALIDLDHFKRINDRHGHAAGDRVLQTFAAVARSCLRDGDVLARYGGEEFVLLLPHADAEQLESCCERLRLAFQQAEPVGVTVDTLSLSVGMTLLYADDDLDEALQRADQALYRAKRGGRNRCDATWEVTSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein
molecule tags Transferase
source organism Pseudomonas aeruginosa pao1
publication title Crystal structure of SadC (323-487) from Pseudomonas aeruginosa PAO1
rcsb
total genus 56
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wxwA00
3PW4A 1JX4A 2IA6A 2OPSB 5FDLB 5KT5A 2CJQA 4K4WA 4LSNA 1JLQA 3QLHA 5C25A 1REVA 3D28A 1KHWA 3KLIB 1TV6A 5KG5A 5KFOA 3JYTA 2R8KA 3G86A 1IKXA 4RW4A 2OPPB 3N6NA 4YP3A 1JLGA 2QE5A 1T05B 1HPZB 1J5OA 3RAXA 3H98A 3CJ2A 5HROA 5KFHA 5DLFA 4YQWA 3PVXA 5KFCA 2WONB 3GYNA 1RTDA 2BE2A 4B3OA 2W9CA 2C2EA 4RNFA 1W25A 3C6TB 4KFBA 4ECZA 1RT4A 2OPSA 1RT2A 1RT5A 1TKXA 1NNDA 3GV5B 1N6QA 3BGRB 4I2PA 4ED8A 4NLDA 3QIDA 4MH8A 4RU9A 3CJ4A 2E9TA 3DLKB 4XPCA 2IJFA 4TQRA 3KK2A 3SFUA 1NHUA 1S4FA 4ED6A 5J2QB 3G6XA 1TKTA 4OL8A 2YNIB 1SH2A 4WE1B 3GQCA 3KK1A 3DDKA 1HNIA 3PR5B 2IAJA 3QGGA 2BE2B 4ID5A 4ECTA 2VG5B 3GIJA 4ZP7A 4IH7A 1TKXB 4NLTA 2HNYA 1HYSA 5J2PB 3DMJB 1IKXB 4RW4B 5L1LA 2W8LA 4NZ0A 2FLLA 4JUZA 4MK7A 5KFJA 2JEGA 4Y2AA 1D1UA 3BREA 5FDLA 4F50A 4J9RA 2FVQA 3NBPB 4RW7A 3PJWA 3KLFB 1MMLA 4XPEA 4ID5B 4NLVA 4TY9A 4J9OA 3V6DA 2XI2A 2WK4A 5C42A 1UWBB 3N6LA 1LWCB 1S1VA 4ECUA 3ISND 5J2QA 4LQ9A 3MEDA 1S6PA 2FJXA 5DGAA 3NKYA 1RT6B 5KFAA 4Y2CA 4K50A 5KFQA 3ICLA 4ZP6A 1N6QB 5L1JA 1JXLA 2V0NA 3DLEB 5EUHA 1S0OA 1LWFA 1VRTB 4O3RA 4LQ3A 2VG6A 2GC8A 4KE5A 1FKPA 5D3GB 2BRKA 3NL0A 2ZD1B 3DMJA 2IM1A 5KT6A 1S10A 2J6TA 1JLBB 3DM2B 3MEEB 1JLEA 2V9WA 5T14A 3C6UA 3PW5A 1DTTA 2C22A 4KV8A 1NHVA 2ZE2B 4GC6A 2WRMA 1BQNA 1YVFA 3CVKA 3TAMB 4DL6A 1BQMB 2D3UA 3DLGA 3CDWA 4TYBA 3MR6A 4TQSA 5J2PA 3KMQA 2IMWP 2C28A 1MU2B 1TKZB 2B5JB 4DL7A 5KFVA 1LWEB 5K14A 5L9XA 4XO0A 2W9BB 3T5JA 2E9RX 5JUMA 4ICLB 5HBMB 2E9ZA 4R8UB 1IKWB 3Q8QB 4IRCA 4WFYA 4QWBA 3KLGA 3IG1B 1JLEB 2ASDA 2RF2B 2I5JA 4RW8A 1K1QA 5KFXA 4ZHRB 3MR5A 1HYSB 4B3OB 2XCAA 4EBEA 4EYIB 1BQNB 2QV6A 2OPRA 4Q45A 3H2LA 4QWCA 1VRTA 4ECQA 4NRUA 5JXSA 1JLFB 2FVRA 1RTJA 3CJ0A 2B6AB 4MK8A 5KFYA 4J9SA 4EBCA 4IDKB 5I42A 2HMIA 3V6HA 3CWJA 3MEEA 2FLNA 4JV1A 1JLBA 3DM2A 3M8QB 4ZVFA 3N6MA 2R2SA 3LP2A 1JKHA 4DL2A 5KG1A 4LSNB 3EPGA 1T94A 1S1TA 3QLHB 4DEZA 4IKAA 2JC0A 1LWFB 4RUCA 4J9MA 1RYRA 5KFLA 4ZMMA 4RW9B 3VQSA 3FFIA 2YKNA 4TYAA 4ZVEA 2OPPA 3OHAA 4PQUA 3OLAA 3CDUA 4NLYA 4F4ZA 1HQEA 1T03A 1LWEA 5K14B 5C5JA 3BR9A 1N5YB 3GIMA 2AGPA 3BSAA 1EETA 3EZUA 2R8HA 2HWIA 5F8MA 3MFHA 2WB4A 3TAMA 3QZ8A 3QGHA 2BRLA 5CYMB 4FBTA 4MKAA 4YR0A 4IG0A 2ATLA 3BGRA 3LALA 4ECYA 1RT3B 3OSNA 2YNGA 4HKQA 4WXOA 1JLGB 3V6KA 4ECVA 2V4RA 4KAIA 1RTHB 4J9PA 3E01B 2BR0A 3KLHB 1RTDB 4RNOA 1S9EA 4IFVB 2YNIA 2IM3A 2RF2A 2IM2A 3FDSA 4NCGA 3LAKA 1LW0B 5KT3A 2VG5A 1QUVA 2AGOA 2IC3B 2BANB 1S1WA 1DTQB 1JLAB 4ZP8A 4MK9A 3E51A 3HKWA 2IJNA 4GC7A 5KG7A 5F8GA 4FBUA 1N5YA 3GIKA 4FS1A 1HMVA 5CYQB 4O44B 4NRTA 3MEDB 2FJVA 2R2RA 3C6UB 2R8IA 3NBPA 2AX0A 4WYLA 4M94A 4NLGA 1C0TA 2HAIA 4TN2A 5KFPA 3OL7A 2C2DA 4I2QA 5C42B 3DI6A 4J9QA 5KFZA 4U6PA 3T5HA 1T3NA 2W7OA 3BQ1A 1REVB 1S49A 3KLIA 4IH5A 5F8IA 2UUTA 4ED2A 2B43A 1IM4A 1C0UA 1HPZA 1RT7B 4EO8A 1T05A 3CIZA 1S9EB 4IFVA 2UVUA 2YKMB 4MFBA 3T1AA 2D3ZA 3I0SA 3V4IB 3V81B 4NLRA 2JEFA 2R8GA 3PZPA 2ASLA 1SV5A 1HARA 1JLQB 3ITHA 5C25B 5KG3A 4RW8B 2UVWA 4F4WA 2YNGB 3DLGB 1SH3A 3Q8RB 4H4MB 2VG7B 1RA6A 5I3UB 1IKYA 3H4DA 1I6JA 3SFGA 1OS5A 4ECRA 2HNZB 3DLKA 4TXSA 1RYSA 1DTTB 5EDWA 3I5CA 4NCGB 3H59A 1QE1A 4ZVGA 2RDIA 3LP0A 4Q43A 3IG1A 4K4XA 1FK9A 1HNVB 5KFDA 3H40A 2FVPA 2OH2A 2AX1A 4IR9A 3V4IA 2GIQA 1RAJA 2VG6B 2ALZA 4I7FB 1R0AB 4O4GA 1KLMA 3ISNC 4ED1A 5HLFA 2VA3A 2W9BA 1FKOA 4Q0BA 1TQLA 2XGQA 1J5OB 2B6AA 3IS9B 1RA7A 3IGVA 4PUOB 4ECSA 4DL4A 3GIIA 2CKWA 3I5AA 3KLEA 3NMAA 3I0RA 3DRRB 4K4UA 3PJXA 3KHGA 5J2NA 3KK1B 4ZHRA 4ED3A 4R0EA 4WE1A 2I5JB 5KG0A 1LW2A 4NLSA 2YNFA 4J9LA 1C0TB 4O3SA 3KK3A 2F8EX 1S1XB 3MR2A 5J2MB 4M95A 1C1CB 4H4OB 4IQXA 2W9AA 5KFTA 5C24A 3OSPA 4IG3A 3FFIB 4H4MA 1Z4UA 4RNMA 4QWAA 3FRZA 3JSMA 2D41A 1UWBA 2JC1A 4WFZA 3KLGB 4K4YA 1HQEB 1T03B 4URGA 1EP4B 1RT1B 1JKHB 4RUAA 4K4VA 4QWDA 1TVRA 3Q8SB 1N48A 3BJYA 2YKNB 4DL5A 4KKOA 4RZRA 4RW7B 2YNFB 2W7PA 4RNNA 1S6QB 2XI3A 1RTJB 4KBIA 5KFIA 3BSNA 1JLCB 5F8LA 3FQLA 3H5UA 4NLXA 4O3NA 2BANA 3RB0A 4WYWA 1RTHA 5F8HA 3M8QA 3KOAA 5F9NA 3QO9A 4LSLB 3IS9A 4G1QB 3T5LA 3DOLA 2HNDA 1QE1B 2AGQA 3GV8B 2AQ4A 3M8PA 3MEGB 4MIAA 4IG0B 3TQ1A 3HHKA 5CYQA 1RT6A 1KLMB 1RTIB 3RB6A 1R0AA 2RDJA 4NLOA 1XR7A 4Q8EA 4K4TA 5DQIA 4Y34A 3IN5A 1S6QA 1DTQA 1JLAA 3JSMB 4KSEB 2AWZA 3FSIA 4DG1A 4IFYB 5KG2A 1S9FA 4IRKA 4IH6A 4FS2A 3MR3A 1C2PA 3NAIA 3M9NB 1XR6A 1RT7A 4TLRA 3T5KA 4KFBB 2RKIB 2W8KA 5DQGA 2R2UA 1BQMA 4QW9A 2IC3A 5C24B 1SV5B 3UR0A 2BQUA 1K1SA 4YMEA 3PW0A 4ZP9A 1DLOB 1SUQB 3OL6A 3G6YA 3M9MB 5HROB 2WTFA 4K4SA 4IR1A 1JIHA 3OLBA 3QO9B 4LSLA 1CSJA 2GIRA 3HVTA 2UUWA 5KFMA 5EWEA 3RAQA 2IBKA 5KFKA 3SI8A 3DI6B 4ZPBA 3MTKA 3LP0B 5KFRA 3T19A 3NGDA 3BQ0A 1TL1B 3HVAA 3IRXA 5J1EA 2O5DA 1JLFA 4RW6B 4NLWA 4O4GB 3UPFA 2BQ3A 4ICLA 5KG6A 2ASJA 4MIBA 4IFYA 3CO9A 2VG7A 3DRSA 1LWCA 1EETB 1S1VB 1TKTB 2FVCA 4Y3CA 4QW8A 4IOBA 4MKBA 4JV0A 2XC9A 1N56A 3TVKA 4URQU 3DRRA 3GV7B 1RTIA 2J6UA 3UQSA 1N4LA 4Q8FA 3CDEA 3KLFA 1GX5A 2JEJA 3IGNA 2HNYB 2XCPA 4RW9A 3BSCA 3CJ3A 3KK3B 4NLPA 4IDKA 5KFBA 3G6VA 1FKOB 4Q0BB 3KJVA 4H54A 5KG4A 2I1RA 4NYZA 2YNHB 5KFSA 1C1BA 5HLFB 2D7SA 2UVRA 4PWDB 4WZQA 3E01A 4EO6A 3I0SB 1FK9B 4ZPCA 3V6JA 3RB3A 3MECA 2FVSA 1VRUA 1S48A 2WCXA 3QGIA 4ZPAA 4EYHB 3RBDA 1TVRB 5CYMA 4I7FA 4G3IA 5L1IA 4J9KA 5L1KA 1ZETA 3D5MA 1FKPB 5D3GA 5J1EB 4ECXA 2DPIA 4ED0A 4NLQA 3PW2A 3PR4A 3DRSB 4IG3B 2XGPA 3KK2B 4QPXA 3DOKA 4NLUA 1HMVB 3KLVA 3BQ2A 4YR2A 4O3QA 2R2TA 4KV8B 1C1CA 1EP4A 1RT1A 1TL1A 1ZTWA 1S1XA 2FJWA 2V4QA 3DYAB 4TY8B 4F4YA 2W9CB 3PW7A 3HVWA 3JYTB 2FLPA 2EC0A 1KHVA 2WHOA 3QYYA 4ZVHA 4PUOA 1HQUA 5KT2A 1TL3B 1S1UA 3LP1B 1C0UB 5I42B 2R8JA 1LW2B 5KFUA 5KFEA 4YR3A 4K4ZA 3DOKB 4KHRA 3LAMA 4URSA 4WFXA 5EWGA 2VA2A 3QIPA 2IAJB 2ILYA 4I2QB 1JLCA 1HNIB 2RKIA 5DG7A 3KHLA 3M9OB 1U09A 4R8UA 5DLGA 4KO0B 4R5PB 4J9NA 3V6DB 4EEYA 5HBMA 1IKYB 5DGBA 1QAJA 1QAIA 2HWHA 3M8PB 3MEGA 1S9GA 3NAHA 3BSOA 1S1UB 5KT7A 2OPQB 1XR5A 3C6TA 1RT4B 1S1TB 3ITHB 5F9LA 3PHEA 3DRPA 4U7CA 5HP1A 5KFNA 4TY8A 5KFWA 4EBDA 4PQUB 5I3UA 3DLEA 3CJ5A 3OHBA 4ECWA 2HMIB 4IRDA 1RT3A 1WNEA 4G1QA 4F4XA 2J6SA 1TL3A 2HNDB 3LP1A 1IKVB 2ZD1A 3KLEB 3LP2B 1D0EA 4QWEA 1HNVA 4KHMA 5F8JA 5DG9A 3DYAA 2OPQA 5DQHA 3KHHA 2UVVA 5F8NA 1DLOA 1SUQA 3EPIA 1SH0A 1HQUB 2IM0A 5KFGA 2HNZA 1GX6A 1TV6B 3DRPB 4H4OA 4RW6A 4KO0A 4DG1B 4R5PA 3H5YA 3RBEA 1S6PB 1MU2A 1TKZA 2B5JA 4RNHA 3H5SA 5DG8A 5J2NB 3H4BA 2XWYA 1S9GB 5KFFA 3I0RB 3QIPB 1IKWA 4Q44A 2ILZA 4WZMA 2WONA 3OL9A 1LW0A 5J2MA 4ZPDA 1VRUB 2AU0A 3IRXB 4O4RA 1RT2B 1RT5B 2WOMA 4DL3A 2ZKUA 3QZ7A 3UDLA 3I5BA 1S1WB 3KLHA 2OPRB 3LANA 4O3PA 3GILA 3FQKA 3MF5A 4ED7A 3RB4A 1S97A 4JV2A 1C1BB 1IKVA 3HVTB 3OL8A 3MFIA 3Q8PB 3KNAA 2ZE2A 2YNHA 4KB7A 4PWDA 1ZTTA 5KT4A 2DPJA 2JLEA 5EWFA 3DOLB 3MECB 4KKOB 5HP1B 1S0MA 1S0NA 1TP7A 2JEIA 4I2PB 4HYKA 4O3OA 3KJVB 4WXWA 2WOMB 4X2BA 3KHRA 1RDRA 4O44A 3KMSA 3H5XA 2YKMA 4MFBB 3V81A 2C2RA 2BQRA
chains in the Genus database with same CATH superfamily
1BXNA 3PW4A 1RHKB 3R5GA 5FDLB 2RILA 4CM0A 2PSZA 1CJUA 1MROB 4LSNA 1JLQA 1QSSA 2XY6A 3QLHA 1H2UX 1REVA 4ER8A 1KHWA 3R2CJ 5KG5A 1VYAA 3BGFA 4RW4A 5FLXY 3N6NA 2DGUA 1N34F 1R6VA 3IO1A 5D0HA 4X4VA 1UZDA 1H38A 1KQKA 4MAKA 5DLFA 1NZAA 1WACA 2K06A 2G0CA 4AL6A 3PO4A 3D4JA 3KDNA 2C3YA 1DQ8A 2LXIA 3RAMA 3QSIA 2W9CA 4LFBF 3R5JB 1W25A 5D8HB 4ECZA 3X1LB 2F7VA 1F3FA 2DXEA 1IR1A 2A6OA 1PC4A 1NNDA 1N6QA 1RABB 1X4DA 3GJSB 4I2PA 3U1LA 4X66J 3FBCA 3M2UA 3M05A 5B0CA 1UJ5A 1GQEA 4BHQA 2NUHA 3HFVA 4A8FA 1N5TA 2HVEA 4QU6A 2LLZA 2AEFA 4KPYA 2FHJA 5K5MA 3GQCA 5AJ3F 1U6ZA 3KK1A 2IY5B 2V9KA 2H65B 4ALZA 1FJ7A 3UFCX 2KXNB 5L8RC 2W01A 5ETOA 2VG5B 4NYOA 2CQBA 3FEXB 4LF6J 1IR2A 4I1TA 1H3DA 4ZP7A 2DB1A 1WSRA 2D9PA 5CZVA 1UL3A 2XLKA 5D4NA 4ZVSB 4CLKA 5J2PB 3IRWP 4C8YA 4OLPA 3CCQS 1HBNB 4C3KA 2Z30B 4NZ0A 3ZNUA 4CT8A 2R7WA 3DGVA 4BLGA 3BZQA 5KFJA 1VK3A 3G87A 5IOLA 1RHMB 2OSQA 4FN5A 4Y2AA 5SZTA 2PEHA 3GJQB 1D1UA 4F50A 2HVIA 1NAQA 1P9QC 5B0BA 3T1YF 2WSCC 3M32A 4XPEA 1L3UA 1S6UA 4NLVA 4QOTA 1MNEA 3MM5A 4TY9A 4DR3J 3SQOP 1I51B 3CC2S 2PO4A 1UWBB 1YG0A 2WW4A 1SBRA 2W2QP 3ISND 5A8WA 2DXFA 2BKPA 2J76E 4X4OA 5J2QA 1S6PA 4WP3A 2OAUA 1MWQA 5IC4B 4TU9A 4C11A 5KFAA 4U8YA 4B3TF 4DR7F 3SCLE 2A0FB 4ZP6A 1N6QB 2DH7A 5L1JA 1AW0A 1JXLA 1QUPA 1K47A 4AE5A 3AFGA 1KBRA 5BR8J 2DD8S 1FFSB 3Q22A 2GC8A 3D0HE 2KVIA 4MJKA 2BRKA 3VVUA 1HR0J 3J7AN 2ZITA 2LQBA 1U7LA 3DMJA 5KT6A 5A2QY 1NJXA 3WX8A 1JLBB 3DM2B 3I4PA 5DRKA 1T9UA 2J6TA 2MB0B 1JLEA 1BY9A 1V5IB 1N0VC 2GJFA 2V9WA 2CG4A 2I38A 3TVZA 3LOUA 4KV8A 2H51B 3PKYA 3M8SA 3NS5A 2D3OR 4GC6A 2XMVA 3A3NB 1BQNA 4DSJA 3WBZA 1LQ9A 3TAMB 4QYRA 3UD3P 3AQOA 1U8WA 2CQGA 2KG1A 3VGUA 2C28A 1X4AA 2IMWP 1TKZB 2QFIA 1LWEB 2K8GA 5L9XA 3T5JA 4FPIA 1NKCA 2E9RX 2A1BA 4R8UB 3Q8QB 5HANA 4IRCA 1X7VA 3B54A 3LWLA 1U1NA 3NNHA 3EDQB 2FQQB 4WJBA 4A8XA 1UFWA 2RF2B 3K7RA 4DCJB 4YHHJ 4ZHRB 4QIVA 2OD4A 2ZVSA 4WU3A 2F8MA 4Q2MA 3DRYA 2QV6A 4Y2KA 5IV3A 2NYIA 2V2QA 3H2LA 4Q45A 4QWCA 1XMOJ 1JLFB 2XWXA 2ZJQQ 1D8ZA 2B6AB 1NJWA 1IVZA 1QDUB 4IYQA 4LRAA 2CPHA 4ETXA 3R5BA 1EQMA 4KJIA 1CJKA 2EKNA 4HACB 4J7CA 4DMZA 3BO4A 2HQIA 2BOPA 1SPBP 4B9VA 1KDNA 2HZVA 2LEPA 1PYTA 5KG1A 5BYSA 1B0TA 3EDRB 3N0VA 2QSWA 4IKAA 2JC0A 1LWFB 2LVWA 1UTAA 2PE8A 2V34A 2XHCA 5HSPA 4RUCA 1KNZA 3PKMA 4TYAA 2YKNA 2GAHC 2OPPA 3SQGA 1BWEA 1M0SA 2XMWA 4OFZA 3BN4A 1OSDA 2NSBA 3GONA 5K14B 1T03A 2BZ2A 3P3DA 4LR8A 3V2UC 3GIMA 1W7WA 3BSAA 1AFIA 2F1FA 1QSYA 2D74B 2R8HA 3M6XA 2BMBA 1VQMS 4ILLA 3TAMA 4XIUA 1U26A 5D15A 3NLCA 4RUBA 1CG2A 5CYMB 2RHSB 4FBTA 4MKAA 3E2EA 1TK8A 2H9ZA 2BJ1A 1R8AA 2ZWPA 1RBLA 4LREA 3V6KA 2UUBF 4HKQA 4DQSA 2R9LA 1F9FA 4N5SA 1RKIA 4AL5A 1F9EB 1Z2ZA 3U7JA 4ATNA 3L3CA 2C2OB 2V8HA 4CLLA 2YNIA 1F6TA 2K7KA 4NCGA 1U45A 3QPIA 4LVOP 1KQFB 5IT0A 3TJ9A 3FSXA 1FRKA 2AGOA 3I56S 2I8EA 4LRFA 2GIFA 3T6JA 1VFJA 4DSFA 1DTQB 1HNXJ 3CC4S 3CCSS 1ZAXA 4H4KC 5ETLA 3H8YA 4Z37A 4DSIA 2Q79A 4GC7A 5KG7A 2YH0A 2XO7A 1RWKB 2DIUA 4OIXA 5E41A 2MKSA 4X66F 1HMVA 4QQBA 1NSPA 4P6QA 5IT9U 1NK5A 4M94A 3C6UB 4UOHA 3RR8A 4Z2XA 2ROEA 2HAIA 4TN2A 3KYLA 4I2QA 1RHJB 2CJYB 3DI6A 2AJ4A 3GMGA 4J9QA 2AP6A 2W7OA 4QJVA 3BQ1A 2VJUA 4ED2A 3CMES 1HBNA 5G0RA 1U1MA 1KD1T 4CP5A 2L9DA 1RZMA 1SC6A 2VFSA 1HPZA 2Q1LA 1HI0P 2ZJPQ 4OV6A 3CIZA 3GYGA 4IFVA 3UO0A 3I0SA 1U24A 4DZDA 1RP5A 3EXCX 5HJXA 1FDBA 3FMWA 4PQAA 2HURA 1Q4RA 1HARA 2IVFB 1KC8T 1FDNA 2HVZA 2H4WB 5FLXU 8AT1B 3B4MA 4RW8B 3IR5B 1Q1KA 2QLBB 3ELHA 4F4WA 3DLGB 1SH3A 1Y00A 3O44A 3H4DA 1A9NB 5H9EK 3SFGA 1OS5A 1FTRA 4MKVA 3F56A 4TXSA 2EFQA 3M2UB 4NCGB 2DNZA 2XNQA 5K9FA 1NK9A 3HLUA 2HFVA 2KKHA 3IG1A 2ASYA 3H40A 1NKEA 3GU0A 5SUHA 3HVRA 2ALZA 1B64A 2HK2A 3FNNA 1KLMA 4ED1A 5HLFA 1PG5B 2PI4A 2GQCA 5E3QA 2W9BA 4DSKA 4Q0BA 2FZCB 2CPZA 4FNIA 2XGQA 4DV3F 5FJ4A 1QTNB 2O1PA 4OLOA 1X4BA 3PRVA 1Y7PA 4PUOB 4DL4A 2VPWB 3GSIA 2CKWA 3KLEA 4OYAA 1HW9A 2VL1A 4N41A 3M2RA 1SIWB 2GHPA 2HZAA 5KG0A 1U6FA 4XAKA 1LW2A 2GW8A 4J9LA 1UEVA 5B7WA 4O3SA 1XNQF 1HI8A 4O23A 2ZDPA 3BPSP 3M8ZA 3G2XA 4ZCLA 3MR2A 3UI3A 4DX8H 2EFVA 3B78A 3K8WA 3UCGA 3K2YA 2DO4A 5A6WA 4H4MA 3AODA 2QT7A 4Z7CA 1D9DA 5LSRA 2GCFA 4A46A 4RNMA 4QWAA 1M90T 1UWBA 4WFZA 3KLGB 1T03B 1PCAA 3I32A 1O51A 2NSCA 4RUAA 1K8AT 2MZRA 4K4VA 3K59A 1TVRA 1SI9A 2WBMA 3Q8SB 3SYZA 4KKOA 4DL5A 3WIVA 4QPTA 4N76A 3EJMA 2QG9B 1NDKA 1LWXA 2CDQA 3L7OA 4KBIA 1XQIA 2VC1A 2W4CA 1F3VA 5KFIA 4DDFA 1HBUA 5F8LA 1CULA 2G0IA 2ZOGA 3H5UA 1ZOTA 2BANA 2VH7A 1RU2A 2K2PA 3DFEA 3FJ2A 3L9ZA 3R5DA 4P10A 2HGNA 1BE4A 4HACA 3GG1A 4WYWA 4CLYA 1TMJA 1RK8A 3QO9A 1X8DA 2ZUAA 6AT1B 5ITHA 6FD1A 3KWMA 2EXUA 1CC8A 1RWOB 3GV8B 2E1CA 2AKWB 2KXFA 3MEGB 1HD1A 3E3XA 3O2IA 5CYQA 1GAOA 2DGOA 3BGOP 4RBTA 4WPAA 2EFPA 3P49B 4J9UE 1K0VA 1NMEB 4KSEB 2GZOA 1YGYA 4K5SA 3IBFB 3KTQA 1YBTA 4U8VA 4HT5A 4FYYB 3MR3A 2FJBB 3THPA 2LU2A 3MM7B 5A0YB 3I31A 2MQPA 2XO6A 3M9NB 1RT7A 3VAJA 4LMZA 2DT9A 2MDAA 1J5EF 1SB6A 4TLRA 5CQGA 4DS4A 2CZVC 3FCVA 4P72A 5D78A 2AHOB 5E7OB 2ZZNA 1XIQA 3I9V9 5JMNA 1HNWJ 4B08A 2ZH1A 1ZM9A 3K0JA 4AT1B 4RKUC 5A76A 2PMZD 3QWPA 2CADA 4K4SA 1Y5IB 2HBRB 2HGMA 1WC6A 5H9FK 1VLOA 4N56A 4QIWD 4B3RJ 4LF4F 1B0PA 5M2PA 3PY8A 3RAQA 2K1RA 2DBBA 5A8RA 3M30B 2H5JB 2MZJA 3MTKA 3LP0B 2F4FA 2W4DA 3HI9A 3AQPA 4CRJA 3IM8A 3HVAA 2CG8A 4YHHF 3TARA 5J1EA 1M5SA 5GVQA 2JFDA 1URRA 1B3TA 2F4VJ 2CJ9A 2VPXB 4O4GB 2CVIA 5KG6A 2ASJA 4JI1F 4JBCA 4MIBA 1F0XA 3RYLA 1KKHA 3CO9A 4QBUA 2QL7B 1FRJA 1ZM4A 1MN9A 5A8KA 1LWCA 1S1VB 1ZAVA 2XC9A 4Y3CA 2WW8A 4JV0A 1N56A 1Y5NB 3A3PB 4X4QA 3LPEA 1A7GE 3TO8A 5KAKA 1GH8A 2V8PA 2KRRA 4RJVA 3CNQP 3PXGa 3ZTQA 2J0WA 2JEJA 3MMJA 2DHXA 2CQ2A 3BSCA 4NMLA 4RW9A 4NLPA 4IDKA 2XCPA 1PSDA 3MM6B 2O3DA 4NXMF 5HMWA 2MPUA 5KFSA 4NYZA 5KG4A 2GX8A 3TEGA 1NZ8A 3QFHA 1AA1B 1NB2A 2ZWOA 4ZKAA 4X62F 3I0SB 2J9CA 2YQ1A 1OMSA 1S99A 3GSDA 4ZPCA 4DR1F 3V6JA 3RB3A 3QJLA 5A8KB 3HSZA 2ZJRQ 4CYUB 1VRUA 1S48A 1FDAA 2MQLA 4CIOA 4MYUA 2FJAB 4OI2A 4UY85 4J9KA 4ZITA 2XY5A 2UV8G 1FKPB 1HW8A 4OYMA 4JI4J 5D3GA 1VBZA 1RI7A 3KUGA 4ZOSA 1RAHB 2HS0A 2KJVA 4LJMA 2BJEA 3WC2A 1ITPA 2ATCB 3KK2B 1LV5A 2RS8A 2CA9A 2BVZA 3DOKA 1HMVB 4UQTA 4OZ2A 4YR2A 2VBWA 2V67A 1C1CA 3ILOA 4LVNP 3CJKB 5CZXA 2B7CB 2PIIA 1OY9A 3AOCA 4DSLA 2HFNA 3BYPA 3B6BA 3CSKA 3IAM9 4P9SA 4F4YA 2EC2A 1UVJA 2D69A 4M5HA 5D0RA 3GB0A 4GKKJ 2JL9A 3NCPA 2FLPA 1XJWB 2HHVA 2RJZA 3PNIA 3UNGC 4YFUA 1FNMA 2WHOA 4PUOA 7FDRA 4X62J 3UCUP 3Q86A 3T9ZA 2AW0A 3SV3A 2LQ8A 1C0UB 2A2CA 1S6OA 5LOQA 1X4EA 5I42B 4ED5A 1LXJA 1LW2B 1GK8A 1NM2A 3GJRB 2VQFF 1KFSA 2V8DA 4TU7A 2LCWA 4W92B 4DHVA 1XNRJ 2H5EA 2PGCA 3DOKB 3C14B 2WAQD 3FMBA 4URSA 5EWGA 3QIPA 2IAJB 2VA2A 1JLCA 3ZXWA 2X3DA 2RKIA 3SCIE 3BM7A 5DG7A 2UXBJ 4PAAA 2H3EB 1RWWB 4DR5J 2PC6A 2NYHA 2HHWA 4J9NA 4V19J 3W62A 2RQMA 1QAJA 2BW7A 1AUSL 1KTQA 2M8HA 1E6VB 4M5JA 1HLWA 2IIHA 2UUCJ 2JVRA 2OPQB 1XR5A 3C6TA 1RT4B 1JMTA 1HHQA 2OFHX 4E2FB 1S1TB 5B09A 1YJUA 1CEZA 3FC9A 3H2UB 1HL6A 2QYGA 2MLZA 1G6BA 2QO3A 4TY8A 3W64A 2LQJA 4WTOB 4ZS6A 5L46A 3DLEA 1V9OA 3D6MB 3OHBA 4JI0J 3A4TA 2UUAF 2ZBRA 1O0PA 1BQXA 1PJ7A 2YWWA 1TL3A 4EMDA 4WIIA 1TK5A 3OJUA 4TVAB 1IKVB 2YWHA 2B0GA 3CJRA 3EWGA 3HHLD 4BCAA 1N34J 5LMUF 2LQ9A 2P8IA 2HG4A 3N5FA 1P27B 3SSRA 4PWWA 4QWEA 1ZPWX 3QT6A 4KHMA 2KFNA 5DG9A 2KVQE 2OPQA 3HSJA 3PFEA 3BKFA 5A2QU 4E8UA 1DLOA 1SUQA 3EPIA 1CC7A 1U02A 4PYDA 5F8NA 1HQUB 2IM0A 3JTPA 2HNZA 3BBFA 4OZNA 1WF0A 5DDPC 3H5YA 1I1GA 3BYRA 1N32F 2XEXA 3BO2A 1MU2A 2B5JA 2GJ2A 1SCJB 2EK6A 2RNEA 2U2FA 3F41A 4I6WA 4RNHA 2B8PA 1R8BA 3EVMA 5DS7A 2RSQA 3RRKA 5DG8A 2XWYA 1S9GB 3R7SB 3J81j 2MLXA 3MCNA 2C1EB 3QIPB 4Q44A 2GHWA 2WONA 1N54B 5HO4A 1QSLA 3OL9A 3WZ0A 1JQGA 4CO0A 4OZJA 2OO4A 5GAGU 1M5OC 2ADCA 4W98A 3UDLA 3H0PA 3KLHA 2A6MA 2RU9A 4RO0A 4B9TA 4ED7A 1U8SA 4IO9Q 1C1BB 1F2HA 4ZPTR 5DDRC 1M1GA 2XMUA 4PWDA 4J9VA 2HPUA 2DNKA 2W4PA 2RAQA 5J1PA 3PJ9A 2N7CA 2OTJS 3QFWA 3DOLB 2WSEC 1EIYB 4GKJJ 1NSAA 2MQMA 1APSA 3HDSA 1TP7A 2FPHX 3KUEA 4ANDA 1PKUA 4PR6A 3HT3A 4N7TA 3DRXA 1X9MA 1FJGF 3FCWA 1HBMA 3KJVB 2NPIA 2QL5B 3ENAA 4X2BA 1TAQA 4OHVA 1RAFB 2E7WA 1UFLA 2F8HA 2YKMA 3FRYA 3EGVA 3M8RA 1FFGB 1R0CB 4OYZA 1LOUA 1AXQA 1Z1ZA 5KT5A 5IM0B 3Q8YA 2CJQA 1C4AA 3OD2A 2M9KA 1UKUA 5C25A 3KLIB 2BM0A 3DLBA 2CPJA 3AB2B 3OV7A 2YPZA 2AZ3A 5LJ5Y 5KFOA 3OXLA 2WVEA 2R8KA 3W2VB 1IKXA 2YXLA 4P7VA 4YP3A 1YJ7A 1NCLA 3X3UA 1HPZB 1HHSA 1T05B 1IBLF 3H98A 4OJ1A 2VFVA 5KFHA 1NJZA 4I6AA 3UNYA 3GYNA 1PYOB 4CLPA 1RTDA 1HKAA 2C2EA 5CD4H 4KFBA 2ZHOA 1PILA 3VTIA 5LXYA 1RT2A 1TKXA 3HHLB 3BGRB 1D3WA 1VDHA 4G65A 2YBVA 4IQMA 3R5AA 4NLDA 4MH8A 1NHKL 5HMYA 2VBXA 3G96A 4XPCA 1U2CA 1IBMJ 4USWA 1LKZA 3ZZZA 2YNIB 1SH2A 1Q8IA 4J90A 4WE1B 2I0XA 4Y2IA 4GVBB 1NK8A 1HNIA 1E6VA 1UJ4A 4G1PA 4QR1A 2HHSA 1HWKA 2IAJA 4OYIA 1FD8A 3QGGA 3R6GB 5DZ6A 4ECTA 2FZGB 4ZVQB 3GIJA 4L75A 4ANCA 2BXJA 4IH7A 4NLTA 3TAQA 2HNYA 4CO5A 1RGVA 3FZBA 4RX6A 4DPXA 4RW4B 4JI8F 5L1LA 4DFMA 3HFKA 2KG0A 3LWMA 4MMOA 1FT8A 1SL1A 3NCQA 4MK7A 4NE9C 2Q6CA 3VALA 1T02A 1VQLS 2V2ZA 3Q2SC 4MTPA 1FNXH 1HYSA 4M5DB 3OR2A 4OX8A 3VZIA 3NBPB 4RW7A 4CO2A 4I68A 4Y6IA 4YS2A 4J9OA 1YWXA 3V6DA 4DQIA 3CCJS 5K8PA 1I94F 5HVGA 3LPYA 4H4KA 3CCTA 4HI1A 2R7TA 2FDNA 2MEWA 4DQQA 2VFRA 2E1PA 3R8YA 2XMMA 2HRUA 3TUZC 1REGX 1RT6B 1Q78A 4K50A 1YLXA 5KFQA 2MYFA 4C8ZA 4HDHA 5EN1A 2OTLS 3P8BB 5HAOA 2V0NA 1F5BA 3DLEB 4WK3A 2LECA 1S0OA 4O3RA 1VRTB 2U1AA 2LXFA 4KE5A 3BKTA 2FZKB 4I67A 4Y65A 1Q53A 2IM1A 1S4EA 4PXEA 2WVBA 1OY8A 3NG8A 1AYEA 1DTTA 2C22A 1NHVA 2NS1B 3GTYX 3KUHA 1W2BR 2Q66A 2E7XA 3OT9A 1K73T 2V4JB 2KDOA 1YVFA 4FP9A 4DL6A 2D3UA 4YY3J 2XY7A 5L39A 5J2PA 3AD7C 3HSGA 1Q95G 2XB2D 3MCMA 4DL7A 2CQPA 3O8WA 3R2DJ 5B08A 4JP8A 5LMNF 4I56A 1Q81T 1RAIB 2CWXA 4DCPB 4DUZF 4ICLB 1N36J 1CVJA 2Y9HA 1D09B 1IKWB 2W2PP 1EKSA 4ZPWR 2YQ0A 4HVZA 1TFYA 1AFJA 1JLEB 4LF5F 2HHXA 4EK2A 2BKNA 4M5MA 2JVOA 3D7SB 4ZN1A 2KM8C 2XCAA 2Q43A 2DGXA 1BQNB 5D6GA 2J9DE 3M2VB 2MSTA 3BBCA 3MAAA 5E3RA 5JXSA 1KR4A 3RBXA 1X0FA 2FVRA 2HBZB 5AXKA 4DV4J 3NOGA 3B8HA 4EBCA 4B3SJ 1DJ0A 1WKKA 1H7XA 2LA6A 2KB2A 1WOPA 1LFWA 2FLNA 4ELUA 1JLBA 3DM2A 4F67A 1BLUA 2L48A 5AXLA 2QEXS 3CIMA 2R8IA 3LP2A 2JEFA 2EEYA 4PXCA 3QQCD 1UZHA 4LSNB 5ADZA 3QLHB 4DEZA 4ZLNA 3H25A 4HH0A 3EPGA 1CJVA 4J9MA 2XS2A 2OSRA 4BBYA 4CO3A 2CQ1A 4ZVEA 4ZLLA 1DURA 1ZZNA 3KG4A 4BDPA 3C16B 4MKYA 2E1AA 2MKCA 3DXSX 1MN7A 3QMQA 4NLYA 3D68A 1YBUA 1IWGA 4F4ZA 1N5YB 3BR9A 4DV1J 3Q83A 2FY1A 4P75A 1EETA 3KJNB 1B4SA 3G71S 1NKBA 1MMNA 3A8KA 4TKTA 1LNQA 2QTWA 3CW2C 3R7BB 3W8GA 3QGHA 4WU2A 3W9IA 4ILRA 3A8IA 3R9LA 1YI2S 1DQ9A 4IG0A 3MMCA 5RUBA 4HDGA 3BGRA 2ATLA 3CJSA 4ECYA 1RT3B 3DOMB 2V4RA 2NZ4A 1UA0A 4KAIA 1IBCB 2ZH6A 4Z7YA 5B0EA 5ETQA 1WHWA 4M5IA 3QWUA 2AIRB 1RTDB 2YKAA 5E3PA 4NA3A 1S9EA 1P1TA 2GVDA 2VF3A 2IM3A 2RF2A 3CO0P 3M8YA 3Q8VA 3PYGA 5E5NA 1OQ3A 2Q3PA 3G82B 1LW0B 4QZVB 5EHHA 4DR6J 5I4MA 4RR5A 5D4LA 1QUVA 3R5CA 5U47A 2KN4A 1HHTP 2F3JA 1S1WA 1JLAB 2MZQA 4MK9A 3HKWA 1HBMB 2AEMA 3NEKA 4J5OA 4R25A 3TX0A 1P1LA 2CRLA 2AMCB 3K8VA 3HD1A 4KGVB 1UVMA 5G4DA 5LMNJ 3VF0B 1PO6A 4JI4F 3W65A 1ELOA 1WC0A 4NRTA 4P74A 1FCAA 3IBWA 2DJWA 1YHQS 4NLGA 1IWAA 3NGKA 3NBPA 1MWZA 2AX0A 4G1IA 5CCMA 4GRSA 2XLJA 5C7PA 3ETOA 1RUSA 5KFPA 3M1VB 3HKZD 4DR2J 3RR7A 2CXEA 4F2RA 5C42B 3MWBA 4NEZA 1AROP 1WDDA 4X65F 2DEJA 2BEFA 2BJ3A 1REVB 2HLUA 3BH6B 3W5YA 3D9BA 2UUTA 4DR1J 1M5KC 1DZ5A 3G9CA 2VASA 2B43A 1IM4A 1C0UA 3PFOA 4J91A 2KZMA 4EO8A 3MI7X 4MFBA 3V81B 1YBAA 2QX0A 3M2RB 4KGKA 3MMAB 4USUA 4JI3F 3PZPA 4LF6F 3MMBA 1UWAA 2DVIA 1SV5A 1KVJA 1JLQB 5BYRA 1F9HA 2LMIA 5KG3A 2CIMA 1MROA 1P9YA 2UVWA 2YNGB 4M63A 1SQEA 2CQDA 3Q8RB 2DNRA 5HATA 1VQ8S 2QYCA 2Y0BB 5HI7A 4C98A 3H2VE 4FYVB 3OUYB 2DGWA 2P9CA 4JI1J 1OYEA 2E29A 4K5RA 1XEZA 3CD5A 3J7ZT 1IN0A 2RDIA 3FSYA 4PG4A 4L72B 2VPYB 1FK9A 1HNVB 1HWLA 3D67A 2I6WA 2HFSA 1R3NA 5AE3A 4IR9A 4C4WA 2JJ4D 4JYAF 4OI3A 3ISNC 1L3KA 1RADB 3RW6A 3M8WA 1TQLA 4EZ9A 2HBQB 1QM9A 2DH9A 3MM8A 1J5OB 3IWNC 1VQOS 3HFZB 2UXDF 2ZH2A 2E5JA 3IS9B 3IGVA 4B9NA 3W2WB 3I5AA 3VWSA 3I0RA 3DRRB 5DJBA 1CPZA 3PJXA 3KHGA 2B9XA 3NGSA 4ZHRA 3KK1B 1EKRA 1BGXT 4R0EA 4WFBQ 2I5JB 2JHEA 5DETA 2JDJA 1C0TB 3NGUA 3VGTA 1U49A 1TL4A 2G2ZA 1S1XB 4CNYA 3RRHA 1YJ9S 2ZH7A 3HO1A 2V63A 1PAUB 4H4OB 5G0RB 4Q2LA 3SZ2A 4XTTA 1UPPA 2GMHA 2FY8A 2O67A 4JV5F 3JSMA 2Z2LA 1KS2A 1IBMF 4K4YA 4YB5A 5LSLA 3MMBB 3MUMP 1FEHA 3P5TL 4XDCA 4E98A 3GPAA 1H2VZ 3NRBA 4X84A 4QWDA 3CCVS 3D0GE 4C8MA 3WIUA 3VCDA 2VDHA 1FEEA 4RNNA 4X4SA 2DRAA 2CPXA 5KTQA 5ETKA 2ZOMA 3BSNA 3MCSA 2Z4PA 3RB0A 4CLUA 1SIZA 1RTHA 3ZZPA 2CYYA 2KM8B 3T5LA 3TVYA 1QE1B 2B4PA 3D3BJ 1HIYA 2DTJA 1R27B 2N3LA 2DY1A 1UP1A 3M8PA 2G1HA 1F1BB 3QAUA 3ZTPA 5CCLA 1RWUA 3HHKA 3H7HB 3S7RA 1KLMB 1RTIB 3HSDA 3JSRA 3OR1A 4P2SA 4C11B 1R0AA 4PG6A 2RHQB 1XR7A 2DNQA 2H1YA 2ROPA 4Q8EA 1WTBA 2F9JA 4K59A 4RL1A 5DQIA 3PV8A 1N8RT 2KI2A 3JSMB 1FD2A 3TZXA 3UE2A 4WK1A 1R7IA 2AWZA 4W4MA 3OBIA 3FSIA 2KL8A 3TA1A 4FNHA 3W1YC 1S9FA 4IRKA 4FS2A 1C2PA 2ROGA 1CQNA 2OP5A 1CLFA 1VK8A 4C6AA 4OHWA 1SJ3P 4DU7A 2R2UA 1XNQJ 4K2JA 2XYPB 3UR0A 3TZWA 4YMEA 2BDPA 4FF4A 1T3OA 5HROB 2WTFA 1JIHA 3P5BP 2RRNA 3QO9B 2DCUB 5D0EA 1CSJA 5H1SV 1JJCB 5KFMA 1FHTA 3GZ7A 2C3MA 4PEOA 2LYVA 5KFKA 3EM1A 3DI6B 3BQ0A 4DOZA 1SJ1A 1SJRA 3P96A 1D8YA 2APOA 2X1FA 4LF9J 3IRXA 3WX4A 2IMOA 1JLFA 3I96A 1U47A 3LGNA 3UPFA 5HQ8A 3GIRA 4KH1B 4OI4A 2HK3A 1QVFR 1JWWA 5ETSA 1Q5YA 2O66A 3IAS9 3DRSA 1B0VA 3OVSA 2FVCA 1EETB 2YKQA 4I64A 2XSFA 5B0FA 4KC5A 4IOBA 4JV5J 4MIWA 1U2FA 3Q8UA 4NASA 3GG0A 1WHVA 2BACA 2K1RB 3C14A 2J6UA 1FO1A 2FGCA 2AJ2A 2GA7A 1N4LA 4B9SA 3KLFA 1GX5A 3NGRA 1Q82T 1FE4A 5ETTA 4HHHA 2JOQA 5KFBA 2QC3A 3G6VA 1URNA 4IOAQ 1FKOB 4ZIVA 3KJVA 3SV4A 3RUBL 5LMUJ 4PWDB 4PRFA 1C1BA 1NPPA 2D7SA 2W2NP 2MKIA 4DQPA 3E01A 4OX9F 4WZQA 1MG7A 4MYTA 2IVMA 2DNHA 4DR4F 2UUAJ 3AA8A 4F02A 3GFZA 5F0WA 1X5TA 3SCKE 3R6LB 3D1QA 3OTDA 2HQ3A 4ZPAA 3QGIA 1FXRA 1U1QA 2F63A 4OMFG 1ZM2A 2HAFA 4CH1A 5CYMA 3CCRS 1FJEB 1F60B 2E1MC 2ZVIA 3D5MA 5I3PA 1GMWA 2R42A 3W7BA 5C2GA 3J7YU 4NLQA 4ECXA 2DPIA 2VKZG 1WC3A 1VQSA 3GFHA 4KY3A 5F3TA 3RGIA 3DRSB 5DM7Q 5JVHQ 2QLJB 2YWEA 4OX6A 5LM7E 4OJGA 2GMJA 1H72C 4WFNQ 3KLVA 4DN0A 2CQHA 2HVHA 2EG2A 2E66A 5GAHI 4NL5A 4AFFA 3CUNA 4KGXB 1S1XA 3M4XA 2YKPA 2VU5A 3THTA 3DYAB 3K17A 3PW7A 2D1CA 3HVWA 1XNRF 3D3CJ 4P71A 2C2KB 2EC0A 2PT0A 5D0GA 3NNAA 1KHVA 3QYYA 4ZVHA 2NLWA 1ICEB 3TJAA 3I82A 2Y3YA 1TL3B 4USHA 1VHFA 3EGNA 3MOZA 4USVA 4UOFA 2M8DB 2R8JA 2COLA 2KT2A 2LP4A 4B9LA 4NCBA 3QT7A 3QJJA 3CDBA 3D66A 3L09A 4L3KA 1WEZA 4OJHA 3V4MA 4YR3A 3LAMA 5IWAF 4OHXA 3HP6A 4A8QA 4K4ZA 2HHQA 5ETRA 1RU1A 2F9DA 4I2QB 4CNZA 3TP2A 1FRMA 3KHLA 4ID8A 2ADBA 2FLOA 4USJC 2P2CB 2YX4A 4R5PB 2Y8YA 1N32J 3QRPA 3HZEA 4FVMA 2QRRA 3ZZRA 2N3OA 1R8CA 3M6VA 3BSOA 4DU8A 4A8KA 1X31C 1XBWA 4NOHA 4Q7AA 4Y0FA 2IPOB 2EK1A 2L3MA 4R0JA 1XK8A 3C19A 4WBFA 1VBKA 4CLSA 2OHDA 3OJSA 1R6YA 2G0JA 3H42A 4F4KA 4DV6F 2EPIA 2WVCA 1RWNB 3OFHA 3Q23A 3VV2B 4UY8T 2XSJB 2HMIB 2MKJA 4EGLA 4PQUB 1WNEA 2J9EA 2HWTA 3L7PA 3LP1A 4DPWA 4A8YA 4JI0F 1VJQA 2MKHA 2E5GA 3LP2B 3R97A 1RWXB 1EZZB 3POTA 2ZZMA 4N8NA 1S77D 3VHQA 5F8JA 2M3DA 5GAEU 4A8OA 5DQHA 4FVCA 3KHHA 2QZ8A 5IQQA 2DHSA 2CPEA 2UUCF 1KOOA 1SH0A 1VISA 3MM5B 4PCQA 3JS9A 3EMTA 4UUXA 5B0AA 1S72S 4U67Q 3RBEA 4H4OA 2FGOA 4RW6A 4R5PA 2ZHBA 1XN9A 4C8KA 2L08A 2DIVA 5A8WB 3S8SA 1RE1B 3H5SA 1PJ5A 2CZ9A 2EBEA 1GMUA 2K3KA 1WSVA 5KOWA 2KTQA 3K5LA 2UXBF 4LRDA 4UUWA 2ERRA 2PFFB 2J8AA 3OTEA 1PC5A 2IA0A 2L9NA 4WZMA 1QAXA 1RJJA 1H7WA 3C8YA 3NMRA 1VRUB 3PEHA 3IRXB 1NH7A 4O4RA 1RT2B 3HHLA 2WOMA 3EICA 4DL3A 1LEOA 2JEIA 3UR3C 1HWUA 1I3OB 4O3PA 3FQKA 3MF5A 3W9HA 1S97A 3ZTOA 4DV2F 4AXJA 3MFIA 3Q2TC 1H73A 2YNHA 3S1TA 1KQSR 4RU2A 5DZ7A 5KT4A 2JLEA 1CBKA 1VMBA 3OTOF 1WD6A 1RLCL 3PO5A 4KKOB 2VIHA 2IRYA 2JH3A 2NCKL 3W60A 1S0NA 2IRXA 3CTRA 1RAAB 4I4BA 4B3TJ 3P4UB 4RBVA 4I2PB 4HYKA 3NP5A 3PHTA 1CULB 1Q86T 2V68A 3MM9A 1MLAA 3T3FA 2G9OA 1IUJA 2WOMB 4WXWA 1FX4A 1KWMA 1D9FA 2LU1A 2LKZA 4OZ5A 4O44A 2ACYA 5BYQA 3S6EA 3VZHA 1U48A 3H5XA 2AYGA 2W1BA 2AYMA 4DR3F 2G1DA 1SXLA 5LXRA 2BQRA 4UOGA 3LTOA 2WB1D 4KT0C 4K4WA 4KYZA 2E5IA 2XHWA 5IWAJ 4NXNJ 1RHQB 1VI7A 4Y28C 3VGSA 4FKYA 1TV6A 1XMBA 2OI2A 3JYTA 2VHGA 1G2EA 2V2KA 3G86A 2NQPA 1IJFB 1JLGA 1RBAA 1FWLA 2QE5A 1NRKA 2P5VA 2QA1A 3P45B 2NXCA 2PA8D 4OYBA 3CJ2A 2UV8A 5E2QA 4KH0B 3MM7A 4NXMJ 3HHNB 2WONB 3FBFA 2R7UA 4I0WA 4DPUA 2BE2A 3ENWA 1FESA 4B3OA 1OQ6A 3CEDA 2F40A 1EJ7L 3OW2R 1FERA 1V3RA 3BV8A 2N4DA 2CNLB 1RT5A 3DGPB 3C46A 2B4OA 1U2RA 5C2CA 4ED8A 2DXDA 4ZVOB 3MXHP 3CJ4A 2E9TA 1YDLA 1M1KT 2V69A 3Q0AA 3KK2A 4TQRA 1N5SA 1SC3B 1NHUA 1S4FA 4C48A 5IV4A 2XQCA 4ED6A 5J2QB 2UP1A 4EFAC 4RBUA 1FJCA 3GLJA 4OL8A 3D1OA 1YIJS 3D0IE 3BDPA 4OZ1A 3ISZA 3MOJB 2Z8QA 4PPDA 2Y1RI 3BS9A 4LFBJ 2V4JA 5BXIA 1VQ6S 3BO3A 5HVFA 1LXNA 2GNKA 4LF4J 4DR4J 1TKXB 2YKOA 2NPFA 5T7LB 4OJ3A 5DDOC 1IKXB 2DNLA 4OX9J 1NK6A 4QYZJ 4LF8F 4ZJLA 4C3MA 2IDEA 3G4SS 2YWKA 4WTYA 4JI5J 3FZ2A 2JEGA 3AXKA 3BREA 4P2MA 1FTCA 1VGYA 4J9RA 1M1HA 4DI6A 3PJWA 3TEHB 2EW9A 1MMLA 4DX5A 2GVZA 3QSYB 2DNGA 3G6ES 1P6TA 2XI2A 2W25A 3MAQA 1VRQC 1GXUA 1LWCB 1S1VA 2JSXA 1VR6A 3FEYB 4PXBA 4ZVRB 2ZFHA 1RWPB 4LQ9A 3ZZ0A 3L4BC 1NJYA 3CD6S 3CMQA 2VD3A 3D6FB 2G13A 3NKYA 4NEYA 1GTHA 4C0HA 4Y2CA 3CT9A 2CVEA 3ICLA 1VQ4S 1GFWB 4N8OA 4M5DA 5DO2A 1X4GA 3DU5A 1FXLA 1RQ0A 1U6BA 2B9EA 4UOCA 3NL0A 2R7RA 1QJHA 1S10A 1N88A 3MCOA 4QIGA 3TUPA 5T14A 3JB9k 1S12A 4CO4A 4LT6A 1WF2A 3N9UC 2WRMA 3ZFVA 4JOUA 2VBYA 1ULRA 3AXMA 1ZBTA 4CH0S 1RHRB 1BQMB 2FHMA 3DLGA 3ILLA 1U1KA 4U7UD 3IR7B 4TQSA 1Q7YT 2FC8A 4ZLJA 1MU2B 1PIEA 2B5JB 2IFXA 2JLFA 2WVFA 2ZKTA 3ILJA 1X5PA 3N28A 5D4PA 5K14A 5K8OA 2XLIA 3AJ2A 2W9BB 3PIOQ 2XBPA 3IMQJ 2CJBA 2QFJA 4A8WA 3W3SA 2HHTA 1T9TA 5BJRA 4QWBA 1U1RA 3R1LA 3IG1B 2ASDA 1WC5A 2I5JA 2MZSA 2OMLA 4LUBA 4RW8A 4CH7A 5AE1A 3MR5A 1S5ZA 3PDNA 4DV0J 5CHCB 4EBEA 3DLLQ 4EYIB 1BUXA 4ECQA 3FGVA 3HHDA 1VRTA 2XYGB 3M7VA 1TUWA 3CJ0A 4MK8A 5E3AA 4ITSA 1G3OA 4IDKB 2QMUB 1WOOA 2ACMA 2EBGA 5HMZA 4U9RA 2NR0A 3MEEA 4JV1A 1KVIA 1DHMA 4ZJOA 3QT5A 4AYBD 1VQ7S 5CA5A 4W90B 4HL9A 1T9YA 1JKHA 4DV7J 4DL2A 4JI2J 3CF5Q 2UUBJ 1KTVA 1S1TA 2H5IB 1ZA1B 4K8RA 1RYRA 2Q6BA 1TELA 5KFLA 2DR8A 4RW9B 5D4OA 1SJFA 3VVTA 3FFIA 3HULA 3TX8A 4WFAQ 3OHAA 2XS5A 4YOEA 2BA9A 3MR7A 2FJEB 3OLAA 1CJTB 1RISA 2DGTA 2PEBA 1TK0A 4GO7X 1KP6A 1LWEA 1NB7A 1YQHA 3EZOA 4DV5J 2AGPA 2H4YB 4PPZA 3BB5A 1VJWA 1FF2A 3EZUA 5GAHU 4BWMA 2HWIA 1R31A 1SQFA 2WB4A 3C3LA 4LFAJ 3OTBA 4XDDA 3MMAA 2BRLA 3FCHA 2AD9A 1XC9A 2ZC4A 1S79A 3KKFA 3HPOA 3LALA 5HVHA 4JI5F 4FYXB 2YNGA 4WXOA 4FXVA 1JLGB 2BBEA 3ZZOA 4DBQA 4D3GA 1RTHB 3JQKA 2HFZA 2KRBA 3E01B 4HH1A 3SDEB 2BR0A 2GQ2A 2AJFE 3KLHB 4E0DA 3UCZP 3PEJA 3WQPA 2AF6A 4P52A 3FDSA 3CJKA 2KJWA 4LRBA 3BGUA 3LA0A 1RAOA 3M2VA 2HFOA 2RT3A 3A13A 1S57A 3I4HX 2IC3B 4GVLA 1AZSB 1N52B 1S59A 2BKOA 4LF1A 2CPYA 1Z2LA 3QRRA 3W63A 3E51A 4ILMA 3MM9B 3HMJG 3GIKA 1NO8A 2HHPA 3MPWA 4DR5F 5CYQB 2N7YA 4O44B 2R7OA 4FYDA 2MY8A 1V3ZA 1WORA 2RUGA 3GR1A 2R2RA 2HS4A 3ILIA 4WYLA 4A47A 4PXDA 2OKQA 1C0TA 1SKUB 4FZVA 2MHEA 1RSCA 3BH7B 4Y2MA 3OL7A 2O01C 1A0OB 5JVGQ 1NDCA 1UMJA 1AUDA 3RBZA 5KFZA 4U6PA 2X7IA 1T3NA 1Y0HA 1R43A 3KLIA 5F8IA 1SJ4P 2X1GA 2W2OP 3IWLA 4NI2B 4DF4A 1T9VA 2WBRA 4G6VB 2MQQA 3W8PA 4ENOA 4YUDA 3U1MA 1B7FA 2PA3A 1T05A 1HA1A 1HR0F 1S9EB 2GO9A 2GVDB 2YKMB 4OYOA 5FD1A 1GTEA 1OO0B 2D3ZA 3T1AA 2KYZA 2NXNA 2Z2MA 5BR8F 3V4IB 2ASLA 4NXNF 4B02A 3CULA 1VLYA 5C25B 3DOMA 1IBKF 3TAPA 3F0NA 2MQ8A 3GFXA 3GYXB 4H4MB 2VG7B 1RA6A 4F3QA 1IKYA 1UJ6A 1UETA 2YTCA 2IVYA 3BPDA 3SBMA 4DPOA 5I3UB 3PYDA 3UD4P 3MGJA 2XMTA 1SL0A 1ACMB 1KQGB 5EDWA 4PG8A 3I5CA 3TRGA 2R7VA 1QE1A 3AOAA 1UPMB 4ZVGA 3LP0A 2FB0A 3LUYA 2J7KA 2NZCA 4OV1A 1R8HA 1WI8A 2AX1A 5GAGI 2FHOB 4X4PA 1R0AB 2B8QA 1Y11A 4O4GA 3MTJA 1B70B 2CQIA 4C8OA 2JRSA 1FDDA 2J9DA 4C8NA 1FKOA 5GADI 3TANA 3HX9A 1JK9B 1FE0A 2DH8A 3L7UA 4DV2J 1BC6A 1BMQB 3CJQA 3SCJE 3DKDA 4ECSA 2Z56B 1DBDA 2V50A 2LDIA 1NPKA 2G2YA 2LXUA 4USIA 3RG6A 4CDIA 1FVSA 2BV3A 1XMOF 4K4UA 5J2NA 4GVBA 1IQZA 1X60A 1UW9A 4WE1A 2YNFA 2K3IA 3U1NA 2RRBA 3KK3A 4UZBA 5J2MB 4M95A 1C1CB 4ZIWA 2ZDOA 1DFDA 3T9NA 2QIFA 2W9AA 4IQXA 4LFCJ 1VHIA 3FFIB 3G8QA 1Z4UA 2V94A 4DV1F 4FYWB 2D41A 1KFDA 1VBXA 2JC1A 4TNOA 1VCTA 2GJIA 4OYPA 1EP4B 1JKHB 4ZDNA 1VQ9S 3RJMB 2HSEB 3J80Y 1N48A 3BDEA 2HQCA 2D3O1 3BJYA 2YKNB 2AJ0A 4RZRA 1KRPA 3G82A 2PDAA 2W7PA 1S6QB 1O6XA 2FD2A 2XI3A 3R1HA 2QGFB 1RTZA 3FQLA 2BYCA 3MD1A 2C3PA 4B3RF 5CABA 2Y0SD 2ALYB 4ZN3A 2IBOA 5F9NA 3K5PA 4LSLB 3IS9A 3ZO7A 1B7YB 2HNDA 1UVLA 3OFEA 3TA0A 2M0GB 4EZ6A 2AQ4A 1WUUA 2E5HA 3A8EA 1M5HA 4MIAA 4IG0B 1H6KX 4NZ7A 4QIFA 4F0MA 1RT6A 1U0HB 4ZVPB 7FD1A 2Y1IA 1K0TA 4DR7J 3RB6A 2FHJD 4P2XA 3U27A 3J7YI 2RDJA 3VAKA 4K4TA 1R8PA 1J5EJ 1HBOA 2FTRA 2RB7A 2M70A 3NCRA 1S6QA 4LBHA 4YEAA 3HXMA 1DTQA 2VONA 1PJ6A 2E7VA 2R7XA 4DUZJ 2I9SA 2MY7A 4DV5F 4DG1A 4IFYB 4F3OA 2R4FA 4AL7A 1JXVA 3NAIA 1UEUA 3CGIA 1XR6A 4MT1A 3GFYA 2XTJP 2QMXA 3T1YJ 3T5KA 1EHWA 5J1NA 2RKIB 3OVAA 5DQGA 4RPFA 1BQMA 1HWIA 1Q5VA 3E8OA 4QW9A 2IC3A 1SV5B 1K1SA 3OR1B 3JQJA 3PW0A 1GXLA 3EGWB 4D3HA 2BABA 4ZP9A 3AD8C 3I87A 1TU0B 3Q89A 4UF4A 3OFGA 3OL6A 3M9MB 2DR7A 3AAWB 2NXUA 1TL5A 1Y3JA 1T95A 4IR1A 1X5SA 3EYZA 1WI6A 2DYAA 1X5OA 2VODA 2HLTA 1DQAA 1DY3A 3HVTA 1VQKS 5EWEA 1GEHA 1Q8KA 3SSQA 5IS2A 2HQDA 3UDCA 2YVSA 2QN6B 3SEOA 5KFRA 3NGDA 3T19A 3OTCA 3QGPA 5AJ3J 4DV0F 1JJHA 2CNKB 2C3UA 1JJ4A 2BQ3A 1CJTA 4ICLA 2UXCF 2DHGA 2VDIA 3IBCB 4IFYA 3ZNJ1 2VG7A 4FF3A 3J81U 4ECUA 1TKTB 4QW8A 4M8LA 5F3ZA 1ZH5A 2DO0A 4MKBA 4DUTA 5IT4A 1HNZJ 2UU9F 1UVIA 1YZ6A 2B3TB 3DRRA 3GJTB 4DFJA 1NBEB 2J7UA 3B82A 2JZ5A 4P2FA 4HT7A 4NWBA 2B56A 4F4AA 1HYSB 3CCZA 3JTNA 1GT8A 3CJ3A 2W2MP 3LH2S 4J37A 4PZVA 4RWWA 3K58A 3MMCB 2C2MB 4M5NA 5T41A 2DHAA 4USMA 1EX8A 2YNHB 1WEXA 4KTQA 2UVRA 4KQZA 4JI8J 2C2NA 1FK9B 4ZVTB 4DJBA 4C2MA 1O5JA 4DV3J 1YITS 2RQCA 2HZCA 4U7UK 3RU0A 2FVSA 2BJ8A 2QL9B 3D6HB 2WCXA 4A8SA 4DCOB 4EYHB 3THVA 1OWXA 1TVRB 1UAWA 4I7FA 3DLJA 2C3OA 1RCXB 3C16A 4LIWA 4G3IA 1SJQA 1CS4A 2H48B 2X3GA 5L1KA 5L1IA 3KFWX 3CCES 1ZETA 5J1EB 2L41A 4HR2A 1FXDA 2AYEA 1F5CA 3CD0A 4WIQA 3PW2A 4YN3B 3PR4A 2DRBA 1VOMA 2DNMA 2XGPA 2JX2A 3WHIA 4NLUA 3EVWA 3AOBA 2ZUGA 4LF9F 4O3QA 2R2TA 2VJVA 4M5LA 1H2TZ 2BOAA 1WC1A 1EP4A 1ZA2B 4KV8B 1NUEA 4CLTA 1T0TV 2OEMA 1VBYA 1ZPVA 4L6V3 2FJWA 2AT1B 2W9CB 1HD0A 5LT5A 3HT0A 3JYTB 1YRXA 1RWMB 3JAMU 1E6YB 5IT9Y 2F5GA 4OYXA 2B9WA 2YQ3A 5KT2A 3LP1B 1S1UA 2LEAA 1KEKA 2MJNA 4FXDA 4K0KJ 2DY9A 2BE7D 5ETMA 1FNOA 1FWPA 4DQRA 2DGVA 4XK8C 3POTB 4WFXA 1FX2A 1QD1A 3D1HA 1WHXA 2ILYA 4EU0A 3K5MA 1HNIB 2HVDA 3ZC4A 4PG7A 5KOXA 3TQ1A 4ERDA 1Q8LA 1HNZF 2UU9J 3AH6A 4QR2A 1U09A 4CCHA 3LO3A 2FYXA 2M4MA 2NXJA 5K8NA 1SC1B 5DLGA 3AY0A 1T9WA 1J2VA 1IKYB 5HBMA 2Y8WA 2DNOA 1QAIA 3MEGA 3RRGA 1S9GA 3AJDA 5DM6Q 3NAHA 1HNXF 2CDRB 3K89A 4DUYJ 1R89A 5KT7A 8ATCB 1FJGJ 3CJ8A 3DHWC 3EXYA 2AEJA 3HZGA 3HHLC 5F9LA 1TFWA 5AE2A 3KDOA 3PHEA 2FUG9 4U7CA 3NS7B 5HP1A 4WCEQ 2EI5A 1NPRA 4EBDA 3PM9A 5DDQC 5I3UA 4PABA 2MJUA 5T7LA 3AB4B 3IWXA 4IRDA 1RT3A 1UVKA 2YY3A 1SKSA 3JQMA 2P6TA 2HNDB 2J6SA 3TYTA 2CQ4A 2KT5A 3IC1A 2PMHA 2RS2A 1VC0A 2IRUA 2ZD1A 4FPRA 1NK4A 1D0EA 4N47A 2X1AA 2IYGA 4F2SA 1EARA 2QA2A 4ZPVR 1HNVA 3UVJA 1FRLA 2CWKA 2OLWA 3DYAA 4L3NA 2DGQA 5IM0A 2N82B 2MGZA 2ZM6J 2DRDA 1U1LA 2R8GA 2UVVA 2BUNA 3TI0A 2V2VA 4LR9A 5KFGA 1KOHA 1NK7A 2JWNA 2OELA 1OPZA 1TKZA 2ZNYA 3ONQA 3CD7A 4DWIA 1ZAWA 5B0DA 2J0QD 1OYDA 5J2NB 1WEYA 3NNCA 1BWVA 3UD5A 5M2RA 4NYPA 5J2MA 1VIOA 4ZPDA 4F0HA 4A4JA 2AU0A 4M1KA 1RT5B 1UCNA 1N0UA 3DGPA 2ZKUA 3OTOJ 4GO5X 1IM6A 2DNYA 4QU7A 2OPRB 3LANA 2HHHF 3UN2A 2CAJA 2YX1A 2FC9A 3RB4A 4WP9A 2UXDJ 2ZEJA 3HVTB 3OL8A 3CCLS 4X64J 4X4TA 1V5VA 3KG0A 3KNAA 4KB7A 2RU3A 4JI7F 4ES1A 2CPDA 2QMWA 1T11A 5EWFA 3MECB 4JYAJ 4AD6A 2MHNA 3J7Z5 1H98A 2GGPB 3ETMA 7AT1B 2VV5A 3MEKA 2GV1A 2KYXA 3CCWA 2VICA 2OD6A 4C0OC 1OIAA 1HBOB 1GXTA 2X1BA 3O5TB 3IA0A 5HQLA 2CJXB 3OQ2A 3M9OB 4PKDB 4F25A 4LFCF 1WKLA 2VUGA 3BN7A 3M6WA 1JX4A 2IA6A 1G7CB 2EWHA 3TUJC 6FDRA 2OPSB 2XULA 2IYIA 2PFDA 4OZ3A 2HGLA 3D28A 4KR0B 1YJNS 2GVZB 2VQFJ 3KJFB 3H90A 3M32B 3BGLA 4UT4A 4B9MA 4QCLA 2OPPB 3SQGB 9RUBA 3LW5C 3MDFA 3MM8B 1J5OA 3RAXA 5HROA 1SVDA 4F36A 4X65J 4YQWA 3PVXA 2LA4A 5ETPA 5KFCA 2DR5A 3RW7A 4DFPA 2CNNB 5EX3A 3Q24A 4DV6J 2EFOA 3IR6B 2MMYA 1AT1B 4RNFA 3BBBA 3C6TB 1RT4A 3W5ZA 2OPSA 2PMWA 1NU4A 3PG9A 2XZDB 5IXUA 3GV5B 3A1YG 3U02A 3IFEA 2RMLA 4M5GA 4KGMA 3V5RA 5EGYA 5HN0A 3UWTA 4F7VA 2R7SA 3QIDA 1TL7A 4RU9A 5LL6d 1NEEA 3DLKB 1S76D 2IJFA 4NMXA 2W24A 3SFUA 4CI0B 4BS2A 3JSYA 1YX2A 3G6XA 1TKTA 1WF1A 2GFFA 4CM2A 1IXKA 3DDKA 4HHJA 2RQKA 3PR5B 1T8EA 4C8LA 4FF2A 4DR6F 1Y10A 4ID5A 2BE2B 2VFTA 3MURP 3AT1B 3IP0A 2VBZA 2XMJA 5HJYA 1M5VC 1RCOB 3SXLA 3H20A 3UN5A 2P6SA 3UDVA 4DSEA 5L9NA 5HL7Q 1T9XA 2CPIA 4B9UA 3BR8A 1VQYA 3DMJB 1LFPA 1YRUA 3P6YC 3LF0A 2W8LA 4DX7A 2FLLA 3QBCA 5A8RB 5GAEI 2CZ4A 4JUZA 2Z2ZA 2JNJA 1NDLA 1BD6A 4KGZB 3O6QA 1KSPA 4JB8B 5FDLA 4LR7A 3AHPA 2OEJA 2QLFB 2M52A 2FVQA 3KLFB 2NREA 4ID5B 1SC4B 4EWTA 4DXLA 2DK2A 1FRIA 2WK4A 5E0OA 5C42A 2ZHAA 3N6LA 1TR0A 2YX7A 1OJ4A 3DU6A 2FJXA 3MEDA 4AXIA 5DGAA 2PN6A 2F4VF 3VAHA 2Z57B 1CJKB 4NCAA 2EKYA 4OI6A 2G4BA 2L9WA 1K9MT 2KT3A 1QTMA 1FVQA 5EUHA 4ZLPA 2GHVC 1LWFA 3FEZA 4NI2A 3W9JA 4LQ3A 2VG6A 3J7A1 1FKPA 5D3GB 2HS3A 2CUYA 2DHHA 3BKUA 4X64F 1H0HB 2ZD1B 3TOQA 4A48A 2OEKA 4F04B 4DV4F 2AJ1A 3MEEB 4CYUA 1N33F 3C6UA 3NY0A 3PW5A 2ZE2B 3A3OB 3MPYA 3WDOA 8RUCA 1C4CA 2CFXA 4F26A 2EG1A 1UVNA 3OXGA 3CJTA 3CVKA 3CC7S 3AJ1A 1QY7A 3DNCA 1NSQA 3G8SA 3CDWA 4TYBA 3WC0A 3TA2A 3MR6A 3VAFA 3C2PA 3M6UA 4LFAF 4L74A 3KMQA 4NA2A 4KIAA 5KFVA 4XO0A 2CPFA 3DN9A 3IM9A 2KHCA 3T41A 1MW7A 5JUMA 4O0IA 2IDLA 1X9SA 1JJ2R 5HBMB 2E9ZA 5IZHA 1JXEA 2D9OA 4RLEA 4WFYA 2V8VA 3HHEA 3KLGA 3G8TA 3JTOA 3CPWR 3OR2B 2XM3A 5CXTA 3OVBA 2MZTA 1K1QA 1R0BG 2A3JA 2HKEA 3DDNA 5KFXA 1FRHA 1Q0NA 1TUGB 4B3MF 4B3OB 4LIRA 4JI2F 2OPRA 1LK5A 4DV7F 4X4UA 4NRUA 1MMDA 5CH7B 1RTJA 2JFKA 5KFYA 5AT1B 4J9SA 2ZH4A 2FHKA 2MSSA 3VAGA 5EX0A 5I42A 2XSJA 2C42A 3CWJA 3V6HA 3KJQB 2HMIA 1FFWB 2HFUA 2V8GA 1WG5A 2WZ1A 3ET6B 3M8QB 3N6MA 3NS6A 4ZVFA 2R2SA 3EVOA 1SKRA 3N79A 1YJRA 2HRTA 1T94A 2RDDA 3ZZUA 1GMWD 1Y9OA 2QLXA 1KLNA 1CJUB 5B0GA 4ZMMA 2YPYA 1XWLA 1F5AA 3VQSA 1V6HA 2IJRA 4DPYA 4PQUA 4CZCA 1JNRB 4DLEA 2MQNA 3ENQA 3CDUA 4TU8A 2MLYA 4CLZA 5JJBA 3TZZA 1HQEA 4IUFA 1L5UA 2VC0A 3PYFA 4AQYF 1I94J 3ULHA 1XMQJ 1W26A 4LF7F 3HM9A 5F8MA 2GQQA 5CD4A 3MFHA 4ES3A 5A0YA 2DNPA 3QZ8A 1TMMA 3PACA 4A8MP 2EVZA 3CCUS 2ZBIA 1U0HA 3NWGA 4CLFA 4YR0A 2B7BB 5LJ3Y 3MM6A 1HFEL 1JNZB 3OSNA 4Y00A 5HQMA 5GMEA 4ECVA 1NJIT 4K0KF 2MQOA 1UEKA 2M5YA 3ENVA 4YDXA 2HEKA 4BC9A 4J9PA 2RE1A 4DF8A 3T1HJ 3EUNA 4IO1A 4RNOA 4IFVB 1O8BA 4KRWA 1G4CA 4ED4A 2IM2A 1PBAA 1VC6A 3MHYA 3N4WA 3N5BA 1HWJA 2WVDA 2YWFA 3LAKA 2OFGX 3L95X 4PG5A 5KT3A 4UZCA 1WG4A 4DLGA 2E5LF 2EFNA 2VG5A 3OPKA 1H74A 1NXIA 4B3MJ 2I2YA 2BANB 2J8SA 2AZ1A 1VIXA 4FF1A 1WELA 4WP8A 4UW2A 3FBEA 1W2IA 4I6YA 2RIJA 4ZP8A 2YWGA 4V19X 4HHUA 4DN9A 4F0KA 2IJNA 3PYEA 5IFMA 4FBUA 5F8GA 1N5YA 1YTYA 2MTLA 4FS1A 3FKBA 4YB7A 3C66A 1VQNS 3MEDB 4WKYA 2FJVA 4B17A 2M7SA 1CJVB 4CQ1A 1Y5LB 2E5LJ 2WSFC 2C2DA 3M30A 5ETVA 4RUHA 3T5HA 4X4RA 2QSFA 4IH5A 1S49A 3T1HF 2VPZB 3QT8A 3PX0A 4DX6A 1IBLJ 4NA1A 2B9YA 4LF8J 3HK2A 3CCMS 5H9EJ 2CQCA 2LFVA 2ZH5A 2LEBA 1RT7B 2Z58B 2XYHB 3LGHA 4CLWA 1RAEB 2UVUA 3QJPA 1N5QA 2JLGA 2RD5C 3PCOB 4NLRA 1SQGA 4F8RA 3GCWP 3TQEA 4LSZB 3B4DA 2F65A 1U0SA 3ITHA 2PI5A 3F44A 3VGVA 4C9DA 2P9GA 3AD9C 3RTVA 1G1XA 4LF7J 4GMKA 3ZTSA 4ES2A 4IOCQ 1YZ7A 1I6JA 3MAHA 2QA4G 1NDPA 3DHXA 4AQYJ 1X4FA 3MAAB 4ECRA 2HNZB 1Q7LB 2SXLA 3DLKA 3GR0A 4USKA 1VC5A 1TL7B 3FK4A 1DTTB 4M5KA 1RYSA 2VOOA 3EGZA 3FVYA 3H59A 1NH8A 3QATA 4K4XA 5K20B 4Q43A 2FVPA 3HCXA 2OH2A 5KFDA 1NSKL 2N4CA 1AB8A 1YKWA 4USTA 3MPUB 1MWYA 2BX6A 1PYSB 2GIQA 1RAJA 2VG6B 2X51A 4I7FB 3V4IA 2DISA 2VKRA 2VA3A 4JI3J 2ZH3A 5LSOA 2MZ1A 1WHYA 2B6AA 3CB4A 5L38A 3ZZYA 1L3SA 1RA7A 3K5OA 1TUVA 5ETNA 3PRBA 5THWA 3GIIA 3NMAA 4ED3A 1JB0C 5IC6B 2ZNZA 3QNWB 4NLSA 2RQ4A 1RBOB 3JAMY 3FBBA 3HF5A 3MZIA 2F8EX 3D2WA 1FA0A 4DR2F 3K57A 2VOPA 2BM1A 4EUVA 1WDTA 4OZLA 5HMXA 5H9FJ 5KFTA 2XMAA 5C24A 3OSPA 4IG3A 5HK4A 2VQEJ 4YB6A 2J0SD 3DDIA 3C15A 1PBUA 2KO1A 3FRZA 3A8JA 5MLCV 2DITA 1HQEB 1DRZA 4URGA 1RT1B 1FWKA 4C0BA 3CXCR 1WC4A 4CTAB 1IJEB 2R7QA 2Z0GA 2MKYA 3ZTRA 1YRTA 2XZWA 2FJDB 3NXZA 4RW7B 2VFUA 2YNFB 4WWSA 1P8GA 4ANEA 4CWBA 1RTJB 4HI2A 5F41A 1N33J 4DS5A 4BWJA 2HW3A 1IQTA 1JLCB 1Q79A 3PTWA 4LF2A 4O3NA 4NLXA 1TZ0A 1AZSA 4ETZA 1GMVA 1UW4A 1X4HA 5F8HA 3ET6A 3M8QA 3KOAA 4G1QB 4JI6F 2J7WA 3DOLA 2AGQA 2OGUA 3EZ5A 2CQ3A 2ZC3A 4DL0C 4X4NA 4UTGA 2EFGA 4LBIA 3F73A 1XERA 4PWUA 2ZBCA 2KH9A 4NLOA 3VAMA 1YSJA 2CJAA 1QLNA 3M1VA 3VR1A 4F3MA 4Y34A 3IN5A 2BW2A 4C7QA 1S7IA 1JLAA 4NPOA 2M88A 3OXFA 5KG2A 4IH6A 3K5NA 1DAXA 1EAYC 2B4VA 4CTAA 2ZH9A 2BJ9A 1SKWA 4KFBB 3TJ8A 4V1Ak 2XMKA 5AXMA 3UVJB 1Y4ZB 2W8KA 4ZJQA 1U1OA 2BQUA 5C24B 1ZS6A 2Y1LB 3W66A 2G2OA 1DLOB 1SUQB 3G6YA 2E44A 4ZCIA 3GCXP 2QA4S 1U4BA 4JI6J 4JI7J 2KU7A 1EB0A 1Y3KA 3OLBA 4LSLA 2DNNA 3O3LA 3R27A 1OY6A 2GIRA 2KHDA 2UUWA 3UW1A 2IBKA 3VAIA 4B3SF 4GKKF 3PIPQ 3SI8A 3DC2A 4ZPBA 1XTZA 3GP9A 4YB1P 2BE9B 2E1RA 1NK0A 2QJ3A 3PX4A 1TL1B 1U25A 4ZCKA 1RHUB 4U95A 2O5DA 2VB6A 4ZA1A 2KZZA 3NGTA 4RW6B 1S7HA 2GO8A 4NLWA 2HIYA 1ROFA 1RWVB 3QRQA 4KPCA 1K44A 4ELVA 1N36F 2MKKA 3DXBA 4HLBA 3VQTA 5FIIA 3TNVA 4DPTA 5C5JA 3W5XA 2ZH8A 2VQEF 3SMZA 3I6PA 2VZ9A 3TVKA 4URQU 1IBKJ 3D6TB 1RTIA 4YY3F 3GV7B 4U96A 3UQSA 4I69A 2AJQA 4Q8FA 3CDEA 4CO1A 4DZ6A 1PGZA 3IGNA 1HQ2A 2HNYB 3KK3B 1ZM3A 4LF5J 4CT9A 4Q0BB 1B99A 2C2ZB 4H54A 5HLFB 2I1RA 2POKA 4EO6A 2LDYA 2V6AA 1CQMA 4KHPF 4EI2A 3R3TA 3T6BA 4OHZA 1YJTA 1X0PA 3MECA 1NLKL 1V3SA 3I9ZA 3JXOA 3R7NB 4YDDB 3EX7B 3RBDA 4P7TA 2W7AA 2KXHA 2KFYA 4P73A 2LQ5A 1M5PC 1WKJA 3MPDA 1TKDA 4ED0A 1F2GA 2HYIB 2CNOB 3CDAA 3J80U 2NXEA 3OFFA 4IG3B 1SL2A 1IR0A 2V5HG 4QPXA 4DFKA 3BQ2A 2DCLA 4OI1A 4NX9A 3BF4A 3EE3A 1RT1A 3PX6A 1TL1A 1VQPS 1ZTWA 3LGMA 4WF9Q 1FI4A 2ZZTA 2MGZB 1TTHB 2GMLA 3HD2A 2V4QA 4TY8B 2RRAA 3HJFA 1OPIA 4HTIA 4L76A 3LQVA 3ADAC 4HTJA 2PD1A 5E33A 2M2BA 3HJVA 3SSSA 1CS4B 5D77A 5M2UA 1HQUA 1YJVA 1HBUB 4C3LA 5GADU 2HHHJ 3NOCA 4K2XA 1L3VA 1RKJA 4K7QA 1UA1A 4N77A 1KVKA 4ELTA 1HNWF 5KFUA 1N5VA 5KFEA 2DEIA 3US5A 2HQGA 3GE9A 1I5OB 2Z2YB 4KHRA 1EQ0A 3UN3A 1U1PA 4RWXA 1WG1A 2IHR1 3A12A 4OQJA 4NZ6A 4PYAA 4TLQA 3JSBA 3DCAA 1BHNA 2DGSA 1WTFA 1VS3A 3UDEA 3PRDA 3MUVP 1J27A 1FRXA 4OX7A 4KO0B 3BEGB 4R8UA 3V6DB 2K7JA 1QAYA 5GMKa 1A6LA 4C97A 5DGBA 4EEYA 2HWHA 3M8PB 1LK7A 1S0VA 2XZTB 5A6PA 1YK9A 1S1UB 2GAGC 2J5AA 3TWZA 3ZZTA 5MAOA 2CJKA 3W61A 4OHYA 2ZM6F 3ITHB 3CE8A 3IXQA 1OSCA 9ATCB 3TUIC 2A2DA 2ABYA 2GGPA 3DRPA 4AUKA 2ZBQA 5I3QA 1RAGB 5KFNA 3NWRA 5KFWA 3CJ5A 4ECWA 2RUSA 3GWCA 3QAEA 4L73A 2R3VA 4G1QA 4F4XA 2Y1JA 4ZVUB 1E6YA 4QYZK 2FIUA 4OI0A 2XS7A 2NUUG 2ZOFA 3SDEA 3KLEB 1FKAF 1WOSA 2CQ0A 2XG8A 1Q16B 4LRCA 3KG1A 4Q5VA 3TW0A 3FUYA 4LBPA 4O0NA 3TZYA 2OMOA 2HQFA 3KXDA 1WJ9A 2A18A 4DUYF 1TAUA 2RVJA 4ZK7M 1GX6A 1TV6B 3DRPB 3O1LA 1WWHA 4KO0A 5GMDA 4DG1B 1XMQF 2H54B 1Q8BA 1S6PB 5CYJA 3RZAA 2DKOB 5AXNA 4FXWA 5E3CA 1ZYQA 2A10A 3C15B 2HRYA 3MUTP 1RXOB 2DR6A 3H4BA 2UXCJ 5KFFA 3N01A 3I0RB 1IKWA 2XNRA 4OZ0A 2ILZA 2HBYB 3D54A 1RACB 1LW0A 2OIHA 4WKRA 1KN6A 1UFKA 4FDFA 4FKXA 1ZZFA 3KNGA 1PAEX 1QVGR 1YJWS 1RLDA 1VQ5S 1T7PA 3SIPB 2OJ3A 4GKJF 3QZ7A 2YH1A 3W2VA 2B51A 3I5BA 1S1WB 3GILA 4KHPJ 3TR5A 2QLWA 3W2WA 2GS8A 3S01A 4UQGA 4JV2A 2KFZA 1IKVA 1GNKA 4QR0A 3Q8PB 3CMAS 2RH3A 2ZBPA 2ZE2A 3MD3A 1ZTTA 2HIQA 2DPJA 2HHUA 2B4UA 4QIEA 2AV5A 4HEA9 3MPVA 2UZAA 3AA9A 3J81Y 5HP1B 1S0MA 2AYBA 5F0UA 1DARA 4ZCMA 1D9AA 1RB0A 2J0XA 4O3OA 4OYWA 1MSWD 2P9EA 5K8MA 1X4CA 5CAAA 3DLHA 2DR9A 3KHRA 1HI1A 1RDRA 1X9WA 3I55S 5IQ6A 3KMSA 2MXYA 2BJDA 1KONA 2BJ7A 2OUGA 4MFBB 4BC7A 3OUYA 3V81A 1L3TA 2C2RA 4S0MA
chains in the Genus database with same CATH topology
3PW4A 5FDLB 2RILA 2PSZA 1QSSA 1MROB 4LSNA 1JLQA 2XY6A 3QLHA 1H2UX 1REVA 1KHWA 5KG5A 3BGFA 4RW4A 5FLXY 3N6NA 2DGUA 1N34F 3IO1A 4X4VA 1H38A 1KQKA 4MAKA 5DLFA 1NZAA 1WACA 2G0CA 4AL6A 2C3YA 1DQ8A 2LXIA 3RAMA 2W9CA 4LFBF 5D8HB 1W25A 4ECZA 3X1LB 2F7VA 1PC4A 1NNDA 1N6QA 1X4DA 3U1LA 4I2PA 3M2UA 5B0CA 3M05A 1UJ5A 1GQEA 4BHQA 2NUHA 4A8FA 1N5TA 4QU6A 2LLZA 4KPYA 2FHJA 5K5MA 3GQCA 5AJ3F 1U6ZA 3KK1A 2V9KA 4ALZA 1FJ7A 3UFCX 2KXNB 5L8RC 2VG5B 4NYOA 2CQBA 3FEXB 4I1TA 1H3DA 4ZP7A 2DB1A 2D9PA 5CZVA 1UL3A 2XLKA 5D4NA 5J2PB 3IRWP 4C8YA 1HYSA 4OLPA 3CCQS 1HBNB 4C3KA 4CT8A 4NZ0A 2R7WA 3BZQA 5KFJA 1VK3A 2OSQA 5SZTA 4FN5A 4Y2AA 2PEHA 2HVIA 1D1UA 4F50A 1NAQA 1P9QC 5B0BA 3T1YF 2WSCC 3M32A 4XPEA 1L3UA 1S6UA 4NLVA 4QOTA 1MNEA 3MM5A 4TY9A 3CC2S 2PO4A 1UWBB 1YG0A 1SBRA 3ISND 5A8WA 2J76E 4X4OA 5J2QA 1S6PA 2OAUA 4TU9A 4C11A 5KFAA 4B3TF 4DR7F 3SCLE 4ZP6A 1N6QB 2DH7A 5L1JA 1JXLA 1QUPA 4AE5A 2DD8S 3Q22A 2GC8A 3D0HE 2KVIA 4MJKA 2BRKA 2ZITA 2LQBA 1U7LA 3DMJA 5KT6A 5A2QY 1NJXA 2J6TA 1JLBB 3DM2B 3I4PA 5DRKA 2MB0B 1JLEA 1BY9A 2V9WA 1N0VC 2CG4A 2I38A 3TVZA 3LOUA 4KV8A 3M8SA 3PKYA 3NS5A 4GC6A 2XMVA 4DSJA 1BQNA 3WBZA 1LQ9A 3TAMB 4QYRA 3UD3P 3AQOA 2CQGA 2KG1A 2C28A 2IMWP 1X4AA 1TKZB 1LWEB 2K8GA 5L9XA 3T5JA 1NKCA 2E9RX 2A1BA 4R8UB 3Q8QB 4IRCA 1X7VA 3LWLA 1U1NA 3NNHA 4WJBA 4A8XA 1UFWA 2RF2B 3K7RA 4ZHRB 4QIVA 2OD4A 2ZVSA 4WU3A 2F8MA 4Q2MA 3DRYA 2QV6A 4Y2KA 4Q45A 2NYIA 3H2LA 4QWCA 1NJWA 1JLFB 2XWXA 2ZJQQ 1D8ZA 2B6AB 4IYQA 2CPHA 4ETXA 3R5BA 4KJIA 2BOPA 4DMZA 3BO4A 4B9VA 2HQIA 2LEPA 5KG1A 1B0TA 3N0VA 2QSWA 4IKAA 2JC0A 1LWFB 2LVWA 2PE8A 4RUCA 3PKMA 1KNZA 4TYAA 2YKNA 2OPPA 3SQGA 1BWEA 1M0SA 2XMWA 4OFZA 3BN4A 1OSDA 2NSBA 5K14B 1T03A 4QYZJ 2BZ2A 3P3DA 3V2UC 3GIMA 3BSAA 1AFIA 2F1FA 1QSYA 2D74B 2R8HA 3M6XA 1VQMS 4ILLA 3TAMA 4XIUA 1U26A 3NLCA 1CG2A 5CYMB 4FBTA 4MKAA 3E2EA 1TK8A 2H9ZA 4HKQA 1R8AA 2UUBF 3V6KA 4DQSA 2R9LA 1F9FA 4N5SA 1RKIA 4AL5A 1Z2ZA 3U7JA 4ATNA 3L3CA 2V8HA 2YNIA 2K7KA 4NCGA 1U45A 3QPIA 4LVOP 1KQFB 5IT0A 3FSXA 1FRKA 2AGOA 3I56S 2I8EA 3T6JA 1VFJA 4DSFA 1DTQB 3CC4S 3CCSS 1ZAXA 4H4KC 4Z37A 3H8YA