4WY4C

Crystal structure of autophagic snare complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
78
structure length
78
Chain Sequence
b'ADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 8
publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 38
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4C00
4OH8B 1L4AA 1SFCD 4W7YA 2N1TA 4JF7A 2PP6A 1HVVA 3PP5A 1SFCC 1N7SC 1URQC 1SFCA 4WY4C 2NPSD 1JTHA 3HD7B 5CCGD 2M8RA 1NHLA 2KOGA 2NPSC 1L4AC 3KYQA 5CCGC 3TSIA 3B5ND 2NPSA 5CCGA 3B5NB 3HD7D 1GL2B 2XDJA 5CCHD 3RK3D 1KILB 5CCHC 3M0DC 3RK3B 3HD7A 1XTGB 5CCHA 3RK2D 4W7ZA 2HFED 3RL0D 1GL2D 3RK2B 3B5NC 1URQB 5KJ7D 1KILD 4W80A 1GL2C 3B5NA 3RL0B 4WY4B 1GL2A 3HD7C 3RK3C 1KILA 4LGDE 2HG5D 2N1TB 1N7SD 1URQD 3P8CE 3RK2C 1SFCB 1N7SB 4WY4D 1N7SA 1URQA 3RL0C 1JTHB 2H8PD 3VOPA 2YMYA 1L4AD 5KJ7C 1KILC 2N1TD 2WZ7A 4WY4A 5KJ7A 2N1TC 2NPSB 1T3JA 1L4AB 3HTKB 4N78E
chains in the Genus database with same CATH superfamily
2PAJA 3L4FA 1FOSE 3AE2C 3E1RA 2KS1B 3B8EB 3HD7B 5GTIH 1N73A 3H1ID 2NPSC 1PP9G 3L71J 2YKQA 1VQ6P 2Q7CA 1R5LA 3CWBD 4YTPC 1LT9B 3M91A 2Q3IA 2E76D 3Q2YA 2OYIB 2Q3EA 3L72J 3L70E 3GF7A 1VPCA 2ZT9B 1ZV8A 3L36A 1GW3A 1SQVD 3AEBC 4C7RA 2O01H 2BEQD 3LIDA 1H0TA 1QLED 1KYOE 3H1IG 2JO1A 2AXTH 2WT7B 1OZHA 4UB8H 3CWBG 5APYA 4H44D 5AVWB 3AEDC 3MZWB 1SFCB 2P67A 4H13C 1M57D 3VP9A 1BE3D 1RQUA 3JCUE 4ASVA 1G1IA 1D7MA 3B71A 1FZFA 4K35A 3T97B 4OH8B 1SQVG 3N4XA 1S4XA 2N1TA 3MTUE 5APXA 1RE4A 1WRGA 1PPJD 1VQKP 1BGYJ 1L0NK 4EIJA 1DX7A 2WTYA 1JM0A 1FS0E 1QVFO 1ZRTE 3L73D 1LTSC 2G8YA 2YKPA 2OYHB 5CCGA 3L37A 2IPPA 2FYZA 5BU5A 3P7KA 3E1IA 1BE3G 1SQPD 2J59M 2IYPA 4NPDA 1QEXA 2V7QJ 3AECC 3CC4P 1KILE 2WSFJ 1L0LJ 2M3EA 1M56D 4U3FD 4KHXA 3RL0B 4GIFA 4WY4B 2ZFCA 3S4RA 2W6BA 4JBZA 2KNCA 2POHA 1QX8A 2FYUG 3L73G 5CHXA 1RF1B 3BCCD 3M9HA 1IFMA 1URQD 1NTKJ 3C8VA 3Q5RA 5AW0B 2OTJP 2YMKA 2OTKE 4RKUJ 2H8PD 2P1JA 3L72E 1SQPG 3AE4C 4N6JA 4HKZH 1T2KD 1KILC 3LW5H 2HODB 3H1HJ 5KJ7A 3CD6P 3L74D 1G2CA 1N2DC 3SWFA 1T6AA 5DJTB 4I1LA 2RN0A 1LTBC 3Q5SA 2W90A 3L70D 1OW6A 5C39A 2C0WA 1SP4A 1IZNB 4HJGH 3QWOC 3BCCG 3GW6A 1MKMA 3B5NB 1X0TA 3HD7D 2RH0A 4BXLA 3O8ZA 1SQBJ 4DCKA 3FWNA 5APUA 2KP8A 3M0DC 3MIWA 2M3BA 1YITP 1EXIA 2ZYDA 1P84D 2E43A 3KZIE 2YO3A 3C9IA 3HE5A 2DW3A 1JMMA 5KJ7D 2P2UA 2BCCD 1NVOA 4OVNF 3CCLP 1J1DB 5KTBA 2ZT9D 5KLIB 1M1JB 3L70G 1VQ4P 5L8RJ 3C1LA 1KILA 3A0BE 3H1LD 3H6PA 1S72P 2QJYB 3V2QA 2GUSA 1N7SB 2FYNC 2HR3A 1KB9H 1SQQD 2NRGA 2Z5IA 1S5LH 2YMYA 1SS1A 2QJPB 1PGPA 1K9MQ 3RBXA 1RF0C 2BEZF 3E7KA 1SFCD 4N78D 1NTMJ 2A45G 1Q7YQ 2O3JA 2E75D 4OGQD 1LTTC 2K3RA 2FYUK 2QJKB 4XA4A 4O9BA 2BCCG 4JQ0D 2R5DA 2K9JB 1QL2A 3CCEP 1JB0J 3H1LG 1M7LA 1NTKE 3CX5H 3CPWO 2KSJA 3AEGC 1ZR2A 1KB9I 2OQQA 3OJAB 1RY3A 1K05A 3L75E 3GHGC 3H1HE 3WUVA 3RK2D 1R5SA 3H1JJ 1S9KD 2OYOA 1NO4A 2Y0DA 3CLQA 1GL2C 4ZNCA 1Q81Q 1AQTA 1GU4A 4PD4I 2ZVNB 2QEXP 3VMAA 3D6YA 5KAFH 2B88A 5CMZA 1RF0A 2E74C 4LC1A 4Y99B 1KZUB 3TF5A 4WY4D 1BDDA 2W27A 3OW2O 2ZJSE 4H44B 5AVUB 1VF5D 1N73B 2ZXEB 2P7JA 2YXRB 2K88A 3HTKA 2P58A 1NKZB 4H0LC 5AVQB 2Q5UA 1ZW0A 2W6AA 3V2NA 2B9BA 3R4YA 1KB9E 2R3SA 3SWYA 4HB1A 1LP1A 1YHQP 1OW7A 5B5EE 1S3JA 4PV1C 1L4AC 2I8DA 5BVZA 1W2BO 2IFNA 5KKZC 1JO5A 1DH3A 1H0TB 1M1KQ 1KC8Q 3V6IA 1LWUC 2RMZA 4AQRD 1U57A 5CCHD 3VP8A 1VDFA 2E42A 1BDCA 4PD4E 2JP3A 3CC7P 4BRYA 3USSA 1L0ND 2RKLA 1KD1Q 1LTIC 2XNXA 3TYYA 1LT1A 1NTME 2M0BA 2PRRA 3CCSP 4TT3H 2JWDA 2Y0EA 3GG2A 3MHVA 2LXBA 1FZAA 4JYBA 3CXHE 1NJIQ 1KYOH 3RK3C 3TK1A 2N1TB 1EXJA 3Q1MA 2YNYA 5E79E 2XU6A 4L76A 5KLVJ 3FXDA 1MV8A 4L73A 1CW5A 3NMDA 1JCDA 4RESB 1Y8AA 1USEA 3H1KD 3CCJP 1L0NG 2FY8A 2VRSA 3H1JE 3HUSA 5KAFE 1BCCJ 1L4AA 1NKNA 4CPGA 2PP6A 1IFDA 2IFMA 2ZXXA 2AEJA 1LWUA 3L75D 1Y47A 1YTZT 3S9OA 1PIXA 1CZQA 4D6TJ 1EDJA 2YO2A 4NPFX 3TGUJ 4H13B 3KHUA 4KJMA 1RH5B 1GK4A 3H1KG 4RJTA 4JYCA 1LGHB 1KQGB 3IN6A 4EOTA 1FZEA 3AE5C 1FZBA 1RE3C 2KIKA 4GKGA 2HFED 1VQLP 2XZRA 2P10A 3L75G 4IL6E 1NTZJ 5AVZB 3PLNA 1GU5A 1EZVD 1BSHA 1YQ4C 1G2CB 2OARA 2C9LY 2KYVA 1IFPA 2KZJA 1HJ0A 3HE4A 4GDOA 1JOCA 1KB9D 3EWKA 3EFGA 1FZCC 3G9RA 4UB6E 3CC2P 1LTJA 1JY2N 4HH2A 4DJGA 1WT6A 1KTMA 2E75B 4OGQB 2AEFA 3ITKA 2FFDC 2WSCJ 1SQXJ 1EZVG 2CPSA 3KYQA 5CJ4A 5KLVE 2HYNA 2NPSA 2CK3H 3CX5D 3AE3C 3HE5B 2XKMA 3F5HA 1YJWP 4EYYQ 5TISE 1KILB 2V4HA 1IO4A 1KORA 1LTAC 5AVVB 2FYUD 1BCCE 1KFNA 3PH0A 3KZIH 1LT9C 3RK2B 2KUBA 4I2LC 1YJ9P 3CCQP 3AE7C 2MJZA 3WU2H 4W80A 1QVGO 1SVFA 2OYIC 3FGAD 4D6TE 2ZT9C 3A0BH 2NZ2A 1FZCA 2QA4P 2GA1A 1KFMA 1NU1J 3TGUE 3P8CE 1JUNA 1M8OB 2JJLA 2JDIH 1NWQA 1ZXGA 2KK7A 3D70A 1NTKK 3I5CA 2QM7A 1FE6A 2N1TD 1DEBA 2QM8A 3TNUA 1PGQA 2KSEA 1VF5B 3L71E 1FU1A 2V7QH 3KQGA 4Z1MH 3H25A 2J58A 3BRVB 4JF7A 2WPQA 1HVVA 2WSFH 3CCRP 1SFCC 1MUUA 1VQ9P 3P8MC 1NTZE 3M9QA 2Z4EA 5CCGD 4IFDK 1OVRA 4WWIA 2H89C 1L2PA 1PP9J 1H88A 2J5UA 2KLUA 2IZ1A 1DD3A 1J2JB 2FYNB 3H32A 1GDTA 1U7MA 1GTWA 5EFWB 2SPZA 1KN7A 5AW9B 1QGKB 2G3AA 1HUCA 3F89A 1HJBA 3VTPC 2D2CB 1Q2NA 4H13D 3A2AA 1E5WA 3V2RA 3N7NA 2QRXA 5APVA 2E5YA 1SQXE 2WPSA 1FC2C 2AEMA 1KYOD 4LGDE 3H1IJ 3AE9C 2ZVOB 1IFIA 1CI6A 1BGYE 5CBNA 3CWBJ 1CSBA 4R4LA 1RHZB 3RL0C 3WU2E 2JR8A 1LP1B 3II6A 1T3JA 2LKMA 2ITAA 2XV5A 3I55P 5CBOA 1SQVJ 3FWLA 2QSIA 1IJDB 1YI2P 4ZMDA 4BRYB 1HH0A 2IX7C 2W6JH 5B5EH 1NHLA 1ZRTD 2KOGA 5AW3B 5AW5B 5B66E 2A06E 2W83C 2ZAEB 3TSIA 1NU1E 1OXZA 2H88C 3GF3A 3CI9A 2KB7P 1L0LE 1JY2P 2R32A 2FXOA 1GK6A 1USDA 3MUDC 4PD4H 1BE3J 2FXMA 5CCHC 3VYIA 3M9BA 1XTGB 3QH9A 3M0DA 5KLVG 1UIXA 4NPEA 3K5BA 2MKVA 3B5NC 1KILD 4L74A 2PGDA 4MN4C 4YXWH 1NAYA 3CXHH 3HUSB 2B89A 4I6MC 1LTGC 3L71D 1KV4A 3L73J 1PP9E 5KKZB 5E79H 3ABVC 4C7NA 4PJ0E 1IFJA 1DIPA 3VOPA 1J1DC 4DZOA 3L72D 5KLIC 1M1JC 1SQPJ 1N86A 2B87A 1OW8A 1PZQA 1LNQA 5AVYB 3BVHA 3CCMP 2QJYC 2Y0CA 1N7SC 2LXCB 1ZLLA 2ZYAA 1SQBE 3L35A 4U3FJ 1YBKA 2QJPC 1VL2A 5AW2B 1JY2O 3CXHI 3H1IE 3L71G 5KAIH 2WSEJ 2WVRA 1VQ7P 3VN0A 3U1AA 3BCCJ 3NXSA 1EDIA 5GTHE 5APWA 4GT1A 2QJKC 2N9YB 1X22A 1NTZG 1AVOA 2XDJA 3L72G 3GHGA 2BASA 3S1KA 3L74J 1SQVE 1AV1A 3AE6C 1BGYD 3HE4B 1MFTA 1NOHA 4IL6H 3RK3E 1GL2A 2FBWC 2D2CD 3L70J 1LTJB 2E76C 3CMEP 4B86A 2HG5D 1EDLA 3TDKA 5AVRB 1T8ZA 1FOSF 5APSA 3G3ZA 2FXPA 2KXPB 1N7SA 4WB4A 1BE3E 3AE8C 4KT0J 5KLVK 1IC2A 3NTNA 4UB6H 5AW1B 2NPSB 1YYCA 2C0XA 1A02F 1OWAA 1DEEG 1BGYG 1H89A 4Y99C 1PPJE 2WQYC 2UWJE 3SSUA 4H44C 2BCCJ 1N73C 1JTHA 3JSVC 3L73E 1GD2E 1OIPA 1IK9A 1NTKD 1VQOP 3H1LJ 1VQPP 4R4MA 1YJNP 1E79H 1J1EC 1FDOA 1Z56A 4DOJA 5TISH 1BSNA 1SQPE 1SQQJ 2E5TA 3EFFK 4A7PA 4I7ZC 3Q5PA 2N9BA 2E74D 3H1HD 3SFEC 1FZCB 3EQ2A 4WVZA 2M5AA 1NU1G 2Q1KA 2WPRA 4TLFA 2IBZI 5KAIE 3OA7A 2L91A 1L0LG 4U3FE 2WMMA 2KNCB 1S1CX 3TNUB 1JMBA 2JKVA 1Y9BA 1JY3N 4H0LD 3O6QA 1AA0A 1NTKG 3MP7B 2R5BA 1NTZK 2A45I 1P84I 2W8ZA 5APQA 1SQBD 4AYCA 4PV1D 1L4AD 2WZ7A 3H1HG 3U59A 1Q86Q 3GMAA 3SFDC 2N1TC 3L74E 4GOEA 1RE4C 3PHLA 3FX0A 2WPVB 1W2EA 4GODA 3H32B 3U1CA 3VMXA 1URQC 2O01J 1ZMEC 1ZP0C 1KQSO 2QVAA 2YKOA 4EI2A 1OVVA 1S5LX 1M90Q 5APTA 1T2KC 5CCGC 3V2PA 2IBZE 1SLQA 2O1JA 1SQXK 2Q6QA 3KPEA 1HGVA 1SQBG 1PFIA 3RK3D 4PD4D 3G4SP 3AEFC 1PGOA 1NTMD 3A3YB 1CI6B 2LR2A 2YIUC 1K8AQ 3PJSK 1FAVA 2CPBA 1P84E 1NH4A 1KQFB 1RE3A 1NAFA 4WBAA 2HPCA 2BCCE 2WSCH 2L5GB 2Q9IA 3CXHD 3HD7C 1YIJP 3H1LE 4EDFA 4U7JA 4C46A 3IR9A 1URQA 1SQQE 1NU1K 5KJ7C 2Z5HA 4OWFA 1VQMP 2YXQB 1JNMA 1L0NJ 1L0LK 1NTMG 2O01N 3H1JD 1FJKA 4N78E 4YPCA 1T3UA 3PP5A 2HLOA 2QG4A 3IFMA 2I1JA 1X8YA 1TU3F 1R8EA 2NPSD 1EQ7A 2QE7H 4RO0A 5B66H 3CCVP 5GTIE 5H2FH 2FFDA 3CMAP 3LIEA 1N7LA 2OGUA 1PPJG 2ZYGA 1OX3A 2E75C 4OGQC 3A7OA 3W67A 2K37A 3H1KJ 2KS1A 2WWWA 3RL0g 3R2PA 3HD7A 3V4QA 3LW5J 3H1JG 3I56P 4C7NB 3CL3D 1S9KE 1AFOA 1LT9A 2B87B 4IL6X 4IFMA 3L75J 2OYIA 2H7HA 3B4SA 2OYHC 3OAKA 2AXTE 1SQBK 4QMAA 4UB8E 1VQ8P 4PJ0H 3RK2C 3V4WA 4Y28J 2R3CA 4U3FG 3CCUP 3KXDA 2KI7B 1YQ3C 1AVYA 5TJHA 4IFFA 4IOIH 2XNDH 1LJ2A 4XE5B 1NYHA 3HTKB 2IBZD 1JY3P 1UIIA 1FBMA 2WT7A 4LLHA 3A0HH 1SFCA 4WY4C 1SQVK 3GHGB 5CJ0A 3JC22 1PV3A 1HTLC 1VF5C 3L74G 3PTZA 1RF1C 5AW8B 5GTHH 3IF4A 5KLVD 1XTCC 3T97A 3BASA 1OFCX 2JWAA 2FKWB 3A5TA 1GL2B 1AJYA 1NTMK 2C9NY 1L0NE 3M06A 1BCCD 2IBZG 5H2FE 2E74B 3BATA 4W7ZA 2OYHA 1VQ5P 3Q3DA 1G1JA 1YTZI 5AW6B 3MD0A 4D6TD 3RBZA 1GZLA 2D2CC 3V5BA 4H0LB 1K73Q 3G6EP 3TGUD 1MZ9A 3P8CD 1MFZA 1PL5A 1JY3O 3AE1C 3WUTA 2GUVA 5BU8B 3H1KE 1JTHB 1ZOYC 4M3LA 4WY4A 1EZVI 1U7JA 4PV1B 1NGMB 1BCCG 2FYUJ 1L4AB 3D71A 1RF1A 4GOFA 1SQPK 2I1KA 1ZN5A 3PRJA 1LWUB 4YXDC 1AQ5A 1SQQG 1K04A 1NTZD 3WMM0 5K5GB 3BRTB 3ZDMA 1IFNA 2M5AB 4D6TG 2E76B 2WITA 1X9VA 3KDPB 2HODA 1QL1A 1GMJA 3TGUG 3P32A 1HGZA 4N3YB 1GW4A 5AVXB 1RQVA 3A0HE 3MGNA 3O6QB 3MUDA 3RK3B 1H8AA 3GLMA 5CCHA 3CX5I 5AVSB 4BWNA 3CWBE 3RL0D 3VMYA 4ZKUA 2IZ0A 3FXEA 3B5NA 4AUWA 3M0AA 1SQXD 5DJUB 2WSEH 1EZVE 1KMIZ 2PFXA 3HRNA 2KZIA 2OTLP 2QIWA 5AVTB 1N8RQ 2H43A 1A02J 1J1EB 4ZKPA 1ZR4A 1PGJA 3AEAC 2Y9ZA 1FJPA 1X79B 1S5LE 4I7ZB 2AXCA 1OVUA 3HUSC 2R44A 2GM4A 1M1JA 1KQLA 1IK7A 3D6ZA 4XFJA 4W7YA 4JPZB 1EC5A 2IDBA 2Y9YA 1SQXG 5AW4B 1S2EA 2M8RA 2A06D 1NU1D 3B5ND 3CX5E 4HYTB 1W5CE 2HPCB 4ASWA 1Q82Q 1L0LD 1Q90D 2JEEA 2K1AA 2K9JA 4L75A 2FYUE 5M1BA 3G71P 4DT0A 3IAOA 1HF9A 2A45H 1FZGA 1P84H 1SQQK 1VQNP 1OMIA 3RGUA 1GL2D 1URQB 5AW7B 3W68A 1WMKA 2WSSH 1JEKA 3JCUH 1EDKA 2O1KA 3NFQA 3SWKA 1FDMA 2K9YA 2A06G 1PP9D 1N7SD 1DD4A 2KLVA 3UIAA 3AEEC 2IYOA 1JCCA 3VMZA 1HBWA 2FFDB 1LTJC 1KYOI 1HWTC 3WUUA 4K3AA 3BCCE 2YIUB 1FDIA
chains in the Genus database with same CATH topology
3HTKA 2XV5A 1NKZB 5AVQB 2Q5UA 1T3UA 3PP5A 2HLOA 2PAJA 3L4FA 1FOSE 2W6AA 3IFMA 1IJDB 2I1JA 3V2NA 1X8YA 3SWYA 1HH0A 2IX7C 2NPSD 3B8EB 1EQ7A 3HD7B 1N73A 1NHLA 2KOGA 5AW3B 2FFDA 5AW5B 2NPSC 1L4AC 3TSIA 5BVZA 2IFNA 1OXZA 2YKQA 3LIEA 1JO5A 1N7LA 1DH3A 2Q7CA 3CI9A 1LT9B 2KB7P 1LWUC 1JY2P 4AQRD 3M91A 2R32A 2Q3IA 1GK6A 5CCHD 3VP8A 3A7OA 1VDFA 2E42A 2FXMA 2OYIB 5CCHC 1VPCA 2WWWA 3M9BA 3VYIA 3R2PA 3HD7A 3V4QA 1ZV8A 1LTIC 1XTGB 2XNXA 3TYYA 3L36A 1GW3A 3M0DA 4C7NB 3CL3D 1S9KE 4C7RA 2O01H 3B5NC 3LIDA 1AFOA 1LT9A 1KILD 1FZAA 4JYBA 4IFMA 3HUSB 3RK3C 4I6MC 1LTGC 2OYIA 2H7HA 3TK1A 2N1TB 2WT7B 2OYHC 3OAKA 2YNYA 1SQBK 5APYA 2XU6A 5AVWB 4C7NA 3RK2C 1MV8A 1SFCB 3V4WA 2P67A 1IFJA 1CW5A 2R3CA 3NMDA 1JCDA 4RESB 3VP9A 3VOPA 1J1DC 4DZOA 1M1JC 4IFFA 1N86A 2VRSA 4XE5B 1G1IA 1FZFA 3HTKB 3HUSA 5AVYB 1JY3P 4OH8B 1L4AA 1NKNA 3N4XA 3BVHA 2N1TA 5APXA 3MTUE 1FBMA 2WT7A 1RE4A 2PP6A 1WRGA 1IFDA 2IFMA 1N7SC 1ZLLA 1L0NK 4EIJA 4LLHA 1SFCA 1DX7A 3L35A 1LWUA 2WTYA 4WY4C 1SQVK 3GHGB 5CJ0A 1YTZT 5AW2B 1JY2O 1HTLC 1LTSC 2YKPA 1CZQA 1RF1C 5AW8B 2OYHB 3VN0A 3U1AA 3NXSA 2YO2A 5CCGA 1XTCC 3L37A 3T97A 3BASA 5APWA 4GT1A 2IPPA 2FYZA 5BU5A 3P7KA 2FKWB 3A5TA 1GK4A 3E1IA 1GL2B 2XDJA 4JYCA 1NTMK 2C9NY 1LGHB 2J59M 3GHGA 4EOTA 2BASA 1FZEA 3M06A 3BATA 1FZBA 1RE3C 4W7ZA 4GKGA 2OYHA 2HFED 3HE4B 1G1JA 1YTZI 2XZRA 1NOHA 4KHXA 3RL0B 4GIFA 4WY4B 2ZFCA 5AVZB 2W6BA 1GL2A 5AW6B 2POHA 3MD0A 1GU5A 5CHXA 1G2CB 1LTJB 4B86A 1GZLA 1RF1B 2OARA 2HG5D 2C9LY 2KYVA 3V5BA 3M9HA 1IFMA 5AVRB 1URQD 1T8ZA 5AW0B 1FOSF 1MZ9A 3P8CD 5APSA 3G3ZA 1MFZA 3HE4A 1JOCA 1JY3O 1N7SA 4WB4A 2GUVA 5BU8B 1JTHB 2H8PD 4M3LA 2P1JA 4N6JA 5KLVK 1T2KD 1KILC 3LW5H 1IC2A 3NTNA 4WY4A 3EFGA 2HODB 1FZCC 5KJ7A 5AW1B 2NPSB 1YYCA 1L4AB 2C0XA 1A02F 1G2CA 1OWAA 1LTJA 1RF1A 1N2DC 3SWFA 1H89A 4Y99C 1JY2N 1SQPK 4I1LA 2I1KA 4HH2A 1ZN5A 1LWUB 1AQ5A 1WT6A 3WMM0 1LTBC 1N73C 2FFDC 1JTHA 3BRTB 1IFNA 2C0WA 1SP4A 1GD2E 2WITA 1X9VA 2CPSA 3KYQA 3KDPB 2HODA 1IK9A 5CJ4A 1QL1A 2HYNA 2NPSA 3HE5B 3P32A 2XKMA 1J1EC 3B5NB 1Z56A 1HGZA 4N3YB 1GW4A 5AVXB 4DOJA 3HD7D 3O8ZA 3MGNA 1KILB 1IO4A 2N9BA 5APUA 3MUDA 1FZCB 1LTAC 2KP8A 3EQ2A 3M0DC 5AVVB 3RK3B 3MIWA 1H8AA 5CCHA 2WPRA 2M3BA 1KFNA 3OA7A 5AVSB 2E43A 1LT9C 3RL0D 3VMYA 3RK2B 2YO3A 4I2LC 3C9IA 4ZKUA 3HE5A 1JMMA 2MJZA 5KJ7D 2P2UA 4W80A 3B5NA 1SVFA 4AUWA 3M0AA 1J1DB 3TNUB 5KTBA 2OYIC 1M1JB 2WSEH 1KILA 1JY3N 3HRNA 1FZCA 3H6PA 2R5BA 1NTZK 1KFMA 2A45I 5AVTB 3P8CE 2H43A 3V2QA 1A02J 1JUNA 1J1EB 2GUSA 2JJLA 1N7SB 4ZKPA 1ZR4A 1NWQA 5APQA 1NTKK 2Z5IA 4AYCA 3I5CA 1FJPA 1X79B 2QM7A 2YMYA 1L4AD 2N1TD 2WZ7A 1DEBA 2QM8A 3HUSC 3U59A 3TNUA 2GM4A 1RF0C 1M1JA 1KQLA 2N1TC 1FU1A 1RE4C 3KQGA 1SFCD 4N78D 4W7YA 2A45G 2J58A 3BRVB 4JF7A 1W2EA 2WPQA 1HVVA 2WSFH 3H32B 3U1CA 1SFCC 3VMXA 1LTTC 1URQC 2FYUK 1MUUA 4XA4A 4O9BA 3P8MC 2R5DA 3M9QA 5AW4B 2YKOA 2Z4EA 1QL2A 5CCGD 4IFDK 2M8RA 5APTA 1T2KC 5CCGC 3V2PA 1M7LA 3B5ND 1SLQA 1H88A 2O1JA 1SQXK 4HYTB 3KPEA 1J2JB 2KSJA 2HPCB 3H32A 1HGVA 2JEEA 1ZR2A 1GDTA 1PFIA 1GTWA 3RK3D 3OJAB 1RY3A 3GHGC 5AW9B 1HUCA 1HJBA 3VTPC 3A3YB 1CI6B 3RK2D 2A45H 1FAVA 1FZGA 2CPBA 1SQQK 3A2AA 1E5WA 3V2RA 3N7NA 1NH4A 1S9KD 1NO4A 1GL2D 1RE3A 3CLQA 1URQB 5APVA 5AW7B 1NAFA 4WBAA 2HPCA 1GL2C 2WSCH 2L5GB 2Q9IA 2WPSA 1GU4A 2O1KA 3HD7C 3NFQA 1FDMA 4LGDE 5CMZA 1RF0A 1N7SD 4LC1A 4C46A 1IFIA 1CI6A 4Y99B 2KLVA 1CSBA 3UIAA 1KZUB 4WY4D 2W27A 3IR9A 1URQA 5AVUB 3RL0C 1NU1K 3II6A 1JCCA 3VMZA 1N73B 1HBWA 2ZXEB 5KJ7C 2P7JA 2FFDB 2Z5HA 1LTJC 1HWTC 1JNMA 1T3JA 1L0LK 2LKMA 1FJKA 4N78E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OH8 B;  1L4A A;  1SFC D;  4W7Y A;  2N1T A;  4JF7 A;  2PP6 A;  1HVV A;  3PP5 A;  1SFC C;  1N7S C;  1URQ C;  1SFC A;  4WY4 C;  2NPS D;  1JTH A;  3HD7 B;  5CCG D;  2M8R A;  1NHL A;  2KOG A;  2NPS C;  1L4A C;  3KYQ A;  5CCG C;  3TSI A;  3B5N D;  2NPS A;  5CCG A;  3B5N B;  3HD7 D;  1GL2 B;  2XDJ A;  5CCH D;  3RK3 D;  1KIL B;  5CCH C;  3M0D C;  3RK3 B;  3HD7 A;  1XTG B;  5CCH A;  3RK2 D;  4W7Z A;  2HFE D;  3RL0 D;  1GL2 D;  3RK2 B;  3B5N C;  1URQ B;  5KJ7 D;  1KIL D;  4W80 A;  1GL2 C;  3B5N A;  3RL0 B;  4WY4 B;  1GL2 A;  3HD7 C;  3RK3 C;  1KIL A;  4LGD E;  2HG5 D;  2N1T B;  1N7S D;  1URQ D;  3P8C E;  3RK2 C;  1SFC B;  1N7S B;  4WY4 D;  1N7S A;  1URQ A;  3RL0 C;  1JTH B;  2H8P D;  3VOP A;  2YMY A;  1L4A D;  5KJ7 C;  1KIL C;  2N1T D;  2WZ7 A;  4WY4 A;  5KJ7 A;  2N1T C;  2NPS B;  1T3J A;  1L4A B;  3HTK B;  4N78 E; 
#chains in the Genus database with same CATH topology
 2PAJ A;  3L4F A;  1FOS E;  3AE2 C;  3E1R A;  2KS1 B;  3B8E B;  3HD7 B;  5GTI H;  1N73 A;  3H1I D;  2NPS C;  1PP9 G;  3L71 J;  2YKQ A;  1VQ6 P;  2Q7C A;  1R5L A;  3CWB D;  4YTP C;  1LT9 B;  3M91 A;  2Q3I A;  2E76 D;  3Q2Y A;  2OYI B;  2Q3E A;  3L72 J;  3L70 E;  3GF7 A;  1VPC A;  2ZT9 B;  1ZV8 A;  3L36 A;  1GW3 A;  1SQV D;  3AEB C;  4C7R A;  2O01 H;  2BEQ D;  3LID A;  1H0T A;  1QLE D;  1KYO E;  3H1I G;  2JO1 A;  2AXT H;  2WT7 B;  1OZH A;  4UB8 H;  3CWB G;  5APY A;  4H44 D;  5AVW B;  3AED C;  3MZW B;  1SFC B;  2P67 A;  4H13 C;  1M57 D;  3VP9 A;  1BE3 D;  1RQU A;  3JCU E;  4ASV A;  1G1I A;  1D7M A;  3B71 A;  1FZF A;  4K35 A;  3T97 B;  4OH8 B;  1SQV G;  3N4X A;  1S4X A;  2N1T A;  3MTU E;  5APX A;  1RE4 A;  1WRG A;  1PPJ D;  1VQK P;  1BGY J;  1L0N K;  4EIJ A;  1DX7 A;  2WTY A;  1JM0 A;  1FS0 E;  1QVF O;  1ZRT E;  3L73 D;  1LTS C;  2G8Y A;  2YKP A;  2OYH B;  5CCG A;  3L37 A;  2IPP A;  2FYZ A;  5BU5 A;  3P7K A;  3E1I A;  1BE3 G;  1SQP D;  2J59 M;  2IYP A;  4NPD A;  1QEX A;  2V7Q J;  3AEC C;  3CC4 P;  1KIL E;  2WSF J;  1L0L J;  2M3E A;  1M56 D;  4U3F D;  4KHX A;  3RL0 B;  4GIF A;  4WY4 B;  2ZFC A;  3S4R A;  2W6B A;  4JBZ A;  2KNC A;  2POH A;  1QX8 A;  2FYU G;  3L73 G;  5CHX A;  1RF1 B;  3BCC D;  3M9H A;  1IFM A;  1URQ D;  1NTK J;  3C8V A;  3Q5R A;  5AW0 B;  2OTJ P;  2YMK A;  2OTK E;  4RKU J;  2H8P D;  2P1J A;  3L72 E;  1SQP G;  3AE4 C;  4N6J A;  4HKZ H;  1T2K D;  1KIL C;  3LW5 H;  2HOD B;  3H1H J;  5KJ7 A;  3CD6 P;  3L74 D;  1G2C A;  1N2D C;  3SWF A;  1T6A A;  5DJT B;  4I1L A;  2RN0 A;  1LTB C;  3Q5S A;  2W90 A;  3L70 D;  1OW6 A;  5C39 A;  2C0W A;  1SP4 A;  1IZN B;  4HJG H;  3QWO C;  3BCC G;  3GW6 A;  1MKM A;  3B5N B;  1X0T A;  3HD7 D;  2RH0 A;  4BXL A;  3O8Z A;  1SQB J;  4DCK A;  3FWN A;  5APU A;  2KP8 A;  3M0D C;  3MIW A;  2M3B A;  1YIT P;  1EXI A;  2ZYD A;  1P84 D;  2E43 A;  3KZI E;  2YO3 A;  3C9I A;  3HE5 A;  2DW3 A;  1JMM A;  5KJ7 D;  2P2U A;  2BCC D;  1NVO A;  4OVN F;  3CCL P;  1J1D B;  5KTB A;  2ZT9 D;  5KLI B;  1M1J B;  3L70 G;  1VQ4 P;  5L8R J;  3C1L A;  1KIL A;  3A0B E;  3H1L D;  3H6P A;  1S72 P;  2QJY B;  3V2Q A;  2GUS A;  1N7S B;  2FYN C;  2HR3 A;  1KB9 H;  1SQQ D;  2NRG A;  2Z5I A;  1S5L H;  2YMY A;  1SS1 A;  2QJP B;  1PGP A;  1K9M Q;  3RBX A;  1RF0 C;  2BEZ F;  3E7K A;  1SFC D;  4N78 D;  1NTM J;  2A45 G;  1Q7Y Q;  2O3J A;  2E75 D;  4OGQ D;  1LTT C;  2K3R A;  2FYU K;  2QJK B;  4XA4 A;  4O9B A;  2BCC G;  4JQ0 D;  2R5D A;  2K9J B;  1QL2 A;  3CCE P;  1JB0 J;  3H1L G;  1M7L A;  1NTK E;  3CX5 H;  3CPW O;  2KSJ A;  3AEG C;  1ZR2 A;  1KB9 I;  2OQQ A;  3OJA B;  1RY3 A;  1K05 A;  3L75 E;  3GHG C;  3H1H E;  3WUV A;  3RK2 D;  1R5S A;  3H1J J;  1S9K D;  2OYO A;  1NO4 A;  2Y0D A;  3CLQ A;  1GL2 C;  4ZNC A;  1Q81 Q;  1AQT A;  1GU4 A;  4PD4 I;  2ZVN B;  2QEX P;  3VMA A;  3D6Y A;  5KAF H;  2B88 A;  5CMZ A;  1RF0 A;  2E74 C;  4LC1 A;  4Y99 B;  1KZU B;  3TF5 A;  4WY4 D;  1BDD A;  2W27 A;  3OW2 O;  2ZJS E;  4H44 B;  5AVU B;  1VF5 D;  1N73 B;  2ZXE B;  2P7J A;  2YXR B;  2K88 A;  3HTK A;  2P58 A;  1NKZ B;  4H0L C;  5AVQ B;  2Q5U A;  1ZW0 A;  2W6A A;  3V2N A;  2B9B A;  3R4Y A;  1KB9 E;  2R3S A;  3SWY A;  4HB1 A;  1LP1 A;  1YHQ P;  1OW7 A;  5B5E E;  1S3J A;  4PV1 C;  1L4A C;  2I8D A;  5BVZ A;  1W2B O;  2IFN A;  5KKZ C;  1JO5 A;  1DH3 A;  1H0T B;  1M1K Q;  1KC8 Q;  3V6I A;  1LWU C;  2RMZ A;  4AQR D;  1U57 A;  5CCH D;  3VP8 A;  1VDF A;  2E42 A;  1BDC A;  4PD4 E;  2JP3 A;  3CC7 P;  4BRY A;  3USS A;  1L0N D;  2RKL A;  1KD1 Q;  1LTI C;  2XNX A;  3TYY A;  1LT1 A;  1NTM E;  2M0B A;  2PRR A;  3CCS P;  4TT3 H;  2JWD A;  2Y0E A;  3GG2 A;  3MHV A;  2LXB A;  1FZA A;  4JYB A;  3CXH E;  1NJI Q;  1KYO H;  3RK3 C;  3TK1 A;  2N1T B;  1EXJ A;  3Q1M A;  2YNY A;  5E79 E;  2XU6 A;  4L76 A;  5KLV J;  3FXD A;  1MV8 A;  4L73 A;  1CW5 A;  3NMD A;  1JCD A;  4RES B;  1Y8A A;  1USE A;  3H1K D;  3CCJ P;  1L0N G;  2FY8 A;  2VRS A;  3H1J E;  3HUS A;  5KAF E;  1BCC J;  1L4A A;  1NKN A;  4CPG A;  2PP6 A;  1IFD A;  2IFM A;  2ZXX A;  2AEJ A;  1LWU A;  3L75 D;  1Y47 A;  1YTZ T;  3S9O A;  1PIX A;  1CZQ A;  4D6T J;  1EDJ A;  2YO2 A;  4NPF X;  3TGU J;  4H13 B;  3KHU A;  4KJM A;  1RH5 B;  1GK4 A;  3H1K G;  4RJT A;  4JYC A;  1LGH B;  1KQG B;  3IN6 A;  4EOT A;  1FZE A;  3AE5 C;  1FZB A;  1RE3 C;  2KIK A;  4GKG A;  2HFE D;  1VQL P;  2XZR A;  2P10 A;  3L75 G;  4IL6 E;  1NTZ J;  5AVZ B;  3PLN A;  1GU5 A;  1EZV D;  1BSH A;  1YQ4 C;  1G2C B;  2OAR A;  2C9L Y;  2KYV A;  1IFP A;  2KZJ A;  1HJ0 A;  3HE4 A;  4GDO A;  1JOC A;  1KB9 D;  3EWK A;  3EFG A;  1FZC C;  3G9R A;  4UB6 E;  3CC2 P;  1LTJ A;  1JY2 N;  4HH2 A;  4DJG A;  1WT6 A;  1KTM A;  2E75 B;  4OGQ B;  2AEF A;  3ITK A;  2FFD C;  2WSC J;  1SQX J;  1EZV G;  2CPS A;  3KYQ A;  5CJ4 A;  5KLV E;  2HYN A;  2NPS A;  2CK3 H;  3CX5 D;  3AE3 C;  3HE5 B;  2XKM A;  3F5H A;  1YJW P;  4EYY Q;  5TIS E;  1KIL B;  2V4H A;  1IO4 A;  1KOR A;  1LTA C;  5AVV B;  2FYU D;  1BCC E;  1KFN A;  3PH0 A;  3KZI H;  1LT9 C;  3RK2 B;  2KUB A;  4I2L C;  1YJ9 P;  3CCQ P;  3AE7 C;  2MJZ A;  3WU2 H;  4W80 A;  1QVG O;  1SVF A;  2OYI C;  3FGA D;  4D6T E;  2ZT9 C;  3A0B H;  2NZ2 A;  1FZC A;  2QA4 P;  2GA1 A;  1KFM A;  1NU1 J;  3TGU E;  3P8C E;  1JUN A;  1M8O B;  2JJL A;  2JDI H;  1NWQ A;  1ZXG A;  2KK7 A;  3D70 A;  1NTK K;  3I5C A;  2QM7 A;  1FE6 A;  2N1T D;  1DEB A;  2QM8 A;  3TNU A;  1PGQ A;  2KSE A;  1VF5 B;  3L71 E;  1FU1 A;  2V7Q H;  3KQG A;  4Z1M H;  3H25 A;  2J58 A;  3BRV B;  4JF7 A;  2WPQ A;  1HVV A;  2WSF H;  3CCR P;  1SFC C;  1MUU A;  1VQ9 P;  3P8M C;  1NTZ E;  3M9Q A;  2Z4E A;  5CCG D;  4IFD K;  1OVR A;  4WWI A;  2H89 C;  1L2P A;  1PP9 J;  1H88 A;  2J5U A;  2KLU A;  2IZ1 A;  1DD3 A;  1J2J B;  2FYN B;  3H32 A;  1GDT A;  1U7M A;  1GTW A;  5EFW B;  2SPZ A;  1KN7 A;  5AW9 B;  1QGK B;  2G3A A;  1HUC A;  3F89 A;  1HJB A;  3VTP C;  2D2C B;  1Q2N A;  4H13 D;  3A2A A;  1E5W A;  3V2R A;  3N7N A;  2QRX A;  5APV A;  2E5Y A;  1SQX E;  2WPS A;  1FC2 C;  2AEM A;  1KYO D;  4LGD E;  3H1I J;  3AE9 C;  2ZVO B;  1IFI A;  1CI6 A;  1BGY E;  5CBN A;  3CWB J;  1CSB A;  4R4L A;  1RHZ B;  3RL0 C;  3WU2 E;  2JR8 A;  1LP1 B;  3II6 A;  1T3J A;  2LKM A;  2ITA A;  2XV5 A;  3I55 P;  5CBO A;  1SQV J;  3FWL A;  2QSI A;  1IJD B;  1YI2 P;  4ZMD A;  4BRY B;  1HH0 A;  2IX7 C;  2W6J H;  5B5E H;  1NHL A;  1ZRT D;  2KOG A;  5AW3 B;  5AW5 B;  5B66 E;  2A06 E;  2W83 C;  2ZAE B;  3TSI A;  1NU1 E;  1OXZ A;  2H88 C;  3GF3 A;  3CI9 A;  2KB7 P;  1L0L E;  1JY2 P;  2R32 A;  2FXO A;  1GK6 A;  1USD A;  3MUD C;  4PD4 H;  1BE3 J;  2FXM A;  5CCH C;  3VYI A;  3M9B A;  1XTG B;  3QH9 A;  3M0D A;  5KLV G;  1UIX A;  4NPE A;  3K5B A;  2MKV A;  3B5N C;  1KIL D;  4L74 A;  2PGD A;  4MN4 C;  4YXW H;  1NAY A;  3CXH H;  3HUS B;  2B89 A;  4I6M C;  1LTG C;  3L71 D;  1KV4 A;  3L73 J;  1PP9 E;  5KKZ B;  5E79 H;  3ABV C;  4C7N A;  4PJ0 E;  1IFJ A;  1DIP A;  3VOP A;  1J1D C;  4DZO A;  3L72 D;  5KLI C;  1M1J C;  1SQP J;  1N86 A;  2B87 A;  1OW8 A;  1PZQ A;  1LNQ A;  5AVY B;  3BVH A;  3CCM P;  2QJY C;  2Y0C A;  1N7S C;  2LXC B;  1ZLL A;  2ZYA A;  1SQB E;  3L35 A;  4U3F J;  1YBK A;  2QJP C;  1VL2 A;  5AW2 B;  1JY2 O;  3CXH I;  3H1I E;  3L71 G;  5KAI H;  2WSE J;  2WVR A;  1VQ7 P;  3VN0 A;  3U1A A;  3BCC J;  3NXS A;  1EDI A;  5GTH E;  5APW A;  4GT1 A;  2QJK C;  2N9Y B;  1X22 A;  1NTZ G;  1AVO A;  2XDJ A;  3L72 G;  3GHG A;  2BAS A;  3S1K A;  3L74 J;  1SQV E;  1AV1 A;  3AE6 C;  1BGY D;  3HE4 B;  1MFT A;  1NOH A;  4IL6 H;  3RK3 E;  1GL2 A;  2FBW C;  2D2C D;  3L70 J;  1LTJ B;  2E76 C;  3CME P;  4B86 A;  2HG5 D;  1EDL A;  3TDK A;  5AVR B;  1T8Z A;  1FOS F;  5APS A;  3G3Z A;  2FXP A;  2KXP B;  1N7S A;  4WB4 A;  1BE3 E;  3AE8 C;  4KT0 J;  5KLV K;  1IC2 A;  3NTN A;  4UB6 H;  5AW1 B;  2NPS B;  1YYC A;  2C0X A;  1A02 F;  1OWA A;  1DEE G;  1BGY G;  1H89 A;  4Y99 C;  1PPJ E;  2WQY C;  2UWJ E;  3SSU A;  4H44 C;  2BCC J;  1N73 C;  1JTH A;  3JSV C;  3L73 E;  1GD2 E;  1OIP A;  1IK9 A;  1NTK D;  1VQO P;  3H1L J;  1VQP P;  4R4M A;  1YJN P;  1E79 H;  1J1E C;  1FDO A;  1Z56 A;  4DOJ A;  5TIS H;  1BSN A;  1SQP E;  1SQQ J;  2E5T A;  3EFF K;  4A7P A;  4I7Z C;  3Q5P A;  2N9B A;  2E74 D;  3H1H D;  3SFE C;  1FZC B;  3EQ2 A;  4WVZ A;  2M5A A;  1NU1 G;  2Q1K A;  2WPR A;  4TLF A;  2IBZ I;  5KAI E;  3OA7 A;  2L91 A;  1L0L G;  4U3F E;  2WMM A;  2KNC B;  1S1C X;  3TNU B;  1JMB A;  2JKV A;  1Y9B A;  1JY3 N;  4H0L D;  3O6Q A;  1AA0 A;  1NTK G;  3MP7 B;  2R5B A;  1NTZ K;  2A45 I;  1P84 I;  2W8Z A;  5APQ A;  1SQB D;  4AYC A;  4PV1 D;  1L4A D;  2WZ7 A;  3H1H G;  3U59 A;  1Q86 Q;  3GMA A;  3SFD C;  2N1T C;  3L74 E;  4GOE A;  1RE4 C;  3PHL A;  3FX0 A;  2WPV B;  1W2E A;  4GOD A;  3H32 B;  3U1C A;  3VMX A;  1URQ C;  2O01 J;  1ZME C;  1ZP0 C;  1KQS O;  2QVA A;  2YKO A;  4EI2 A;  1OVV A;  1S5L X;  1M90 Q;  5APT A;  1T2K C;  5CCG C;  3V2P A;  2IBZ E;  1SLQ A;  2O1J A;  1SQX K;  2Q6Q A;  3KPE A;  1HGV A;  1SQB G;  1PFI A;  3RK3 D;  4PD4 D;  3G4S P;  3AEF C;  1PGO A;  1NTM D;  3A3Y B;  1CI6 B;  2LR2 A;  2YIU C;  1K8A Q;  3PJS K;  1FAV A;  2CPB A;  1P84 E;  1NH4 A;  1KQF B;  1RE3 A;  1NAF A;  4WBA A;  2HPC A;  2BCC E;  2WSC H;  2L5G B;  2Q9I A;  3CXH D;  3HD7 C;  1YIJ P;  3H1L E;  4EDF A;  4U7J A;  4C46 A;  3IR9 A;  1URQ A;  1SQQ E;  1NU1 K;  5KJ7 C;  2Z5H A;  4OWF A;  1VQM P;  2YXQ B;  1JNM A;  1L0N J;  1L0L K;  1NTM G;  2O01 N;  3H1J D;  1FJK A;  4N78 E;  4YPC A;  1T3U A;  3PP5 A;  2HLO A;  2QG4 A;  3IFM A;  2I1J A;  1X8Y A;  1TU3 F;  1R8E A;  2NPS D;  1EQ7 A;  2QE7 H;  4RO0 A;  5B66 H;  3CCV P;  5GTI E;  5H2F H;  2FFD A;  3CMA P;  3LIE A;  1N7L A;  2OGU A;  1PPJ G;  2ZYG A;  1OX3 A;  2E75 C;  4OGQ C;  3A7O A;  3W67 A;  2K37 A;  3H1K J;  2KS1 A;  2WWW A;  3RL0 g;  3R2P A;  3HD7 A;  3V4Q A;  3LW5 J;  3H1J G;  3I56 P;  4C7N B;  3CL3 D;  1S9K E;  1AFO A;  1LT9 A;  2B87 B;  4IL6 X;  4IFM A;  3L75 J;  2OYI A;  2H7H A;  3B4S A;  2OYH C;  3OAK A;  2AXT E;  1SQB K;  4QMA A;  4UB8 E;  1VQ8 P;  4PJ0 H;  3RK2 C;  3V4W A;  4Y28 J;  2R3C A;  4U3F G;  3CCU P;  3KXD A;  2KI7 B;  1YQ3 C;  1AVY A;  5TJH A;  4IFF A;  4IOI H;  2XND H;  1LJ2 A;  4XE5 B;  1NYH A;  3HTK B;  2IBZ D;  1JY3 P;  1UII A;  1FBM A;  2WT7 A;  4LLH A;  3A0H H;  1SFC A;  4WY4 C;  1SQV K;  3GHG B;  5CJ0 A;  3JC2 2;  1PV3 A;  1HTL C;  1VF5 C;  3L74 G;  3PTZ A;  1RF1 C;  5AW8 B;  5GTH H;  3IF4 A;  5KLV D;  1XTC C;  3T97 A;  3BAS A;  1OFC X;  2JWA A;  2FKW B;  3A5T A;  1GL2 B;  1AJY A;  1NTM K;  2C9N Y;  1L0N E;  3M06 A;  1BCC D;  2IBZ G;  5H2F E;  2E74 B;  3BAT A;  4W7Z A;  2OYH A;  1VQ5 P;  3Q3D A;  1G1J A;  1YTZ I;  5AW6 B;  3MD0 A;  4D6T D;  3RBZ A;  1GZL A;  2D2C C;  3V5B A;  4H0L B;  1K73 Q;  3G6E P;  3TGU D;  1MZ9 A;  3P8C D;  1MFZ A;  1PL5 A;  1JY3 O;  3AE1 C;  3WUT A;  2GUV A;  5BU8 B;  3H1K E;  1JTH B;  1ZOY C;  4M3L A;  4WY4 A;  1EZV I;  1U7J A;  4PV1 B;  1NGM B;  1BCC G;  2FYU J;  1L4A B;  3D71 A;  1RF1 A;  4GOF A;  1SQP K;  2I1K A;  1ZN5 A;  3PRJ A;  1LWU B;  4YXD C;  1AQ5 A;  1SQQ G;  1K04 A;  1NTZ D;  3WMM 0;  5K5G B;  3BRT B;  3ZDM A;  1IFN A;  2M5A B;  4D6T G;  2E76 B;  2WIT A;  1X9V A;  3KDP B;  2HOD A;  1QL1 A;  1GMJ A;  3TGU G;  3P32 A;  1HGZ A;  4N3Y B;  1GW4 A;  5AVX B;  1RQV A;  3A0H E;  3MGN A;  3O6Q B;  3MUD A;  3RK3 B;  1H8A A;  3GLM A;  5CCH A;  3CX5 I;  5AVS B;  4BWN A;  3CWB E;  3RL0 D;  3VMY A;  4ZKU A;  2IZ0 A;  3FXE A;  3B5N A;  4AUW A;  3M0A A;  1SQX D;  5DJU B;  2WSE H;  1EZV E;  1KMI Z;  2PFX A;  3HRN A;  2KZI A;  2OTL P;  2QIW A;  5AVT B;  1N8R Q;  2H43 A;  1A02 J;  1J1E B;  4ZKP A;  1ZR4 A;  1PGJ A;  3AEA C;  2Y9Z A;  1FJP A;  1X79 B;  1S5L E;  4I7Z B;  2AXC A;  1OVU A;  3HUS C;  2R44 A;  2GM4 A;  1M1J A;  1KQL A;  1IK7 A;  3D6Z A;  4XFJ A;  4W7Y A;  4JPZ B;  1EC5 A;  2IDB A;  2Y9Y A;  1SQX G;  5AW4 B;  1S2E A;  2M8R A;  2A06 D;  1NU1 D;  3B5N D;  3CX5 E;  4HYT B;  1W5C E;  2HPC B;  4ASW A;  1Q82 Q;  1L0L D;  1Q90 D;  2JEE A;  2K1A A;  2K9J A;  4L75 A;  2FYU E;  5M1B A;  3G71 P;  4DT0 A;  3IAO A;  1HF9 A;  2A45 H;  1FZG A;  1P84 H;  1SQQ K;  1VQN P;  1OMI A;  3RGU A;  1GL2 D;  1URQ B;  5AW7 B;  3W68 A;  1WMK A;  2WSS H;  1JEK A;  3JCU H;  1EDK A;  2O1K A;  3NFQ A;  3SWK A;  1FDM A;  2K9Y A;  2A06 G;  1PP9 D;  1N7S D;  1DD4 A;  2KLV A;  3UIA A;  3AEE C;  2IYO A;  1JCC A;  3VMZ A;  1HBW A;  2FFD B;  1LTJ C;  1KYO I;  1HWT C;  3WUU A;  4K3A A;  3BCC E;  2YIU B;  1FDI A; 
#chains in the Genus database with same CATH homology
 3HTK A;  2XV5 A;  1NKZ B;  5AVQ B;  2Q5U A;  1T3U A;  3PP5 A;  2HLO A;  2PAJ A;  3L4F A;  1FOS E;  2W6A A;  3IFM A;  1IJD B;  2I1J A;  3V2N A;  1X8Y A;  3SWY A;  1HH0 A;  2IX7 C;  2NPS D;  3B8E B;  1EQ7 A;  3HD7 B;  1N73 A;  1NHL A;  2KOG A;  5AW3 B;  2FFD A;  5AW5 B;  2NPS C;  1L4A C;  3TSI A;  5BVZ A;  2IFN A;  1OXZ A;  2YKQ A;  3LIE A;  1JO5 A;  1N7L A;  1DH3 A;  2Q7C A;  3CI9 A;  1LT9 B;  2KB7 P;  1LWU C;  1JY2 P;  4AQR D;  3M91 A;  2R32 A;  2Q3I A;  1GK6 A;  5CCH D;  3VP8 A;  3A7O A;  1VDF A;  2E42 A;  2FXM A;  2OYI B;  5CCH C;  1VPC A;  2WWW A;  3M9B A;  3VYI A;  3R2P A;  3HD7 A;  3V4Q A;  1ZV8 A;  1LTI C;  1XTG B;  2XNX A;  3TYY A;  3L36 A;  1GW3 A;  3M0D A;  4C7N B;  3CL3 D;  1S9K E;  4C7R A;  2O01 H;  3B5N C;  3LID A;  1AFO A;  1LT9 A;  1KIL D;  1FZA A;  4JYB A;  4IFM A;  3HUS B;  3RK3 C;  4I6M C;  1LTG C;  2OYI A;  2H7H A;  3TK1 A;  2N1T B;  2WT7 B;  2OYH C;  3OAK A;  2YNY A;  1SQB K;  5APY A;  2XU6 A;  5AVW B;  4C7N A;  3RK2 C;  1MV8 A;  1SFC B;  3V4W A;  2P67 A;  1IFJ A;  1CW5 A;  2R3C A;  3NMD A;  1JCD A;  4RES B;  3VP9 A;  3VOP A;  1J1D C;  4DZO A;  1M1J C;  4IFF A;  1N86 A;  2VRS A;  4XE5 B;  1G1I A;  1FZF A;  3HTK B;  3HUS A;  5AVY B;  1JY3 P;  4OH8 B;  1L4A A;  1NKN A;  3N4X A;  3BVH A;  2N1T A;  5APX A;  3MTU E;  1FBM A;  2WT7 A;  1RE4 A;  2PP6 A;  1WRG A;  1IFD A;  2IFM A;  1N7S C;  1ZLL A;  1L0N K;  4EIJ A;  4LLH A;  1SFC A;  1DX7 A;  3L35 A;  1LWU A;  2WTY A;  4WY4 C;  1SQV K;  3GHG B;  5CJ0 A;  1YTZ T;  5AW2 B;  1JY2 O;  1HTL C;  1LTS C;  2YKP A;  1CZQ A;  1RF1 C;  5AW8 B;  2OYH B;  3VN0 A;  3U1A A;  3NXS A;  2YO2 A;  5CCG A;  1XTC C;  3L37 A;  3T97 A;  3BAS A;  5APW A;  4GT1 A;  2IPP A;  2FYZ A;  5BU5 A;  3P7K A;  2FKW B;  3A5T A;  1GK4 A;  3E1I A;  1GL2 B;  2XDJ A;  4JYC A;  1NTM K;  2C9N Y;  1LGH B;  2J59 M;  3GHG A;  4EOT A;  2BAS A;  1FZE A;  3M06 A;  3BAT A;  1FZB A;  1RE3 C;  4W7Z A;  4GKG A;  2OYH A;  2HFE D;  3HE4 B;  1G1J A;  1YTZ I;  2XZR A;  1NOH A;  4KHX A;  3RL0 B;  4GIF A;  4WY4 B;  2ZFC A;  5AVZ B;  2W6B A;  1GL2 A;  5AW6 B;  2POH A;  3MD0 A;  1GU5 A;  5CHX A;  1G2C B;  1LTJ B;  4B86 A;  1GZL A;  1RF1 B;  2OAR A;  2HG5 D;  2C9L Y;  2KYV A;  3V5B A;  3M9H A;  1IFM A;  5AVR B;  1URQ D;  1T8Z A;  5AW0 B;  1FOS F;  1MZ9 A;  3P8C D;  5APS A;  3G3Z A;  1MFZ A;  3HE4 A;  1JOC A;  1JY3 O;  1N7S A;  4WB4 A;  2GUV A;  5BU8 B;  1JTH B;  2H8P D;  4M3L A;  2P1J A;  4N6J A;  5KLV K;  1T2K D;  1KIL C;  3LW5 H;  1IC2 A;  3NTN A;  4WY4 A;  3EFG A;  2HOD B;  1FZC C;  5KJ7 A;  5AW1 B;  2NPS B;  1YYC A;  1L4A B;  2C0X A;  1A02 F;  1G2C A;  1OWA A;  1LTJ A;  1RF1 A;  1N2D C;  3SWF A;  1H89 A;  4Y99 C;  1JY2 N;  1SQP K;  4I1L A;  2I1K A;  4HH2 A;  1ZN5 A;  1LWU B;  1AQ5 A;  1WT6 A;  3WMM 0;  1LTB C;  1N73 C;  2FFD C;  1JTH A;  3BRT B;  1IFN A;  2C0W A;  1SP4 A;  1GD2 E;  2WIT A;  1X9V A;  2CPS A;  3KYQ A;  3KDP B;  2HOD A;  1IK9 A;  5CJ4 A;  1QL1 A;  2HYN A;  2NPS A;  3HE5 B;  3P32 A;  2XKM A;  1J1E C;  3B5N B;  1Z56 A;  1HGZ A;  4N3Y B;  1GW4 A;  5AVX B;  4DOJ A;  3HD7 D;  3O8Z A;  3MGN A;  1KIL B;  1IO4 A;  2N9B A;  5APU A;  3MUD A;  1FZC B;  1LTA C;  2KP8 A;  3EQ2 A;  3M0D C;  5AVV B;  3RK3 B;  3MIW A;  1H8A A;  5CCH A;  2WPR A;  2M3B A;  1KFN A;  3OA7 A;  5AVS B;  2E43 A;  1LT9 C;  3RL0 D;  3VMY A;  3RK2 B;  2YO3 A;  4I2L C;  3C9I A;  4ZKU A;  3HE5 A;  1JMM A;  2MJZ A;  5KJ7 D;  2P2U A;  4W80 A;  3B5N A;  1SVF A;  4AUW A;  3M0A A;  1J1D B;  3TNU B;  5KTB A;  2OYI C;  1M1J B;  2WSE H;  1KIL A;  1JY3 N;  3HRN A;  1FZC A;  3H6P A;  2R5B A;  1NTZ K;  1KFM A;  2A45 I;  5AVT B;  3P8C E;  2H43 A;  3V2Q A;  1A02 J;  1JUN A;  1J1E B;  2GUS A;  2JJL A;  1N7S B;  4ZKP A;  1ZR4 A;  1NWQ A;  5APQ A;  1NTK K;  2Z5I A;  4AYC A;  3I5C A;  1FJP A;  1X79 B;  2QM7 A;  2YMY A;  1L4A D;  2N1T D;  2WZ7 A;  1DEB A;  2QM8 A;  3HUS C;  3U59 A;  3TNU A;  2GM4 A;  1RF0 C;  1M1J A;  1KQL A;  2N1T C;  1FU1 A;  1RE4 C;  3KQG A;  1SFC D;  4N78 D;  4W7Y A;  2A45 G;  2J58 A;  3BRV B;  4JF7 A;  1W2E A;  2WPQ A;  1HVV A;  2WSF H;  3H32 B;  3U1C A;  1SFC C;  3VMX A;  1LTT C;  1URQ C;  2FYU K;  1MUU A;  4XA4 A;  4O9B A;  3P8M C;  2R5D A;  3M9Q A;  5AW4 B;  2YKO A;  2Z4E A;  1QL2 A;  5CCG D;  4IFD K;  2M8R A;  5APT A;  1T2K C;  5CCG C;  3V2P A;  1M7L A;  3B5N D;  1SLQ A;  1H88 A;  2O1J A;  1SQX K;  4HYT B;  3KPE A;  1J2J B;  2KSJ A;  2HPC B;  3H32 A;  1HGV A;  2JEE A;  1ZR2 A;  1GDT A;  1PFI A;  1GTW A;  3RK3 D;  3OJA B;  1RY3 A;  3GHG C;  5AW9 B;  1HUC A;  1HJB A;  3VTP C;  3A3Y B;  1CI6 B;  3RK2 D;  2A45 H;  1FAV A;  1FZG A;  2CPB A;  1SQQ K;  3A2A A;  1E5W A;  3V2R A;  3N7N A;  1NH4 A;  1S9K D;  1NO4 A;  1GL2 D;  1RE3 A;  3CLQ A;  1URQ B;  5APV A;  5AW7 B;  1NAF A;  4WBA A;  2HPC A;  1GL2 C;  2WSC H;  2L5G B;  2Q9I A;  2WPS A;  1GU4 A;  2O1K A;  3HD7 C;  3NFQ A;  1FDM A;  4LGD E;  5CMZ A;  1RF0 A;  1N7S D;  4LC1 A;  4C46 A;  1IFI A;  1CI6 A;  4Y99 B;  2KLV A;  1CSB A;  3UIA A;  1KZU B;  4WY4 D;  2W27 A;  3IR9 A;  1URQ A;  5AVU B;  3RL0 C;  1NU1 K;  3II6 A;  1JCC A;  3VMZ A;  1N73 B;  1HBW A;  2ZXE B;  5KJ7 C;  2P7J A;  2FFD B;  2Z5H A;  1LTJ C;  1HWT C;  1JNM A;  1T3J A;  1L0L K;  2LKM A;  1FJK A;  4N78 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...