4WY4C

Crystal structure of autophagic snare complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
78
structure length
78
Chain Sequence
ADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 8
publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 38
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4C00
2WZ7A 4JF7A 3HD7A 1URQD 1GL2C 1GL2B 3RK2C 3RK2B 2NPSD 1JTHB 4W7YA 1SFCA 3HD7D 3P8CE 4W7ZA 3B5NC 3RK3C 1HVVA 3B5NB 3TSIA 5CCGA 1SFCC 1SFCB 3PP5A 1URQC 1URQB 2H8PD 4WY4A 5CCGD 5CCHC 2NPSC 2XDJA 2NPSB 3HD7C 2HFED 2PP6A 3HD7B 2YMYA 4WY4D 4W80A 5KJ7A 2N1TA 1L4AA 1N7SA 3RL0D 1KILA 2HG5D 1GL2A 5KJ7D 2N1TD 5CCGC 3RK3D 1L4AD 4N78E 1JTHA 1N7SD 3HTKB 1KILD 3VOPA 2M8RA 1GL2D 4WY4C 2KOGA 3RK2D 4WY4B 3B5NA 1NHLA 4OH8B 5CCHD 1T3JA 4LGDE 3RL0C 3RL0B 3M0DC 3B5ND 1URQA 3KYQA 5KJ7C 2N1TC 1L4AC 1XTGB 2N1TB 3RK3B 1L4AB 1N7SC 1SFCD 5CCHA 2NPSA 1KILC 1N7SB 1KILB
chains in the Genus database with same CATH superfamily
1PGJA 3CXHI 3CXHE 5APYA 2KNCA 1E5WA 3WUTA 4C7RA 2Y0DA 2WSEH 2PFXA 2WQYC 3CWBG 1Q82Q 3AE6C 3IFMA 2OTJP 2Y9ZA 3B5NB 1VPCA 3ABVC 1LP1A 5KLIC 3PRJA 1URQC 1DD3A 2XU6A 3H1KG 1BGYG 1NAFA 3C9IA 1GDTA 1SQVD 1Z56A 2E76C 1X0TA 3AEDC 3NXSA 4GODA 2PP6A 2E74C 4D6TE 2AXCA 3FWNA 3KDPB 5KAIH 3IF4A 1JO5A 2R44A 1S72P 2C9NY 3VP8A 2HYNA 1LWUC 1N7SD 1KD1Q 1BCCG 5GTHE 1NTKJ 2ZT9D 1JOCA 2Q3EA 2M8RA 2K9YA 2MJZA 4H13B 1GU4A 3B5NA 1EDKA 3H1JJ 2WPRA 1EDIA 1OVVA 2UWJE 4CPGA 2O01H 1L4AB 1IK7A 1PPJD 1NTKD 2HR3A 3RK3E 1L0NJ 3LW5J 3V4QA 3H1JD 3C1LA 4UB6H 2IBZI 4N6JA 4I6MC 2IBZE 1SFCB 1BE3G 5EFWB 1Q90D 1Y8AA 3Q2YA 4LC1A 1L0ND 2NPSB 2R3CA 3D6ZA 3M9BA 2I1JA 4WVZA 3G9RA 3AE3C 4K3AA 3H1IG 1L4AA 4C46A 1HBWA 1VF5B 3B71A 3A0BH 2Q6QA 3KXDA 4U3FJ 1P84H 4EI2A 2FYUE 3JCUE 1JEKA 3HRNA 1RQVA 1NHLA 2E5TA 1X9VA 1JCCA 1ZP0C 1ZRTE 5AW8B 1RF1B 2C9LY 1SLQA 2N1TB 1LNQA 1FZEA 5AW9B 4MN4C 2NPSA 1R5LA 1USDA 4U3FD 1MV8A 3VMXA 1HJBA 4JPZB 3L75J 1NU1K 3FXEA 3CCVP 3CC2P 1U7JA 3SSUA 1VQ7P 1IO4A 2OTLP 3L72G 1LT9B 2JDIH 2KP8A 1N7LA 1NU1G 4W7ZA 3L70J 1S5LH 3B5NC 2ZFCA 1S1CX 2FBWC 1OWAA 2A06G 3F89A 3VP9A 2SPZA 2FXOA 2GUVA 1KTMA 2M5AB 3L75D 3CWBE 2O3JA 3OA7A 1ZW0A 1KC8Q 1SQVK 1QGKB 2RKLA 3L70D 2H88C 2E75D 2N1TA 2WSCH 1SQVG 1XTCC 4DOJA 1VQ9P 1N86A 2HG5D 1GMJA 1WT6A 5AVUB 3SWYA 5K5GB 1LTBC 3VMAA 1LJ2A 1LT9A 4H13C 1VQMP 1LTTC 1VDFA 2WSSH 5GTIH 3KZIH 3CCRP 2YKQA 2XZRA 2QSIA 3F5HA 4IOIH 4IFMA 1JY2O 5APTA 1R5SA 1OW8A 1HUCA 2W8ZA 2M5AA 1L4AC 2K9JB 1RQUA 2OQQA 1PV3A 2Y0EA 4UB8E 2HODB 2E75C 2KSEA 3H1KJ 1G1JA 1KILE 1BGYJ 3II6A 3W68A 2IYOA 2KXPB 1OW7A 4A7PA 1KQFB 1PPJG 2LR2A 1HVVA 2NRGA 1SFCC 1KYOH 1MUUA 1PGPA 4L76A 1G1IA 5B5EE 1JNMA 4ZNCA 2NPSC 2KLVA 1NJIQ 3H1KD 1DD4A 2CK3H 1BGYD 2YO2A 1KQLA 2GUSA 1BCCJ 1FOSE 2RMZA 2GM4A 2FYZA 3SFDC 1R8EA 1IFIA 1AJYA 1WMKA 2FXMA 3EFGA 3GHGB 2V7QJ 1SQPE 1VF5C 1KB9H 1NYHA 3CC4P 1EZVG 3BCCD 1GL2D 4PD4I 1BCCD 4PD4E 3D70A 2KB7P 1JUNA 2R5BA 1KZUB 1NTMK 4IL6H 3CX5D 4DZOA 2N1TC 4YXWH 4H0LB 1NTMG 5CCHA 2QJYB 1H0TB 3VYIA 1K04A 1FE6A 3WU2E 2KK7A 3CCEP 1NO4A 1FDOA 1BE3J 3L73E 2JKVA 2WPSA 3AEBC 2ZJSE 2ZYGA 1S9KD 4W7YA 3GW6A 3AEFC 1LT9C 3GHGA 4GDOA 5C39A 1OVUA 1G2CB 1JY3N 1U57A 1NWQA 3H1LD 5AVWB 2O1KA 2YXRB 3L71D 3TDKA 3H1IJ 3R2PA 1M57D 1IC2A 1BE3D 1MFTA 1NU1E 4OGQB 4C7NA 4RESB 1FBMA 1N2DC 2LXCB 1LTIC 5APQA 1H0TA 1M90Q 2C0XA 3L75G 1M1JB 1FC2C 3H1ID 5B66E 3RGUA 2M3BA 2A45I 3K5BA 2D2CB 3U59A 3VTPC 2W27A 4OWFA 4XE5B 1ZR2A 5CCHD 3LIDA 4EOTA 4JYBA 2AXTE 1GK6A 3L72J 1A02J 2N9YB 1NU1J 2WVRA 1OZHA 1QX8A 1GW3A 1URQD 2POHA 3ZDMA 2E76D 2QVAA 2QEXP 1VQ6P 2Q5UA 2QM7A 1M1JA 3CCQP 2M3EA 2E74D 1UIXA 3L35A 3CI9A 2OYIB 2V4HA 3CPWO 4H44B 3L72D 5H2FH 2YKPA 3IR9A 1QEXA 4BRYB 4PJ0H 2A06D 1KQGB 1SQVJ 1L2PA 2B87B 5CCHC 2WSEJ 1JCDA 1PPJE 1NTKE 1D7MA 2A45H 3N4XA 3S1KA 2RH0A 1ZR4A 1T2KC 3CC7P 3HE4B 3GHGC 1HGZA 1SVFA 4ASVA 2Y9YA 3H1JE 3M91A 1NGMB 2E42A 3V5BA 2KZIA 5AW6B 3VMZA 2FYNB 2ZYDA 1SQXD 2OYIA 2Q7CA 1L0NE 2YKOA 4BRYA 3RL0B 3G3ZA 5M1BA 4H0LC 2B87A 1YYCA 3BCCG 1HGVA 2QJYC 3RK3B 1NTZK 3PJSK 1M7LA 1PP9J 2WZ7A 3A0HE 1NTZG 3CXHH 3PLNA 2QJPB 3HE4A 1VQ8P 1CI6B 4I7ZB 2O01J 3H1HG 5CCGA 3V6IA 2K1AA 2KIKA 3D71A 1PP9D 4AUWA 1VQOP 3FX0A 2H8PD 4RKUJ 1X8YA 3H1LG 2BCCG 3V2RA 4U3FE 4OGQC 4YPCA 3Q5RA 3L71G 5APVA 2AEFA 4L74A 3JSVC 1SP4A 1OMIA 1M1JC 3HE5B 1GTWA 1FZCB 3TK1A 3WMM0 5CJ4A 1NKZB 2WPVB 2D2CC 2HPCB 5GTHH 2FXPA 1CI6A 1NTMJ 3MGNA 3RBZA 4XFJA 3BRVB 4D6TD 4WY4B 1EZVD 3IN6A 3L75E 1FAVA 1GU5A 3L74D 1EDJA 2HLOA 3B5ND 5E79E 3OW2O 3L70E 3TGUJ 3IAOA 5BVZA 1NOHA 2JP3A 2PGDA 1H89A 4JF7A 2KS1B 1NTMD 2J5UA 1ZLLA 2NZ2A 3LIEA 4QMAA 3RK2B 1OXZA 1SFCA 3AEEC 3HE5A 3OAKA 4DT0A 1FZCA 4JYCA 2OYIC 2I1KA 1VQLP 1FJPA 5APXA 3CD6P 4H44C 2FKWB 2JO1A 1P84D 5TISE 1IFPA 2HPCA 1N8RQ 3TGUD 3PP5A 3BVHA 1Q2NA 1QL1A 2H43A 4WY4A 3B8EB 2JJLA 4WWIA 4H13D 2IDBA 1FJKA 1GW4A 2O01N 3I55P 1OIPA 3AEGC 1PGQA 1NVOA 3SFEC 1YJ9P 3O8ZA 2YMKA 1JMBA 2AEMA 5CCGC 3WUUA 1L4AD 1FDIA 2FYNC 3AE2C 3CMAP 3CCUP 3VOPA 2WPQA 4GOFA 2KOGA 3JCUH 1RF1A 1ZMEC 2QE7H 1T3JA 1SQXK 1PFIA 3H1KE 1BGYE 3RL0C 3M0DC 1L0LK 1SQXG 3CL3D 4ZKUA 2OYOA 3AE1C 1SFCD 4R4LA 5CMZA 1J1EB 1KILB 1L0LG 4PV1B 2OTKE 4DJGA 3OJAB 2WSFH 4BWNA 2QJPC 2NPSD 1OW6A 4HYTB 4I7ZC 5AVQB 2PAJA 2ZXEB 1BCCE 3MUDA 3E1IA 2YO3A 1ZV8A 3CX5I 1LTJB 1BSHA 3CX5E 1VF5D 2OYHB 5KTBA 2GA1A 4DCKA 1YITP 2WT7B 1KFNA 3MHVA 2HFED 3HD7B 4GKGA 1PP9G 5KLVD 1VL2A 1S9KE 1PZQA 1IFNA 5KJ7A 2FFDB 1FZCC 1KILA 1LTGC 3PHLA 1T8ZA 3H1LE 2N1TD 1AFOA 1BDCA 3BCCJ 3L71E 3P8CD 3GF3A 4WY4C 2ZVOB 1BE3E 2M0BA 2K9JA 1KYOD 2XNDH 1NTZJ 1LTJA 1FS0E 2HODA 2RN0A 5AW5B 2BEQD 1JB0J 2ZAEB 2OYHA 2Z5HA 1DX7A 4D6TG 3PTZA 1YHQP 2WT7A 3H1HJ 4WB4A 1LTSC 3H1IE 2Q1KA 3HD7A 3L74G 2LKMA 1HWTC 4UB8H 3I56P 3RK2C 2FFDA 5AVYB 4ZKPA 1RE3A 3AE8C 2W6BA 1NTZD 3H1LJ 3W67A 1YI2P 2BCCJ 1RF1C 1HJ0A 1KB9D 1ZN5A 1HTLC 3L71J 4N78D 3M9HA 1JY3P 2IFNA 4AQRD 2ZVNB 2YXQB 3Q5SA 3H1HD 2K88A 2ITAA 2WMMA 3L37A 2H89C 5B5EH 3N7NA 3TNUB 3A3YB 2Y0CA 3TGUG 2BCCD 3KPEA 5KAFE 2IPPA 1IJDB 4W80A 4HB1A 2IZ0A 3V2QA 3AE9C 2QJKB 2ZYAA 3L72E 3MUDC 1EXJA 2J59M 4AYCA 1JY2N 1ZOYC 1SQQD 3O6QB 1J2JB 2A06E 2IBZG 1VQKP 2JWAA 2Q9IA 4PD4H 4OH8B 4XA4A 2KSJA 1YQ3C 2C0WA 2R32A 5KJ7C 3Q5PA 1IK9A 2FY8A 2L91A 1J1EC 3TNUA 1KILC 1H88A 1N7SB 1G2CA 5AVVB 3WU2H 3MIWA 2ZT9B 3BASA 1SQVE 1YBKA 2MKVA 2XNXA 3C8VA 1DEBA 2IX7C 3VMYA 1T2KD 1BSNA 1LTJC 1RHZB 4M3LA 5AW3B 3Q3DA 5TJHA 1E79H 2OYHC 3CCMP 1S3JA 4WBAA 4OVNF 5APWA 2XDJA 3HD7C 5KAIE 2FFDC 3L36A 1RE3C 3A7OA 1N7SA 1UIIA 2YNYA 5KLVK 1EQ7A 2W90A 3G4SP 4H0LD 1AVYA 2O1JA 3USSA 5B66H 5KLVG 1SQXJ 1YTZT 1PP9E 1W2EA 4KHXA 2QM8A 1L0LJ 2E43A 1SQBJ 2P7JA 1JM0A 1MKMA 2PRRA 3E7KA 2AXTH 2DW3A 1IFDA 4EIJA 2JWDA 1GK4A 4JBZA 1KMIZ 4TLFA 1X22A 1KORA 2JR8A 1N73B 2QRXA 1L0LD 1RH5B 4OGQD 5APSA 1SQBD 2WWWA 2W83C 4K35A 3AE5C 1EZVI 3V4WA 4UB6E 1EZVE 1M1KQ 1S2EA 1OFCX 1YJWP 3L74E 1T3UA 3CCSP 1OVRA 2D2CD 3QH9A 1X79B 3T97B 3TF5A 1NTME 1Y9BA 3EFFK 2KLUA 1HH0A 3L4FA 1QL2A 1VQPP 5APUA 3H32B 1IFJA 3KHUA 1N73A 2WITA 5BU5A 3A0BE 2QJKC 3CXHD 2JEEA 5AW2B 1P84I 1FZAA 1P84E 3V2PA 3TGUE 4EDFA 4D6TJ 4TT3H 4R4MA 3M0DA 1H8AA 2IZ1A 1M56D 1SQQK 2N9BA 3L74J 5DJTB 4RJTA 2E75B 3RBXA 1HF9A 2IFMA 3LW5H 1SQQG 4H44D 2XV5A 1VQ4P 1N7SC 3T97A 2CPBA 1SQPK 2I8DA 1RE4A 2ZT9C 1VQNP 1AV1A 1LGHB 3A0HH 1SQPG 3MD0A 1JTHB 2W6AA 3H32A 1DEEG 1DIPA 1LTAC 1S5LE 1IZNB 4U7JA 3TSIA 3GLMA 4NPFX 5CCGD 3CLQA 1K8AQ 3M06A 3H6PA 3E1RA 1RF0A 2Q3IA 5KKZB 1EDLA 3L73G 1FU1A 3SWFA 3RL0D 2P58A 1FOSF 5AW0B 2VRSA 3RK3D 5CHXA 3CCLP 1FDMA 1JTHA 1Q81Q 1GZLA 3WUVA 1KQSO 2XKMA 3MZWB 5GTIE 3KZIE 2B89A 1MFZA 2IBZD 2KS1A 1PGOA 3KYQA 5E79H 5KLVE 5BU8B 3TYYA 1N73C 2FYUJ 2P10A 2WSCJ 2BEZF 1VQ5P 1GL2B 5AVRB 1USEA 1NKNA 1K9MQ 3FXDA 1SS1A 3KQGA 1FZBA 2KI7B 1CSBA 3M9QA 3P8CE 3B4SA 2A45G 3RL0g 1PL5A 2E5YA 3RK3C 3S4RA 1DH3A 1Q7YQ 2P2UA 1KYOI 1SQBK 1KYOE 1LT1A 2YIUB 1KFMA 3NFQA 5TISH 2R3SA 3FWLA 2WSFJ 5L8RJ 2FYUD 3H25A 1SQBG 3U1CA 1JY3O 1QVFO 1RE4C 3BCCE 3Q1MA 4ASWA 1AVOA 1K05A 5KLVJ 4JQ0D 2YMYA 2OGUA 4WY4D 3MP7B 1Y47A 1ZRTD 3AECC 2J58A 1PIXA 3EQ2A 1A02F 1W5CE 4YTPC 1NTZE 1FZFA 2QIWA 3P8MC 4Y99B 1KB9I 4IFDK 1KB9E 3HUSB 4HKZH 3GF7A 2H7HA 3CMEP 1GL2A 1EXIA 4N78E 3G6EP 3HTKB 3CWBJ 3I5CA 2KYVA 3D6YA 3H1HE 5AVSB 2WTYA 1AQ5A 3MTUE 2W6JH 3RK2D 3SWKA 1NTKK 2G3AA 4LGDE 5CBNA 1RF0C 1S5LX 1YTZI 4IL6E 3NMDA 3JC22 2BCCE 1NTKG 1WRGA 1M8OB 4GIFA 3P32A 3CWBD 1J1DB 2AEJA 1U7MA 1GD2E 3AEAC 5CJ0A 4YXDC 2CPSA 1YIJP 3AE7C 3H1JG 4I1LA 2IYPA 1SQQE 1YJNP 3HUSA 3ITKA 1JMMA 1L0NK 4HJGH 4GOEA 3HTKA 3GMAA 5AW4B 4GT1A 2QA4P 5KLIB 3CX5H 1L0NG 1TU3F 3BRTB 4LLHA 1MZ9A 1URQB 2V7QH 1FZGA 4NPEA 1EC5A 2E76B 3A5TA 5KKZC 2QG4A 2E74B 2L5GB 1AA0A 3GG2A 3UIAA 2K3RA 4EYYQ 5KJ7D 4C7NB 1SQQJ 2OARA 2Z5IA 1OX3A 4B86A 1LWUB 1ZXGA 1KILD 4PV1D 4Z1MH 3FGAD 4NPDA 3VN0A 1JY2P 1IFMA 2B88A 3EWKA 5AVXB 3R4YA 4RO0A 1SQPJ 1CW5A 4KT0J 4U3FG 1URQA 5CBOA 1YQ4C 2G8YA 1QLED 3V2NA 1K73Q 4I2LC 4L75A 1GL2C 3BATA 2KUBA 3HD7D 4O9BA 1SQPD 3CCJP 5H2FE 2YIUC 1LWUA 2P67A 4PV1C 4PJ0E 3L73J 1S4XA 3A2AA 1CZQA 2Z4EA 2KZJA 4PD4D 1Q86Q 5AW7B 2FYUK 4ZMDA 3L70G 1NAYA 1SQXE 2K37A 4L73A 4IFFA 2ZXXA 3QWOC 2P1JA 2FYUG 1KN7A 3U1AA 2KNCB 5KAFH 2LXBA 4IL6X 1L0LE 4Y99C 3O6QA 5DJUB 1SQBE 1BDDA 1KV4A 3HUSC 4BXLA 2R5DA 3L73D 3AE4C 3NTNA 3M0AA 1W2BO 3P7KA 1T6AA 1RY3A 1LP1B 1QVGO 4Y28J 5AW1B 3PH0A 5AVTB 1AQTA 4KJMA 2B9BA 4N3YB 5AVZB 1NH4A 1XTGB 3S9OA 1J1DC 3G71P 2BASA 1NU1D 4HH2A
chains in the Genus database with same CATH topology
1NO4A 1LGHB 3OJAB 2WSFH 5APYA 2WPSA 1S9KD 2NPSD 3MD0A 1JTHB 4W7YA 1E5WA 4C7RA 4HYTB 1LT9C 3GHGA 2W6AA 3H32A 2WSEH 1G2CB 1LTAC 5AVQB 1JY3N 2PAJA 2ZXEB 1NWQA 3IFMA 5AVWB 3B5NB 2O1KA 3TSIA 1VPCA 3MUDA 3E1IA 2YO3A 1ZV8A 1LTJB 3R2PA 1URQC 2XU6A 2OYHB 5CCGD 1NAFA 3C9IA 1IC2A 3CLQA 1GDTA 5KTBA 1Z56A 3M06A 2WT7B 1KFNA 3H6PA 3NXSA 2HFED 2PP6A 1RF0A 3HD7B 2Q3IA 4GKGA 4C7NA 4RESB 3KDPB 1FBMA 1N2DC 1S9KE 1IFNA 1LTIC 5KJ7A 2FFDB 1JO5A 5APQA 1FU1A 1FZCC 2C0XA 3SWFA 1M1JB 3RL0D 1KILA 2C9NY 1LTGC 3VP8A 2HYNA 1FOSF 5AW0B 1T8ZA 2VRSA 2N1TD 1AFOA 1LWUC 5CHXA 3RK3D 2M3BA 2A45I 1JTHA 1FDMA 1N7SD 1GZLA 3U59A 1JOCA 3P8CD 3VTPC 2M8RA 2MJZA 2W27A 2XKMA 4WY4C 1GU4A 3B5NA 4XE5B 1ZR2A 5CCHD 3LIDA 1MFZA 4EOTA 4JYBA 1LTJA 2WPRA 1GK6A 2HODA 5AW5B 2OYHA 3KYQA 1A02J 2Z5HA 1DX7A 2O01H 5BU8B 1L4AB 2WT7A 3TYYA 1N73C 4WB4A 1LTSC 3HD7A 1GW3A 1URQD 2LKMA 1HWTC 1GL2B 5AVRB 2POHA 3RK2C 1NKNA 2FFDA 5AVYB 4ZKPA 3KQGA 1FZBA 2Q5UA 1RE3A 2QM7A 2W6BA 3V4QA 1M1JA 1CSBA 3M9QA 3P8CE 3L35A 1RF1C 2A45G 1ZN5A 3CI9A 3RK3C 1HTLC 2OYIB 1DH3A 2P2UA 1SQBK 4N78D 2YKPA 4N6JA 4I6MC 1KFMA 3IR9A 3NFQA 3M9HA 1JY3P 1SFCB 2IFNA 4AQRD 3L37A 5CCHC 3U1CA 1JY3O 1RE4C 3N7NA 2NPSB 4LC1A 3TNUB 2R3CA 1JCDA 3A3YB 2A45H 3N4XA 3M9BA 2I1JA 2YMYA 4WY4D 3KPEA 2IPPA 1IJDB 4W80A 1ZR4A 1T2KC 2J58A 1L4AA 3EQ2A 3HE4B 3GHGC 4C46A 1A02F 1HGZA 1SVFA 1FZFA 3P8MC 4Y99B 1HBWA 4IFDK 3HUSB 3V2QA 2H7HA 1GL2A 3M91A 2E42A 4N78E 3V5BA 2J59M 4AYCA 1JY2N 3HTKB 3I5CA 5AW6B 3VMZA 2KYVA 1J2JB 5AVSB 2WTYA 1AQ5A 3MTUE 2OYIA 3HRNA 3RK2D 2Q9IA 1NHLA 4OH8B 1NTKK 2Q7CA 1X9VA 4XA4A 4LGDE 1RF0C 2YKOA 1YTZI 2KSJA 1JCCA 3RL0B 3G3ZA 3NMDA 2C0WA 2R32A 1YYCA 5KJ7C 1WRGA 5AW8B 1RF1B 2C9LY 1IK9A 1HGVA 1SLQA 2N1TB 3RK3B 1FZEA 1NTZK 4GIFA 5AW9B 1J1EC 2NPSA 3TNUA 1KILC 1H88A 1M7LA 1N7SB 3P32A 1G2CA 1J1DB 5AVVB 1MV8A 2WZ7A 1GD2E 3MIWA 5CJ0A 3BASA 3VMXA 2CPSA 1HJBA 1NU1K 4I1LA 3HE4A 2XNXA 1IO4A 1DEBA 1CI6B 1LT9B 2KP8A 1N7LA 4W7ZA 3HUSA 3B5NC 2ZFCA 2IX7C 1JMMA 1L0NK 1OWAA 3VMYA 1T2KD 5CCGA 3HTKA 1LTJC 3VP9A 4M3LA 5AW3B 5AW4B 4GT1A 2OYHC 4AUWA 4LLHA 2GUVA 3BRTB 4WBAA 1MZ9A 1URQB 1FZGA 2H8PD 5APWA 1X8YA 2XDJA 3V2RA 3A5TA 3HD7C 3OA7A 1SQVK 5APVA 2L5GB 1SP4A 2FFDC 3L36A 2N1TA 2WSCH 1RE3C 1M1JC 3A7OA 1N7SA 3HE5B 1XTCC 4DOJA 2YNYA 1GTWA 5KLVK 1EQ7A 1FZCB 3UIAA 3TK1A 1N86A 2HG5D 5KJ7D 2O1JA 4C7NB 1WT6A 3WMM0 2OARA 2Z5IA 5CJ4A 1NKZB 4B86A 1LWUB 2HPCB 1KILD 5AVUB 3SWYA 1CI6A 1LTBC 1YTZT 1LT9A 3MGNA 1W2EA 4KHXA 3VN0A 1JY2P 1LTTC 1VDFA 3BRVB 4WY4B 2QM8A 1IFMA 2YKQA 1FAVA 1GU5A 5AVXB 2E43A 2XZRA 2P7JA 4IFMA 1JY2O 1IFDA 4EIJA 1CW5A 2HLOA 5APTA 3B5ND 1URQA 1GK4A 1HUCA 1L4AC 5BVZA 3V2NA 1NOHA 1H89A 1N73B 4I2LC 4JF7A 1GL2C 3BATA 1ZLLA 2HODB 3LIEA 3RK2B 1OXZA 1SFCA 1G1JA 3II6A 3HE5A 3OAKA 3HD7D 4O9BA 5APSA 1FZCA 2WWWA 4JYCA 5CMZA 2OYIC 2I1KA 1FJPA 5APXA 3V4WA 1HVVA 2FKWB 1LWUA 2P67A 1SFCC 2HPCA 1MUUA 3PP5A 3BVHA 1G1IA 1T3UA 3A2AA 1CZQA 1QL1A 2Z4EA 2H43A 4WY4A 3B8EB 5AW7B 1JNMA 2NPSC 2FYUK 2JJLA 1X79B 2KLVA 2YO2A 1KQLA 4IFFA 2GUSA 1FOSE 2GM4A 1FJKA 1GW4A 2FYZA 2P1JA 3U1AA 1IFIA 1HH0A 2FXMA 3L4FA 3EFGA 4Y99C 1QL2A 3GHGB 5APUA 3H32B 1IFJA 3O8ZA 1N73A 3HUSC 2R5DA 2WITA 5BU5A 2JEEA 5CCGC 3NTNA 3M0AA 1L4AD 5AW2B 1FZAA 3P7KA 1RY3A 3V2PA 3VOPA 2WPQA 1GL2D 3M0DA 2KOGA 1H8AA 5AW1B 1RF1A 1SQQK 2N9BA 2KB7P 1T3JA 1SQXK 2R5BA 1JUNA 5AVTB 1PFIA 1KZUB 1NTMK 3RL0C 2IFMA 3LW5H 4DZOA 3M0DC 4N3YB 5AVZB 2XV5A 2N1TC 1L0LK 1NH4A 3CL3D 1XTGB 4ZKUA 1N7SC 1SFCD 5CCHA 3T97A 1J1DC 2CPBA 3VYIA 1SQPK 2BASA 1RE4A 4HH2A 1J1EB 1KILB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZ7 A;  4JF7 A;  3HD7 A;  1URQ D;  1GL2 C;  1GL2 B;  3RK2 C;  3RK2 B;  2NPS D;  1JTH B;  4W7Y A;  1SFC A;  3HD7 D;  3P8C E;  4W7Z A;  3B5N C;  3RK3 C;  1HVV A;  3B5N B;  3TSI A;  5CCG A;  1SFC C;  1SFC B;  3PP5 A;  1URQ C;  1URQ B;  2H8P D;  4WY4 A;  5CCG D;  5CCH C;  2NPS C;  2XDJ A;  2NPS B;  3HD7 C;  2HFE D;  2PP6 A;  3HD7 B;  2YMY A;  4WY4 D;  4W80 A;  5KJ7 A;  2N1T A;  1L4A A;  1N7S A;  3RL0 D;  1KIL A;  2HG5 D;  1GL2 A;  5KJ7 D;  2N1T D;  5CCG C;  3RK3 D;  1L4A D;  4N78 E;  1JTH A;  1N7S D;  3HTK B;  1KIL D;  3VOP A;  2M8R A;  1GL2 D;  4WY4 C;  2KOG A;  3RK2 D;  4WY4 B;  3B5N A;  1NHL A;  4OH8 B;  5CCH D;  1T3J A;  4LGD E;  3RL0 C;  3RL0 B;  3M0D C;  3B5N D;  1URQ A;  3KYQ A;  5KJ7 C;  2N1T C;  1L4A C;  1XTG B;  2N1T B;  3RK3 B;  1L4A B;  1N7S C;  1SFC D;  5CCH A;  2NPS A;  1KIL C;  1N7S B;  1KIL B; 
#chains in the Genus database with same CATH topology
 1PGJ A;  3CXH I;  3CXH E;  5APY A;  2KNC A;  1E5W A;  3WUT A;  4C7R A;  2Y0D A;  2WSE H;  2PFX A;  2WQY C;  3CWB G;  1Q82 Q;  3AE6 C;  3IFM A;  2OTJ P;  2Y9Z A;  3B5N B;  1VPC A;  3ABV C;  1LP1 A;  5KLI C;  3PRJ A;  1URQ C;  1DD3 A;  2XU6 A;  3H1K G;  1BGY G;  1NAF A;  3C9I A;  1GDT A;  1SQV D;  1Z56 A;  2E76 C;  1X0T A;  3AED C;  3NXS A;  4GOD A;  2PP6 A;  2E74 C;  4D6T E;  2AXC A;  3FWN A;  3KDP B;  5KAI H;  3IF4 A;  1JO5 A;  2R44 A;  1S72 P;  2C9N Y;  3VP8 A;  2HYN A;  1LWU C;  1N7S D;  1KD1 Q;  1BCC G;  5GTH E;  1NTK J;  2ZT9 D;  1JOC A;  2Q3E A;  2M8R A;  2K9Y A;  2MJZ A;  4H13 B;  1GU4 A;  3B5N A;  1EDK A;  3H1J J;  2WPR A;  1EDI A;  1OVV A;  2UWJ E;  4CPG A;  2O01 H;  1L4A B;  1IK7 A;  1PPJ D;  1NTK D;  2HR3 A;  3RK3 E;  1L0N J;  3LW5 J;  3V4Q A;  3H1J D;  3C1L A;  4UB6 H;  2IBZ I;  4N6J A;  4I6M C;  2IBZ E;  1SFC B;  1BE3 G;  5EFW B;  1Q90 D;  1Y8A A;  3Q2Y A;  4LC1 A;  1L0N D;  2NPS B;  2R3C A;  3D6Z A;  3M9B A;  2I1J A;  4WVZ A;  3G9R A;  3AE3 C;  4K3A A;  3H1I G;  1L4A A;  4C46 A;  1HBW A;  1VF5 B;  3B71 A;  3A0B H;  2Q6Q A;  3KXD A;  4U3F J;  1P84 H;  4EI2 A;  2FYU E;  3JCU E;  1JEK A;  3HRN A;  1RQV A;  1NHL A;  2E5T A;  1X9V A;  1JCC A;  1ZP0 C;  1ZRT E;  5AW8 B;  1RF1 B;  2C9L Y;  1SLQ A;  2N1T B;  1LNQ A;  1FZE A;  5AW9 B;  4MN4 C;  2NPS A;  1R5L A;  1USD A;  4U3F D;  1MV8 A;  3VMX A;  1HJB A;  4JPZ B;  3L75 J;  1NU1 K;  3FXE A;  3CCV P;  3CC2 P;  1U7J A;  3SSU A;  1VQ7 P;  1IO4 A;  2OTL P;  3L72 G;  1LT9 B;  2JDI H;  2KP8 A;  1N7L A;  1NU1 G;  4W7Z A;  3L70 J;  1S5L H;  3B5N C;  2ZFC A;  1S1C X;  2FBW C;  1OWA A;  2A06 G;  3F89 A;  3VP9 A;  2SPZ A;  2FXO A;  2GUV A;  1KTM A;  2M5A B;  3L75 D;  3CWB E;  2O3J A;  3OA7 A;  1ZW0 A;  1KC8 Q;  1SQV K;  1QGK B;  2RKL A;  3L70 D;  2H88 C;  2E75 D;  2N1T A;  2WSC H;  1SQV G;  1XTC C;  4DOJ A;  1VQ9 P;  1N86 A;  2HG5 D;  1GMJ A;  1WT6 A;  5AVU B;  3SWY A;  5K5G B;  1LTB C;  3VMA A;  1LJ2 A;  1LT9 A;  4H13 C;  1VQM P;  1LTT C;  1VDF A;  2WSS H;  5GTI H;  3KZI H;  3CCR P;  2YKQ A;  2XZR A;  2QSI A;  3F5H A;  4IOI H;  4IFM A;  1JY2 O;  5APT A;  1R5S A;  1OW8 A;  1HUC A;  2W8Z A;  2M5A A;  1L4A C;  2K9J B;  1RQU A;  2OQQ A;  1PV3 A;  2Y0E A;  4UB8 E;  2HOD B;  2E75 C;  2KSE A;  3H1K J;  1G1J A;  1KIL E;  1BGY J;  3II6 A;  3W68 A;  2IYO A;  2KXP B;  1OW7 A;  4A7P A;  1KQF B;  1PPJ G;  2LR2 A;  1HVV A;  2NRG A;  1SFC C;  1KYO H;  1MUU A;  1PGP A;  4L76 A;  1G1I A;  5B5E E;  1JNM A;  4ZNC A;  2NPS C;  2KLV A;  1NJI Q;  3H1K D;  1DD4 A;  2CK3 H;  1BGY D;  2YO2 A;  1KQL A;  2GUS A;  1BCC J;  1FOS E;  2RMZ A;  2GM4 A;  2FYZ A;  3SFD C;  1R8E A;  1IFI A;  1AJY A;  1WMK A;  2FXM A;  3EFG A;  3GHG B;  2V7Q J;  1SQP E;  1VF5 C;  1KB9 H;  1NYH A;  3CC4 P;  1EZV G;  3BCC D;  1GL2 D;  4PD4 I;  1BCC D;  4PD4 E;  3D70 A;  2KB7 P;  1JUN A;  2R5B A;  1KZU B;  1NTM K;  4IL6 H;  3CX5 D;  4DZO A;  2N1T C;  4YXW H;  4H0L B;  1NTM G;  5CCH A;  2QJY B;  1H0T B;  3VYI A;  1K04 A;  1FE6 A;  3WU2 E;  2KK7 A;  3CCE P;  1NO4 A;  1FDO A;  1BE3 J;  3L73 E;  2JKV A;  2WPS A;  3AEB C;  2ZJS E;  2ZYG A;  1S9K D;  4W7Y A;  3GW6 A;  3AEF C;  1LT9 C;  3GHG A;  4GDO A;  5C39 A;  1OVU A;  1G2C B;  1JY3 N;  1U57 A;  1NWQ A;  3H1L D;  5AVW B;  2O1K A;  2YXR B;  3L71 D;  3TDK A;  3H1I J;  3R2P A;  1M57 D;  1IC2 A;  1BE3 D;  1MFT A;  1NU1 E;  4OGQ B;  4C7N A;  4RES B;  1FBM A;  1N2D C;  2LXC B;  1LTI C;  5APQ A;  1H0T A;  1M90 Q;  2C0X A;  3L75 G;  1M1J B;  1FC2 C;  3H1I D;  5B66 E;  3RGU A;  2M3B A;  2A45 I;  3K5B A;  2D2C B;  3U59 A;  3VTP C;  2W27 A;  4OWF A;  4XE5 B;  1ZR2 A;  5CCH D;  3LID A;  4EOT A;  4JYB A;  2AXT E;  1GK6 A;  3L72 J;  1A02 J;  2N9Y B;  1NU1 J;  2WVR A;  1OZH A;  1QX8 A;  1GW3 A;  1URQ D;  2POH A;  3ZDM A;  2E76 D;  2QVA A;  2QEX P;  1VQ6 P;  2Q5U A;  2QM7 A;  1M1J A;  3CCQ P;  2M3E A;  2E74 D;  1UIX A;  3L35 A;  3CI9 A;  2OYI B;  2V4H A;  3CPW O;  4H44 B;  3L72 D;  5H2F H;  2YKP A;  3IR9 A;  1QEX A;  4BRY B;  4PJ0 H;  2A06 D;  1KQG B;  1SQV J;  1L2P A;  2B87 B;  5CCH C;  2WSE J;  1JCD A;  1PPJ E;  1NTK E;  1D7M A;  2A45 H;  3N4X A;  3S1K A;  2RH0 A;  1ZR4 A;  1T2K C;  3CC7 P;  3HE4 B;  3GHG C;  1HGZ A;  1SVF A;  4ASV A;  2Y9Y A;  3H1J E;  3M91 A;  1NGM B;  2E42 A;  3V5B A;  2KZI A;  5AW6 B;  3VMZ A;  2FYN B;  2ZYD A;  1SQX D;  2OYI A;  2Q7C A;  1L0N E;  2YKO A;  4BRY A;  3RL0 B;  3G3Z A;  5M1B A;  4H0L C;  2B87 A;  1YYC A;  3BCC G;  1HGV A;  2QJY C;  3RK3 B;  1NTZ K;  3PJS K;  1M7L A;  1PP9 J;  2WZ7 A;  3A0H E;  1NTZ G;  3CXH H;  3PLN A;  2QJP B;  3HE4 A;  1VQ8 P;  1CI6 B;  4I7Z B;  2O01 J;  3H1H G;  5CCG A;  3V6I A;  2K1A A;  2KIK A;  3D71 A;  1PP9 D;  4AUW A;  1VQO P;  3FX0 A;  2H8P D;  4RKU J;  1X8Y A;  3H1L G;  2BCC G;  3V2R A;  4U3F E;  4OGQ C;  4YPC A;  3Q5R A;  3L71 G;  5APV A;  2AEF A;  4L74 A;  3JSV C;  1SP4 A;  1OMI A;  1M1J C;  3HE5 B;  1GTW A;  1FZC B;  3TK1 A;  3WMM 0;  5CJ4 A;  1NKZ B;  2WPV B;  2D2C C;  2HPC B;  5GTH H;  2FXP A;  1CI6 A;  1NTM J;  3MGN A;  3RBZ A;  4XFJ A;  3BRV B;  4D6T D;  4WY4 B;  1EZV D;  3IN6 A;  3L75 E;  1FAV A;  1GU5 A;  3L74 D;  1EDJ A;  2HLO A;  3B5N D;  5E79 E;  3OW2 O;  3L70 E;  3TGU J;  3IAO A;  5BVZ A;  1NOH A;  2JP3 A;  2PGD A;  1H89 A;  4JF7 A;  2KS1 B;  1NTM D;  2J5U A;  1ZLL A;  2NZ2 A;  3LIE A;  4QMA A;  3RK2 B;  1OXZ A;  1SFC A;  3AEE C;  3HE5 A;  3OAK A;  4DT0 A;  1FZC A;  4JYC A;  2OYI C;  2I1K A;  1VQL P;  1FJP A;  5APX A;  3CD6 P;  4H44 C;  2FKW B;  2JO1 A;  1P84 D;  5TIS E;  1IFP A;  2HPC A;  1N8R Q;  3TGU D;  3PP5 A;  3BVH A;  1Q2N A;  1QL1 A;  2H43 A;  4WY4 A;  3B8E B;  2JJL A;  4WWI A;  4H13 D;  2IDB A;  1FJK A;  1GW4 A;  2O01 N;  3I55 P;  1OIP A;  3AEG C;  1PGQ A;  1NVO A;  3SFE C;  1YJ9 P;  3O8Z A;  2YMK A;  1JMB A;  2AEM A;  5CCG C;  3WUU A;  1L4A D;  1FDI A;  2FYN C;  3AE2 C;  3CMA P;  3CCU P;  3VOP A;  2WPQ A;  4GOF A;  2KOG A;  3JCU H;  1RF1 A;  1ZME C;  2QE7 H;  1T3J A;  1SQX K;  1PFI A;  3H1K E;  1BGY E;  3RL0 C;  3M0D C;  1L0L K;  1SQX G;  3CL3 D;  4ZKU A;  2OYO A;  3AE1 C;  1SFC D;  4R4L A;  5CMZ A;  1J1E B;  1KIL B;  1L0L G;  4PV1 B;  2OTK E;  4DJG A;  3OJA B;  2WSF H;  4BWN A;  2QJP C;  2NPS D;  1OW6 A;  4HYT B;  4I7Z C;  5AVQ B;  2PAJ A;  2ZXE B;  1BCC E;  3MUD A;  3E1I A;  2YO3 A;  1ZV8 A;  3CX5 I;  1LTJ B;  1BSH A;  3CX5 E;  1VF5 D;  2OYH B;  5KTB A;  2GA1 A;  4DCK A;  1YIT P;  2WT7 B;  1KFN A;  3MHV A;  2HFE D;  3HD7 B;  4GKG A;  1PP9 G;  5KLV D;  1VL2 A;  1S9K E;  1PZQ A;  1IFN A;  5KJ7 A;  2FFD B;  1FZC C;  1KIL A;  1LTG C;  3PHL A;  1T8Z A;  3H1L E;  2N1T D;  1AFO A;  1BDC A;  3BCC J;  3L71 E;  3P8C D;  3GF3 A;  4WY4 C;  2ZVO B;  1BE3 E;  2M0B A;  2K9J A;  1KYO D;  2XND H;  1NTZ J;  1LTJ A;  1FS0 E;  2HOD A;  2RN0 A;  5AW5 B;  2BEQ D;  1JB0 J;  2ZAE B;  2OYH A;  2Z5H A;  1DX7 A;  4D6T G;  3PTZ A;  1YHQ P;  2WT7 A;  3H1H J;  4WB4 A;  1LTS C;  3H1I E;  2Q1K A;  3HD7 A;  3L74 G;  2LKM A;  1HWT C;  4UB8 H;  3I56 P;  3RK2 C;  2FFD A;  5AVY B;  4ZKP A;  1RE3 A;  3AE8 C;  2W6B A;  1NTZ D;  3H1L J;  3W67 A;  1YI2 P;  2BCC J;  1RF1 C;  1HJ0 A;  1KB9 D;  1ZN5 A;  1HTL C;  3L71 J;  4N78 D;  3M9H A;  1JY3 P;  2IFN A;  4AQR D;  2ZVN B;  2YXQ B;  3Q5S A;  3H1H D;  2K88 A;  2ITA A;  2WMM A;  3L37 A;  2H89 C;  5B5E H;  3N7N A;  3TNU B;  3A3Y B;  2Y0C A;  3TGU G;  2BCC D;  3KPE A;  5KAF E;  2IPP A;  1IJD B;  4W80 A;  4HB1 A;  2IZ0 A;  3V2Q A;  3AE9 C;  2QJK B;  2ZYA A;  3L72 E;  3MUD C;  1EXJ A;  2J59 M;  4AYC A;  1JY2 N;  1ZOY C;  1SQQ D;  3O6Q B;  1J2J B;  2A06 E;  2IBZ G;  1VQK P;  2JWA A;  2Q9I A;  4PD4 H;  4OH8 B;  4XA4 A;  2KSJ A;  1YQ3 C;  2C0W A;  2R32 A;  5KJ7 C;  3Q5P A;  1IK9 A;  2FY8 A;  2L91 A;  1J1E C;  3TNU A;  1KIL C;  1H88 A;  1N7S B;  1G2C A;  5AVV B;  3WU2 H;  3MIW A;  2ZT9 B;  3BAS A;  1SQV E;  1YBK A;  2MKV A;  2XNX A;  3C8V A;  1DEB A;  2IX7 C;  3VMY A;  1T2K D;  1BSN A;  1LTJ C;  1RHZ B;  4M3L A;  5AW3 B;  3Q3D A;  5TJH A;  1E79 H;  2OYH C;  3CCM P;  1S3J A;  4WBA A;  4OVN F;  5APW A;  2XDJ A;  3HD7 C;  5KAI E;  2FFD C;  3L36 A;  1RE3 C;  3A7O A;  1N7S A;  1UII A;  2YNY A;  5KLV K;  1EQ7 A;  2W90 A;  3G4S P;  4H0L D;  1AVY A;  2O1J A;  3USS A;  5B66 H;  5KLV G;  1SQX J;  1YTZ T;  1PP9 E;  1W2E A;  4KHX A;  2QM8 A;  1L0L J;  2E43 A;  1SQB J;  2P7J A;  1JM0 A;  1MKM A;  2PRR A;  3E7K A;  2AXT H;  2DW3 A;  1IFD A;  4EIJ A;  2JWD A;  1GK4 A;  4JBZ A;  1KMI Z;  4TLF A;  1X22 A;  1KOR A;  2JR8 A;  1N73 B;  2QRX A;  1L0L D;  1RH5 B;  4OGQ D;  5APS A;  1SQB D;  2WWW A;  2W83 C;  4K35 A;  3AE5 C;  1EZV I;  3V4W A;  4UB6 E;  1EZV E;  1M1K Q;  1S2E A;  1OFC X;  1YJW P;  3L74 E;  1T3U A;  3CCS P;  1OVR A;  2D2C D;  3QH9 A;  1X79 B;  3T97 B;  3TF5 A;  1NTM E;  1Y9B A;  3EFF K;  2KLU A;  1HH0 A;  3L4F A;  1QL2 A;  1VQP P;  5APU A;  3H32 B;  1IFJ A;  3KHU A;  1N73 A;  2WIT A;  5BU5 A;  3A0B E;  2QJK C;  3CXH D;  2JEE A;  5AW2 B;  1P84 I;  1FZA A;  1P84 E;  3V2P A;  3TGU E;  4EDF A;  4D6T J;  4TT3 H;  4R4M A;  3M0D A;  1H8A A;  2IZ1 A;  1M56 D;  1SQQ K;  2N9B A;  3L74 J;  5DJT B;  4RJT A;  2E75 B;  3RBX A;  1HF9 A;  2IFM A;  3LW5 H;  1SQQ G;  4H44 D;  2XV5 A;  1VQ4 P;  1N7S C;  3T97 A;  2CPB A;  1SQP K;  2I8D A;  1RE4 A;  2ZT9 C;  1VQN P;  1AV1 A;  1LGH B;  3A0H H;  1SQP G;  3MD0 A;  1JTH B;  2W6A A;  3H32 A;  1DEE G;  1DIP A;  1LTA C;  1S5L E;  1IZN B;  4U7J A;  3TSI A;  3GLM A;  4NPF X;  5CCG D;  3CLQ A;  1K8A Q;  3M06 A;  3H6P A;  3E1R A;  1RF0 A;  2Q3I A;  5KKZ B;  1EDL A;  3L73 G;  1FU1 A;  3SWF A;  3RL0 D;  2P58 A;  1FOS F;  5AW0 B;  2VRS A;  3RK3 D;  5CHX A;  3CCL P;  1FDM A;  1JTH A;  1Q81 Q;  1GZL A;  3WUV A;  1KQS O;  2XKM A;  3MZW B;  5GTI E;  3KZI E;  2B89 A;  1MFZ A;  2IBZ D;  2KS1 A;  1PGO A;  3KYQ A;  5E79 H;  5KLV E;  5BU8 B;  3TYY A;  1N73 C;  2FYU J;  2P10 A;  2WSC J;  2BEZ F;  1VQ5 P;  1GL2 B;  5AVR B;  1USE A;  1NKN A;  1K9M Q;  3FXD A;  1SS1 A;  3KQG A;  1FZB A;  2KI7 B;  1CSB A;  3M9Q A;  3P8C E;  3B4S A;  2A45 G;  3RL0 g;  1PL5 A;  2E5Y A;  3RK3 C;  3S4R A;  1DH3 A;  1Q7Y Q;  2P2U A;  1KYO I;  1SQB K;  1KYO E;  1LT1 A;  2YIU B;  1KFM A;  3NFQ A;  5TIS H;  2R3S A;  3FWL A;  2WSF J;  5L8R J;  2FYU D;  3H25 A;  1SQB G;  3U1C A;  1JY3 O;  1QVF O;  1RE4 C;  3BCC E;  3Q1M A;  4ASW A;  1AVO A;  1K05 A;  5KLV J;  4JQ0 D;  2YMY A;  2OGU A;  4WY4 D;  3MP7 B;  1Y47 A;  1ZRT D;  3AEC C;  2J58 A;  1PIX A;  3EQ2 A;  1A02 F;  1W5C E;  4YTP C;  1NTZ E;  1FZF A;  2QIW A;  3P8M C;  4Y99 B;  1KB9 I;  4IFD K;  1KB9 E;  3HUS B;  4HKZ H;  3GF7 A;  2H7H A;  3CME P;  1GL2 A;  1EXI A;  4N78 E;  3G6E P;  3HTK B;  3CWB J;  3I5C A;  2KYV A;  3D6Y A;  3H1H E;  5AVS B;  2WTY A;  1AQ5 A;  3MTU E;  2W6J H;  3RK2 D;  3SWK A;  1NTK K;  2G3A A;  4LGD E;  5CBN A;  1RF0 C;  1S5L X;  1YTZ I;  4IL6 E;  3NMD A;  3JC2 2;  2BCC E;  1NTK G;  1WRG A;  1M8O B;  4GIF A;  3P32 A;  3CWB D;  1J1D B;  2AEJ A;  1U7M A;  1GD2 E;  3AEA C;  5CJ0 A;  4YXD C;  2CPS A;  1YIJ P;  3AE7 C;  3H1J G;  4I1L A;  2IYP A;  1SQQ E;  1YJN P;  3HUS A;  3ITK A;  1JMM A;  1L0N K;  4HJG H;  4GOE A;  3HTK A;  3GMA A;  5AW4 B;  4GT1 A;  2QA4 P;  5KLI B;  3CX5 H;  1L0N G;  1TU3 F;  3BRT B;  4LLH A;  1MZ9 A;  1URQ B;  2V7Q H;  1FZG A;  4NPE A;  1EC5 A;  2E76 B;  3A5T A;  5KKZ C;  2QG4 A;  2E74 B;  2L5G B;  1AA0 A;  3GG2 A;  3UIA A;  2K3R A;  4EYY Q;  5KJ7 D;  4C7N B;  1SQQ J;  2OAR A;  2Z5I A;  1OX3 A;  4B86 A;  1LWU B;  1ZXG A;  1KIL D;  4PV1 D;  4Z1M H;  3FGA D;  4NPD A;  3VN0 A;  1JY2 P;  1IFM A;  2B88 A;  3EWK A;  5AVX B;  3R4Y A;  4RO0 A;  1SQP J;  1CW5 A;  4KT0 J;  4U3F G;  1URQ A;  5CBO A;  1YQ4 C;  2G8Y A;  1QLE D;  3V2N A;  1K73 Q;  4I2L C;  4L75 A;  1GL2 C;  3BAT A;  2KUB A;  3HD7 D;  4O9B A;  1SQP D;  3CCJ P;  5H2F E;  2YIU C;  1LWU A;  2P67 A;  4PV1 C;  4PJ0 E;  3L73 J;  1S4X A;  3A2A A;  1CZQ A;  2Z4E A;  2KZJ A;  4PD4 D;  1Q86 Q;  5AW7 B;  2FYU K;  4ZMD A;  3L70 G;  1NAY A;  1SQX E;  2K37 A;  4L73 A;  4IFF A;  2ZXX A;  3QWO C;  2P1J A;  2FYU G;  1KN7 A;  3U1A A;  2KNC B;  5KAF H;  2LXB A;  4IL6 X;  1L0L E;  4Y99 C;  3O6Q A;  5DJU B;  1SQB E;  1BDD A;  1KV4 A;  3HUS C;  4BXL A;  2R5D A;  3L73 D;  3AE4 C;  3NTN A;  3M0A A;  1W2B O;  3P7K A;  1T6A A;  1RY3 A;  1LP1 B;  1QVG O;  4Y28 J;  5AW1 B;  3PH0 A;  5AVT B;  1AQT A;  4KJM A;  2B9B A;  4N3Y B;  5AVZ B;  1NH4 A;  1XTG B;  3S9O A;  1J1D C;  3G71 P;  2BAS A;  1NU1 D;  4HH2 A; 
#chains in the Genus database with same CATH homology
 1NO4 A;  1LGH B;  3OJA B;  2WSF H;  5APY A;  2WPS A;  1S9K D;  2NPS D;  3MD0 A;  1JTH B;  4W7Y A;  1E5W A;  4C7R A;  4HYT B;  1LT9 C;  3GHG A;  2W6A A;  3H32 A;  2WSE H;  1G2C B;  1LTA C;  5AVQ B;  1JY3 N;  2PAJ A;  2ZXE B;  1NWQ A;  3IFM A;  5AVW B;  3B5N B;  2O1K A;  3TSI A;  1VPC A;  3MUD A;  3E1I A;  2YO3 A;  1ZV8 A;  1LTJ B;  3R2P A;  1URQ C;  2XU6 A;  2OYH B;  5CCG D;  1NAF A;  3C9I A;  1IC2 A;  3CLQ A;  1GDT A;  5KTB A;  1Z56 A;  3M06 A;  2WT7 B;  1KFN A;  3H6P A;  3NXS A;  2HFE D;  2PP6 A;  1RF0 A;  3HD7 B;  2Q3I A;  4GKG A;  4C7N A;  4RES B;  3KDP B;  1FBM A;  1N2D C;  1S9K E;  1IFN A;  1LTI C;  5KJ7 A;  2FFD B;  1JO5 A;  5APQ A;  1FU1 A;  1FZC C;  2C0X A;  3SWF A;  1M1J B;  3RL0 D;  1KIL A;  2C9N Y;  1LTG C;  3VP8 A;  2HYN A;  1FOS F;  5AW0 B;  1T8Z A;  2VRS A;  2N1T D;  1AFO A;  1LWU C;  5CHX A;  3RK3 D;  2M3B A;  2A45 I;  1JTH A;  1FDM A;  1N7S D;  1GZL A;  3U59 A;  1JOC A;  3P8C D;  3VTP C;  2M8R A;  2MJZ A;  2W27 A;  2XKM A;  4WY4 C;  1GU4 A;  3B5N A;  4XE5 B;  1ZR2 A;  5CCH D;  3LID A;  1MFZ A;  4EOT A;  4JYB A;  1LTJ A;  2WPR A;  1GK6 A;  2HOD A;  5AW5 B;  2OYH A;  3KYQ A;  1A02 J;  2Z5H A;  1DX7 A;  2O01 H;  5BU8 B;  1L4A B;  2WT7 A;  3TYY A;  1N73 C;  4WB4 A;  1LTS C;  3HD7 A;  1GW3 A;  1URQ D;  2LKM A;  1HWT C;  1GL2 B;  5AVR B;  2POH A;  3RK2 C;  1NKN A;  2FFD A;  5AVY B;  4ZKP A;  3KQG A;  1FZB A;  2Q5U A;  1RE3 A;  2QM7 A;  2W6B A;  3V4Q A;  1M1J A;  1CSB A;  3M9Q A;  3P8C E;  3L35 A;  1RF1 C;  2A45 G;  1ZN5 A;  3CI9 A;  3RK3 C;  1HTL C;  2OYI B;  1DH3 A;  2P2U A;  1SQB K;  4N78 D;  2YKP A;  4N6J A;  4I6M C;  1KFM A;  3IR9 A;  3NFQ A;  3M9H A;  1JY3 P;  1SFC B;  2IFN A;  4AQR D;  3L37 A;  5CCH C;  3U1C A;  1JY3 O;  1RE4 C;  3N7N A;  2NPS B;  4LC1 A;  3TNU B;  2R3C A;  1JCD A;  3A3Y B;  2A45 H;  3N4X A;  3M9B A;  2I1J A;  2YMY A;  4WY4 D;  3KPE A;  2IPP A;  1IJD B;  4W80 A;  1ZR4 A;  1T2K C;  2J58 A;  1L4A A;  3EQ2 A;  3HE4 B;  3GHG C;  4C46 A;  1A02 F;  1HGZ A;  1SVF A;  1FZF A;  3P8M C;  4Y99 B;  1HBW A;  4IFD K;  3HUS B;  3V2Q A;  2H7H A;  1GL2 A;  3M91 A;  2E42 A;  4N78 E;  3V5B A;  2J59 M;  4AYC A;  1JY2 N;  3HTK B;  3I5C A;  5AW6 B;  3VMZ A;  2KYV A;  1J2J B;  5AVS B;  2WTY A;  1AQ5 A;  3MTU E;  2OYI A;  3HRN A;  3RK2 D;  2Q9I A;  1NHL A;  4OH8 B;  1NTK K;  2Q7C A;  1X9V A;  4XA4 A;  4LGD E;  1RF0 C;  2YKO A;  1YTZ I;  2KSJ A;  1JCC A;  3RL0 B;  3G3Z A;  3NMD A;  2C0W A;  2R32 A;  1YYC A;  5KJ7 C;  1WRG A;  5AW8 B;  1RF1 B;  2C9L Y;  1IK9 A;  1HGV A;  1SLQ A;  2N1T B;  3RK3 B;  1FZE A;  1NTZ K;  4GIF A;  5AW9 B;  1J1E C;  2NPS A;  3TNU A;  1KIL C;  1H88 A;  1M7L A;  1N7S B;  3P32 A;  1G2C A;  1J1D B;  5AVV B;  1MV8 A;  2WZ7 A;  1GD2 E;  3MIW A;  5CJ0 A;  3BAS A;  3VMX A;  2CPS A;  1HJB A;  1NU1 K;  4I1L A;  3HE4 A;  2XNX A;  1IO4 A;  1DEB A;  1CI6 B;  1LT9 B;  2KP8 A;  1N7L A;  4W7Z A;  3HUS A;  3B5N C;  2ZFC A;  2IX7 C;  1JMM A;  1L0N K;  1OWA A;  3VMY A;  1T2K D;  5CCG A;  3HTK A;  1LTJ C;  3VP9 A;  4M3L A;  5AW3 B;  5AW4 B;  4GT1 A;  2OYH C;  4AUW A;  4LLH A;  2GUV A;  3BRT B;  4WBA A;  1MZ9 A;  1URQ B;  1FZG A;  2H8P D;  5APW A;  1X8Y A;  2XDJ A;  3V2R A;  3A5T A;  3HD7 C;  3OA7 A;  1SQV K;  5APV A;  2L5G B;  1SP4 A;  2FFD C;  3L36 A;  2N1T A;  2WSC H;  1RE3 C;  1M1J C;  3A7O A;  1N7S A;  3HE5 B;  1XTC C;  4DOJ A;  2YNY A;  1GTW A;  5KLV K;  1EQ7 A;  1FZC B;  3UIA A;  3TK1 A;  1N86 A;  2HG5 D;  5KJ7 D;  2O1J A;  4C7N B;  1WT6 A;  3WMM 0;  2OAR A;  2Z5I A;  5CJ4 A;  1NKZ B;  4B86 A;  1LWU B;  2HPC B;  1KIL D;  5AVU B;  3SWY A;  1CI6 A;  1LTB C;  1YTZ T;  1LT9 A;  3MGN A;  1W2E A;  4KHX A;  3VN0 A;  1JY2 P;  1LTT C;  1VDF A;  3BRV B;  4WY4 B;  2QM8 A;  1IFM A;  2YKQ A;  1FAV A;  1GU5 A;  5AVX B;  2E43 A;  2XZR A;  2P7J A;  4IFM A;  1JY2 O;  1IFD A;  4EIJ A;  1CW5 A;  2HLO A;  5APT A;  3B5N D;  1URQ A;  1GK4 A;  1HUC A;  1L4A C;  5BVZ A;  3V2N A;  1NOH A;  1H89 A;  1N73 B;  4I2L C;  4JF7 A;  1GL2 C;  3BAT A;  1ZLL A;  2HOD B;  3LIE A;  3RK2 B;  1OXZ A;  1SFC A;  1G1J A;  3II6 A;  3HE5 A;  3OAK A;  3HD7 D;  4O9B A;  5APS A;  1FZC A;  2WWW A;  4JYC A;  5CMZ A;  2OYI C;  2I1K A;  1FJP A;  5APX A;  3V4W A;  1HVV A;  2FKW B;  1LWU A;  2P67 A;  1SFC C;  2HPC A;  1MUU A;  3PP5 A;  3BVH A;  1G1I A;  1T3U A;  3A2A A;  1CZQ A;  1QL1 A;  2Z4E A;  2H43 A;  4WY4 A;  3B8E B;  5AW7 B;  1JNM A;  2NPS C;  2FYU K;  2JJL A;  1X79 B;  2KLV A;  2YO2 A;  1KQL A;  4IFF A;  2GUS A;  1FOS E;  2GM4 A;  1FJK A;  1GW4 A;  2FYZ A;  2P1J A;  3U1A A;  1IFI A;  1HH0 A;  2FXM A;  3L4F A;  3EFG A;  4Y99 C;  1QL2 A;  3GHG B;  5APU A;  3H32 B;  1IFJ A;  3O8Z A;  1N73 A;  3HUS C;  2R5D A;  2WIT A;  5BU5 A;  2JEE A;  5CCG C;  3NTN A;  3M0A A;  1L4A D;  5AW2 B;  1FZA A;  3P7K A;  1RY3 A;  3V2P A;  3VOP A;  2WPQ A;  1GL2 D;  3M0D A;  2KOG A;  1H8A A;  5AW1 B;  1RF1 A;  1SQQ K;  2N9B A;  2KB7 P;  1T3J A;  1SQX K;  2R5B A;  1JUN A;  5AVT B;  1PFI A;  1KZU B;  1NTM K;  3RL0 C;  2IFM A;  3LW5 H;  4DZO A;  3M0D C;  4N3Y B;  5AVZ B;  2XV5 A;  2N1T C;  1L0L K;  1NH4 A;  3CL3 D;  1XTG B;  4ZKU A;  1N7S C;  1SFC D;  5CCH A;  3T97 A;  1J1D C;  2CPB A;  3VYI A;  1SQP K;  2BAS A;  1RE4 A;  4HH2 A;  1J1E B;  1KIL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...