4WY4C

Crystal structure of autophagic snare complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
78
structure length
78
Chain Sequence
b'ADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 8
publication title ATG14 promotes membrane tethering and fusion of autophagosomes to endolysosomes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 38
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2014-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wy4C00
3B5NC 3B5NA 5CCHC 2HFED 4WY4C 1GL2B 5KJ7D 1L4AB 2N1TB 1URQD 1KILA 3B5NB 5KJ7C 4WY4B 1URQC 2KOGA 1GL2A 5CCGD 3RK3D 3HD7D 1L4AA 2N1TA 1HVVA 3RK3C 2HG5D 1URQB 5CCHA 2NPSD 4WY4A 2H8PD 4W7YA 2NPSC 2NPSA 3TSIA 3RK3B 5KJ7A 1N7SD 4JF7A 2PP6A 1URQA 4W80A 2NPSB 1N7SC 1N7SA 5CCGC 1JTHB 5CCGA 3HD7C 3HD7A 1XTGB 1SFCD 1N7SB 3RK2D 3HTKB 1SFCC 3RK2C 3HD7B 3PP5A 3P8CE 2YMYA 1JTHA 1NHLA 3VOPA 2WZ7A 3RL0D 1SFCB 3M0DC 3RK2B 1T3JA 4W7ZA 1KILD 3RL0C 2XDJA 1KILC 3KYQA 4LGDE 1GL2D 2M8RA 4N78E 1SFCA 4OH8B 1L4AD 3RL0B 2N1TD 1GL2C 3B5ND 1KILB 5CCHD 1L4AC 4WY4D 2N1TC
chains in the Genus database with same CATH superfamily
1J1DB 2W6AA 4PV1C 1EXJA 3L75J 1L4AB 1KQFB 1EDKA 1PGOA 3H1IG 5APVA 4H13D 2YXRB 2R32A 3LW5H 2KK7A 3CMAP 1KYOI 2N1TA 1KQGB 2E43A 4AUWA 5BU5A 1ZOYC 2WITA 2GM4A 3L4FA 2JJLA 2FKWB 5AW9B 1MV8A 2NPSC 3AE7C 1X0TA 1LT1A 4YXDC 1RF0C 2ZFCA 1H0TB 2C9LY 4C7RA 5AW6B 1VQOP 1HGZA 3IF4A 3ITKA 1KTMA 2Y0CA 2FBWC 5AW0B 5AW2B 5AW3B 3AEDC 2C0XA 3CC7P 1SQBJ 1M90Q 1JY3N 3OJAB 4YPCA 2I1KA 3V4WA 2OGUA 1JY3P 1L0NJ 2I1JA 3EWKA 1RF1B 3BRVB 5M1BA 1FZCB 4C7NA 3H1JG 3FXEA 3O6QA 3HE5B 3CC4P 3LIDA 2W6JH 3BATA 1N2DC 2BEZF 3V6IA 1GL2A 2ZYDA 5CCGD 1JCDA 3V4QA 1X9VA 1FOSF 1DH3A 2M0BA 4JQ0D 2A06D 2ITAA 1QEXA 2KLVA 3AEFC 2OTLP 4H44D 2WSCH 1NH4A 4IFFA 3D71A 3RK3B 3JCUE 2UWJE 3SSUA 4TT3H 1XTCC 2PGDA 3TYYA 2O1KA 2IZ0A 5B5EE 3AE1C 4YXWH 3HTKB 2QEXP 4IL6X 2KNCB 3D70A 2XU6A 3PH0A 4LLHA 3P8MC 3BCCD 3NFQA 1ZV8A 1Q82Q 3H1LE 1ZXGA 4CPGA 2B87A 1LT9B 3JCUH 3HUSC 1L2PA 3TGUJ 3CXHI 4PD4E 3RL0B 4XA4A 1GDTA 5B5EH 1KILB 3E1RA 5KAFE 3PTZA 2E75C 3A3YB 2O1JA 4HB1A 1AVYA 5CMZA 1KFNA 3AE2C 3H1HJ 1FZBA 2ZAEB 2E76D 3V5BA 3B4SA 1AA0A 3KZIE 2K3RA 2Q1KA 4GKGA 2OYHC 1Q86Q 4N3YB 1R5LA 3H1IJ 4PD4H 1T2KD 3L70E 4W7YA 2NPSA 2ZT9D 5KAFH 2FYUE 2A06G 2AEMA 1LP1A 1J1EC 1AVOA 3AEBC 4H13C 5KLIB 3RK3E 3JC22 2WT7B 2VRSA 1XTGB 2WWWA 1GZLA 1EZVI 2YMKA 1LTJC 3KZIH 4UB6E 3CCJP 3D6YA 3SWFA 4I6MC 1KQSO 1S4XA 2P1JA 3Q1MA 1JB0J 1OZHA 1KD1Q 4XFJA 3L70D 3CCRP 1M1JC 3M0AA 1SQVJ 1EDIA 1T6AA 2GUVA 3BCCG 1VQ8P 1S5LX 4EIJA 4PV1D 1K73Q 5H2FE 5AVQB 4JYBA 2WSEJ 1IFIA 4U7JA 1KB9I 4EOTA 4UB6H 3E1IA 4RJTA 1FZAA 3H1JJ 5C39A 2IZ1A 2E74B 1CI6B 2PFXA 1WMKA 4HKZH 3L35A 2NPSD 3QWOC 4WY4A 1NU1J 1OXZA 2Z5HA 3OAKA 5H2FH 5KJ7A 2D2CC 1IJDB 4JF7A 4NPFX 2JEEA 2QJKB 4JYCA 3VMZA 5CCGC 2HYNA 3ZDMA 2YXQB 3PLNA 5APYA 1PPJE 1GU5A 3Q3DA 1YJNP 3OW2O 3L72E 1YTZI 3S9OA 4DT0A 1SFCC 4H44C 5KKZC 4BWNA 3HD7B 2JP3A 5DJUB 2ZVNB 4D6TE 3C8VA 3M0DC 1BCCE 2BCCE 5L8RJ 1G2CA 2JWAA 4O9BA 1OVUA 2H89C 2L5GB 1BE3E 2HLOA 3N4XA 4B86A 1SLQA 3IR9A 3HUSA 2FYNB 3L70G 1J1DC 2PRRA 1DEEG 2QE7H 5BVZA 2JO1A 1L4AC 5AW1B 1SQPE 1M57D 1PPJD 2R5DA 5CCHC 3L72D 3M9BA 1H88A 3H6PA 3C9IA 2WSSH 3A5TA 2Q7CA 1BDCA 3Q5PA 5APWA 1LWUB 1BCCD 2JWDA 4GIFA 2P67A 2OYHA 1HJ0A 1URQB 2FY8A 3GHGC 2POHA 3CCLP 4Y28J 5DJTB 2KZJA 1E79H 1VDFA 1SQPD 1PP9D 4ASVA 2LXCB 1VF5B 2Z4EA 1AQTA 2IYPA 3MIWA 1CZQA 3H32A 3AEAC 1WT6A 1X79B 3T97A 4H0LB 1LTJA 3FGAD 1LNQA 2WSCJ 1T2KC 1Q2NA 1T3UA 3PP5A 3GG2A 1W5CE 3GW6A 3L73D 3L36A 1GK4A 1SQXD 1FOSE 2E74D 3CI9A 5CBOA 5AVVB 2KZIA 1RF1C 1E5WA 3EQ2A 3TF5A 1M1JA 2SPZA 1KN7A 1FDMA 1FZCC 1SQVD 3CCUP 3M9QA 4I1LA 4BRYA 2E75D 1EXIA 2ZYGA 5APXA 1LTGC 3BCCJ 3HRNA 1CSBA 3M91A 1HWTC 2Q9IA 3HE4B 2OYIA 2N1TB 1EC5A 3CCSP 1PPJG 2QRXA 5CHXA 3L74E 3L71E 4I7ZB 3FXDA 1NVOA 3L72G 4AYCA 3CD6P 2P2UA 3HD7D 1SQPK 3RK3C 3GF7A 1NYHA 3GMAA 1JMBA 1P84I 1DD3A 1BCCG 1NU1D 1SVFA 3PJSK 1M56D 2N9YB 2K88A 1Y9BA 4GOFA 3AEGC 5KLVE 3U1CA 3G9RA 2IFNA 3I56P 1YI2P 1SQXK 1SQPG 4L73A 5CCGA 1M8OB 1PP9G 2GA1A 2KS1B 1U7MA 1T8ZA 1SQVK 3N7NA 3AE6C 2P10A 3V2NA 2YO2A 1JM0A 1LT9C 2O01H 3ABVC 3VOPA 1A02J 3CMEP 1JY2O 3RK2B 3RL0C 3Q5SA 3L73G 2E5YA 1RQVA 1FAVA 1SQXG 1KILC 1HBWA 3WU2E 3O6QB 1FS0E 3MUDC 1GTWA 5AW4B 2LXBA 1SQVG 2B9BA 4GODA 1VQMP 1N8RQ 4Z1MH 1VF5D 3CL3D 4GOEA 1GL2B 3L70J 5KTBA 3CCEP 1NO4A 4EYYQ 3B5NB 1RE4C 1NU1K 4H0LD 2Y9ZA 2LKMA 1UIIA 1PV3A 1Z56A 1H89A 3CCVP 1N73A 3IFMA 2HODB 1NTME 1S3JA 3AE5C 3WU2H 1NTKE 1EDJA 3GHGA 1FC2C 1HGVA 1FDOA 2V7QH 2D2CD 1H0TA 1K9MQ 2CPSA 5KLIC 2H7HA 1QLED 1NU1G 2H88C 3SFEC 2HR3A 1S9KE 1OMIA 3CCQP 4RESB 1SFCD 3P32A 3GF3A 3W68A 3BVHA 2YMYA 1GK6A 3VP9A 3L37A 3R2PA 2M5AA 1NTMD 2IPPA 1RF1A 3RGUA 2W90A 1FZCA 2RN0A 1S2EA 1OW8A 2KLUA 3II6A 4N78E 1L4AD 1S9KD 5CCHD 4U3FE 3HE5A 1VQ4P 1AFOA 2QJPB 3F89A 4KT0J 1H8AA 2W6BA 4K3AA 3CC2P 2E74C 2KXPB 2K9JB 1QX8A 1U7JA 3L75E 1K8AQ 2ZYAA 3TDKA 2OARA 4GDOA 1N86A 4OGQB 1IZNB 3JSVC 1IFDA 1G1JA 1DIPA 3G4SP 1NOHA 1VQ6P 1LP1B 3G3ZA 1SS1A 4IL6E 3UIAA 3L72J 2WMMA 4HJGH 4N78D 1VQNP 4GT1A 4R4MA 1W2EA 1MUUA 1OWAA 2QJKC 3V2RA 2R5BA 1VQ5P 3B8EB 3I5CA 1BCCJ 2BCCJ 4ZNCA 3H1LD 1JNMA 2KNCA 1NTMK 3HD7C 4DOJA 3G6EP 1GMJA 1AV1A 4PD4D 2XNXA 2OTJP 1JTHA 1SQPJ 1PP9J 1RF0A 4IL6H 3MTUE 1LT9A 4PD4I 4I2LC 2E42A 2FYNC 4C46A 1YJWP 1RH5B 1RY3A 1NTMG 2OYOA 4YTPC 5APSA 1UIXA 1WRGA 3MUDA 1OVRA 2XKMA 1FZGA 2QM8A 1FZFA 3VMYA 3L73J 1NJIQ 1SQXJ 1HUCA 4ZMDA 4JBZA 1LWUC 2FYUD 3VN0A 2YNYA 4WY4B 1GU4A 1URQC 2O01N 2KSJA 3RK3D 1IO4A 1FBMA 1LGHB 2CPBA 2MKVA 3H1KE 3CX5E 1X22A 1JY2N 2XZRA 1KILE 1VF5C 1VL2A 2FFDB 4ZKUA 3PRJA 3VYIA 3GLMA 2AEFA 4RO0A 3A7OA 4UB8E 2B88A 4H0LC 4DCKA 1Q90D 1JMMA 5E79E 3W67A 4TLFA 2J58A 1N7SB 1S5LE 4WBAA 3H1LG 1K04A 4DJGA 2DW3A 3VTPC 1GD2E 2ZXXA 3CX5H 2FXOA 1NHLA 3H1KD 3RL0D 4OGQD 3CX5D 3MHVA 5CJ0A 3LW5J 1KILD 2XDJA 1NTZE 2WVRA 3L71J 4UB8H 1EQ7A 2IX7C 2FYUK 5E79H 1JCCA 1LTIC 1NGMB 3EFGA 2N1TC 2IBZE 3Q2YA 1S5LH 2O01J 4I7ZC 1FJKA 2Z5IA 1CI6A 3CPWO 1MFTA 5KLVJ 2FYUG 5CBNA 1L0LE 1A02F 4DZOA 2NZ2A 2WSFH 1NTZD 2W83C 4WB4A 3CWBE 2JR8A 1Y47A 5AVSB 4L75A 4D6TD 3T97B 4W80A 2IBZD 2BCCD 3G71P 1IK9A 1BE3D 3HD7A 3TK1A 1BGYE 1YQ4C 3U59A 1PFIA 3EFFK 3CLQA 3RK2C 2V7QJ 3AEEC 2V4HA 1BDDA 1TU3F 1L0LD 4BRYB 2B89A 2IDBA 3CWBD 1NWQA 2A45H 1AQ5A 2L91A 1NAFA 2KI7B 4OVNF 3P7KA 2BASA 1GL2C 2C0WA 2OYIB 1FZEA 1NTMJ 5AVRB 3B5NC 1NTKJ 1BGYD 2Q3EA 4R4LA 2HFED 3TNUA 2Q3IA 2AXTE 1LWUA 5EFWB 1NTZK 4N6JA 1QL2A 5BU8B 3SFDC 1RQUA 3A0HE 2KYVA 5B66E 4BXLA 2QSIA 5AVWB 1HVVA 1HTLC 5AVZB 1LTSC 3BRTB 1ZW0A 2C9NY 2HPCA 5AW8B 3M9HA 4IFDK 1KYOE 1NTZG 2AXTH 1SQQE 1QVGO 1Q81Q 4D6TG 2M3EA 1L0LK 2PAJA 2IBZG 4NPDA 1YYCA 3IN6A 2BCCG 3A0HH 2J59M 1ZLLA 5B66H 1AJYA 1BE3G 1YTZT 3P8CE 4QMAA 4U3FJ 2ZVOB 1VPCA 1IFPA 2QIWA 1IFJA 1FJPA 3H1LJ 4WVZA 2Y0EA 1KYOH 1ZR2A 1USEA 1L0LG 3L74D 1KYOD 3L71D 4RKUJ 1FDIA 2QJPC 1SFCA 3CWBG 3C1LA 1DD4A 2Y9YA 1SQQD 1M7LA 2A45G 3HE4A 5APTA 2RKLA 3M0DA 3VMXA 2JKVA 4PJ0E 4OGQC 2XNDH 1ZP0C 4C7NB 1N73B 1DX7A 1URQD 1BGYG 3P8CD 1N7LA 3VMAA 3GHGB 4Y99B 1VQ7P 2KOGA 3USSA 1QGKB 5KLVD 3MZWB 1L4AA 2KB7P 2QJYB 3B71A 1KV4A 2HG5D 2YIUB 5CCHA 2E76B 2I8DA 1DEBA 3D6ZA 3M06A 2FYUJ 1G1IA 5AW7B 2M3BA 4PJ0H 1IFNA 3NXSA 4HH2A 2KS1A 2ZJSE 2ZT9B 4NPEA 5GTHE 1BSNA 2A06E 2M5AB 2WTYA 4L76A 1SQQK 4LC1A 1Q7YQ 3RBZA 2AEJA 1YIJP 3NTNA 4AQRD 1LTTC 1SP4A 4LGDE 3QH9A 4OH8B 2B87B 1LTAC 2N1TD 1OX3A 3OA7A 3L74G 5GTHH 3L71G 3K5BA 2GUSA 3H1KJ 1NTKD 3B5NA 1YHQP 5KLVK 1PGPA 3BCCE 4WY4C 3CXHE 1SQQG 2G3AA 2QA4P 2QM7A 5KJ7C 1EDLA 4PV1B 1NAYA 2HODA 3U1AA 3IAOA 2W27A 5APQA 2FFDC 1KFMA 5KLVG 3O8ZA 3LIEA 4EDFA 1Y8AA 3AECC 1LTBC 3PHLA 3CXHH 1KZUB 2NPSB 1N7SC 5AVUB 3KQGA 1MKMA 3CXHD 3SWKA 1JTHB 3S1KA 1LJ2A 1NTZJ 3KDPB 3RK2D 4KJMA 2WSFJ 5KAIE 2YKOA 4D6TJ 3FX0A 1VQLP 4U3FD 5GTIE 2WZ7A 3KHUA 3HTKA 1EZVE 1T3JA 1R5SA 4W7ZA 1GW3A 1BE3J 3AE4C 1HH0A 1NKNA 3L75D 4L74A 1NTKK 1GL2D 4IFMA 2RH0A 3B5ND 1SQBE 2K9JA 1JOCA 1L0LJ 1VQKP 3Q5RA 2OQQA 2K1AA 5KAIH 2WQYC 3CWBJ 3V2QA 1L0NE 1YITP 1NTKG 1KILA 5GTIH 2QVAA 2WPVB 2Y0DA 3AE3C 1QL1A 1VQPP 4EI2A 1W2BO 1KB9E 1EZVD 1PZQA 1YBKA 1FU1A 3AE9C 1BGYJ 3V2PA 2H8PD 1IFMA 1RE4A 1SQBD 4ASWA 2G8YA 2K9YA 3F5HA 1L0ND 3FWNA 1FE6A 1KB9H 1NKZB 4A7PA 5CJ4A 4M3LA 1KB9D 2KSEA 2Q6QA 2WT7A 5AVTB 3RL0g 1BSHA 3MP7B 1JY2P 2KIKA 2H43A 2LR2A 3AE8C 3FWLA 4ZKPA 4U3FG 2OYIC 5APUA 3KYQA 1G2CB 3L75G 4MN4C 2CK3H 1K05A 2K37A 2R3CA 2AXCA 1RHZB 1JEKA 1RE3C 1QVFO 3HUSB 1OW6A 1VQ9P 1OIPA 2RMZA 2FXMA 2W8ZA 2O3JA 2N9BA 3L74J 2E75B 3CX5I 1JY3O 3TGUE 3WUVA 2NRGA 3A2AA 1HJBA 2BEQD 1SQQJ 1SQBK 2P58A 3R4YA 2FFDA 2FXPA 2P7JA 1EZVG 3I55P 3RBXA 1KQLA 1L0NK 3TSIA 2OYHB 2YKPA 1USDA 3H1HE 1S1CX 2IFMA 1N7SA 2J5UA 2QG4A 1SQBG 2WPQA 1J1EB 1IC2A 3H1IE 4H13B 1PL5A 5AVYB 3TGUD 4JPZB 4HYTB 3H32B 1L0NG 5AW5B 2WPRA 2R3SA 1PP9E 3A0BE 1LTJB 3KXDA 5TISE 1MZ9A 3E7KA 3NMDA 1YJ9P 1OW7A 1M1KQ 2IBZI 3H1HD 1IK7A 1KORA 2M8RA 3TNUB 2WPSA 1M1JB 4IOIH 1ZN5A 1D7MA 3VP8A 3WMM0 1OVVA 2OTKE 2R44A 3L73E 4WY4D 5AVXB 1N73C 1SQXE 2KP8A 1U57A 3H1ID 4Y99C 2E5TA 1JUNA 5KJ7D 4OWFA 3H1KG 3CCMP 1SQVE 2YKQA 3MGNA 3A0BH 2QJYC 5TISH 2YIUC 3H25A 2IYOA 1PIXA 2E76C 2HPCB 2A45I 1ZMEC 3BASA 1JO5A 5TJHA 2ZXEB 1OFCX 2KUBA 1ZRTE 1N7SD 3H1JE 2PP6A 2ZT9C 1KC8Q 1URQA 2MJZA 2FYZA 1HF9A 1P84E 3S4RA 1X8YA 2D2CB 1YQ3C 3KPEA 4KHXA 1NU1E 3WUUA 4XE5B 1KMIZ 2WSEH 1GW4A 1CW5A 2Q5UA 3TGUG 1PGJA 1SFCB 5KKZB 1PGQA 4H44B 1J2JB 2XV5A 3MD0A 3WUTA 5K5GB 4K35A 1ZRTD 1ZR4A 3H1JD 1P84H 1MFZA 4WWIA 2JDIH 3SWYA 1P84D 2YO3A 3H1HG 1R8EA 1S72P 1RE3A
chains in the Genus database with same CATH topology
1HUCA 2GUSA 3B5NA 2R5DA 1J1DB 2W6AA 5KLVK 5CCHC 4WY4C 3M9BA 1H88A 3H6PA 1L4AB 1LWUC 3C9IA 2QM7A 3VN0A 3A5TA 2Q7CA 2YNYA 5KJ7C 5APWA 4WY4B 5APVA 1GU4A 2HODA 3U1AA 1URQC 2R32A 2KSJA 3LW5H 1LWUB 3RK3D 1IO4A 2W27A 4GIFA 1FBMA 2P67A 2N1TA 1LGHB 5APQA 2FFDC 2CPBA 2OYHA 2E43A 4AUWA 5BU5A 1URQB 2WITA 1KFMA 3GHGC 1JY2N 2GM4A 3L4FA 2JJLA 3O8ZA 2XZRA 2FKWB 2POHA 5AW9B 3LIEA 1MV8A 2NPSC 2FFDB 4ZKUA 1VDFA 3VYIA 1RF0C 1LTBC 3A7OA 2ZFCA 1KZUB 2NPSB 1N7SC 2Z4EA 2C9LY 5AVUB 4C7RA 3MIWA 3KQGA 1JMMA 1CZQA 5AW6B 1JTHB 3H32A 1WT6A 1HGZA 1X79B 3T97A 2J58A 1N7SB 3KDPB 3RK2D 4WBAA 1LTJA 5AW0B 5AW2B 2YKOA 1T2KC 3VTPC 1GD2E 1T3UA 3PP5A 5AW3B 2C0XA 1JY3N 3OJAB 3L36A 1GK4A 1FOSE 1NHLA 2WZ7A 3RL0D 3CI9A 3HTKA 2I1KA 5AVVB 5CJ0A 1RF1C 1E5WA 1T3JA 3EQ2A 3V4WA 4W7ZA 1GW3A 1M1JA 1KILD 1FDMA 1HH0A 1NKNA 1FZCC 1JY3P 1NTKK 2XDJA 2I1JA 1GL2D 4IFMA 1EQ7A 1RF1B 2IX7C 3BRVB 3M9QA 4I1LA 2FYUK 1FZCB 1JCCA 1LTIC 3B5ND 3EFGA 4C7NA 5APXA 2N1TC 1JOCA 1LTGC 3HRNA 1CSBA 1FJKA 3M91A 1HWTC 3V2QA 2Q9IA 3HE4B 3HE5B 2OYIA 2Z5IA 2N1TB 3LIDA 1CI6A 3BATA 1KILA 5CHXA 1N2DC 1QL1A 4AYCA 1GL2A 2P2UA 5CCGD 3HD7D 1JCDA 3V4QA 1SQPK 1X9VA 1FOSF 1DH3A 1FU1A 3RK3C 1A02F 3V2PA 4DZOA 2KLVA 2WSFH 2H8PD 4WB4A 2WSCH 1IFMA 1NH4A 1SVFA 4IFFA 5AVSB 3RK3B 1RE4A 4W80A 1XTCC 3U1CA 1IK9A 2IFNA 3TYYA 2O1KA 1SQXK 5CCGA 3HD7A 3TK1A 3U59A 1NKZB 5CJ4A 3HTKB 1PFIA 4M3LA 1T8ZA 3CLQA 3RK2C 1SQVK 3N7NA 2WT7A 5AVTB 3V2NA 1JY2P 2XU6A 2YO2A 4LLHA 3P8MC 1LT9C 2O01H 1A02J 3VOPA 2H43A 3NFQA 1ZV8A 1JY2O 3RK2B 4ZKPA 3RL0C 1NWQA 2A45H 1AQ5A 2OYIC 1FAVA 1LT9B 5APUA 1KILC 1NAFA 3KYQA 1HBWA 3HUSC 1G2CB 1GTWA 3P7KA 3RL0B 5AW4B 2BASA 4XA4A 1GL2C 2C0WA 2OYIB 1GDTA 2R3CA 1KILB 1RE3C 3HUSB 1FZEA 5AVRB 3B5NC 3A3YB 2O1JA 2HFED 3CL3D 3TNUA 1GL2B 2Q3IA 5KTBA 5CMZA 2FXMA 1NO4A 1LWUA 1KFNA 1NTZK 2N9BA 3B5NB 1FZBA 4N6JA 1RE4C 1JY3O 1QL2A 1NU1K 5BU8B 3V5BA 2LKMA 2KYVA 3A2AA 1HJBA 1Z56A 1H89A 1SQBK 4GKGA 2FFDA 1N73A 5AVWB 3IFMA 1HVVA 2OYHC 1HTLC 2HODB 4N3YB 3GHGA 1T2KD 5AVZB 2P7JA 4W7YA 1HGVA 1LTSC 1KQLA 2NPSA 3BRTB 1L0NK 2C9NY 2CPSA 3TSIA 2HPCA 2OYHB 2YKPA 5AW8B 3M9HA 4IFDK 2H7HA 1J1EC 2IFMA 1N7SA 1S9KE 2WT7B 2VRSA 2WPQA 1L0LK 1XTGB 4RESB 2PAJA 2WWWA 1J1EB 1GZLA 1YYCA 1IC2A 1SFCD 2J59M 3P32A 1ZLLA 5AVYB 1LTJC 3BVHA 4HYTB 3H32B 3SWFA 4I6MC 1YTZT 3P8CE 5AW5B 2YMYA 1GK6A 2WPRA 3VP9A 2P1JA 3L37A 3R2PA 1LTJB 1MZ9A 1VPCA 1IFJA 1FJPA 2IPPA 1RF1A 1M1JC 3NMDA 1FZCA 1ZR2A 3M0AA 2GUVA 2M8RA 3II6A 3TNUB 2WPSA 1M1JB 4N78E 1SFCA 1ZN5A 1L4AD 3VP8A 3WMM0 1S9KD 1M7LA 4EIJA 5CCHD 2A45G 3HE4A 3HE5A 4WY4D 5APTA 5AVXB 5AVQB 1N73C 4JYBA 1AFOA 1IFIA 3M0DA 5AW1B 4EOTA 3VMXA 2KP8A 4Y99C 1H8AA 3E1IA 1JUNA 2W6BA 5KJ7D 4C7NB 1N73B 1DX7A 1URQD 3P8CD 1FZAA 2YKQA 3MGNA 2OARA 1N7LA 3GHGB 4Y99B 1N86A 2KOGA 1IFDA 1CI6B 2HPCB 1G1JA 1L4AA 2A45I 2KB7P 1NOHA 2HG5D 3G3ZA 3BASA 3UIAA 5CCHA 3L35A 2NPSD 4WY4A 1JO5A 1DEBA 1OXZA 2Z5HA 4N78D 3M06A 4GT1A 3OAKA 2ZXEB 1W2EA 1MUUA 1OWAA 5KJ7A 3V2RA 2R5BA 1N7SD 1IJDB 1G1IA 4JF7A 5AW7B 2PP6A 2M3BA 1URQA 2MJZA 2FYZA 3B8EB 3I5CA 2JEEA 1IFNA 3NXSA 1X8YA 4HH2A 4JYCA 3VMZA 5CCGC 1JNMA 2HYNA 3HD7C 1NTMK 5APYA 1GU5A 4DOJA 3KPEA 1YTZI 4KHXA 2XNXA 1SFCC 3HD7B 4XE5B 2WTYA 1JTHA 2WSEH 1GW4A 1RF0A 1CW5A 2Q5UA 3MTUE 1LT9A 1SFCB 3M0DC 4I2LC 1SQQK 2E42A 4LC1A 4C46A 1G2CA 1J2JB 2XV5A 3MD0A 4O9BA 3NTNA 2L5GB 2HLOA 1RY3A 4AQRD 1LTTC 3N4XA 1SP4A 4B86A 4LGDE 1SLQA 3IR9A 3HUSA 1ZR4A 3MUDA 1WRGA 5APSA 1MFZA 2XKMA 1J1DC 4OH8B 1FZGA 3SWYA 2QM8A 1LTAC 2N1TD 1FZFA 3VMYA 5BVZA 2YO3A 3OA7A 1L4AC 1RE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B5N C;  3B5N A;  5CCH C;  2HFE D;  4WY4 C;  1GL2 B;  5KJ7 D;  1L4A B;  2N1T B;  1URQ D;  1KIL A;  3B5N B;  5KJ7 C;  4WY4 B;  1URQ C;  2KOG A;  1GL2 A;  5CCG D;  3RK3 D;  3HD7 D;  1L4A A;  2N1T A;  1HVV A;  3RK3 C;  2HG5 D;  1URQ B;  5CCH A;  2NPS D;  4WY4 A;  2H8P D;  4W7Y A;  2NPS C;  2NPS A;  3TSI A;  3RK3 B;  5KJ7 A;  1N7S D;  4JF7 A;  2PP6 A;  1URQ A;  4W80 A;  2NPS B;  1N7S C;  1N7S A;  5CCG C;  1JTH B;  5CCG A;  3HD7 C;  3HD7 A;  1XTG B;  1SFC D;  1N7S B;  3RK2 D;  3HTK B;  1SFC C;  3RK2 C;  3HD7 B;  3PP5 A;  3P8C E;  2YMY A;  1JTH A;  1NHL A;  3VOP A;  2WZ7 A;  3RL0 D;  1SFC B;  3M0D C;  3RK2 B;  1T3J A;  4W7Z A;  1KIL D;  3RL0 C;  2XDJ A;  1KIL C;  3KYQ A;  4LGD E;  1GL2 D;  2M8R A;  4N78 E;  1SFC A;  4OH8 B;  1L4A D;  3RL0 B;  2N1T D;  1GL2 C;  3B5N D;  1KIL B;  5CCH D;  1L4A C;  4WY4 D;  2N1T C; 
#chains in the Genus database with same CATH topology
 1J1D B;  2W6A A;  4PV1 C;  1EXJ A;  3L75 J;  1L4A B;  1KQF B;  1EDK A;  1PGO A;  3H1I G;  5APV A;  4H13 D;  2YXR B;  2R32 A;  3LW5 H;  2KK7 A;  3CMA P;  1KYO I;  2N1T A;  1KQG B;  2E43 A;  4AUW A;  5BU5 A;  1ZOY C;  2WIT A;  2GM4 A;  3L4F A;  2JJL A;  2FKW B;  5AW9 B;  1MV8 A;  2NPS C;  3AE7 C;  1X0T A;  1LT1 A;  4YXD C;  1RF0 C;  2ZFC A;  1H0T B;  2C9L Y;  4C7R A;  5AW6 B;  1VQO P;  1HGZ A;  3IF4 A;  3ITK A;  1KTM A;  2Y0C A;  2FBW C;  5AW0 B;  5AW2 B;  5AW3 B;  3AED C;  2C0X A;  3CC7 P;  1SQB J;  1M90 Q;  1JY3 N;  3OJA B;  4YPC A;  2I1K A;  3V4W A;  2OGU A;  1JY3 P;  1L0N J;  2I1J A;  3EWK A;  1RF1 B;  3BRV B;  5M1B A;  1FZC B;  4C7N A;  3H1J G;  3FXE A;  3O6Q A;  3HE5 B;  3CC4 P;  3LID A;  2W6J H;  3BAT A;  1N2D C;  2BEZ F;  3V6I A;  1GL2 A;  2ZYD A;  5CCG D;  1JCD A;  3V4Q A;  1X9V A;  1FOS F;  1DH3 A;  2M0B A;  4JQ0 D;  2A06 D;  2ITA A;  1QEX A;  2KLV A;  3AEF C;  2OTL P;  4H44 D;  2WSC H;  1NH4 A;  4IFF A;  3D71 A;  3RK3 B;  3JCU E;  2UWJ E;  3SSU A;  4TT3 H;  1XTC C;  2PGD A;  3TYY A;  2O1K A;  2IZ0 A;  5B5E E;  3AE1 C;  4YXW H;  3HTK B;  2QEX P;  4IL6 X;  2KNC B;  3D70 A;  2XU6 A;  3PH0 A;  4LLH A;  3P8M C;  3BCC D;  3NFQ A;  1ZV8 A;  1Q82 Q;  3H1L E;  1ZXG A;  4CPG A;  2B87 A;  1LT9 B;  3JCU H;  3HUS C;  1L2P A;  3TGU J;  3CXH I;  4PD4 E;  3RL0 B;  4XA4 A;  1GDT A;  5B5E H;  1KIL B;  3E1R A;  5KAF E;  3PTZ A;  2E75 C;  3A3Y B;  2O1J A;  4HB1 A;  1AVY A;  5CMZ A;  1KFN A;  3AE2 C;  3H1H J;  1FZB A;  2ZAE B;  2E76 D;  3V5B A;  3B4S A;  1AA0 A;  3KZI E;  2K3R A;  2Q1K A;  4GKG A;  2OYH C;  1Q86 Q;  4N3Y B;  1R5L A;  3H1I J;  4PD4 H;  1T2K D;  3L70 E;  4W7Y A;  2NPS A;  2ZT9 D;  5KAF H;  2FYU E;  2A06 G;  2AEM A;  1LP1 A;  1J1E C;  1AVO A;  3AEB C;  4H13 C;  5KLI B;  3RK3 E;  3JC2 2;  2WT7 B;  2VRS A;  1XTG B;  2WWW A;  1GZL A;  1EZV I;  2YMK A;  1LTJ C;  3KZI H;  4UB6 E;  3CCJ P;  3D6Y A;  3SWF A;  4I6M C;  1KQS O;  1S4X A;  2P1J A;  3Q1M A;  1JB0 J;  1OZH A;  1KD1 Q;  4XFJ A;  3L70 D;  3CCR P;  1M1J C;  3M0A A;  1SQV J;  1EDI A;  1T6A A;  2GUV A;  3BCC G;  1VQ8 P;  1S5L X;  4EIJ A;  4PV1 D;  1K73 Q;  5H2F E;  5AVQ B;  4JYB A;  2WSE J;  1IFI A;  4U7J A;  1KB9 I;  4EOT A;  4UB6 H;  3E1I A;  4RJT A;  1FZA A;  3H1J J;  5C39 A;  2IZ1 A;  2E74 B;  1CI6 B;  2PFX A;  1WMK A;  4HKZ H;  3L35 A;  2NPS D;  3QWO C;  4WY4 A;  1NU1 J;  1OXZ A;  2Z5H A;  3OAK A;  5H2F H;  5KJ7 A;  2D2C C;  1IJD B;  4JF7 A;  4NPF X;  2JEE A;  2QJK B;  4JYC A;  3VMZ A;  5CCG C;  2HYN A;  3ZDM A;  2YXQ B;  3PLN A;  5APY A;  1PPJ E;  1GU5 A;  3Q3D A;  1YJN P;  3OW2 O;  3L72 E;  1YTZ I;  3S9O A;  4DT0 A;  1SFC C;  4H44 C;  5KKZ C;  4BWN A;  3HD7 B;  2JP3 A;  5DJU B;  2ZVN B;  4D6T E;  3C8V A;  3M0D C;  1BCC E;  2BCC E;  5L8R J;  1G2C A;  2JWA A;  4O9B A;  1OVU A;  2H89 C;  2L5G B;  1BE3 E;  2HLO A;  3N4X A;  4B86 A;  1SLQ A;  3IR9 A;  3HUS A;  2FYN B;  3L70 G;  1J1D C;  2PRR A;  1DEE G;  2QE7 H;  5BVZ A;  2JO1 A;  1L4A C;  5AW1 B;  1SQP E;  1M57 D;  1PPJ D;  2R5D A;  5CCH C;  3L72 D;  3M9B A;  1H88 A;  3H6P A;  3C9I A;  2WSS H;  3A5T A;  2Q7C A;  1BDC A;  3Q5P A;  5APW A;  1LWU B;  1BCC D;  2JWD A;  4GIF A;  2P67 A;  2OYH A;  1HJ0 A;  1URQ B;  2FY8 A;  3GHG C;  2POH A;  3CCL P;  4Y28 J;  5DJT B;  2KZJ A;  1E79 H;  1VDF A;  1SQP D;  1PP9 D;  4ASV A;  2LXC B;  1VF5 B;  2Z4E A;  1AQT A;  2IYP A;  3MIW A;  1CZQ A;  3H32 A;  3AEA C;  1WT6 A;  1X79 B;  3T97 A;  4H0L B;  1LTJ A;  3FGA D;  1LNQ A;  2WSC J;  1T2K C;  1Q2N A;  1T3U A;  3PP5 A;  3GG2 A;  1W5C E;  3GW6 A;  3L73 D;  3L36 A;  1GK4 A;  1SQX D;  1FOS E;  2E74 D;  3CI9 A;  5CBO A;  5AVV B;  2KZI A;  1RF1 C;  1E5W A;  3EQ2 A;  3TF5 A;  1M1J A;  2SPZ A;  1KN7 A;  1FDM A;  1FZC C;  1SQV D;  3CCU P;  3M9Q A;  4I1L A;  4BRY A;  2E75 D;  1EXI A;  2ZYG A;  5APX A;  1LTG C;  3BCC J;  3HRN A;  1CSB A;  3M91 A;  1HWT C;  2Q9I A;  3HE4 B;  2OYI A;  2N1T B;  1EC5 A;  3CCS P;  1PPJ G;  2QRX A;  5CHX A;  3L74 E;  3L71 E;  4I7Z B;  3FXD A;  1NVO A;  3L72 G;  4AYC A;  3CD6 P;  2P2U A;  3HD7 D;  1SQP K;  3RK3 C;  3GF7 A;  1NYH A;  3GMA A;  1JMB A;  1P84 I;  1DD3 A;  1BCC G;  1NU1 D;  1SVF A;  3PJS K;  1M56 D;  2N9Y B;  2K88 A;  1Y9B A;  4GOF A;  3AEG C;  5KLV E;  3U1C A;  3G9R A;  2IFN A;  3I56 P;  1YI2 P;  1SQX K;  1SQP G;  4L73 A;  5CCG A;  1M8O B;  1PP9 G;  2GA1 A;  2KS1 B;  1U7M A;  1T8Z A;  1SQV K;  3N7N A;  3AE6 C;  2P10 A;  3V2N A;  2YO2 A;  1JM0 A;  1LT9 C;  2O01 H;  3ABV C;  3VOP A;  1A02 J;  3CME P;  1JY2 O;  3RK2 B;  3RL0 C;  3Q5S A;  3L73 G;  2E5Y A;  1RQV A;  1FAV A;  1SQX G;  1KIL C;  1HBW A;  3WU2 E;  3O6Q B;  1FS0 E;  3MUD C;  1GTW A;  5AW4 B;  2LXB A;  1SQV G;  2B9B A;  4GOD A;  1VQM P;  1N8R Q;  4Z1M H;  1VF5 D;  3CL3 D;  4GOE A;  1GL2 B;  3L70 J;  5KTB A;  3CCE P;  1NO4 A;  4EYY Q;  3B5N B;  1RE4 C;  1NU1 K;  4H0L D;  2Y9Z A;  2LKM A;  1UII A;  1PV3 A;  1Z56 A;  1H89 A;  3CCV P;  1N73 A;  3IFM A;  2HOD B;  1NTM E;  1S3J A;  3AE5 C;  3WU2 H;  1NTK E;  1EDJ A;  3GHG A;  1FC2 C;  1HGV A;  1FDO A;  2V7Q H;  2D2C D;  1H0T A;  1K9M Q;  2CPS A;  5KLI C;  2H7H A;  1QLE D;  1NU1 G;  2H88 C;  3SFE C;  2HR3 A;  1S9K E;  1OMI A;  3CCQ P;  4RES B;  1SFC D;  3P32 A;  3GF3 A;  3W68 A;  3BVH A;  2YMY A;  1GK6 A;  3VP9 A;  3L37 A;  3R2P A;  2M5A A;  1NTM D;  2IPP A;  1RF1 A;  3RGU A;  2W90 A;  1FZC A;  2RN0 A;  1S2E A;  1OW8 A;  2KLU A;  3II6 A;  4N78 E;  1L4A D;  1S9K D;  5CCH D;  4U3F E;  3HE5 A;  1VQ4 P;  1AFO A;  2QJP B;  3F89 A;  4KT0 J;  1H8A A;  2W6B A;  4K3A A;  3CC2 P;  2E74 C;  2KXP B;  2K9J B;  1QX8 A;  1U7J A;  3L75 E;  1K8A Q;  2ZYA A;  3TDK A;  2OAR A;  4GDO A;  1N86 A;  4OGQ B;  1IZN B;  3JSV C;  1IFD A;  1G1J A;  1DIP A;  3G4S P;  1NOH A;  1VQ6 P;  1LP1 B;  3G3Z A;  1SS1 A;  4IL6 E;  3UIA A;  3L72 J;  2WMM A;  4HJG H;  4N78 D;  1VQN P;  4GT1 A;  4R4M A;  1W2E A;  1MUU A;  1OWA A;  2QJK C;  3V2R A;  2R5B A;  1VQ5 P;  3B8E B;  3I5C A;  1BCC J;  2BCC J;  4ZNC A;  3H1L D;  1JNM A;  2KNC A;  1NTM K;  3HD7 C;  4DOJ A;  3G6E P;  1GMJ A;  1AV1 A;  4PD4 D;  2XNX A;  2OTJ P;  1JTH A;  1SQP J;  1PP9 J;  1RF0 A;  4IL6 H;  3MTU E;  1LT9 A;  4PD4 I;  4I2L C;  2E42 A;  2FYN C;  4C46 A;  1YJW P;  1RH5 B;  1RY3 A;  1NTM G;  2OYO A;  4YTP C;  5APS A;  1UIX A;  1WRG A;  3MUD A;  1OVR A;  2XKM A;  1FZG A;  2QM8 A;  1FZF A;  3VMY A;  3L73 J;  1NJI Q;  1SQX J;  1HUC A;  4ZMD A;  4JBZ A;  1LWU C;  2FYU D;  3VN0 A;  2YNY A;  4WY4 B;  1GU4 A;  1URQ C;  2O01 N;  2KSJ A;  3RK3 D;  1IO4 A;  1FBM A;  1LGH B;  2CPB A;  2MKV A;  3H1K E;  3CX5 E;  1X22 A;  1JY2 N;  2XZR A;  1KIL E;  1VF5 C;  1VL2 A;  2FFD B;  4ZKU A;  3PRJ A;  3VYI A;  3GLM A;  2AEF A;  4RO0 A;  3A7O A;  4UB8 E;  2B88 A;  4H0L C;  4DCK A;  1Q90 D;  1JMM A;  5E79 E;  3W67 A;  4TLF A;  2J58 A;  1N7S B;  1S5L E;  4WBA A;  3H1L G;  1K04 A;  4DJG A;  2DW3 A;  3VTP C;  1GD2 E;  2ZXX A;  3CX5 H;  2FXO A;  1NHL A;  3H1K D;  3RL0 D;  4OGQ D;  3CX5 D;  3MHV A;  5CJ0 A;  3LW5 J;  1KIL D;  2XDJ A;  1NTZ E;  2WVR A;  3L71 J;  4UB8 H;  1EQ7 A;  2IX7 C;  2FYU K;  5E79 H;  1JCC A;  1LTI C;  1NGM B;  3EFG A;  2N1T C;  2IBZ E;  3Q2Y A;  1S5L H;  2O01 J;  4I7Z C;  1FJK A;  2Z5I A;  1CI6 A;  3CPW O;  1MFT A;  5KLV J;  2FYU G;  5CBN A;  1L0L E;  1A02 F;  4DZO A;  2NZ2 A;  2WSF H;  1NTZ D;  2W83 C;  4WB4 A;  3CWB E;  2JR8 A;  1Y47 A;  5AVS B;  4L75 A;  4D6T D;  3T97 B;  4W80 A;  2IBZ D;  2BCC D;  3G71 P;  1IK9 A;  1BE3 D;  3HD7 A;  3TK1 A;  1BGY E;  1YQ4 C;  3U59 A;  1PFI A;  3EFF K;  3CLQ A;  3RK2 C;  2V7Q J;  3AEE C;  2V4H A;  1BDD A;  1TU3 F;  1L0L D;  4BRY B;  2B89 A;  2IDB A;  3CWB D;  1NWQ A;  2A45 H;  1AQ5 A;  2L91 A;  1NAF A;  2KI7 B;  4OVN F;  3P7K A;  2BAS A;  1GL2 C;  2C0W A;  2OYI B;  1FZE A;  1NTM J;  5AVR B;  3B5N C;  1NTK J;  1BGY D;  2Q3E A;  4R4L A;  2HFE D;  3TNU A;  2Q3I A;  2AXT E;  1LWU A;  5EFW B;  1NTZ K;  4N6J A;  1QL2 A;  5BU8 B;  3SFD C;  1RQU A;  3A0H E;  2KYV A;  5B66 E;  4BXL A;  2QSI A;  5AVW B;  1HVV A;  1HTL C;  5AVZ B;  1LTS C;  3BRT B;  1ZW0 A;  2C9N Y;  2HPC A;  5AW8 B;  3M9H A;  4IFD K;  1KYO E;  1NTZ G;  2AXT H;  1SQQ E;  1QVG O;  1Q81 Q;  4D6T G;  2M3E A;  1L0L K;  2PAJ A;  2IBZ G;  4NPD A;  1YYC A;  3IN6 A;  2BCC G;  3A0H H;  2J59 M;  1ZLL A;  5B66 H;  1AJY A;  1BE3 G;  1YTZ T;  3P8C E;  4QMA A;  4U3F J;  2ZVO B;  1VPC A;  1IFP A;  2QIW A;  1IFJ A;  1FJP A;  3H1L J;  4WVZ A;  2Y0E A;  1KYO H;  1ZR2 A;  1USE A;  1L0L G;  3L74 D;  1KYO D;  3L71 D;  4RKU J;  1FDI A;  2QJP C;  1SFC A;  3CWB G;  3C1L A;  1DD4 A;  2Y9Y A;  1SQQ D;  1M7L A;  2A45 G;  3HE4 A;  5APT A;  2RKL A;  3M0D A;  3VMX A;  2JKV A;  4PJ0 E;  4OGQ C;  2XND H;  1ZP0 C;  4C7N B;  1N73 B;  1DX7 A;  1URQ D;  1BGY G;  3P8C D;  1N7L A;  3VMA A;  3GHG B;  4Y99 B;  1VQ7 P;  2KOG A;  3USS A;  1QGK B;  5KLV D;  3MZW B;  1L4A A;  2KB7 P;  2QJY B;  3B71 A;  1KV4 A;  2HG5 D;  2YIU B;  5CCH A;  2E76 B;  2I8D A;  1DEB A;  3D6Z A;  3M06 A;  2FYU J;  1G1I A;  5AW7 B;  2M3B A;  4PJ0 H;  1IFN A;  3NXS A;  4HH2 A;  2KS1 A;  2ZJS E;  2ZT9 B;  4NPE A;  5GTH E;  1BSN A;  2A06 E;  2M5A B;  2WTY A;  4L76 A;  1SQQ K;  4LC1 A;  1Q7Y Q;  3RBZ A;  2AEJ A;  1YIJ P;  3NTN A;  4AQR D;  1LTT C;  1SP4 A;  4LGD E;  3QH9 A;  4OH8 B;  2B87 B;  1LTA C;  2N1T D;  1OX3 A;  3OA7 A;  3L74 G;  5GTH H;  3L71 G;  3K5B A;  2GUS A;  3H1K J;  1NTK D;  3B5N A;  1YHQ P;  5KLV K;  1PGP A;  3BCC E;  4WY4 C;  3CXH E;  1SQQ G;  2G3A A;  2QA4 P;  2QM7 A;  5KJ7 C;  1EDL A;  4PV1 B;  1NAY A;  2HOD A;  3U1A A;  3IAO A;  2W27 A;  5APQ A;  2FFD C;  1KFM A;  5KLV G;  3O8Z A;  3LIE A;  4EDF A;  1Y8A A;  3AEC C;  1LTB C;  3PHL A;  3CXH H;  1KZU B;  2NPS B;  1N7S C;  5AVU B;  3KQG A;  1MKM A;  3CXH D;  3SWK A;  1JTH B;  3S1K A;  1LJ2 A;  1NTZ J;  3KDP B;  3RK2 D;  4KJM A;  2WSF J;  5KAI E;  2YKO A;  4D6T J;  3FX0 A;  1VQL P;  4U3F D;  5GTI E;  2WZ7 A;  3KHU A;  3HTK A;  1EZV E;  1T3J A;  1R5S A;  4W7Z A;  1GW3 A;  1BE3 J;  3AE4 C;  1HH0 A;  1NKN A;  3L75 D;  4L74 A;  1NTK K;  1GL2 D;  4IFM A;  2RH0 A;  3B5N D;  1SQB E;  2K9J A;  1JOC A;  1L0L J;  1VQK P;  3Q5R A;  2OQQ A;  2K1A A;  5KAI H;  2WQY C;  3CWB J;  3V2Q A;  1L0N E;  1YIT P;  1NTK G;  1KIL A;  5GTI H;  2QVA A;  2WPV B;  2Y0D A;  3AE3 C;  1QL1 A;  1VQP P;  4EI2 A;  1W2B O;  1KB9 E;  1EZV D;  1PZQ A;  1YBK A;  1FU1 A;  3AE9 C;  1BGY J;  3V2P A;  2H8P D;  1IFM A;  1RE4 A;  1SQB D;  4ASW A;  2G8Y A;  2K9Y A;  3F5H A;  1L0N D;  3FWN A;  1FE6 A;  1KB9 H;  1NKZ B;  4A7P A;  5CJ4 A;  4M3L A;  1KB9 D;  2KSE A;  2Q6Q A;  2WT7 A;  5AVT B;  3RL0 g;  1BSH A;  3MP7 B;  1JY2 P;  2KIK A;  2H43 A;  2LR2 A;  3AE8 C;  3FWL A;  4ZKP A;  4U3F G;  2OYI C;  5APU A;  3KYQ A;  1G2C B;  3L75 G;  4MN4 C;  2CK3 H;  1K05 A;  2K37 A;  2R3C A;  2AXC A;  1RHZ B;  1JEK A;  1RE3 C;  1QVF O;  3HUS B;  1OW6 A;  1VQ9 P;  1OIP A;  2RMZ A;  2FXM A;  2W8Z A;  2O3J A;  2N9B A;  3L74 J;  2E75 B;  3CX5 I;  1JY3 O;  3TGU E;  3WUV A;  2NRG A;  3A2A A;  1HJB A;  2BEQ D;  1SQQ J;  1SQB K;  2P58 A;  3R4Y A;  2FFD A;  2FXP A;  2P7J A;  1EZV G;  3I55 P;  3RBX A;  1KQL A;  1L0N K;  3TSI A;  2OYH B;  2YKP A;  1USD A;  3H1H E;  1S1C X;  2IFM A;  1N7S A;  2J5U A;  2QG4 A;  1SQB G;  2WPQ A;  1J1E B;  1IC2 A;  3H1I E;  4H13 B;  1PL5 A;  5AVY B;  3TGU D;  4JPZ B;  4HYT B;  3H32 B;  1L0N G;  5AW5 B;  2WPR A;  2R3S A;  1PP9 E;  3A0B E;  1LTJ B;  3KXD A;  5TIS E;  1MZ9 A;  3E7K A;  3NMD A;  1YJ9 P;  1OW7 A;  1M1K Q;  2IBZ I;  3H1H D;  1IK7 A;  1KOR A;  2M8R A;  3TNU B;  2WPS A;  1M1J B;  4IOI H;  1ZN5 A;  1D7M A;  3VP8 A;  3WMM 0;  1OVV A;  2OTK E;  2R44 A;  3L73 E;  4WY4 D;  5AVX B;  1N73 C;  1SQX E;  2KP8 A;  1U57 A;  3H1I D;  4Y99 C;  2E5T A;  1JUN A;  5KJ7 D;  4OWF A;  3H1K G;  3CCM P;  1SQV E;  2YKQ A;  3MGN A;  3A0B H;  2QJY C;  5TIS H;  2YIU C;  3H25 A;  2IYO A;  1PIX A;  2E76 C;  2HPC B;  2A45 I;  1ZME C;  3BAS A;  1JO5 A;  5TJH A;  2ZXE B;  1OFC X;  2KUB A;  1ZRT E;  1N7S D;  3H1J E;  2PP6 A;  2ZT9 C;  1KC8 Q;  1URQ A;  2MJZ A;  2FYZ A;  1HF9 A;  1P84 E;  3S4R A;  1X8Y A;  2D2C B;  1YQ3 C;  3KPE A;  4KHX A;  1NU1 E;  3WUU A;  4XE5 B;  1KMI Z;  2WSE H;  1GW4 A;  1CW5 A;  2Q5U A;  3TGU G;  1PGJ A;  1SFC B;  5KKZ B;  1PGQ A;  4H44 B;  1J2J B;  2XV5 A;  3MD0 A;  3WUT A;  5K5G B;  4K35 A;  1ZRT D;  1ZR4 A;  3H1J D;  1P84 H;  1MFZ A;  4WWI A;  2JDI H;  3SWY A;  1P84 D;  2YO3 A;  3H1H G;  1R8E A;  1S72 P;  1RE3 A; 
#chains in the Genus database with same CATH homology
 1HUC A;  2GUS A;  3B5N A;  2R5D A;  1J1D B;  2W6A A;  5KLV K;  5CCH C;  4WY4 C;  3M9B A;  1H88 A;  3H6P A;  1L4A B;  1LWU C;  3C9I A;  2QM7 A;  3VN0 A;  3A5T A;  2Q7C A;  2YNY A;  5KJ7 C;  5APW A;  4WY4 B;  5APV A;  1GU4 A;  2HOD A;  3U1A A;  1URQ C;  2R32 A;  2KSJ A;  3LW5 H;  1LWU B;  3RK3 D;  1IO4 A;  2W27 A;  4GIF A;  1FBM A;  2P67 A;  2N1T A;  1LGH B;  5APQ A;  2FFD C;  2CPB A;  2OYH A;  2E43 A;  4AUW A;  5BU5 A;  1URQ B;  2WIT A;  1KFM A;  3GHG C;  1JY2 N;  2GM4 A;  3L4F A;  2JJL A;  3O8Z A;  2XZR A;  2FKW B;  2POH A;  5AW9 B;  3LIE A;  1MV8 A;  2NPS C;  2FFD B;  4ZKU A;  1VDF A;  3VYI A;  1RF0 C;  1LTB C;  3A7O A;  2ZFC A;  1KZU B;  2NPS B;  1N7S C;  2Z4E A;  2C9L Y;  5AVU B;  4C7R A;  3MIW A;  3KQG A;  1JMM A;  1CZQ A;  5AW6 B;  1JTH B;  3H32 A;  1WT6 A;  1HGZ A;  1X79 B;  3T97 A;  2J58 A;  1N7S B;  3KDP B;  3RK2 D;  4WBA A;  1LTJ A;  5AW0 B;  5AW2 B;  2YKO A;  1T2K C;  3VTP C;  1GD2 E;  1T3U A;  3PP5 A;  5AW3 B;  2C0X A;  1JY3 N;  3OJA B;  3L36 A;  1GK4 A;  1FOS E;  1NHL A;  2WZ7 A;  3RL0 D;  3CI9 A;  3HTK A;  2I1K A;  5AVV B;  5CJ0 A;  1RF1 C;  1E5W A;  1T3J A;  3EQ2 A;  3V4W A;  4W7Z A;  1GW3 A;  1M1J A;  1KIL D;  1FDM A;  1HH0 A;  1NKN A;  1FZC C;  1JY3 P;  1NTK K;  2XDJ A;  2I1J A;  1GL2 D;  4IFM A;  1EQ7 A;  1RF1 B;  2IX7 C;  3BRV B;  3M9Q A;  4I1L A;  2FYU K;  1FZC B;  1JCC A;  1LTI C;  3B5N D;  3EFG A;  4C7N A;  5APX A;  2N1T C;  1JOC A;  1LTG C;  3HRN A;  1CSB A;  1FJK A;  3M91 A;  1HWT C;  3V2Q A;  2Q9I A;  3HE4 B;  3HE5 B;  2OYI A;  2Z5I A;  2N1T B;  3LID A;  1CI6 A;  3BAT A;  1KIL A;  5CHX A;  1N2D C;  1QL1 A;  4AYC A;  1GL2 A;  2P2U A;  5CCG D;  3HD7 D;  1JCD A;  3V4Q A;  1SQP K;  1X9V A;  1FOS F;  1DH3 A;  1FU1 A;  3RK3 C;  1A02 F;  3V2P A;  4DZO A;  2KLV A;  2WSF H;  2H8P D;  4WB4 A;  2WSC H;  1IFM A;  1NH4 A;  1SVF A;  4IFF A;  5AVS B;  3RK3 B;  1RE4 A;  4W80 A;  1XTC C;  3U1C A;  1IK9 A;  2IFN A;  3TYY A;  2O1K A;  1SQX K;  5CCG A;  3HD7 A;  3TK1 A;  3U59 A;  1NKZ B;  5CJ4 A;  3HTK B;  1PFI A;  4M3L A;  1T8Z A;  3CLQ A;  3RK2 C;  1SQV K;  3N7N A;  2WT7 A;  5AVT B;  3V2N A;  1JY2 P;  2XU6 A;  2YO2 A;  4LLH A;  3P8M C;  1LT9 C;  2O01 H;  1A02 J;  3VOP A;  2H43 A;  3NFQ A;  1ZV8 A;  1JY2 O;  3RK2 B;  4ZKP A;  3RL0 C;  1NWQ A;  2A45 H;  1AQ5 A;  2OYI C;  1FAV A;  1LT9 B;  5APU A;  1KIL C;  1NAF A;  3KYQ A;  1HBW A;  3HUS C;  1G2C B;  1GTW A;  3P7K A;  3RL0 B;  5AW4 B;  2BAS A;  4XA4 A;  1GL2 C;  2C0W A;  2OYI B;  1GDT A;  2R3C A;  1KIL B;  1RE3 C;  3HUS B;  1FZE A;  5AVR B;  3B5N C;  3A3Y B;  2O1J A;  2HFE D;  3CL3 D;  3TNU A;  1GL2 B;  2Q3I A;  5KTB A;  5CMZ A;  2FXM A;  1NO4 A;  1LWU A;  1KFN A;  1NTZ K;  2N9B A;  3B5N B;  1FZB A;  4N6J A;  1RE4 C;  1JY3 O;  1QL2 A;  1NU1 K;  5BU8 B;  3V5B A;  2LKM A;  2KYV A;  3A2A A;  1HJB A;  1Z56 A;  1H89 A;  1SQB K;  4GKG A;  2FFD A;  1N73 A;  5AVW B;  3IFM A;  1HVV A;  2OYH C;  1HTL C;  2HOD B;  4N3Y B;  3GHG A;  1T2K D;  5AVZ B;  2P7J A;  4W7Y A;  1HGV A;  1LTS C;  1KQL A;  2NPS A;  3BRT B;  1L0N K;  2C9N Y;  2CPS A;  3TSI A;  2HPC A;  2OYH B;  2YKP A;  5AW8 B;  3M9H A;  4IFD K;  2H7H A;  1J1E C;  2IFM A;  1N7S A;  1S9K E;  2WT7 B;  2VRS A;  2WPQ A;  1L0L K;  1XTG B;  4RES B;  2PAJ A;  2WWW A;  1J1E B;  1GZL A;  1YYC A;  1IC2 A;  1SFC D;  2J59 M;  3P32 A;  1ZLL A;  5AVY B;  1LTJ C;  3BVH A;  4HYT B;  3H32 B;  3SWF A;  4I6M C;  1YTZ T;  3P8C E;  5AW5 B;  2YMY A;  1GK6 A;  2WPR A;  3VP9 A;  2P1J A;  3L37 A;  3R2P A;  1LTJ B;  1MZ9 A;  1VPC A;  1IFJ A;  1FJP A;  2IPP A;  1RF1 A;  1M1J C;  3NMD A;  1FZC A;  1ZR2 A;  3M0A A;  2GUV A;  2M8R A;  3II6 A;  3TNU B;  2WPS A;  1M1J B;  4N78 E;  1SFC A;  1ZN5 A;  1L4A D;  3VP8 A;  3WMM 0;  1S9K D;  1M7L A;  4EIJ A;  5CCH D;  2A45 G;  3HE4 A;  3HE5 A;  4WY4 D;  5APT A;  5AVX B;  5AVQ B;  1N73 C;  4JYB A;  1AFO A;  1IFI A;  3M0D A;  5AW1 B;  4EOT A;  3VMX A;  2KP8 A;  4Y99 C;  1H8A A;  3E1I A;  1JUN A;  2W6B A;  5KJ7 D;  4C7N B;  1N73 B;  1DX7 A;  1URQ D;  3P8C D;  1FZA A;  2YKQ A;  3MGN A;  2OAR A;  1N7L A;  3GHG B;  4Y99 B;  1N86 A;  2KOG A;  1IFD A;  1CI6 B;  2HPC B;  1G1J A;  1L4A A;  2A45 I;  2KB7 P;  1NOH A;  2HG5 D;  3G3Z A;  3BAS A;  3UIA A;  5CCH A;  3L35 A;  2NPS D;  4WY4 A;  1JO5 A;  1DEB A;  1OXZ A;  2Z5H A;  4N78 D;  3M06 A;  4GT1 A;  3OAK A;  2ZXE B;  1W2E A;  1MUU A;  1OWA A;  5KJ7 A;  3V2R A;  2R5B A;  1N7S D;  1IJD B;  1G1I A;  4JF7 A;  5AW7 B;  2PP6 A;  2M3B A;  1URQ A;  2MJZ A;  2FYZ A;  3B8E B;  3I5C A;  2JEE A;  1IFN A;  3NXS A;  1X8Y A;  4HH2 A;  4JYC A;  3VMZ A;  5CCG C;  1JNM A;  2HYN A;  3HD7 C;  1NTM K;  5APY A;  1GU5 A;  4DOJ A;  3KPE A;  1YTZ I;  4KHX A;  2XNX A;  1SFC C;  3HD7 B;  4XE5 B;  2WTY A;  1JTH A;  2WSE H;  1GW4 A;  1RF0 A;  1CW5 A;  2Q5U A;  3MTU E;  1LT9 A;  1SFC B;  3M0D C;  4I2L C;  1SQQ K;  2E42 A;  4LC1 A;  4C46 A;  1G2C A;  1J2J B;  2XV5 A;  3MD0 A;  4O9B A;  3NTN A;  2L5G B;  2HLO A;  1RY3 A;  4AQR D;  1LTT C;  3N4X A;  1SP4 A;  4B86 A;  4LGD E;  1SLQ A;  3IR9 A;  3HUS A;  1ZR4 A;  3MUD A;  1WRG A;  5APS A;  1MFZ A;  2XKM A;  1J1D C;  4OH8 B;  1FZG A;  3SWY A;  2QM8 A;  1LTA C;  2N1T D;  1FZF A;  3VMY A;  5BVZ A;  2YO3 A;  3OA7 A;  1L4A C;  1RE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...