4WYMA

Structural basis of hiv-1 capsid recognition by cpsf6
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
214
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 66
structure length 214
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4wymA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4wymA02
2ONTA 4COCA 2L6EA 2JYLA 1M9XC 4IPYA 2X82A 2M8PA 1G03A 4PH0A 4U0FA 2WLVA 1A8OA 1M9YC 3MGEA 5JPAA 2KGFA 1M9EC 4J93A 2JO0A 2M8LA 4PH1A 2XGUA 4XFXA 2BUOA 4XFYA 3VRLC 2GOLB 4DGAC 2XGVA 2PWOA 5HGMA 3LRYA 1QRJA 3G1IA 1EOQA 4COPA 3G1GA 2X83A 2Y4ZA 5HGNA 4WYMA 1EM9A 3DS1A 4E91A 4E92A 1E6JP 1GWPA 2M8NA 2JPRA 1M9DC 3G21A 5DCKA 3P05A 4LQWC 3G0VA 3G29A 4M0IA 4XFZA 1D1DA 1AUMA 4B4NA 4DGEC 2KODA 2XV6A 1BAJA 4NX4C 4U0CA 4U0DA 1U7KA 2PWMA 5HGLA 2GONA 1P7NA 4QNBA 3DTJA 5HGOA 4XROA 1A43A 4PH3A 3DS5A 3H4EA 2V4XA 3DS0A 3G26A 2XDEA 3G28A 4U0BA 4U0AA 2EIAA 4HTWA 2XT1A 2XXMA 4PH2A 4U0EA 3DS4A 1M9FC 1AK4C 2X2DD 3H47A 2WLVB 3NTEA 5HGKA 1EIAA 2LF4A 4INBA 2JYGA 3DS2A 3DPHA 2PXRC 1M9CC 1AFVA 3BP9A 2XGYA 4XRQA 1L6NA 3DS3A 5I4TG
chains in the Genus database with same CATH superfamily
2GZIA 1DNYA 2K0XA 1YJWP 1DV5A 2PEMA 2KOOA 2JU2A 2BHVA 3B4QA 1G03A 4PH0A 1A8OA 1M9YC 5JPAA 2KGFA 2K92A 2L4BA 2OTJP 2FQ2A 1ACPA 2AFEA 1VKUA 3G71P 2FQ1A 2FADA 2FQ0A 3WBHA 3OW2O 3E2DA 2PEIA 3CC7P 4IZ6A 3G1IA 2JGPA 1VQNP 2NO8A 3RG6C 2CG5B 2K0YA 2Y4ZA 5HGNA 2VLOA 2CGQA 3DS1A 2KGEA 5KP8B 4E91A 2QA4P 4E92A 5KP6B 3EJEA 5HV8A 2JPRA 3G21A 1VQPP 4BPHA 5DCKA 2JQ4A 4LQWC 2KWLA 2XV6A 2KG8A 1BAJA 3CMAP 1Q7YQ 2PEQA 2GDXA 1L0IA 1UJZA 4QNBA 3DTJA 5HGOA 1RO0A 4PH3A 2OARA 3DS5A 4PWVB 2LTEA 2VSQA 2V4XA 1KC8Q 3G26A 4GR2A 1HQBA 3G28A 4U0AA 3CC4P 2VLQA 2KOPA 1N8RQ 2X2DD 3H47A 3NTEA 1GXGA 1M90Q 3CD6P 2XZ1C 1AFVA 3BP9A 1IUQA 3Q20A 2MVUA 5EJDA 2GYKA 2K0DX 4R0MA 1RNIA 3CCLP 2ONTA 2N6YA 4COCA 3G6EP 3CCEP 3NY7B 3I56P 2X82A 2Z46A 1VQ4P 4U0FA 2WLVA 2XZ0D 7CEIA 4CA3A 2MR8A 1YI2P 1K73Q 1L0HA 2ROQA 2K2QA 1K8AQ 3EJDA 2K93A 2LPKA 2MF4A 1BXIA 1GXHA 2Z44A 4PH1A 2GZEA 2GZGA 3GZLA 2K94A 2PEKA 2KR5A 1VQKP 2XGVA 4BPGA 1E0HA 1KLPA 1QRJA 2KG9A 3G1GA 3GJNA 3CCVP 2N98A 2FACA 5CZDB 2L9FA 2M8NA 1VQ5P 2PENA 2KORA 3CCJP 1KQSO 2ERHA 1K9MQ 5KP7B 1D1DA 2PNGA 1AUMA 2KOSA 2KODA 1QVFO 2AVAA 2N5HA 2LIUA 3I55P 4U0CA 1VQMP 1U7KA 2PWMA 5HGLA 1YIJP 2JBGA 1A43A 3CCMP 2VLPA 2L0QA 3H4EA 2K5XA 4U0BA 3HYBA 4F37A 1VQLP 4U0EA 1M9FC 4NEOA 3LMOA 2KGCA 2LF4A 2JYGA 3DPHA 3M1MA 2PXRC 5HVCA 1VQOP 1K30A 2EHSA 2VLNA 2EHTA 2N50A 2FVAA 2CWOA 2QEXP 2N5IA 3CCRP 2JYLA 1M9XC 4IPYA 2FVFA 2LMLA 3MGEA 1EMVA 2JU1A 1X3OA 1M1KQ 5F2OA 2N6ZA 1NJIQ 4J93A 1M6NA 1M74A 2X2BA 1MZ8A 1VHNA 2KGDA 2KGAA 2XGUA 4XFXA 1IMPA 4XFYA 3CCSP 2GOLB 4DGAC 4BPFA 1ZNVA 1YJNP 1KD1Q 2PWOA 3B5IA 1AF8A 3LRYA 2MVVA 2X83A 5F2KA 2GDWA 1EM9A 1Q81Q 1IMQA 2CNRA 1AYIA 1E6JP 1GWPA 3G0VA 4MRTC 3CE7A 2MD9A 2PEOA 4B4NA 4DGEC 2FHSC 2CQ8A 3EJBA 4H2WC 1YJ9P 2OTLP 3CXCO 3CCUP 4HKGA 2GZFA 3GZMA 1VQ9P 2KG6A 2DGYA 2EIAA 2XT1A 2L22A 4PH2A 2XXMA 1Z6MA 3CCQP 1AK4C 2LL8A 1F80D 5EW5E 3CMEP 5HGKA 4H2YC 4INBA 3DS2A 1JJ2O 1M9CC 4H2XC 1L6NA 2KW2A 4GR6A 2GZJA 3CPWO 1HY8A 3H0DA 2L6EA 1YHQP 5F2NA 2M8PA 2PY8A 4QKOA 3U43A 1M9EC 2EFJA 5BS2A 2KOQA 2JO0A 2LIWA 1FR2A 2M8LA 2AF8A 2BUOA 3VRLC 1M6EX 1ZMBA 1NQ4A 5HGMA 5BS1A 2FVEA 2JB0A 1EOQA 4COPA 4PXHB 2QNWA 4WYMA 2GDYA 2LKIA 1YITP 1VQ8P 2E1MA 1VQ7P 1Q82Q 1M9DC 2Z45A 3RG2A 3P05A 4DG9A 2DNWA 3G29A 2P9XA 4M0IA 4XFZA 1Q86Q 1QVGO 4NX4C 2LOLA 2EG5A 4UHPB 2JAZA 2FAEA 2WPTA 4U0DA 2MR7A 3CC2P 2GONA 2AFDA 2M5RA 1P7NA 3HZQA 4XROA 1VQ6P 3DS0A 1W2BO 2XDEA 4HTWA 3GKLC 3DS4A 1RO2A 2WLVB 2PEJA 3G4SP 1T8KA 1EIAA 1S72P 1UNKA 1GPJA 2MY5A 2XGYA 1CEIA 4XRQA 1OR5A 3DS3A 5I4TG
chains in the Genus database with same CATH topology
2CWOA 3H0DA 2QEXP 1YJWP 1RNIA 3CCLP 2PEMA 2ONTA 4COCA 2L6EA 3CCRP 3G6EP 3CCEP 2JYLA 2BHVA 1YHQP 1M9XC 4IPYA 5F2NA 3I56P 2X82A 2M8PA 1G03A 2Z46A 1VQ4P 2PY8A 4PH0A 4U0FA 2WLVA 1A8OA 1M9YC 3MGEA 5JPAA 2KGFA 1M1KQ 1YI2P 1K73Q 1M9EC 5F2OA 2EFJA 5BS2A 1NJIQ 4J93A 1M6NA 2OTJP 2JO0A 1K8AQ 1M74A 3G71P 2M8LA 2Z44A 4PH1A 2XGUA 4XFXA 2BUOA 4XFYA 2PEKA 3VRLC 3CCSP 3WBHA 2GOLB 1M6EX 1ZMBA 4DGAC 1VQKP 3OW2O 2XGVA 3E2DA 1YJNP 1KD1Q 2PWOA 3B5IA 2PEIA 3CC7P 5HGMA 3LRYA 1QRJA 3G1IA 5BS1A 1VQNP 1EOQA 4COPA 3G1GA 2X83A 3RG6C 5F2KA 2Y4ZA 5HGNA 4WYMA 1EM9A 3DS1A 1Q81Q 3CCVP 1YITP 1VQ8P 4E91A 2QA4P 4E92A 2E1MA 1E6JP 1VQ7P 1GWPA 2M8NA 1VQ5P 2PENA 1Q82Q 2JPRA 3CCJP 1M9DC 3G21A 1KQSO 1VQPP 2Z45A 1K9MQ 5DCKA 3P05A 4LQWC 3G0VA 3G29A 2P9XA 4M0IA 4XFZA 1D1DA 1Q86Q 2PEOA 1AUMA 4B4NA 4DGEC 2KODA 2XV6A 1QVGO 1BAJA 1QVFO 3CMAP 4NX4C 2EG5A 3I55P 1Q7YQ 2PEQA 1YJ9P 4U0CA 4U0DA 1VQMP 1U7KA 3CC2P 2PWMA 2OTLP 5HGLA 2GONA 3CXCO 3CCUP 1P7NA 4QNBA 1YIJP 3DTJA 5HGOA 3HZQA 4XROA 1A43A 1RO0A 4PH3A 3CCMP 2OARA 3DS5A 1VQ6P 3H4EA 2V4XA 3DS0A 1KC8Q 1W2BO 3G26A 4GR2A 1VQ9P 2XDEA 3G28A 4U0BA 4U0AA 2DGYA 2EIAA 3HYBA 3CC4P 1VQLP 4HTWA 2XT1A 2XXMA 4PH2A 4U0EA 3CCQP 3DS4A 1M9FC 1N8RQ 1AK4C 1RO2A 2X2DD 3H47A 2WLVB 2PEJA 3G4SP 3CMEP 3NTEA 5HGKA 1EIAA 2LF4A 1S72P 4INBA 2JYGA 1M90Q 3DS2A 3DPHA 3M1MA 1JJ2O 2PXRC 1M9CC 3CD6P 1VQOP 1AFVA 3BP9A 2XGYA 1K30A 4XRQA 1L6NA 3DS3A 5I4TG 1IUQA 3Q20A 4GR6A 3CPWO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ONT A;  4COC A;  2L6E A;  2JYL A;  1M9X C;  4IPY A;  2X82 A;  2M8P A;  1G03 A;  4PH0 A;  4U0F A;  2WLV A;  1A8O A;  1M9Y C;  3MGE A;  5JPA A;  2KGF A;  1M9E C;  4J93 A;  2JO0 A;  2M8L A;  4PH1 A;  2XGU A;  4XFX A;  2BUO A;  4XFY A;  3VRL C;  2GOL B;  4DGA C;  2XGV A;  2PWO A;  5HGM A;  3LRY A;  1QRJ A;  3G1I A;  1EOQ A;  4COP A;  3G1G A;  2X83 A;  2Y4Z A;  5HGN A;  4WYM A;  1EM9 A;  3DS1 A;  4E91 A;  4E92 A;  1E6J P;  1GWP A;  2M8N A;  2JPR A;  1M9D C;  3G21 A;  5DCK A;  3P05 A;  4LQW C;  3G0V A;  3G29 A;  4M0I A;  4XFZ A;  1D1D A;  1AUM A;  4B4N A;  4DGE C;  2KOD A;  2XV6 A;  1BAJ A;  4NX4 C;  4U0C A;  4U0D A;  1U7K A;  2PWM A;  5HGL A;  2GON A;  1P7N A;  4QNB A;  3DTJ A;  5HGO A;  4XRO A;  1A43 A;  4PH3 A;  3DS5 A;  3H4E A;  2V4X A;  3DS0 A;  3G26 A;  2XDE A;  3G28 A;  4U0B A;  4U0A A;  2EIA A;  4HTW A;  2XT1 A;  2XXM A;  4PH2 A;  4U0E A;  3DS4 A;  1M9F C;  1AK4 C;  2X2D D;  3H47 A;  2WLV B;  3NTE A;  5HGK A;  1EIA A;  2LF4 A;  4INB A;  2JYG A;  3DS2 A;  3DPH A;  2PXR C;  1M9C C;  1AFV A;  3BP9 A;  2XGY A;  4XRQ A;  1L6N A;  3DS3 A;  5I4T G; 
#chains in the Genus database with same CATH topology
 2GZI A;  1DNY A;  2K0X A;  1YJW P;  1DV5 A;  2PEM A;  2KOO A;  2JU2 A;  2BHV A;  3B4Q A;  1G03 A;  4PH0 A;  1A8O A;  1M9Y C;  5JPA A;  2KGF A;  2K92 A;  2L4B A;  2OTJ P;  2FQ2 A;  1ACP A;  2AFE A;  1VKU A;  3G71 P;  2FQ1 A;  2FAD A;  2FQ0 A;  3WBH A;  3OW2 O;  3E2D A;  2PEI A;  3CC7 P;  4IZ6 A;  3G1I A;  2JGP A;  1VQN P;  2NO8 A;  3RG6 C;  2CG5 B;  2K0Y A;  2Y4Z A;  5HGN A;  2VLO A;  2CGQ A;  3DS1 A;  2KGE A;  5KP8 B;  4E91 A;  2QA4 P;  4E92 A;  5KP6 B;  3EJE A;  5HV8 A;  2JPR A;  3G21 A;  1VQP P;  4BPH A;  5DCK A;  2JQ4 A;  4LQW C;  2KWL A;  2XV6 A;  2KG8 A;  1BAJ A;  3CMA P;  1Q7Y Q;  2PEQ A;  2GDX A;  1L0I A;  1UJZ A;  4QNB A;  3DTJ A;  5HGO A;  1RO0 A;  4PH3 A;  2OAR A;  3DS5 A;  4PWV B;  2LTE A;  2VSQ A;  2V4X A;  1KC8 Q;  3G26 A;  4GR2 A;  1HQB A;  3G28 A;  4U0A A;  3CC4 P;  2VLQ A;  2KOP A;  1N8R Q;  2X2D D;  3H47 A;  3NTE A;  1GXG A;  1M90 Q;  3CD6 P;  2XZ1 C;  1AFV A;  3BP9 A;  1IUQ A;  3Q20 A;  2MVU A;  5EJD A;  2GYK A;  2K0D X;  4R0M A;  1RNI A;  3CCL P;  2ONT A;  2N6Y A;  4COC A;  3G6E P;  3CCE P;  3NY7 B;  3I56 P;  2X82 A;  2Z46 A;  1VQ4 P;  4U0F A;  2WLV A;  2XZ0 D;  7CEI A;  4CA3 A;  2MR8 A;  1YI2 P;  1K73 Q;  1L0H A;  2ROQ A;  2K2Q A;  1K8A Q;  3EJD A;  2K93 A;  2LPK A;  2MF4 A;  1BXI A;  1GXH A;  2Z44 A;  4PH1 A;  2GZE A;  2GZG A;  3GZL A;  2K94 A;  2PEK A;  2KR5 A;  1VQK P;  2XGV A;  4BPG A;  1E0H A;  1KLP A;  1QRJ A;  2KG9 A;  3G1G A;  3GJN A;  3CCV P;  2N98 A;  2FAC A;  5CZD B;  2L9F A;  2M8N A;  1VQ5 P;  2PEN A;  2KOR A;  3CCJ P;  1KQS O;  2ERH A;  1K9M Q;  5KP7 B;  1D1D A;  2PNG A;  1AUM A;  2KOS A;  2KOD A;  1QVF O;  2AVA A;  2N5H A;  2LIU A;  3I55 P;  4U0C A;  1VQM P;  1U7K A;  2PWM A;  5HGL A;  1YIJ P;  2JBG A;  1A43 A;  3CCM P;  2VLP A;  2L0Q A;  3H4E A;  2K5X A;  4U0B A;  3HYB A;  4F37 A;  1VQL P;  4U0E A;  1M9F C;  4NEO A;  3LMO A;  2KGC A;  2LF4 A;  2JYG A;  3DPH A;  3M1M A;  2PXR C;  5HVC A;  1VQO P;  1K30 A;  2EHS A;  2VLN A;  2EHT A;  2N50 A;  2FVA A;  2CWO A;  2QEX P;  2N5I A;  3CCR P;  2JYL A;  1M9X C;  4IPY A;  2FVF A;  2LML A;  3MGE A;  1EMV A;  2JU1 A;  1X3O A;  1M1K Q;  5F2O A;  2N6Z A;  1NJI Q;  4J93 A;  1M6N A;  1M74 A;  2X2B A;  1MZ8 A;  1VHN A;  2KGD A;  2KGA A;  2XGU A;  4XFX A;  1IMP A;  4XFY A;  3CCS P;  2GOL B;  4DGA C;  4BPF A;  1ZNV A;  1YJN P;  1KD1 Q;  2PWO A;  3B5I A;  1AF8 A;  3LRY A;  2MVV A;  2X83 A;  5F2K A;  2GDW A;  1EM9 A;  1Q81 Q;  1IMQ A;  2CNR A;  1AYI A;  1E6J P;  1GWP A;  3G0V A;  4MRT C;  3CE7 A;  2MD9 A;  2PEO A;  4B4N A;  4DGE C;  2FHS C;  2CQ8 A;  3EJB A;  4H2W C;  1YJ9 P;  2OTL P;  3CXC O;  3CCU P;  4HKG A;  2GZF A;  3GZM A;  1VQ9 P;  2KG6 A;  2DGY A;  2EIA A;  2XT1 A;  2L22 A;  4PH2 A;  2XXM A;  1Z6M A;  3CCQ P;  1AK4 C;  2LL8 A;  1F80 D;  5EW5 E;  3CME P;  5HGK A;  4H2Y C;  4INB A;  3DS2 A;  1JJ2 O;  1M9C C;  4H2X C;  1L6N A;  2KW2 A;  4GR6 A;  2GZJ A;  3CPW O;  1HY8 A;  3H0D A;  2L6E A;  1YHQ P;  5F2N A;  2M8P A;  2PY8 A;  4QKO A;  3U43 A;  1M9E C;  2EFJ A;  5BS2 A;  2KOQ A;  2JO0 A;  2LIW A;  1FR2 A;  2M8L A;  2AF8 A;  2BUO A;  3VRL C;  1M6E X;  1ZMB A;  1NQ4 A;  5HGM A;  5BS1 A;  2FVE A;  2JB0 A;  1EOQ A;  4COP A;  4PXH B;  2QNW A;  4WYM A;  2GDY A;  2LKI A;  1YIT P;  1VQ8 P;  2E1M A;  1VQ7 P;  1Q82 Q;  1M9D C;  2Z45 A;  3RG2 A;  3P05 A;  4DG9 A;  2DNW A;  3G29 A;  2P9X A;  4M0I A;  4XFZ A;  1Q86 Q;  1QVG O;  4NX4 C;  2LOL A;  2EG5 A;  4UHP B;  2JAZ A;  2FAE A;  2WPT A;  4U0D A;  2MR7 A;  3CC2 P;  2GON A;  2AFD A;  2M5R A;  1P7N A;  3HZQ A;  4XRO A;  1VQ6 P;  3DS0 A;  1W2B O;  2XDE A;  4HTW A;  3GKL C;  3DS4 A;  1RO2 A;  2WLV B;  2PEJ A;  3G4S P;  1T8K A;  1EIA A;  1S72 P;  1UNK A;  1GPJ A;  2MY5 A;  2XGY A;  1CEI A;  4XRQ A;  1OR5 A;  3DS3 A;  5I4T G; 
#chains in the Genus database with same CATH homology
 2CWO A;  3H0D A;  2QEX P;  1YJW P;  1RNI A;  3CCL P;  2PEM A;  2ONT A;  4COC A;  2L6E A;  3CCR P;  3G6E P;  3CCE P;  2JYL A;  2BHV A;  1YHQ P;  1M9X C;  4IPY A;  5F2N A;  3I56 P;  2X82 A;  2M8P A;  1G03 A;  2Z46 A;  1VQ4 P;  2PY8 A;  4PH0 A;  4U0F A;  2WLV A;  1A8O A;  1M9Y C;  3MGE A;  5JPA A;  2KGF A;  1M1K Q;  1YI2 P;  1K73 Q;  1M9E C;  5F2O A;  2EFJ A;  5BS2 A;  1NJI Q;  4J93 A;  1M6N A;  2OTJ P;  2JO0 A;  1K8A Q;  1M74 A;  3G71 P;  2M8L A;  2Z44 A;  4PH1 A;  2XGU A;  4XFX A;  2BUO A;  4XFY A;  2PEK A;  3VRL C;  3CCS P;  3WBH A;  2GOL B;  1M6E X;  1ZMB A;  4DGA C;  1VQK P;  3OW2 O;  2XGV A;  3E2D A;  1YJN P;  1KD1 Q;  2PWO A;  3B5I A;  2PEI A;  3CC7 P;  5HGM A;  3LRY A;  1QRJ A;  3G1I A;  5BS1 A;  1VQN P;  1EOQ A;  4COP A;  3G1G A;  2X83 A;  3RG6 C;  5F2K A;  2Y4Z A;  5HGN A;  4WYM A;  1EM9 A;  3DS1 A;  1Q81 Q;  3CCV P;  1YIT P;  1VQ8 P;  4E91 A;  2QA4 P;  4E92 A;  2E1M A;  1E6J P;  1VQ7 P;  1GWP A;  2M8N A;  1VQ5 P;  2PEN A;  1Q82 Q;  2JPR A;  3CCJ P;  1M9D C;  3G21 A;  1KQS O;  1VQP P;  2Z45 A;  1K9M Q;  5DCK A;  3P05 A;  4LQW C;  3G0V A;  3G29 A;  2P9X A;  4M0I A;  4XFZ A;  1D1D A;  1Q86 Q;  2PEO A;  1AUM A;  4B4N A;  4DGE C;  2KOD A;  2XV6 A;  1QVG O;  1BAJ A;  1QVF O;  3CMA P;  4NX4 C;  2EG5 A;  3I55 P;  1Q7Y Q;  2PEQ A;  1YJ9 P;  4U0C A;  4U0D A;  1VQM P;  1U7K A;  3CC2 P;  2PWM A;  2OTL P;  5HGL A;  2GON A;  3CXC O;  3CCU P;  1P7N A;  4QNB A;  1YIJ P;  3DTJ A;  5HGO A;  3HZQ A;  4XRO A;  1A43 A;  1RO0 A;  4PH3 A;  3CCM P;  2OAR A;  3DS5 A;  1VQ6 P;  3H4E A;  2V4X A;  3DS0 A;  1KC8 Q;  1W2B O;  3G26 A;  4GR2 A;  1VQ9 P;  2XDE A;  3G28 A;  4U0B A;  4U0A A;  2DGY A;  2EIA A;  3HYB A;  3CC4 P;  1VQL P;  4HTW A;  2XT1 A;  2XXM A;  4PH2 A;  4U0E A;  3CCQ P;  3DS4 A;  1M9F C;  1N8R Q;  1AK4 C;  1RO2 A;  2X2D D;  3H47 A;  2WLV B;  2PEJ A;  3G4S P;  3CME P;  3NTE A;  5HGK A;  1EIA A;  2LF4 A;  1S72 P;  4INB A;  2JYG A;  1M90 Q;  3DS2 A;  3DPH A;  3M1M A;  1JJ2 O;  2PXR C;  1M9C C;  3CD6 P;  1VQO P;  1AFV A;  3BP9 A;  2XGY A;  1K30 A;  4XRQ A;  1L6N A;  3DS3 A;  5I4T G;  1IUQ A;  3Q20 A;  4GR6 A;  3CPW O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...