4WYMA

Structural basis of hiv-1 capsid recognition by cpsf6
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
214
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 66
structure length 214
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4wymA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4wymA02
3DS2A 1GWPA 4M0IA 2XGVA 2LF4A 4HTWA 3VRLC 4PH3A 1M9FC 4XFXA 2JO0A 1A43A 3G1IA 2JPRA 2GOLB 5HGLA 4U0DA 4E91A 1M9EC 5JPAA 2PWOA 1AUMA 4U0EA 1E6JP 3G21A 4DGEC 4PH1A 2X2DD 1L6NA 4U0CA 2GONA 5HGKA 2XT1A 2WLVB 4B4NA 3NTEA 3G28A 2Y4ZA 1D1DA 2XV6A 1EIAA 4PH0A 2KODA 4E92A 3DPHA 2XGUA 2XXMA 4XROA 5HGOA 4COCA 4U0FA 5DCKA 2L6EA 2PXRC 5I4TG 3DS1A 1A8OA 4INBA 2BUOA 5HGNA 2EIAA 4QNBA 3H4EA 3H47A 3DS3A 4LQWC 1G03A 3G29A 4J93A 4IPYA 3DTJA 3MGEA 4WYMA 3LRYA 1M9CC 5HGMA 3DS0A 3G0VA 3G1GA 1M9DC 3BP9A 4U0AA 2PWMA 1EOQA 1QRJA 4NX4C 3P05A 2JYLA 2X82A 2ONTA 3DS4A 1U7KA 2V4XA 4DGAC 2KGFA 2XDEA 2JYGA 2M8NA 1AK4C 1M9XC 1EM9A 4U0BA 1AFVA 1BAJA 4PH2A 4XFYA 4XRQA 2M8PA 1P7NA 2WLVA 4XFZA 3DS5A 4COPA 3G26A 1M9YC 2X83A 2XGYA 2M8LA
chains in the Genus database with same CATH superfamily
1GWPA 2LPKA 1K30A 1VQNP 2Z44A 4PH3A 1Q86Q 3G1IA 2QNWA 1N8RQ 5F2OA 3B4QA 2JGPA 3CCRP 4HKGA 2PWOA 5EW5E 3CCQP 1MZ8A 3CCMP 1VQ7P 4BPHA 3CCVP 2WLVB 5F2NA 3G28A 2FAEA 2Y4ZA 1D1DA 4IZ6A 1M90Q 4QKOA 2EG5A 5BS1A 5CZDB 5HGOA 2KOSA 2PY8A 2GZIA 2KOOA 4U0FA 2PNGA 2CGQA 4R0MA 4GR2A 2KG8A 1A8OA 2PENA 3U43A 3DS3A 2K93A 1VQ4P 3CMEP 3EJDA 3G1GA 2EFJA 2CNRA 3CCUP 3CCJP 4U0AA 2CG5B 3CC2P 4GR6A 1YHQP 2JYLA 3GKLC 1NQ4A 1IMQA 2FQ0A 2FVAA 2JQ4A 1CEIA 2GZJA 2GZGA 1M9XC 3E2DA 4XRQA 1P7NA 3G26A 2X83A 2AFEA 3DS2A 4M0IA 3CE7A 2JBGA 4XFXA 2JO0A 2GOLB 2Z45A 4U0DA 1S72P 1ZNVA 3RG6C 3GJNA 1M1KQ 1E6JP 3G21A 1ACPA 1L6NA 3G71P 1ZMBA 2K92A 1KQSO 1GXHA 1VQ9P 2N6ZA 2XV6A 3GZLA 4PH0A 2K0YA 3WBHA 1JJ2O 2QEXP 2XGUA 2KOPA 4XROA 1T8KA 3I56P 4CA3A 5DCKA 3RG2A 2PXRC 1KLPA 2GYKA 4QNBA 3HZQA 3CCEP 2N6YA 1VQ8P 2LIUA 1W2BO 2OTJP 2VLPA 7CEIA 1VQ6P 4WYMA 3LRYA 2NO8A 2VLOA 5HGMA 1L0HA 1X3OA 3DS0A 2LMLA 2GDYA 3BP9A 2PWMA 2X2BA 2VLNA 2FADA 1K8AQ 2KG6A 2ERHA 1M74A 2MVVA 1U7KA 2FVEA 2MVUA 1UNKA 2XDEA 4PXHB 5KP7B 1YJWP 1Q82Q 5BS2A 1FR2A 4U0BA 1YI2P 1BAJA 4XFYA 2L9FA 2KR5A 2FACA 4BPFA 3DS5A 4XFZA 2XGVA 1A43A 1NJIQ 3LMOA 2K0DX 5HGLA 1DNYA 2VLQA 1M9EC 2K0XA 5JPAA 4DGEC 2KWLA 1DV5A 1VQLP 1IUQA 4H2YC 5HGKA 2EHTA 2LOLA 3NTEA 2P9XA 1Z6MA 2GDWA 3CCSP 1YJ9P 2KODA 2PEKA 2LKIA 3DPHA 2ROQA 1VQ5P 2M5RA 5HV8A 1HY8A 1KD1Q 1VQOP 2FQ2A 1YITP 1AF8A 2DGYA 2BUOA 5HGNA 2EIAA 1M6EX 3CMAP 5HVCA 3H4EA 3H47A 1VQMP 3H0DA 1GPJA 4LQWC 3CCLP 2K94A 4J93A 3MGEA 1K73Q 2MR8A 3CD6P 4BPGA 3NY7B 1EOQA 3OW2O 2E1MA 4NX4C 2VSQA 3P05A 1RO2A 2KOQA 5F2KA 2AVAA 2PEIA 2JB0A 3GZMA 1VKUA 1Q81Q 1VQKP 2MF4A 3CC7P 2L4BA 3B5IA 3DS4A 1Q7YQ 3G4SP 2M8NA 1AK4C 2XZ1C 1EM9A 2KORA 2M8PA 2GZFA 2KGEA 2FHSC 3Q20A 2WLVA 3G6EP 2BHVA 2N5HA 1M9YC 2XGYA 2XZ0D 4H2WC 2KW2A 2K2QA 1VQPP 2LF4A 4HTWA 2KGAA 5EJDA 3VRLC 1M9FC 2K5XA 1EMVA 4F37A 2JPRA 2Z46A 2LIWA 2CWOA 4E91A 4NEOA 1HQBA 2GZEA 3M1MA 1AUMA 4U0EA 1E0HA 1KC8Q 4PH1A 2X2DD 2L0QA 2KGCA 4U0CA 2GONA 2N98A 3CPWO 1GXGA 2XT1A 2LTEA 4B4NA 1BXIA 2FQ1A 1EIAA 5KP6B 2AFDA 1K9MQ 1YJNP 4DG9A 4E92A 1QVGO 2XXMA 4UHPB 2MR7A 2WPTA 4COCA 1RO0A 2L6EA 2LL8A 5I4TG 2FVFA 3DS1A 1OR5A 4INBA 3CC4P 2CQ8A 2OTLP 4MRTC 2PEJA 1G03A 3G29A 4IPYA 3DTJA 2GDXA 2JAZA 1M9CC 2JU1A 5KP8B 2DNWA 2AF8A 2N50A 3G0VA 3EJEA 2PEOA 1VHNA 3I55P 1M9DC 4PWVB 1YIJP 1QRJA 1M6NA 1AYIA 2PEMA 1IMPA 4H2XC 2KG9A 3EJBA 1F80D 2QA4P 2L22A 2X82A 2ONTA 2JU2A 2MY5A 1L0IA 2V4XA 4DGAC 1UJZA 3CXCO 2KGFA 2KGDA 1RNIA 2JYGA 1QVFO 3HYBA 2EHSA 2MD9A 1AFVA 2OARA 4PH2A 4COPA 2PEQA 2N5IA 2M8LA
chains in the Genus database with same CATH topology
3DS2A 1GWPA 4M0IA 1K30A 1VQPP 1VQNP 2XGVA 2LF4A 2Z44A 4HTWA 3VRLC 4PH3A 1Q86Q 1M9FC 4XFXA 2JO0A 1A43A 3G1IA 1NJIQ 2JPRA 2GOLB 2Z46A 5HGLA 5F2OA 1N8RQ 2Z45A 4U0DA 2CWOA 1S72P 4E91A 3RG6C 1M9EC 5JPAA 1M1KQ 3CCRP 3M1MA 2PWOA 1AUMA 4U0EA 1KC8Q 1E6JP 3G21A 3CCQP 4DGEC 4PH1A 2X2DD 1VQLP 1IUQA 3CCMP 1L6NA 4U0CA 2GONA 3CPWO 5HGKA 2XT1A 3G71P 1VQ7P 1ZMBA 1KQSO 3CCVP 2WLVB 4B4NA 3NTEA 3G28A 2Y4ZA 5F2NA 1VQ9P 1D1DA 2XV6A 2P9XA 1EIAA 4PH0A 1K9MQ 1YJ9P 3CCSP 1YJNP 3WBHA 2KODA 4E92A 1M90Q 2PEKA 3DPHA 1QVGO 2EG5A 5BS1A 2QEXP 1VQ5P 2XGUA 1JJ2O 2XXMA 4XROA 5HGOA 2PY8A 4COCA 3I56P 4U0FA 5DCKA 1RO0A 1KD1Q 2L6EA 2PXRC 4GR2A 1VQOP 5I4TG 1YITP 3DS1A 1A8OA 2PENA 2DGYA 4INBA 2BUOA 3CC4P 5HGNA 2EIAA 1M6EX 4QNBA 3HZQA 3H4EA 3H47A 3CMAP 3H0DA 1VQMP 1VQ8P 3CCEP 1VQ6P 3DS3A 1W2BO 2OTLP 2OTJP 2PEJA 4LQWC 1G03A 3G29A 4J93A 4IPYA 1VQ4P 3DTJA 3CCLP 3MGEA 4WYMA 3CMEP 3LRYA 1M9CC 1K73Q 5HGMA 3DS0A 3CD6P 3G0VA 3G1GA 2EFJA 3CCUP 3CCJP 2PEOA 3I55P 1M9DC 3BP9A 4U0AA 1YIJP 2PWMA 3CC2P 1EOQA 1QRJA 4GR6A 3OW2O 1M6NA 2E1MA 4NX4C 1YHQP 2PEMA 3P05A 2JYLA 1K8AQ 1RO2A 2QA4P 5F2KA 2PEIA 1VQKP 1Q81Q 3CC7P 1M74A 2X82A 2ONTA 3B5IA 3DS4A 1Q7YQ 1U7KA 2V4XA 4DGAC 3CXCO 3G4SP 2KGFA 2XDEA 1RNIA 2JYGA 2M8NA 1YJWP 1Q82Q 1AK4C 1M9XC 3E2DA 3HYBA 5BS2A 1EM9A 1QVFO 4U0BA 1AFVA 2OARA 1YI2P 1BAJA 4PH2A 4XFYA 4XRQA 2M8PA 1P7NA 3Q20A 2WLVA 4XFZA 2PEQA 3DS5A 3G26A 4COPA 2BHVA 3G6EP 1M9YC 2X83A 2XGYA 2M8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DS2 A;  1GWP A;  4M0I A;  2XGV A;  2LF4 A;  4HTW A;  3VRL C;  4PH3 A;  1M9F C;  4XFX A;  2JO0 A;  1A43 A;  3G1I A;  2JPR A;  2GOL B;  5HGL A;  4U0D A;  4E91 A;  1M9E C;  5JPA A;  2PWO A;  1AUM A;  4U0E A;  1E6J P;  3G21 A;  4DGE C;  4PH1 A;  2X2D D;  1L6N A;  4U0C A;  2GON A;  5HGK A;  2XT1 A;  2WLV B;  4B4N A;  3NTE A;  3G28 A;  2Y4Z A;  1D1D A;  2XV6 A;  1EIA A;  4PH0 A;  2KOD A;  4E92 A;  3DPH A;  2XGU A;  2XXM A;  4XRO A;  5HGO A;  4COC A;  4U0F A;  5DCK A;  2L6E A;  2PXR C;  5I4T G;  3DS1 A;  1A8O A;  4INB A;  2BUO A;  5HGN A;  2EIA A;  4QNB A;  3H4E A;  3H47 A;  3DS3 A;  4LQW C;  1G03 A;  3G29 A;  4J93 A;  4IPY A;  3DTJ A;  3MGE A;  4WYM A;  3LRY A;  1M9C C;  5HGM A;  3DS0 A;  3G0V A;  3G1G A;  1M9D C;  3BP9 A;  4U0A A;  2PWM A;  1EOQ A;  1QRJ A;  4NX4 C;  3P05 A;  2JYL A;  2X82 A;  2ONT A;  3DS4 A;  1U7K A;  2V4X A;  4DGA C;  2KGF A;  2XDE A;  2JYG A;  2M8N A;  1AK4 C;  1M9X C;  1EM9 A;  4U0B A;  1AFV A;  1BAJ A;  4PH2 A;  4XFY A;  4XRQ A;  2M8P A;  1P7N A;  2WLV A;  4XFZ A;  3DS5 A;  4COP A;  3G26 A;  1M9Y C;  2X83 A;  2XGY A;  2M8L A; 
#chains in the Genus database with same CATH topology
 1GWP A;  2LPK A;  1K30 A;  1VQN P;  2Z44 A;  4PH3 A;  1Q86 Q;  3G1I A;  2QNW A;  1N8R Q;  5F2O A;  3B4Q A;  2JGP A;  3CCR P;  4HKG A;  2PWO A;  5EW5 E;  3CCQ P;  1MZ8 A;  3CCM P;  1VQ7 P;  4BPH A;  3CCV P;  2WLV B;  5F2N A;  3G28 A;  2FAE A;  2Y4Z A;  1D1D A;  4IZ6 A;  1M90 Q;  4QKO A;  2EG5 A;  5BS1 A;  5CZD B;  5HGO A;  2KOS A;  2PY8 A;  2GZI A;  2KOO A;  4U0F A;  2PNG A;  2CGQ A;  4R0M A;  4GR2 A;  2KG8 A;  1A8O A;  2PEN A;  3U43 A;  3DS3 A;  2K93 A;  1VQ4 P;  3CME P;  3EJD A;  3G1G A;  2EFJ A;  2CNR A;  3CCU P;  3CCJ P;  4U0A A;  2CG5 B;  3CC2 P;  4GR6 A;  1YHQ P;  2JYL A;  3GKL C;  1NQ4 A;  1IMQ A;  2FQ0 A;  2FVA A;  2JQ4 A;  1CEI A;  2GZJ A;  2GZG A;  1M9X C;  3E2D A;  4XRQ A;  1P7N A;  3G26 A;  2X83 A;  2AFE A;  3DS2 A;  4M0I A;  3CE7 A;  2JBG A;  4XFX A;  2JO0 A;  2GOL B;  2Z45 A;  4U0D A;  1S72 P;  1ZNV A;  3RG6 C;  3GJN A;  1M1K Q;  1E6J P;  3G21 A;  1ACP A;  1L6N A;  3G71 P;  1ZMB A;  2K92 A;  1KQS O;  1GXH A;  1VQ9 P;  2N6Z A;  2XV6 A;  3GZL A;  4PH0 A;  2K0Y A;  3WBH A;  1JJ2 O;  2QEX P;  2XGU A;  2KOP A;  4XRO A;  1T8K A;  3I56 P;  4CA3 A;  5DCK A;  3RG2 A;  2PXR C;  1KLP A;  2GYK A;  4QNB A;  3HZQ A;  3CCE P;  2N6Y A;  1VQ8 P;  2LIU A;  1W2B O;  2OTJ P;  2VLP A;  7CEI A;  1VQ6 P;  4WYM A;  3LRY A;  2NO8 A;  2VLO A;  5HGM A;  1L0H A;  1X3O A;  3DS0 A;  2LML A;  2GDY A;  3BP9 A;  2PWM A;  2X2B A;  2VLN A;  2FAD A;  1K8A Q;  2KG6 A;  2ERH A;  1M74 A;  2MVV A;  1U7K A;  2FVE A;  2MVU A;  1UNK A;  2XDE A;  4PXH B;  5KP7 B;  1YJW P;  1Q82 Q;  5BS2 A;  1FR2 A;  4U0B A;  1YI2 P;  1BAJ A;  4XFY A;  2L9F A;  2KR5 A;  2FAC A;  4BPF A;  3DS5 A;  4XFZ A;  2XGV A;  1A43 A;  1NJI Q;  3LMO A;  2K0D X;  5HGL A;  1DNY A;  2VLQ A;  1M9E C;  2K0X A;  5JPA A;  4DGE C;  2KWL A;  1DV5 A;  1VQL P;  1IUQ A;  4H2Y C;  5HGK A;  2EHT A;  2LOL A;  3NTE A;  2P9X A;  1Z6M A;  2GDW A;  3CCS P;  1YJ9 P;  2KOD A;  2PEK A;  2LKI A;  3DPH A;  2ROQ A;  1VQ5 P;  2M5R A;  5HV8 A;  1HY8 A;  1KD1 Q;  1VQO P;  2FQ2 A;  1YIT P;  1AF8 A;  2DGY A;  2BUO A;  5HGN A;  2EIA A;  1M6E X;  3CMA P;  5HVC A;  3H4E A;  3H47 A;  1VQM P;  3H0D A;  1GPJ A;  4LQW C;  3CCL P;  2K94 A;  4J93 A;  3MGE A;  1K73 Q;  2MR8 A;  3CD6 P;  4BPG A;  3NY7 B;  1EOQ A;  3OW2 O;  2E1M A;  4NX4 C;  2VSQ A;  3P05 A;  1RO2 A;  2KOQ A;  5F2K A;  2AVA A;  2PEI A;  2JB0 A;  3GZM A;  1VKU A;  1Q81 Q;  1VQK P;  2MF4 A;  3CC7 P;  2L4B A;  3B5I A;  3DS4 A;  1Q7Y Q;  3G4S P;  2M8N A;  1AK4 C;  2XZ1 C;  1EM9 A;  2KOR A;  2M8P A;  2GZF A;  2KGE A;  2FHS C;  3Q20 A;  2WLV A;  3G6E P;  2BHV A;  2N5H A;  1M9Y C;  2XGY A;  2XZ0 D;  4H2W C;  2KW2 A;  2K2Q A;  1VQP P;  2LF4 A;  4HTW A;  2KGA A;  5EJD A;  3VRL C;  1M9F C;  2K5X A;  1EMV A;  4F37 A;  2JPR A;  2Z46 A;  2LIW A;  2CWO A;  4E91 A;  4NEO A;  1HQB A;  2GZE A;  3M1M A;  1AUM A;  4U0E A;  1E0H A;  1KC8 Q;  4PH1 A;  2X2D D;  2L0Q A;  2KGC A;  4U0C A;  2GON A;  2N98 A;  3CPW O;  1GXG A;  2XT1 A;  2LTE A;  4B4N A;  1BXI A;  2FQ1 A;  1EIA A;  5KP6 B;  2AFD A;  1K9M Q;  1YJN P;  4DG9 A;  4E92 A;  1QVG O;  2XXM A;  4UHP B;  2MR7 A;  2WPT A;  4COC A;  1RO0 A;  2L6E A;  2LL8 A;  5I4T G;  2FVF A;  3DS1 A;  1OR5 A;  4INB A;  3CC4 P;  2CQ8 A;  2OTL P;  4MRT C;  2PEJ A;  1G03 A;  3G29 A;  4IPY A;  3DTJ A;  2GDX A;  2JAZ A;  1M9C C;  2JU1 A;  5KP8 B;  2DNW A;  2AF8 A;  2N50 A;  3G0V A;  3EJE A;  2PEO A;  1VHN A;  3I55 P;  1M9D C;  4PWV B;  1YIJ P;  1QRJ A;  1M6N A;  1AYI A;  2PEM A;  1IMP A;  4H2X C;  2KG9 A;  3EJB A;  1F80 D;  2QA4 P;  2L22 A;  2X82 A;  2ONT A;  2JU2 A;  2MY5 A;  1L0I A;  2V4X A;  4DGA C;  1UJZ A;  3CXC O;  2KGF A;  2KGD A;  1RNI A;  2JYG A;  1QVF O;  3HYB A;  2EHS A;  2MD9 A;  1AFV A;  2OAR A;  4PH2 A;  4COP A;  2PEQ A;  2N5I A;  2M8L A; 
#chains in the Genus database with same CATH homology
 3DS2 A;  1GWP A;  4M0I A;  1K30 A;  1VQP P;  1VQN P;  2XGV A;  2LF4 A;  2Z44 A;  4HTW A;  3VRL C;  4PH3 A;  1Q86 Q;  1M9F C;  4XFX A;  2JO0 A;  1A43 A;  3G1I A;  1NJI Q;  2JPR A;  2GOL B;  2Z46 A;  5HGL A;  5F2O A;  1N8R Q;  2Z45 A;  4U0D A;  2CWO A;  1S72 P;  4E91 A;  3RG6 C;  1M9E C;  5JPA A;  1M1K Q;  3CCR P;  3M1M A;  2PWO A;  1AUM A;  4U0E A;  1KC8 Q;  1E6J P;  3G21 A;  3CCQ P;  4DGE C;  4PH1 A;  2X2D D;  1VQL P;  1IUQ A;  3CCM P;  1L6N A;  4U0C A;  2GON A;  3CPW O;  5HGK A;  2XT1 A;  3G71 P;  1VQ7 P;  1ZMB A;  1KQS O;  3CCV P;  2WLV B;  4B4N A;  3NTE A;  3G28 A;  2Y4Z A;  5F2N A;  1VQ9 P;  1D1D A;  2XV6 A;  2P9X A;  1EIA A;  4PH0 A;  1K9M Q;  1YJ9 P;  3CCS P;  1YJN P;  3WBH A;  2KOD A;  4E92 A;  1M90 Q;  2PEK A;  3DPH A;  1QVG O;  2EG5 A;  5BS1 A;  2QEX P;  1VQ5 P;  2XGU A;  1JJ2 O;  2XXM A;  4XRO A;  5HGO A;  2PY8 A;  4COC A;  3I56 P;  4U0F A;  5DCK A;  1RO0 A;  1KD1 Q;  2L6E A;  2PXR C;  4GR2 A;  1VQO P;  5I4T G;  1YIT P;  3DS1 A;  1A8O A;  2PEN A;  2DGY A;  4INB A;  2BUO A;  3CC4 P;  5HGN A;  2EIA A;  1M6E X;  4QNB A;  3HZQ A;  3H4E A;  3H47 A;  3CMA P;  3H0D A;  1VQM P;  1VQ8 P;  3CCE P;  1VQ6 P;  3DS3 A;  1W2B O;  2OTL P;  2OTJ P;  2PEJ A;  4LQW C;  1G03 A;  3G29 A;  4J93 A;  4IPY A;  1VQ4 P;  3DTJ A;  3CCL P;  3MGE A;  4WYM A;  3CME P;  3LRY A;  1M9C C;  1K73 Q;  5HGM A;  3DS0 A;  3CD6 P;  3G0V A;  3G1G A;  2EFJ A;  3CCU P;  3CCJ P;  2PEO A;  3I55 P;  1M9D C;  3BP9 A;  4U0A A;  1YIJ P;  2PWM A;  3CC2 P;  1EOQ A;  1QRJ A;  4GR6 A;  3OW2 O;  1M6N A;  2E1M A;  4NX4 C;  1YHQ P;  2PEM A;  3P05 A;  2JYL A;  1K8A Q;  1RO2 A;  2QA4 P;  5F2K A;  2PEI A;  1VQK P;  1Q81 Q;  3CC7 P;  1M74 A;  2X82 A;  2ONT A;  3B5I A;  3DS4 A;  1Q7Y Q;  1U7K A;  2V4X A;  4DGA C;  3CXC O;  3G4S P;  2KGF A;  2XDE A;  1RNI A;  2JYG A;  2M8N A;  1YJW P;  1Q82 Q;  1AK4 C;  1M9X C;  3E2D A;  3HYB A;  5BS2 A;  1EM9 A;  1QVF O;  4U0B A;  1AFV A;  2OAR A;  1YI2 P;  1BAJ A;  4PH2 A;  4XFY A;  4XRQ A;  2M8P A;  1P7N A;  3Q20 A;  2WLV A;  4XFZ A;  2PEQ A;  3DS5 A;  3G26 A;  4COP A;  2BHV A;  3G6E P;  1M9Y C;  2X83 A;  2XGY A;  2M8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...