4WYMA

Structural basis of hiv-1 capsid recognition by cpsf6
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
214
Chain Sequence
b'PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 66
structure length 214
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4wymA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4wymA02
2XT1A 3DS2A 4XRQA 4PH1A 2XGUA 2Y4ZA 2M8LA 1QRJA 2X2DD 4QNBA 3DTJA 4DGAC 1AK4C 1U7KA 1M9EC 3DPHA 3MGEA 1AFVA 2WLVA 2X83A 1G03A 4INBA 5HGOA 2WLVB 2L6EA 3DS3A 4XROA 3G21A 1EOQA 4IPYA 4U0BA 2PWMA 2XV6A 4XFZA 1D1DA 1A43A 4J93A 3H47A 2JYGA 1M9FC 5JPAA 1E6JP 2GONA 2M8NA 3BP9A 4DGEC 3VRLC 3H4EA 2ONTA 4XFYA 3G0VA 5HGMA 1M9CC 4HTWA 2JYLA 4PH3A 2XGYA 4U0CA 1GWPA 1AUMA 2JO0A 2LF4A 5I4TG 3G1GA 2XXMA 4COPA 2BUOA 5DCKA 4U0AA 4U0EA 3G1IA 3DS5A 1P7NA 4PH0A 5HGNA 2XDEA 1M9DC 5HGLA 3DS4A 3DS0A 2GOLB 4B4NA 4WYMA 2JPRA 1EM9A 2V4XA 2X82A 4E91A 2M8PA 5HGKA 1M9YC 1EIAA 1M9XC 3G26A 3P05A 2EIAA 2PXRC 4PH2A 4U0DA 4XFXA 3DS1A 3LRYA 2KGFA 4COCA 2KODA 4M0IA 1BAJA 4U0FA 4NX4C 4E92A 3G28A 2PWOA 4LQWC 3NTEA 1A8OA 2XGVA 3G29A 1L6NA
chains in the Genus database with same CATH superfamily
1VQPP 4PH1A 1VQLP 2EFJA 2K2QA 2LTEA 1M9EC 3DPHA 1AFVA 2CG5B 3I56P 2CQ8A 2JU2A 2WLVA 1L0HA 2FACA 5HGOA 2M5RA 2X2BA 3CCEP 4IPYA 4U0BA 2XV6A 1GXGA 1VQKP 2L0QA 1K73Q 1ACPA 3GZMA 2VSQA 3GKLC 2KWLA 2LIWA 2GONA 2KW2A 5F2KA 2ONTA 2Z45A 2PEMA 2JGPA 4HTWA 1Q81Q 2KG6A 4U0CA 1IMQA 1VQ8P 1GPJA 4R0MA 1NJIQ 1M90Q 2K94A 5I4TG 1VQ5P 2QEXP 2CNRA 2FAEA 1K8AQ 1JJ2O 2BUOA 2OARA 4NEOA 3G1IA 1RO0A 4IZ6A 2PNGA 3M1MA 2FHSC 2K0YA 3DS4A 2VLNA 2GOLB 4B4NA 2KORA 4WYMA 1M9YC 1EIAA 1YIJP 3G26A 3U43A 2LMLA 2GDWA 2N6YA 2KODA 4M0IA 1VQ7P 1BAJA 3CCJP 1HQBA 1S72P 2CGQA 3G29A 2XT1A 3DS2A 2PEJA 2DGYA 2GZFA 4MRTC 3G4SP 1VQNP 1AYIA 1DV5A 1QRJA 4QNBA 2Z46A 2ROQA 4H2YC 2X83A 2LL8A 4INBA 1K9MQ 1YHQP 2LPKA 2PEIA 4QKOA 3G21A 1EOQA 3CE7A 3NY7B 1D1DA 1A43A 2MR7A 1Q82Q 4DG9A 1VQOP 1T8KA 4PWVB 2JYGA 1ZNVA 2FQ0A 5JPAA 2M8NA 2WPTA 2OTLP 1VKUA 1KQSO 2JAZA 2JU1A 2KGEA 2LKIA 3E2DA 5HGMA 4UHPB 5BS2A 1M6EX 1AUMA 4BPHA 2LIUA 3G1GA 1KD1Q 2PEQA 3HYBA 2BHVA 3CCVP 7CEIA 1Z6MA 3EJBA 1YJ9P 2FVEA 2KR5A 2AFEA 1M9DC 1QVGO 3WBHA 3DS0A 5KP8B 2JPRA 1EM9A 4E91A 1M9XC 3P05A 5EW5E 2PEKA 2EIAA 4PH2A 4U0DA 4XFXA 2QA4P 1KLPA 1Q86Q 1IMPA 1IUQA 2OTJP 3CCRP 2N5IA 3CC7P 2XGVA 2JB0A 2PENA 1L6NA 2KOOA 2GDYA 1UNKA 2JBGA 2QNWA 3B4QA 2M8LA 1VQ4P 2GDXA 2VLOA 2X2DD 3DTJA 4DGAC 3MGEA 3CCQP 3CMEP 5F2NA 3EJEA 1VQ9P 2AF8A 1G03A 2K5XA 2N6ZA 2L6EA 1BXIA 3CCUP 2MR8A 3G6EP 4J93A 3GZLA 2FVAA 1N8RQ 2DNWA 1YJNP 1M9FC 3BP9A 2AFDA 2GZJA 2EHSA 4BPFA 2FQ2A 5F2OA 1HY8A 2MD9A 1F80D 1M9CC 3I55P 2JYLA 3CC4P 4PH3A 1M1KQ 2XGYA 2NO8A 1AF8A 2JO0A 4COPA 5HVCA 5EJDA 2MVVA 5DCKA 4U0EA 1W2BO 3DS5A 3CD6P 2MY5A 2E1MA 5HGLA 1DNYA 2N5HA 3Q20A 2X82A 1RO2A 3CCMP 3CCSP 2M8PA 5HGKA 1EMVA 4H2WC 1YJWP 1YI2P 2P9XA 3LRYA 2KGFA 3RG2A 2MVUA 4E92A 5HV8A 2LOLA 3G28A 2PWOA 1CEIA 2PEOA 1A8OA 2GZIA 2L4BA 2KOQA 2XZ1C 1VQMP 4CA3A 4XRQA 2N50A 1YITP 2JQ4A 4HKGA 2FVFA 2XGUA 2Y4ZA 1GXHA 3GJNA 2XZ0D 1AK4C 1U7KA 3OW2O 2MF4A 3G71P 4F37A 2FADA 1QVFO 2WLVB 3CCLP 3DS3A 4GR6A 4XROA 3CPWO 1K30A 1L0IA 2PY8A 2PWMA 4XFZA 2VLPA 2GZGA 2L22A 3H47A 1RNIA 2KGAA 2KG9A 3H0DA 3EJDA 3CMAP 1KC8Q 2L9FA 3LMOA 1E6JP 1M74A 4GR2A 2EHTA 4DGEC 3VRLC 3H4EA 2K0XA 1VQ6P 4XFYA 2N98A 3G0VA 1FR2A 2AVAA 2KGDA 1OR5A 2K92A 1GWPA 1UJZA 4BPGA 2LF4A 2FQ1A 2XXMA 2KOSA 1NQ4A 4U0AA 1X3OA 2VLQA 3CXCO 3RG6C 1Q7YQ 1P7NA 4PH0A 5HGNA 2CWOA 2ERHA 4PXHB 2XDEA 5KP7B 2EG5A 2GYKA 3CC2P 2K93A 3B5IA 2V4XA 3HZQA 1M6NA 2PXRC 3DS1A 2KOPA 4COCA 1VHNA 2GZEA 2KG8A 4U0FA 1MZ8A 4NX4C 4H2XC 5BS1A 5CZDB 5KP6B 4LQWC 2Z44A 3NTEA 2KGCA 2K0DX 1ZMBA 1E0HA
chains in the Genus database with same CATH topology
2XT1A 3DS2A 1VQMP 1VQPP 2PEJA 2DGYA 4XRQA 3G4SP 1YITP 4PH1A 1VQLP 2EFJA 2XGUA 1VQNP 2Y4ZA 2M8LA 1VQ4P 1QRJA 2X2DD 4QNBA 2Z46A 3DTJA 4DGAC 1AK4C 1U7KA 1M9EC 3DPHA 3OW2O 3MGEA 3CCQP 3CMEP 1AFVA 5F2NA 3I56P 3G71P 2WLVA 2X83A 1VQ9P 1G03A 4INBA 5HGOA 1K9MQ 1YHQP 2WLVB 1QVFO 2PEIA 2L6EA 3CCLP 3DS3A 4GR6A 4XROA 3CPWO 3CCEP 3G21A 1EOQA 1K30A 4IPYA 4U0BA 2PY8A 3CCUP 2PWMA 2XV6A 4XFZA 3G6EP 1D1DA 1A43A 1Q82Q 1VQKP 4J93A 1N8RQ 3H47A 1VQOP 1RNIA 1K73Q 3H0DA 2JYGA 3CMAP 1YJNP 1M9FC 1KC8Q 5JPAA 1E6JP 2GONA 2M8NA 1M74A 3BP9A 5F2KA 4GR2A 4DGEC 3VRLC 2OTLP 1KQSO 3H4EA 2ONTA 1VQ6P 4XFYA 2Z45A 5F2OA 2PEMA 3G0VA 3E2DA 5HGMA 1M9CC 3I55P 4HTWA 2JYLA 1Q81Q 3CC4P 4PH3A 5BS2A 1M1KQ 2XGYA 1M6EX 4U0CA 1GWPA 1VQ8P 1AUMA 2JO0A 1NJIQ 1M90Q 2LF4A 5I4TG 1VQ5P 2QEXP 3G1GA 1KD1Q 1K8AQ 1JJ2O 2XXMA 4COPA 2PEQA 2BUOA 3HYBA 2OARA 5DCKA 4U0AA 2BHVA 3CCVP 4U0EA 3G1IA 1YJ9P 1W2BO 3DS5A 1RO0A 3CXCO 3CD6P 3RG6C 1Q7YQ 2E1MA 1P7NA 4PH0A 5HGNA 2CWOA 3M1MA 2XDEA 1M9DC 1QVGO 2EG5A 3WBHA 5HGLA 3DS4A 3DS0A 3CC2P 2GOLB 4B4NA 3B5IA 3Q20A 4WYMA 2JPRA 1EM9A 2V4XA 2X82A 4E91A 1RO2A 3CCMP 3CCSP 2M8PA 3HZQA 5HGKA 1M9YC 1EIAA 1M9XC 1YIJP 1YJWP 1M6NA 3G26A 1YI2P 3P05A 2EIAA 2PXRC 4PH2A 4U0DA 4XFXA 2P9XA 2PEKA 3DS1A 3LRYA 2KGFA 2QA4P 4COCA 1Q86Q 2KODA 4M0IA 1VQ7P 1IUQA 1BAJA 4U0FA 4NX4C 5BS1A 4E92A 3CCJP 2OTJP 3CCRP 3G28A 2PWOA 1S72P 4LQWC 2PEOA 2Z44A 3NTEA 1A8OA 2XGVA 2PENA 3CC7P 3G29A 1L6NA 1ZMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT1 A;  3DS2 A;  4XRQ A;  4PH1 A;  2XGU A;  2Y4Z A;  2M8L A;  1QRJ A;  2X2D D;  4QNB A;  3DTJ A;  4DGA C;  1AK4 C;  1U7K A;  1M9E C;  3DPH A;  3MGE A;  1AFV A;  2WLV A;  2X83 A;  1G03 A;  4INB A;  5HGO A;  2WLV B;  2L6E A;  3DS3 A;  4XRO A;  3G21 A;  1EOQ A;  4IPY A;  4U0B A;  2PWM A;  2XV6 A;  4XFZ A;  1D1D A;  1A43 A;  4J93 A;  3H47 A;  2JYG A;  1M9F C;  5JPA A;  1E6J P;  2GON A;  2M8N A;  3BP9 A;  4DGE C;  3VRL C;  3H4E A;  2ONT A;  4XFY A;  3G0V A;  5HGM A;  1M9C C;  4HTW A;  2JYL A;  4PH3 A;  2XGY A;  4U0C A;  1GWP A;  1AUM A;  2JO0 A;  2LF4 A;  5I4T G;  3G1G A;  2XXM A;  4COP A;  2BUO A;  5DCK A;  4U0A A;  4U0E A;  3G1I A;  3DS5 A;  1P7N A;  4PH0 A;  5HGN A;  2XDE A;  1M9D C;  5HGL A;  3DS4 A;  3DS0 A;  2GOL B;  4B4N A;  4WYM A;  2JPR A;  1EM9 A;  2V4X A;  2X82 A;  4E91 A;  2M8P A;  5HGK A;  1M9Y C;  1EIA A;  1M9X C;  3G26 A;  3P05 A;  2EIA A;  2PXR C;  4PH2 A;  4U0D A;  4XFX A;  3DS1 A;  3LRY A;  2KGF A;  4COC A;  2KOD A;  4M0I A;  1BAJ A;  4U0F A;  4NX4 C;  4E92 A;  3G28 A;  2PWO A;  4LQW C;  3NTE A;  1A8O A;  2XGV A;  3G29 A;  1L6N A; 
#chains in the Genus database with same CATH topology
 1VQP P;  4PH1 A;  1VQL P;  2EFJ A;  2K2Q A;  2LTE A;  1M9E C;  3DPH A;  1AFV A;  2CG5 B;  3I56 P;  2CQ8 A;  2JU2 A;  2WLV A;  1L0H A;  2FAC A;  5HGO A;  2M5R A;  2X2B A;  3CCE P;  4IPY A;  4U0B A;  2XV6 A;  1GXG A;  1VQK P;  2L0Q A;  1K73 Q;  1ACP A;  3GZM A;  2VSQ A;  3GKL C;  2KWL A;  2LIW A;  2GON A;  2KW2 A;  5F2K A;  2ONT A;  2Z45 A;  2PEM A;  2JGP A;  4HTW A;  1Q81 Q;  2KG6 A;  4U0C A;  1IMQ A;  1VQ8 P;  1GPJ A;  4R0M A;  1NJI Q;  1M90 Q;  2K94 A;  5I4T G;  1VQ5 P;  2QEX P;  2CNR A;  2FAE A;  1K8A Q;  1JJ2 O;  2BUO A;  2OAR A;  4NEO A;  3G1I A;  1RO0 A;  4IZ6 A;  2PNG A;  3M1M A;  2FHS C;  2K0Y A;  3DS4 A;  2VLN A;  2GOL B;  4B4N A;  2KOR A;  4WYM A;  1M9Y C;  1EIA A;  1YIJ P;  3G26 A;  3U43 A;  2LML A;  2GDW A;  2N6Y A;  2KOD A;  4M0I A;  1VQ7 P;  1BAJ A;  3CCJ P;  1HQB A;  1S72 P;  2CGQ A;  3G29 A;  2XT1 A;  3DS2 A;  2PEJ A;  2DGY A;  2GZF A;  4MRT C;  3G4S P;  1VQN P;  1AYI A;  1DV5 A;  1QRJ A;  4QNB A;  2Z46 A;  2ROQ A;  4H2Y C;  2X83 A;  2LL8 A;  4INB A;  1K9M Q;  1YHQ P;  2LPK A;  2PEI A;  4QKO A;  3G21 A;  1EOQ A;  3CE7 A;  3NY7 B;  1D1D A;  1A43 A;  2MR7 A;  1Q82 Q;  4DG9 A;  1VQO P;  1T8K A;  4PWV B;  2JYG A;  1ZNV A;  2FQ0 A;  5JPA A;  2M8N A;  2WPT A;  2OTL P;  1VKU A;  1KQS O;  2JAZ A;  2JU1 A;  2KGE A;  2LKI A;  3E2D A;  5HGM A;  4UHP B;  5BS2 A;  1M6E X;  1AUM A;  4BPH A;  2LIU A;  3G1G A;  1KD1 Q;  2PEQ A;  3HYB A;  2BHV A;  3CCV P;  7CEI A;  1Z6M A;  3EJB A;  1YJ9 P;  2FVE A;  2KR5 A;  2AFE A;  1M9D C;  1QVG O;  3WBH A;  3DS0 A;  5KP8 B;  2JPR A;  1EM9 A;  4E91 A;  1M9X C;  3P05 A;  5EW5 E;  2PEK A;  2EIA A;  4PH2 A;  4U0D A;  4XFX A;  2QA4 P;  1KLP A;  1Q86 Q;  1IMP A;  1IUQ A;  2OTJ P;  3CCR P;  2N5I A;  3CC7 P;  2XGV A;  2JB0 A;  2PEN A;  1L6N A;  2KOO A;  2GDY A;  1UNK A;  2JBG A;  2QNW A;  3B4Q A;  2M8L A;  1VQ4 P;  2GDX A;  2VLO A;  2X2D D;  3DTJ A;  4DGA C;  3MGE A;  3CCQ P;  3CME P;  5F2N A;  3EJE A;  1VQ9 P;  2AF8 A;  1G03 A;  2K5X A;  2N6Z A;  2L6E A;  1BXI A;  3CCU P;  2MR8 A;  3G6E P;  4J93 A;  3GZL A;  2FVA A;  1N8R Q;  2DNW A;  1YJN P;  1M9F C;  3BP9 A;  2AFD A;  2GZJ A;  2EHS A;  4BPF A;  2FQ2 A;  5F2O A;  1HY8 A;  2MD9 A;  1F80 D;  1M9C C;  3I55 P;  2JYL A;  3CC4 P;  4PH3 A;  1M1K Q;  2XGY A;  2NO8 A;  1AF8 A;  2JO0 A;  4COP A;  5HVC A;  5EJD A;  2MVV A;  5DCK A;  4U0E A;  1W2B O;  3DS5 A;  3CD6 P;  2MY5 A;  2E1M A;  5HGL A;  1DNY A;  2N5H A;  3Q20 A;  2X82 A;  1RO2 A;  3CCM P;  3CCS P;  2M8P A;  5HGK A;  1EMV A;  4H2W C;  1YJW P;  1YI2 P;  2P9X A;  3LRY A;  2KGF A;  3RG2 A;  2MVU A;  4E92 A;  5HV8 A;  2LOL A;  3G28 A;  2PWO A;  1CEI A;  2PEO A;  1A8O A;  2GZI A;  2L4B A;  2KOQ A;  2XZ1 C;  1VQM P;  4CA3 A;  4XRQ A;  2N50 A;  1YIT P;  2JQ4 A;  4HKG A;  2FVF A;  2XGU A;  2Y4Z A;  1GXH A;  3GJN A;  2XZ0 D;  1AK4 C;  1U7K A;  3OW2 O;  2MF4 A;  3G71 P;  4F37 A;  2FAD A;  1QVF O;  2WLV B;  3CCL P;  3DS3 A;  4GR6 A;  4XRO A;  3CPW O;  1K30 A;  1L0I A;  2PY8 A;  2PWM A;  4XFZ A;  2VLP A;  2GZG A;  2L22 A;  3H47 A;  1RNI A;  2KGA A;  2KG9 A;  3H0D A;  3EJD A;  3CMA P;  1KC8 Q;  2L9F A;  3LMO A;  1E6J P;  1M74 A;  4GR2 A;  2EHT A;  4DGE C;  3VRL C;  3H4E A;  2K0X A;  1VQ6 P;  4XFY A;  2N98 A;  3G0V A;  1FR2 A;  2AVA A;  2KGD A;  1OR5 A;  2K92 A;  1GWP A;  1UJZ A;  4BPG A;  2LF4 A;  2FQ1 A;  2XXM A;  2KOS A;  1NQ4 A;  4U0A A;  1X3O A;  2VLQ A;  3CXC O;  3RG6 C;  1Q7Y Q;  1P7N A;  4PH0 A;  5HGN A;  2CWO A;  2ERH A;  4PXH B;  2XDE A;  5KP7 B;  2EG5 A;  2GYK A;  3CC2 P;  2K93 A;  3B5I A;  2V4X A;  3HZQ A;  1M6N A;  2PXR C;  3DS1 A;  2KOP A;  4COC A;  1VHN A;  2GZE A;  2KG8 A;  4U0F A;  1MZ8 A;  4NX4 C;  4H2X C;  5BS1 A;  5CZD B;  5KP6 B;  4LQW C;  2Z44 A;  3NTE A;  2KGC A;  2K0D X;  1ZMB A;  1E0H A; 
#chains in the Genus database with same CATH homology
 2XT1 A;  3DS2 A;  1VQM P;  1VQP P;  2PEJ A;  2DGY A;  4XRQ A;  3G4S P;  1YIT P;  4PH1 A;  1VQL P;  2EFJ A;  2XGU A;  1VQN P;  2Y4Z A;  2M8L A;  1VQ4 P;  1QRJ A;  2X2D D;  4QNB A;  2Z46 A;  3DTJ A;  4DGA C;  1AK4 C;  1U7K A;  1M9E C;  3DPH A;  3OW2 O;  3MGE A;  3CCQ P;  3CME P;  1AFV A;  5F2N A;  3I56 P;  3G71 P;  2WLV A;  2X83 A;  1VQ9 P;  1G03 A;  4INB A;  5HGO A;  1K9M Q;  1YHQ P;  2WLV B;  1QVF O;  2PEI A;  2L6E A;  3CCL P;  3DS3 A;  4GR6 A;  4XRO A;  3CPW O;  3CCE P;  3G21 A;  1EOQ A;  1K30 A;  4IPY A;  4U0B A;  2PY8 A;  3CCU P;  2PWM A;  2XV6 A;  4XFZ A;  3G6E P;  1D1D A;  1A43 A;  1Q82 Q;  1VQK P;  4J93 A;  1N8R Q;  3H47 A;  1VQO P;  1RNI A;  1K73 Q;  3H0D A;  2JYG A;  3CMA P;  1YJN P;  1M9F C;  1KC8 Q;  5JPA A;  1E6J P;  2GON A;  2M8N A;  1M74 A;  3BP9 A;  5F2K A;  4GR2 A;  4DGE C;  3VRL C;  2OTL P;  1KQS O;  3H4E A;  2ONT A;  1VQ6 P;  4XFY A;  2Z45 A;  5F2O A;  2PEM A;  3G0V A;  3E2D A;  5HGM A;  1M9C C;  3I55 P;  4HTW A;  2JYL A;  1Q81 Q;  3CC4 P;  4PH3 A;  5BS2 A;  1M1K Q;  2XGY A;  1M6E X;  4U0C A;  1GWP A;  1VQ8 P;  1AUM A;  2JO0 A;  1NJI Q;  1M90 Q;  2LF4 A;  5I4T G;  1VQ5 P;  2QEX P;  3G1G A;  1KD1 Q;  1K8A Q;  1JJ2 O;  2XXM A;  4COP A;  2PEQ A;  2BUO A;  3HYB A;  2OAR A;  5DCK A;  4U0A A;  2BHV A;  3CCV P;  4U0E A;  3G1I A;  1YJ9 P;  1W2B O;  3DS5 A;  1RO0 A;  3CXC O;  3CD6 P;  3RG6 C;  1Q7Y Q;  2E1M A;  1P7N A;  4PH0 A;  5HGN A;  2CWO A;  3M1M A;  2XDE A;  1M9D C;  1QVG O;  2EG5 A;  3WBH A;  5HGL A;  3DS4 A;  3DS0 A;  3CC2 P;  2GOL B;  4B4N A;  3B5I A;  3Q20 A;  4WYM A;  2JPR A;  1EM9 A;  2V4X A;  2X82 A;  4E91 A;  1RO2 A;  3CCM P;  3CCS P;  2M8P A;  3HZQ A;  5HGK A;  1M9Y C;  1EIA A;  1M9X C;  1YIJ P;  1YJW P;  1M6N A;  3G26 A;  1YI2 P;  3P05 A;  2EIA A;  2PXR C;  4PH2 A;  4U0D A;  4XFX A;  2P9X A;  2PEK A;  3DS1 A;  3LRY A;  2KGF A;  2QA4 P;  4COC A;  1Q86 Q;  2KOD A;  4M0I A;  1VQ7 P;  1IUQ A;  1BAJ A;  4U0F A;  4NX4 C;  5BS1 A;  4E92 A;  3CCJ P;  2OTJ P;  3CCR P;  3G28 A;  2PWO A;  1S72 P;  4LQW C;  2PEO A;  2Z44 A;  3NTE A;  1A8O A;  2XGV A;  2PEN A;  3CC7 P;  3G29 A;  1L6N A;  1ZMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...