4WYMA

Structural basis of hiv-1 capsid recognition by cpsf6
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
214
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 66
structure length 214
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4wymA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4wymA02
3BP9A 5I4TG 4XFZA 5HGOA 4HTWA 3NTEA 3DS1A 2WLVA 4COPA 2X83A 4U0EA 5HGMA 1EOQA 3DS0A 1G03A 2JYGA 4IPYA 4NX4C 4B4NA 1A8OA 4XRQA 1EIAA 2XGUA 4U0AA 4COCA 4U0BA 4J93A 1BAJA 2V4XA 4M0IA 4U0DA 4PH2A 2XGYA 1GWPA 3DTJA 4QNBA 3LRYA 4U0CA 2LF4A 4DGAC 2XV6A 2PXRC 2PWMA 4XROA 3DS5A 4WYMA 4PH0A 1QRJA 1AUMA 1AK4C 2KGFA 2L6EA 3H4EA 2XDEA 3DS2A 4INBA 2GOLB 2ONTA 4LQWC 2XT1A 2JO0A 2M8LA 1M9CC 3H47A 4XFYA 3G28A 4PH1A 2GONA 1U7KA 1M9DC 4U0FA 1M9EC 1EM9A 5JPAA 1A43A 5HGKA 2BUOA 2WLVB 1L6NA 3MGEA 4E92A 3G1IA 2XGVA 2PWOA 1M9XC 2Y4ZA 3G1GA 1M9FC 3P05A 2X82A 2KODA 3VRLC 4XFXA 2JPRA 3DS3A 3G26A 5DCKA 2JYLA 3G21A 2X2DD 3DPHA 4DGEC 1P7NA 5HGLA 1D1DA 2EIAA 2XXMA 5HGNA 4E91A 1AFVA 1E6JP 4PH3A 3G0VA 2M8NA 3G29A 1M9YC 3DS4A 2M8PA
chains in the Genus database with same CATH superfamily
3BP9A 4XFZA 5HGOA 2K5XA 2OTLP 3GKLC 2GZGA 3CCQP 1KQSO 2GYKA 4MRTC 1RNIA 4U0EA 1L0IA 2JGPA 3DS0A 2CG5B 3CCLP 2JYGA 4IPYA 3GZMA 1A8OA 1Q86Q 1M1KQ 4U0BA 1BAJA 2L4BA 3EJBA 2MY5A 3CC7P 4UHPB 2K0YA 1VQ7P 1E0HA 2FQ2A 3U43A 2LF4A 2XV6A 4WYMA 1ZMBA 2XZ1C 2PENA 2VLOA 4R0MA 1VQ4P 1YITP 2XT1A 2LIWA 2FQ1A 3Q20A 3H47A 2JU1A 2PEKA 1RO0A 2KR5A 1VQPP 2K2QA 5HGKA 4CA3A 1X3OA 1S72P 2L22A 2JPRA 2MD9A 1Q82Q 3WBHA 1IUQA 1M6NA 1F80D 4BPHA 5EW5E 3CCMP 1YIJP 2AF8A 2MVUA 1D1DA 2ROQA 1VHNA 2XXMA 2KOPA 1AFVA 2E1MA 2VLQA 3G0VA 1VQOP 2M8NA 5KP7B 1UJZA 5EJDA 2EHSA 3NTEA 1T8KA 3OW2O 1KC8Q 2WLVA 1Z6MA 1YHQP 3HYBA 2AFDA 2LIUA 3E2DA 3NY7B 1G03A 1QVFO 4NX4C 2FVEA 4XRQA 4COCA 3CCJP 4H2XC 1L0HA 2JQ4A 4M0IA 4PH2A 5BS1A 3LRYA 1HY8A 1VQ8P 4DGAC 3CMAP 2GZEA 4XROA 2LKIA 3DS5A 1W2BO 2L9FA 4GR2A 2CQ8A 2FHSC 2PY8A 2PNGA 4PH0A 3B5IA 1QRJA 1AUMA 4H2WC 2QEXP 2KGFA 1NJIQ 5BS2A 2KG8A 2KGDA 2EG5A 2CWOA 2CNRA 2EHTA 3CPWO 1GXGA 4LQWC 2N98A 4XFYA 2LPKA 1M74A 2GDYA 1K30A 1VKUA 4NEOA 1M9DC 1M9EC 3CE7A 3B4QA 2WLVB 7CEIA 1VQ6P 1ACPA 2FQ0A 3CMEP 1HQBA 3G1IA 2XGVA 2PWOA 2ERHA 1EMVA 3VRLC 1M9FC 3P05A 2KODA 3CCRP 2KGAA 2AVAA 2Z46A 3I56P 3DS3A 2L0QA 2JB0A 5DCKA 2PEJA 2X2DD 1VQNP 2LMLA 2PEOA 5HGLA 2EIAA 2MR7A 5HGNA 1JJ2O 1ZNVA 2NO8A 2MVVA 3H0DA 2KWLA 1CEIA 2QNWA 2CGQA 2M8PA 1IMPA 1M90Q 2KG6A 2VSQA 2VLPA 3DS1A 1UNKA 1EOQA 2DGYA 2KOOA 1K8AQ 2FVFA 3LMOA 2FVAA 4B4NA 1AF8A 1EIAA 2XGUA 4U0AA 3CCUP 4GR6A 1K73Q 2K0DX 4J93A 2V4XA 2PEMA 1GWPA 2QA4P 3DTJA 3CXCO 4U0CA 1DNYA 3RG6C 1N8RQ 1YJWP 2N5IA 2PWMA 1OR5A 3CD6P 3M1MA 2L6EA 2VLNA 2N50A 2XDEA 3DS2A 4INBA 3G71P 1IMQA 1GPJA 2K92A 4IZ6A 2JO0A 2M8LA 2PEQA 4F37A 1DV5A 3G28A 4PH1A 5JPAA 3G6EP 1VQ9P 2GDWA 2BUOA 3I55P 2FACA 3MGEA 1YI2P 4PXHB 1M9XC 2MF4A 3G1GA 5F2KA 5KP6B 4XFXA 3G26A 2JYLA 2XZ0D 5HVCA 2N6YA 3DPHA 2LL8A 4DGEC 2GZJA 2KG9A 2K94A 1FR2A 1YJ9P 2N6ZA 1QVGO 1M9YC 2KGEA 4PWVB 3GZLA 3DS4A 2JU2A 5I4TG 2KGCA 2FAEA 1VQKP 4HTWA 2M5RA 5F2NA 2N5HA 2OARA 2JBGA 4COPA 2X83A 5HGMA 2KOSA 1MZ8A 4H2YC 2LOLA 4BPGA 1KLPA 4U0DA 2XGYA 4QNBA 1Q81Q 2MR8A 2OTJP 3CCEP 2PXRC 2P9XA 3GJNA 2Z45A 1M6EX 1AK4C 1NQ4A 2WPTA 3H4EA 1YJNP 2KW2A 2GOLB 2ONTA 2GDXA 1VQMP 3EJEA 3CCVP 1M9CC 1Q7YQ 1VQLP 2AFEA 2BHVA 2JAZA 2FADA 4BPFA 2GONA 1U7KA 4U0FA 1EM9A 1A43A 5F2OA 1GXHA 1L6NA 2EFJA 5CZDB 5KP8B 4QKOA 4E92A 1AYIA 3CC4P 3HZQA 2Y4ZA 3G4SP 2X82A 5HV8A 3CC2P 3G21A 1K9MQ 1KD1Q 1RO2A 2DNWA 2Z44A 1BXIA 1P7NA 2X2BA 3EJDA 4HKGA 2LTEA 4E91A 2K0XA 3CCSP 2GZFA 1E6JP 4PH3A 3RG2A 2KOQA 1VQ5P 4DG9A 2KORA 3G29A 2K93A 2GZIA 2PEIA
chains in the Genus database with same CATH topology
3BP9A 5I4TG 4XFZA 1M90Q 5HGOA 1VQKP 2OTLP 4HTWA 5F2NA 2OARA 3NTEA 3DS1A 3CCQP 3OW2O 1KQSO 1KC8Q 2WLVA 4COPA 1RNIA 1YHQP 2X83A 4U0EA 5HGMA 3HYBA 1EOQA 3E2DA 2DGYA 3DS0A 1G03A 1K8AQ 3CCLP 1QVFO 2JYGA 4IPYA 4NX4C 4B4NA 1A8OA 4XRQA 1EIAA 2XGUA 4U0AA 3CCUP 1Q86Q 4GR6A 1M1KQ 4COCA 1K73Q 4U0BA 3CCJP 4J93A 1BAJA 2V4XA 4M0IA 2PEMA 4U0DA 4PH2A 2XGYA 1GWPA 3DTJA 5BS1A 2QA4P 4QNBA 3CXCO 1Q81Q 3CC7P 3LRYA 1VQ7P 1VQ8P 4U0CA 3RG6C 2LF4A 4DGAC 1YJWP 1N8RQ 3CMAP 2XV6A 3CCEP 2PXRC 2P9XA 2OTJP 2PWMA 4XROA 3DS5A 1W2BO 4WYMA 1ZMBA 2Z45A 4GR2A 2PY8A 4PH0A 1M6EX 3B5IA 3CD6P 1QRJA 3M1MA 1AUMA 1AK4C 2PENA 2KGFA 2QEXP 1NJIQ 5BS2A 2L6EA 2EG5A 3H4EA 1YJNP 2XDEA 3DS2A 2CWOA 4INBA 3G71P 3CPWO 1VQ4P 1YITP 2GOLB 2ONTA 4LQWC 2XT1A 1VQMP 3Q20A 2JO0A 2M8LA 3CCVP 1M9CC 3H47A 4XFYA 2PEQA 1Q7YQ 2PEKA 1VQLP 1M74A 1RO0A 3G28A 2BHVA 1VQPP 4PH1A 2GONA 1K30A 1U7KA 1M9DC 4U0FA 1M9EC 1EM9A 5JPAA 1A43A 3G6EP 1VQ9P 5HGKA 2BUOA 3I55P 5F2OA 2WLVB 1L6NA 2EFJA 3MGEA 1YI2P 1VQ6P 4E92A 3CMEP 3G1IA 3CC4P 1S72P 2XGVA 2PWOA 3HZQA 1M9XC 2Y4ZA 3G4SP 3G1GA 1M9FC 3P05A 2X82A 2KODA 5F2KA 4XFXA 2JPRA 3VRLC 3CCRP 1Q82Q 3CC2P 2Z46A 3I56P 3DS3A 3WBHA 1IUQA 1M6NA 3G26A 2JYLA 2PEJA 3G21A 5DCKA 2X2DD 1K9MQ 3CCMP 3DPHA 1KD1Q 1RO2A 1YIJP 1VQNP 4DGEC 2Z44A 1P7NA 2PEOA 5HGLA 1D1DA 2EIAA 2XXMA 5HGNA 1JJ2O 4E91A 3CCSP 1AFVA 2E1MA 1E6JP 4PH3A 3G0VA 1VQOP 3H0DA 1VQ5P 1YJ9P 1QVGO 2M8NA 3G29A 1M9YC 2PEIA 3DS4A 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP9 A;  5I4T G;  4XFZ A;  5HGO A;  4HTW A;  3NTE A;  3DS1 A;  2WLV A;  4COP A;  2X83 A;  4U0E A;  5HGM A;  1EOQ A;  3DS0 A;  1G03 A;  2JYG A;  4IPY A;  4NX4 C;  4B4N A;  1A8O A;  4XRQ A;  1EIA A;  2XGU A;  4U0A A;  4COC A;  4U0B A;  4J93 A;  1BAJ A;  2V4X A;  4M0I A;  4U0D A;  4PH2 A;  2XGY A;  1GWP A;  3DTJ A;  4QNB A;  3LRY A;  4U0C A;  2LF4 A;  4DGA C;  2XV6 A;  2PXR C;  2PWM A;  4XRO A;  3DS5 A;  4WYM A;  4PH0 A;  1QRJ A;  1AUM A;  1AK4 C;  2KGF A;  2L6E A;  3H4E A;  2XDE A;  3DS2 A;  4INB A;  2GOL B;  2ONT A;  4LQW C;  2XT1 A;  2JO0 A;  2M8L A;  1M9C C;  3H47 A;  4XFY A;  3G28 A;  4PH1 A;  2GON A;  1U7K A;  1M9D C;  4U0F A;  1M9E C;  1EM9 A;  5JPA A;  1A43 A;  5HGK A;  2BUO A;  2WLV B;  1L6N A;  3MGE A;  4E92 A;  3G1I A;  2XGV A;  2PWO A;  1M9X C;  2Y4Z A;  3G1G A;  1M9F C;  3P05 A;  2X82 A;  2KOD A;  3VRL C;  4XFX A;  2JPR A;  3DS3 A;  3G26 A;  5DCK A;  2JYL A;  3G21 A;  2X2D D;  3DPH A;  4DGE C;  1P7N A;  5HGL A;  1D1D A;  2EIA A;  2XXM A;  5HGN A;  4E91 A;  1AFV A;  1E6J P;  4PH3 A;  3G0V A;  2M8N A;  3G29 A;  1M9Y C;  3DS4 A;  2M8P A; 
#chains in the Genus database with same CATH topology
 3BP9 A;  4XFZ A;  5HGO A;  2K5X A;  2OTL P;  3GKL C;  2GZG A;  3CCQ P;  1KQS O;  2GYK A;  4MRT C;  1RNI A;  4U0E A;  1L0I A;  2JGP A;  3DS0 A;  2CG5 B;  3CCL P;  2JYG A;  4IPY A;  3GZM A;  1A8O A;  1Q86 Q;  1M1K Q;  4U0B A;  1BAJ A;  2L4B A;  3EJB A;  2MY5 A;  3CC7 P;  4UHP B;  2K0Y A;  1VQ7 P;  1E0H A;  2FQ2 A;  3U43 A;  2LF4 A;  2XV6 A;  4WYM A;  1ZMB A;  2XZ1 C;  2PEN A;  2VLO A;  4R0M A;  1VQ4 P;  1YIT P;  2XT1 A;  2LIW A;  2FQ1 A;  3Q20 A;  3H47 A;  2JU1 A;  2PEK A;  1RO0 A;  2KR5 A;  1VQP P;  2K2Q A;  5HGK A;  4CA3 A;  1X3O A;  1S72 P;  2L22 A;  2JPR A;  2MD9 A;  1Q82 Q;  3WBH A;  1IUQ A;  1M6N A;  1F80 D;  4BPH A;  5EW5 E;  3CCM P;  1YIJ P;  2AF8 A;  2MVU A;  1D1D A;  2ROQ A;  1VHN A;  2XXM A;  2KOP A;  1AFV A;  2E1M A;  2VLQ A;  3G0V A;  1VQO P;  2M8N A;  5KP7 B;  1UJZ A;  5EJD A;  2EHS A;  3NTE A;  1T8K A;  3OW2 O;  1KC8 Q;  2WLV A;  1Z6M A;  1YHQ P;  3HYB A;  2AFD A;  2LIU A;  3E2D A;  3NY7 B;  1G03 A;  1QVF O;  4NX4 C;  2FVE A;  4XRQ A;  4COC A;  3CCJ P;  4H2X C;  1L0H A;  2JQ4 A;  4M0I A;  4PH2 A;  5BS1 A;  3LRY A;  1HY8 A;  1VQ8 P;  4DGA C;  3CMA P;  2GZE A;  4XRO A;  2LKI A;  3DS5 A;  1W2B O;  2L9F A;  4GR2 A;  2CQ8 A;  2FHS C;  2PY8 A;  2PNG A;  4PH0 A;  3B5I A;  1QRJ A;  1AUM A;  4H2W C;  2QEX P;  2KGF A;  1NJI Q;  5BS2 A;  2KG8 A;  2KGD A;  2EG5 A;  2CWO A;  2CNR A;  2EHT A;  3CPW O;  1GXG A;  4LQW C;  2N98 A;  4XFY A;  2LPK A;  1M74 A;  2GDY A;  1K30 A;  1VKU A;  4NEO A;  1M9D C;  1M9E C;  3CE7 A;  3B4Q A;  2WLV B;  7CEI A;  1VQ6 P;  1ACP A;  2FQ0 A;  3CME P;  1HQB A;  3G1I A;  2XGV A;  2PWO A;  2ERH A;  1EMV A;  3VRL C;  1M9F C;  3P05 A;  2KOD A;  3CCR P;  2KGA A;  2AVA A;  2Z46 A;  3I56 P;  3DS3 A;  2L0Q A;  2JB0 A;  5DCK A;  2PEJ A;  2X2D D;  1VQN P;  2LML A;  2PEO A;  5HGL A;  2EIA A;  2MR7 A;  5HGN A;  1JJ2 O;  1ZNV A;  2NO8 A;  2MVV A;  3H0D A;  2KWL A;  1CEI A;  2QNW A;  2CGQ A;  2M8P A;  1IMP A;  1M90 Q;  2KG6 A;  2VSQ A;  2VLP A;  3DS1 A;  1UNK A;  1EOQ A;  2DGY A;  2KOO A;  1K8A Q;  2FVF A;  3LMO A;  2FVA A;  4B4N A;  1AF8 A;  1EIA A;  2XGU A;  4U0A A;  3CCU P;  4GR6 A;  1K73 Q;  2K0D X;  4J93 A;  2V4X A;  2PEM A;  1GWP A;  2QA4 P;  3DTJ A;  3CXC O;  4U0C A;  1DNY A;  3RG6 C;  1N8R Q;  1YJW P;  2N5I A;  2PWM A;  1OR5 A;  3CD6 P;  3M1M A;  2L6E A;  2VLN A;  2N50 A;  2XDE A;  3DS2 A;  4INB A;  3G71 P;  1IMQ A;  1GPJ A;  2K92 A;  4IZ6 A;  2JO0 A;  2M8L A;  2PEQ A;  4F37 A;  1DV5 A;  3G28 A;  4PH1 A;  5JPA A;  3G6E P;  1VQ9 P;  2GDW A;  2BUO A;  3I55 P;  2FAC A;  3MGE A;  1YI2 P;  4PXH B;  1M9X C;  2MF4 A;  3G1G A;  5F2K A;  5KP6 B;  4XFX A;  3G26 A;  2JYL A;  2XZ0 D;  5HVC A;  2N6Y A;  3DPH A;  2LL8 A;  4DGE C;  2GZJ A;  2KG9 A;  2K94 A;  1FR2 A;  1YJ9 P;  2N6Z A;  1QVG O;  1M9Y C;  2KGE A;  4PWV B;  3GZL A;  3DS4 A;  2JU2 A;  5I4T G;  2KGC A;  2FAE A;  1VQK P;  4HTW A;  2M5R A;  5F2N A;  2N5H A;  2OAR A;  2JBG A;  4COP A;  2X83 A;  5HGM A;  2KOS A;  1MZ8 A;  4H2Y C;  2LOL A;  4BPG A;  1KLP A;  4U0D A;  2XGY A;  4QNB A;  1Q81 Q;  2MR8 A;  2OTJ P;  3CCE P;  2PXR C;  2P9X A;  3GJN A;  2Z45 A;  1M6E X;  1AK4 C;  1NQ4 A;  2WPT A;  3H4E A;  1YJN P;  2KW2 A;  2GOL B;  2ONT A;  2GDX A;  1VQM P;  3EJE A;  3CCV P;  1M9C C;  1Q7Y Q;  1VQL P;  2AFE A;  2BHV A;  2JAZ A;  2FAD A;  4BPF A;  2GON A;  1U7K A;  4U0F A;  1EM9 A;  1A43 A;  5F2O A;  1GXH A;  1L6N A;  2EFJ A;  5CZD B;  5KP8 B;  4QKO A;  4E92 A;  1AYI A;  3CC4 P;  3HZQ A;  2Y4Z A;  3G4S P;  2X82 A;  5HV8 A;  3CC2 P;  3G21 A;  1K9M Q;  1KD1 Q;  1RO2 A;  2DNW A;  2Z44 A;  1BXI A;  1P7N A;  2X2B A;  3EJD A;  4HKG A;  2LTE A;  4E91 A;  2K0X A;  3CCS P;  2GZF A;  1E6J P;  4PH3 A;  3RG2 A;  2KOQ A;  1VQ5 P;  4DG9 A;  2KOR A;  3G29 A;  2K93 A;  2GZI A;  2PEI A; 
#chains in the Genus database with same CATH homology
 3BP9 A;  5I4T G;  4XFZ A;  1M90 Q;  5HGO A;  1VQK P;  2OTL P;  4HTW A;  5F2N A;  2OAR A;  3NTE A;  3DS1 A;  3CCQ P;  3OW2 O;  1KQS O;  1KC8 Q;  2WLV A;  4COP A;  1RNI A;  1YHQ P;  2X83 A;  4U0E A;  5HGM A;  3HYB A;  1EOQ A;  3E2D A;  2DGY A;  3DS0 A;  1G03 A;  1K8A Q;  3CCL P;  1QVF O;  2JYG A;  4IPY A;  4NX4 C;  4B4N A;  1A8O A;  4XRQ A;  1EIA A;  2XGU A;  4U0A A;  3CCU P;  1Q86 Q;  4GR6 A;  1M1K Q;  4COC A;  1K73 Q;  4U0B A;  3CCJ P;  4J93 A;  1BAJ A;  2V4X A;  4M0I A;  2PEM A;  4U0D A;  4PH2 A;  2XGY A;  1GWP A;  3DTJ A;  5BS1 A;  2QA4 P;  4QNB A;  3CXC O;  1Q81 Q;  3CC7 P;  3LRY A;  1VQ7 P;  1VQ8 P;  4U0C A;  3RG6 C;  2LF4 A;  4DGA C;  1YJW P;  1N8R Q;  3CMA P;  2XV6 A;  3CCE P;  2PXR C;  2P9X A;  2OTJ P;  2PWM A;  4XRO A;  3DS5 A;  1W2B O;  4WYM A;  1ZMB A;  2Z45 A;  4GR2 A;  2PY8 A;  4PH0 A;  1M6E X;  3B5I A;  3CD6 P;  1QRJ A;  3M1M A;  1AUM A;  1AK4 C;  2PEN A;  2KGF A;  2QEX P;  1NJI Q;  5BS2 A;  2L6E A;  2EG5 A;  3H4E A;  1YJN P;  2XDE A;  3DS2 A;  2CWO A;  4INB A;  3G71 P;  3CPW O;  1VQ4 P;  1YIT P;  2GOL B;  2ONT A;  4LQW C;  2XT1 A;  1VQM P;  3Q20 A;  2JO0 A;  2M8L A;  3CCV P;  1M9C C;  3H47 A;  4XFY A;  2PEQ A;  1Q7Y Q;  2PEK A;  1VQL P;  1M74 A;  1RO0 A;  3G28 A;  2BHV A;  1VQP P;  4PH1 A;  2GON A;  1K30 A;  1U7K A;  1M9D C;  4U0F A;  1M9E C;  1EM9 A;  5JPA A;  1A43 A;  3G6E P;  1VQ9 P;  5HGK A;  2BUO A;  3I55 P;  5F2O A;  2WLV B;  1L6N A;  2EFJ A;  3MGE A;  1YI2 P;  1VQ6 P;  4E92 A;  3CME P;  3G1I A;  3CC4 P;  1S72 P;  2XGV A;  2PWO A;  3HZQ A;  1M9X C;  2Y4Z A;  3G4S P;  3G1G A;  1M9F C;  3P05 A;  2X82 A;  2KOD A;  5F2K A;  4XFX A;  2JPR A;  3VRL C;  3CCR P;  1Q82 Q;  3CC2 P;  2Z46 A;  3I56 P;  3DS3 A;  3WBH A;  1IUQ A;  1M6N A;  3G26 A;  2JYL A;  2PEJ A;  3G21 A;  5DCK A;  2X2D D;  1K9M Q;  3CCM P;  3DPH A;  1KD1 Q;  1RO2 A;  1YIJ P;  1VQN P;  4DGE C;  2Z44 A;  1P7N A;  2PEO A;  5HGL A;  1D1D A;  2EIA A;  2XXM A;  5HGN A;  1JJ2 O;  4E91 A;  3CCS P;  1AFV A;  2E1M A;  1E6J P;  4PH3 A;  3G0V A;  1VQO P;  3H0D A;  1VQ5 P;  1YJ9 P;  1QVG O;  2M8N A;  3G29 A;  1M9Y C;  2PEI A;  3DS4 A;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...