4WYMA

Structural basis of hiv-1 capsid recognition by cpsf6
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
214
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Structural basis of HIV-1 capsid recognition by PF74 and CPSF6.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 66
structure length 214
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2014-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4wymA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4wymA02
5HGNA 3G26A 2XT1A 2XDEA 2X83A 2M8PA 1AUMA 4PH1A 4HTWA 3DS1A 2KGFA 2BUOA 3DTJA 1M9XC 1BAJA 1QRJA 1EOQA 2LF4A 5HGOA 1EIAA 3DS5A 1EM9A 1AFVA 1D1DA 3G0VA 3DS3A 2XGVA 4M0IA 4XFXA 2KODA 4XROA 2GONA 3H47A 4U0AA 4PH2A 2L6EA 3DPHA 2PXRC 3H4EA 4INBA 2M8LA 2PWMA 1M9YC 1U7KA 4E92A 2M8NA 4IPYA 4U0FA 2Y4ZA 4LQWC 2ONTA 4XFYA 4NX4C 5DCKA 5I4TG 4J93A 2XXMA 4DGAC 4U0DA 3LRYA 3DS4A 3DS2A 4U0EA 5HGMA 4E91A 2WLVB 2JO0A 2PWOA 4PH0A 1GWPA 2V4XA 3G28A 3P05A 1P7NA 2EIAA 4XFZA 2JYLA 5HGKA 1E6JP 1A43A 2JYGA 5JPAA 4DGEC 2XV6A 2XGYA 4WYMA 3G29A 1AK4C 2X82A 4U0BA 3MGEA 1M9CC 1M9EC 4QNBA 3G21A 2JPRA 2X2DD 4U0CA 4COCA 1M9DC 5HGLA 3G1IA 4PH3A 1M9FC 2XGUA 4COPA 2WLVA 1G03A 3BP9A 3VRLC 3DS0A 3G1GA 4XRQA 4B4NA 2GOLB 1A8OA 1L6NA 3NTEA
chains in the Genus database with same CATH superfamily
2PEMA 1HY8A 1BXIA 1VQ7P 3CCLP 1VQLP 3EJDA 2KGFA 2BUOA 1K73Q 2GZFA 3I56P 2EG5A 2K94A 1BAJA 5F2OA 1OR5A 1K8AQ 3I55P 1EOQA 1VQ5P 2KGEA 2NO8A 5F2NA 3EJBA 2VLNA 5HVCA 2XGVA 4XFXA 4XROA 2KOPA 2LKIA 1QVGO 2GDXA 1YJ9P 4U0AA 4H2XC 2AFEA 2AF8A 2WPTA 3CC7P 2M8LA 2N50A 4GR2A 4DG9A 2M8NA 2PENA 1YHQP 3CE7A 4NX4C 5DCKA 4J93A 4R0MA 3LMOA 5KP6B 3LRYA 2LL8A 1VQNP 1L0IA 2WLVB 2PWOA 1K9MQ 2KGAA 5EW5E 2VSQA 3P05A 1P7NA 2AVAA 4XFZA 2LIUA 3CD6P 2MY5A 1YIJP 4F37A 5HGKA 2P9XA 1E6JP 2JYGA 5JPAA 4DGEC 2XV6A 1KLPA 2KG9A 3G29A 2X82A 3MGEA 1M9EC 2CGQA 3G21A 2EFJA 2X2DD 7CEIA 1VQPP 1M9FC 2XGUA 2QA4P 2JB0A 1RO2A 4COPA 3U43A 5F2KA 4XRQA 2XZ0D 5KP8B 1L6NA 1VQOP 2FVFA 2CQ8A 4BPGA 2MD9A 2XDEA 2M8PA 1QVFO 1VQ4P 4PH1A 2MF4A 2KOOA 3GKLC 2MR8A 3DS1A 1W2BO 2PEOA 3DTJA 1IUQA 4CA3A 3Q20A 1QRJA 3CCVP 2KOQA 3CC2P 2VLPA 1VQ8P 1EIAA 4QKOA 1ZMBA 2LOLA 1EM9A 2JU1A 2L4BA 4BPHA 2JGPA 2L22A 4M0IA 2KODA 1F80D 1Q82Q 2MVUA 2N98A 3OW2O 3H47A 3GZLA 4PH2A 2L6EA 3H4EA 1GPJA 2PNGA 2FVEA 2VLOA 4H2YC 4INBA 2PWMA 1M9YC 4E92A 2Z46A 2FAEA 4U0FA 2Y4ZA 4LQWC 2DNWA 2GDWA 2FADA 2KW2A 2PEJA 3GJNA 2FQ0A 3B5IA 1VHNA 2CNRA 2XXMA 4DGAC 4PXHB 5HGMA 2X2BA 2JO0A 1IMPA 2AFDA 3RG2A 1A43A 2XGYA 2LIWA 1VKUA 2N5HA 1Q81Q 2MR7A 1M9CC 2JPRA 4COCA 2CG5B 3G1IA 4H2WC 4PWVB 2LTEA 2BHVA 2WLVA 4IZ6A 3DS0A 2JQ4A 3G1GA 2GZGA 2PEIA 2KOSA 2PEKA 2EHTA 5HGNA 1X3OA 3G26A 4HKGA 1Q7YQ 4HTWA 2JBGA 2K0YA 3CCSP 1JJ2O 1IMQA 1M9XC 2FACA 1DV5A 2L9FA 1M6EX 3CCQP 2GYKA 2KORA 3CCMP 1YI2P 1AF8A 2LF4A 2ERHA 1Q86Q 1AYIA 2K93A 3G0VA 2GONA 3CPWO 3CCEP 2QNWA 3CMEP 4UHPB 2VLQA 2Z45A 1GXGA 3RG6C 1Z6MA 2EHSA 1CEIA 2OTJP 3G71P 2ONTA 1VQ6P 3CC4P 2KR5A 2KWLA 5BS2A 5I4TG 3CCUP 2JU2A 3B4QA 1UNKA 2KG8A 4U0DA 3M1MA 3DS4A 3DS2A 4E91A 1NQ4A 1YJNP 4PH0A 3WBHA 2V4XA 2LMLA 3GZMA 2JYLA 2EIAA 2ROQA 2N6YA 1EMVA 2KG6A 1S72P 1KQSO 1DNYA 1RO0A 2GDYA 4WYMA 1HQBA 4U0BA 2N6ZA 2LPKA 1T8KA 2Z44A 3E2DA 3CXCO 1ACPA 4NEOA 1A8OA 3NTEA 2FQ2A 3CCJP 2XT1A 3H0DA 2X83A 1AUMA 2CWOA 1VQKP 2OTLP 1M1KQ 1UJZA 2K0DX 2FVAA 2E1MA 2K0XA 3CMAP 1KC8Q 2FHSC 3EJEA 2GZJA 2DGYA 5HGOA 1NJIQ 3DS5A 1K30A 1AFVA 3HZQA 5KP7B 1D1DA 1M6NA 2N5IA 3DS3A 2KGCA 3G4SP 1KD1Q 4GR6A 1VQ9P 1E0HA 1GXHA 1L0HA 4BPFA 1M74A 2MVVA 3DPHA 2PXRC 4MRTC 2PY8A 2GZEA 5HV8A 2QEXP 1N8RQ 1U7KA 5EJDA 5BS1A 4IPYA 2OARA 3NY7B 4XFYA 2K92A 2KGDA 4U0EA 3G6EP 1ZNVA 1GWPA 3G28A 2JAZA 1VQMP 5CZDB 1AK4C 2K5XA 4QNBA 4U0CA 1M9DC 5HGLA 2M5RA 1YITP 3HYBA 1RNIA 2XZ1C 2GZIA 4PH3A 1M90Q 1G03A 3BP9A 1FR2A 3CCRP 1MZ8A 3VRLC 1YJWP 4B4NA 2GOLB 2PEQA 2FQ1A 2K2QA 2L0QA
chains in the Genus database with same CATH topology
5HGNA 3G26A 3CCJP 2XT1A 2XDEA 3H0DA 2X83A 2M8PA 1QVFO 1AUMA 2PEMA 1VQ7P 1VQ4P 3CCLP 4PH1A 2CWOA 1Q7YQ 1VQLP 1VQKP 4HTWA 2OTLP 3DS1A 2KGFA 1M1KQ 2BUOA 1W2BO 2PEOA 3DTJA 1K73Q 3I56P 3CCSP 1IUQA 1JJ2O 2EG5A 1M9XC 2E1MA 3CMAP 1BAJA 3Q20A 5F2OA 1KC8Q 1QRJA 1K8AQ 3I55P 1EOQA 3CCVP 1M6EX 3CCQP 3CCMP 1YI2P 3CC2P 2DGYA 1VQ5P 2LF4A 5HGOA 1VQ8P 1Q86Q 1EIAA 1NJIQ 3DS5A 1ZMBA 5F2NA 1K30A 1EM9A 1AFVA 3HZQA 1D1DA 3G0VA 1M6NA 3DS3A 2XGVA 4M0IA 4XFXA 3G4SP 1KD1Q 4GR6A 2KODA 1Q82Q 3OW2O 1VQ9P 4XROA 2GONA 3CPWO 3H47A 1QVGO 1M74A 1YJ9P 4U0AA 4PH2A 2L6EA 3DPHA 2PXRC 3H4EA 3CCEP 2PY8A 3CMEP 3CC7P 4INBA 2M8LA 2Z45A 2PWMA 4GR2A 2QEXP 1M9YC 3RG6C 1N8RQ 1U7KA 4E92A 2Z46A 5BS1A 2M8NA 4IPYA 2OTJP 2OARA 4U0FA 2Y4ZA 4LQWC 2ONTA 2PEJA 2PENA 3G71P 3CC4P 1VQ6P 5BS2A 1YHQP 4XFYA 3B5IA 4NX4C 5DCKA 5I4TG 3CCUP 4J93A 2XXMA 4DGAC 4U0DA 3LRYA 3M1MA 1VQNP 3DS4A 3DS2A 4U0EA 5HGMA 3G6EP 4E91A 1YJNP 2WLVB 2JO0A 2PWOA 4PH0A 1GWPA 3WBHA 1K9MQ 2V4XA 3G28A 3P05A 1P7NA 2EIAA 4XFZA 2JYLA 3CD6P 1YIJP 5HGKA 2P9XA 1E6JP 1A43A 2JYGA 1S72P 1KQSO 5JPAA 1RO0A 4DGEC 1VQMP 2XV6A 2XGYA 4WYMA 3G29A 1Q81Q 1AK4C 2X82A 4U0BA 3MGEA 1M9CC 1M9EC 4QNBA 3G21A 2JPRA 2EFJA 2X2DD 4U0CA 4COCA 1M9DC 5HGLA 1YITP 3HYBA 2Z44A 1RNIA 3E2DA 1VQPP 3G1IA 3CXCO 4PH3A 1M9FC 2XGUA 2QA4P 2BHVA 1M90Q 1RO2A 2WLVA 4COPA 1G03A 3BP9A 5F2KA 3CCRP 1YJWP 3VRLC 3DS0A 3G1GA 4XRQA 4B4NA 2GOLB 2PEIA 2PEQA 1A8OA 1L6NA 3NTEA 1VQOP 2PEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGN A;  3G26 A;  2XT1 A;  2XDE A;  2X83 A;  2M8P A;  1AUM A;  4PH1 A;  4HTW A;  3DS1 A;  2KGF A;  2BUO A;  3DTJ A;  1M9X C;  1BAJ A;  1QRJ A;  1EOQ A;  2LF4 A;  5HGO A;  1EIA A;  3DS5 A;  1EM9 A;  1AFV A;  1D1D A;  3G0V A;  3DS3 A;  2XGV A;  4M0I A;  4XFX A;  2KOD A;  4XRO A;  2GON A;  3H47 A;  4U0A A;  4PH2 A;  2L6E A;  3DPH A;  2PXR C;  3H4E A;  4INB A;  2M8L A;  2PWM A;  1M9Y C;  1U7K A;  4E92 A;  2M8N A;  4IPY A;  4U0F A;  2Y4Z A;  4LQW C;  2ONT A;  4XFY A;  4NX4 C;  5DCK A;  5I4T G;  4J93 A;  2XXM A;  4DGA C;  4U0D A;  3LRY A;  3DS4 A;  3DS2 A;  4U0E A;  5HGM A;  4E91 A;  2WLV B;  2JO0 A;  2PWO A;  4PH0 A;  1GWP A;  2V4X A;  3G28 A;  3P05 A;  1P7N A;  2EIA A;  4XFZ A;  2JYL A;  5HGK A;  1E6J P;  1A43 A;  2JYG A;  5JPA A;  4DGE C;  2XV6 A;  2XGY A;  4WYM A;  3G29 A;  1AK4 C;  2X82 A;  4U0B A;  3MGE A;  1M9C C;  1M9E C;  4QNB A;  3G21 A;  2JPR A;  2X2D D;  4U0C A;  4COC A;  1M9D C;  5HGL A;  3G1I A;  4PH3 A;  1M9F C;  2XGU A;  4COP A;  2WLV A;  1G03 A;  3BP9 A;  3VRL C;  3DS0 A;  3G1G A;  4XRQ A;  4B4N A;  2GOL B;  1A8O A;  1L6N A;  3NTE A; 
#chains in the Genus database with same CATH topology
 2PEM A;  1HY8 A;  1BXI A;  1VQ7 P;  3CCL P;  1VQL P;  3EJD A;  2KGF A;  2BUO A;  1K73 Q;  2GZF A;  3I56 P;  2EG5 A;  2K94 A;  1BAJ A;  5F2O A;  1OR5 A;  1K8A Q;  3I55 P;  1EOQ A;  1VQ5 P;  2KGE A;  2NO8 A;  5F2N A;  3EJB A;  2VLN A;  5HVC A;  2XGV A;  4XFX A;  4XRO A;  2KOP A;  2LKI A;  1QVG O;  2GDX A;  1YJ9 P;  4U0A A;  4H2X C;  2AFE A;  2AF8 A;  2WPT A;  3CC7 P;  2M8L A;  2N50 A;  4GR2 A;  4DG9 A;  2M8N A;  2PEN A;  1YHQ P;  3CE7 A;  4NX4 C;  5DCK A;  4J93 A;  4R0M A;  3LMO A;  5KP6 B;  3LRY A;  2LL8 A;  1VQN P;  1L0I A;  2WLV B;  2PWO A;  1K9M Q;  2KGA A;  5EW5 E;  2VSQ A;  3P05 A;  1P7N A;  2AVA A;  4XFZ A;  2LIU A;  3CD6 P;  2MY5 A;  1YIJ P;  4F37 A;  5HGK A;  2P9X A;  1E6J P;  2JYG A;  5JPA A;  4DGE C;  2XV6 A;  1KLP A;  2KG9 A;  3G29 A;  2X82 A;  3MGE A;  1M9E C;  2CGQ A;  3G21 A;  2EFJ A;  2X2D D;  7CEI A;  1VQP P;  1M9F C;  2XGU A;  2QA4 P;  2JB0 A;  1RO2 A;  4COP A;  3U43 A;  5F2K A;  4XRQ A;  2XZ0 D;  5KP8 B;  1L6N A;  1VQO P;  2FVF A;  2CQ8 A;  4BPG A;  2MD9 A;  2XDE A;  2M8P A;  1QVF O;  1VQ4 P;  4PH1 A;  2MF4 A;  2KOO A;  3GKL C;  2MR8 A;  3DS1 A;  1W2B O;  2PEO A;  3DTJ A;  1IUQ A;  4CA3 A;  3Q20 A;  1QRJ A;  3CCV P;  2KOQ A;  3CC2 P;  2VLP A;  1VQ8 P;  1EIA A;  4QKO A;  1ZMB A;  2LOL A;  1EM9 A;  2JU1 A;  2L4B A;  4BPH A;  2JGP A;  2L22 A;  4M0I A;  2KOD A;  1F80 D;  1Q82 Q;  2MVU A;  2N98 A;  3OW2 O;  3H47 A;  3GZL A;  4PH2 A;  2L6E A;  3H4E A;  1GPJ A;  2PNG A;  2FVE A;  2VLO A;  4H2Y C;  4INB A;  2PWM A;  1M9Y C;  4E92 A;  2Z46 A;  2FAE A;  4U0F A;  2Y4Z A;  4LQW C;  2DNW A;  2GDW A;  2FAD A;  2KW2 A;  2PEJ A;  3GJN A;  2FQ0 A;  3B5I A;  1VHN A;  2CNR A;  2XXM A;  4DGA C;  4PXH B;  5HGM A;  2X2B A;  2JO0 A;  1IMP A;  2AFD A;  3RG2 A;  1A43 A;  2XGY A;  2LIW A;  1VKU A;  2N5H A;  1Q81 Q;  2MR7 A;  1M9C C;  2JPR A;  4COC A;  2CG5 B;  3G1I A;  4H2W C;  4PWV B;  2LTE A;  2BHV A;  2WLV A;  4IZ6 A;  3DS0 A;  2JQ4 A;  3G1G A;  2GZG A;  2PEI A;  2KOS A;  2PEK A;  2EHT A;  5HGN A;  1X3O A;  3G26 A;  4HKG A;  1Q7Y Q;  4HTW A;  2JBG A;  2K0Y A;  3CCS P;  1JJ2 O;  1IMQ A;  1M9X C;  2FAC A;  1DV5 A;  2L9F A;  1M6E X;  3CCQ P;  2GYK A;  2KOR A;  3CCM P;  1YI2 P;  1AF8 A;  2LF4 A;  2ERH A;  1Q86 Q;  1AYI A;  2K93 A;  3G0V A;  2GON A;  3CPW O;  3CCE P;  2QNW A;  3CME P;  4UHP B;  2VLQ A;  2Z45 A;  1GXG A;  3RG6 C;  1Z6M A;  2EHS A;  1CEI A;  2OTJ P;  3G71 P;  2ONT A;  1VQ6 P;  3CC4 P;  2KR5 A;  2KWL A;  5BS2 A;  5I4T G;  3CCU P;  2JU2 A;  3B4Q A;  1UNK A;  2KG8 A;  4U0D A;  3M1M A;  3DS4 A;  3DS2 A;  4E91 A;  1NQ4 A;  1YJN P;  4PH0 A;  3WBH A;  2V4X A;  2LML A;  3GZM A;  2JYL A;  2EIA A;  2ROQ A;  2N6Y A;  1EMV A;  2KG6 A;  1S72 P;  1KQS O;  1DNY A;  1RO0 A;  2GDY A;  4WYM A;  1HQB A;  4U0B A;  2N6Z A;  2LPK A;  1T8K A;  2Z44 A;  3E2D A;  3CXC O;  1ACP A;  4NEO A;  1A8O A;  3NTE A;  2FQ2 A;  3CCJ P;  2XT1 A;  3H0D A;  2X83 A;  1AUM A;  2CWO A;  1VQK P;  2OTL P;  1M1K Q;  1UJZ A;  2K0D X;  2FVA A;  2E1M A;  2K0X A;  3CMA P;  1KC8 Q;  2FHS C;  3EJE A;  2GZJ A;  2DGY A;  5HGO A;  1NJI Q;  3DS5 A;  1K30 A;  1AFV A;  3HZQ A;  5KP7 B;  1D1D A;  1M6N A;  2N5I A;  3DS3 A;  2KGC A;  3G4S P;  1KD1 Q;  4GR6 A;  1VQ9 P;  1E0H A;  1GXH A;  1L0H A;  4BPF A;  1M74 A;  2MVV A;  3DPH A;  2PXR C;  4MRT C;  2PY8 A;  2GZE A;  5HV8 A;  2QEX P;  1N8R Q;  1U7K A;  5EJD A;  5BS1 A;  4IPY A;  2OAR A;  3NY7 B;  4XFY A;  2K92 A;  2KGD A;  4U0E A;  3G6E P;  1ZNV A;  1GWP A;  3G28 A;  2JAZ A;  1VQM P;  5CZD B;  1AK4 C;  2K5X A;  4QNB A;  4U0C A;  1M9D C;  5HGL A;  2M5R A;  1YIT P;  3HYB A;  1RNI A;  2XZ1 C;  2GZI A;  4PH3 A;  1M90 Q;  1G03 A;  3BP9 A;  1FR2 A;  3CCR P;  1MZ8 A;  3VRL C;  1YJW P;  4B4N A;  2GOL B;  2PEQ A;  2FQ1 A;  2K2Q A;  2L0Q A; 
#chains in the Genus database with same CATH homology
 5HGN A;  3G26 A;  3CCJ P;  2XT1 A;  2XDE A;  3H0D A;  2X83 A;  2M8P A;  1QVF O;  1AUM A;  2PEM A;  1VQ7 P;  1VQ4 P;  3CCL P;  4PH1 A;  2CWO A;  1Q7Y Q;  1VQL P;  1VQK P;  4HTW A;  2OTL P;  3DS1 A;  2KGF A;  1M1K Q;  2BUO A;  1W2B O;  2PEO A;  3DTJ A;  1K73 Q;  3I56 P;  3CCS P;  1IUQ A;  1JJ2 O;  2EG5 A;  1M9X C;  2E1M A;  3CMA P;  1BAJ A;  3Q20 A;  5F2O A;  1KC8 Q;  1QRJ A;  1K8A Q;  3I55 P;  1EOQ A;  3CCV P;  1M6E X;  3CCQ P;  3CCM P;  1YI2 P;  3CC2 P;  2DGY A;  1VQ5 P;  2LF4 A;  5HGO A;  1VQ8 P;  1Q86 Q;  1EIA A;  1NJI Q;  3DS5 A;  1ZMB A;  5F2N A;  1K30 A;  1EM9 A;  1AFV A;  3HZQ A;  1D1D A;  3G0V A;  1M6N A;  3DS3 A;  2XGV A;  4M0I A;  4XFX A;  3G4S P;  1KD1 Q;  4GR6 A;  2KOD A;  1Q82 Q;  3OW2 O;  1VQ9 P;  4XRO A;  2GON A;  3CPW O;  3H47 A;  1QVG O;  1M74 A;  1YJ9 P;  4U0A A;  4PH2 A;  2L6E A;  3DPH A;  2PXR C;  3H4E A;  3CCE P;  2PY8 A;  3CME P;  3CC7 P;  4INB A;  2M8L A;  2Z45 A;  2PWM A;  4GR2 A;  2QEX P;  1M9Y C;  3RG6 C;  1N8R Q;  1U7K A;  4E92 A;  2Z46 A;  5BS1 A;  2M8N A;  4IPY A;  2OTJ P;  2OAR A;  4U0F A;  2Y4Z A;  4LQW C;  2ONT A;  2PEJ A;  2PEN A;  3G71 P;  3CC4 P;  1VQ6 P;  5BS2 A;  1YHQ P;  4XFY A;  3B5I A;  4NX4 C;  5DCK A;  5I4T G;  3CCU P;  4J93 A;  2XXM A;  4DGA C;  4U0D A;  3LRY A;  3M1M A;  1VQN P;  3DS4 A;  3DS2 A;  4U0E A;  5HGM A;  3G6E P;  4E91 A;  1YJN P;  2WLV B;  2JO0 A;  2PWO A;  4PH0 A;  1GWP A;  3WBH A;  1K9M Q;  2V4X A;  3G28 A;  3P05 A;  1P7N A;  2EIA A;  4XFZ A;  2JYL A;  3CD6 P;  1YIJ P;  5HGK A;  2P9X A;  1E6J P;  1A43 A;  2JYG A;  1S72 P;  1KQS O;  5JPA A;  1RO0 A;  4DGE C;  1VQM P;  2XV6 A;  2XGY A;  4WYM A;  3G29 A;  1Q81 Q;  1AK4 C;  2X82 A;  4U0B A;  3MGE A;  1M9C C;  1M9E C;  4QNB A;  3G21 A;  2JPR A;  2EFJ A;  2X2D D;  4U0C A;  4COC A;  1M9D C;  5HGL A;  1YIT P;  3HYB A;  2Z44 A;  1RNI A;  3E2D A;  1VQP P;  3G1I A;  3CXC O;  4PH3 A;  1M9F C;  2XGU A;  2QA4 P;  2BHV A;  1M90 Q;  1RO2 A;  2WLV A;  4COP A;  1G03 A;  3BP9 A;  5F2K A;  3CCR P;  1YJW P;  3VRL C;  3DS0 A;  3G1G A;  4XRQ A;  4B4N A;  2GOL B;  2PEI A;  2PEQ A;  1A8O A;  1L6N A;  3NTE A;  1VQO P;  2PEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...