4WYYA

Crystal structure of p. aeruginosa ampc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
360
structure length
360
Chain Sequence
b'APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase/hydrolase inhibitor
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
publication title 4,5-Disubstituted 6-Aryloxy-1,3-dihydrobenzo[c][1,2]oxaboroles Are Broad-Spectrum Serine beta-Lactamase Inhibitors.
pubmed doi rcsb
total genus 122
structure length 360
sequence length 360
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4wyyA00
1H8YA 3HREA 3PBOA 4R3BA 4KZ3A 4FD8A 3GTCA 4L0LA 3MFDA 3SH9A 4X6TA 4DRTA 4D2OA 2WZXA 4ZTKA 1ESUA 3OC2A 3Q81A 1XA7A 1SKFA 3BLSA 4ZJ3A 3S22A 3V50A 3ZNTA 4E3IA 1BUEA 2P74A 3NIAA 4KZ7A 3UPPA 3IQAA 3Q7ZA 4OOMA 3ZVWA 1ERQA 3M6BA 4HEFA 1MWRA 3UO9A 5M18A 2I72A 3IXHA 4BJPA 4BLMA 4U0XA 3VP4A 2WAEA 3N6IA 1YM1A 1E3UD 1QMEA 4QJGA 4IBXA 1XX2A 4GD8A 3SH7A 2Y2NA 4X55A 5HX9A 1K55C 3P98A 5GHZA 1KVMA 1BULA 1CK3A 2G2UA 1SDEA 3GRJA 4UA7A 1TDLA 1K6RA 3LO7A 3IXBA 4UA9A 4XUZA 4JF5A 3VP1A 3ZNYA 4YINA 1I2SA 1FR1A 3OPPA 2ZQCA 1S0WA 2ZLYA 4LCMA 4MBHA 4BENA 4GOGA 4MEZA 4DXBA 4PM5A 4KG2A 2VGJA 1BLCA 1E3UA 1LHYA 3CJMA 1H8ZA 5F83A 2WAFA 1ZKJA 5GLAA 5FAOA 5CECA 3M6HA 4OLGA 5JYPA 3PBNA 1KDWA 1GHMA 4WEKA 1E4DA 3JYIA 3A3FA 3ZG9B 3WWXA 5U47A 3C5AA 4E3KA 1W5DA 4WBGA 5EOEA 4JBFA 4E6WA 4OPZA 4EBPA 1FSWA 1PZPA 2OLUA 2Y2GA 3Q1FA 3ITAA 1PWGA 5E2GA 2R9WA 5A90A 3V5MA 3OZHA 1MY8A 1OMEA 1MPLA 5KMWA 1ZG4A 1JVJA 2ZC7A 3QNBA 4GNUA 3SH8A 1SCWA 5FA7A 3O88A 1IYQA 4CJNA 3ZHHA 1YLYA 3O86A 3ZVTA 2HP6A 3BYDA 3VFHA 2V1ZA 5EE8A 1PW8A 3ZFZA 3SS5A 3BEBA 1XPBA 5FQKA 4XUXA 3SS3A 4NK3A 5HW3A 4WMCA 2ZC3B 5IHVA 3PBSA 3WRTA 1BTLA 3WS2A 4N92A 1KE3A 2BLSA 4OPYA 5DTTA 1NYYA 1M6KA 2WK0A 1ONHA 1NZUA 2J7VA 4S2PA 3VOZA 2WKHA 4LENA 4DE2A 5FASA 4UA6A 4YFMA 4JXWA 5EVLA 2G2WA 3ZDJA 4BD1A 2DNSA 2X02A 3MZDA 5HFOA 4R23A 5FQIA 4QB8A 2WGIA 2IWCA 2ZC5B 1KGGA 4LCLA 3OPHA 5A93A 1CI8A 5HAPA 4OP8A 3SOIA 1HD8A 1LLBA 2C5WB 4UHUA 1MXOA 3GMWA 3DWZA 4HBTA 1ONGA 2HDUA 2WGWA 4OPRA 2XR0A 3CG5A 4K91A 4WELA 1QMFA 4S2KA 4OOYA 3VSLA 1ZC2A 2XH9A 1NJ4A 4BQMA 4OVDA 4Y0UA 4KQRA 3HLWA 4NETA 1Q2PA 3MXSA 3NY4A 3PBTA 2V20A 3VMAA 1KDSA 4ID4A 5G18A 1XP4A 3IF6B 2WGWB 2XEPA 4IVKA 4Y7PA 3N4IA 3Q7VA 4OPQA 5A92A 1N4OA 4B4XA 2HP5A 1LL5A 2EFXA 2PU4A 1K55A 1KE0A 3A3DA 4FCFA 2H10A 1K56D 5J8XA 4R0QA 1XA1A 1JWPA 3C7VA 4KQOA 2XD5A 3MKFA 3VFFA 3PTEA 4GN2A 4R3JA 2EX9A 4JF4A 3IF6A 3G34A 3FYZA 3NCKA 4LV1A 2HP9A 2J8YA 3W4PA 3WRZA 4OOLA 3BFGA 2A3UA 4HESA 3BECA 4ZDXA 3BFEA 1YLPA 2XGNA 4GD6A 1H5XA 3PBRA 3O3VA 3GSGA 2FFYA 3LEZA 2XQZA 3DTMA 3G2YA 4KQQA 3HLCA 2IWBA 1GA0A 4RA7A 4S2IA 5M1AA 1MWUA 3UNWA 4Q8IA 5CGXA 1IYOA 5EPHA 4OH0A 3IT9A 1ALQA 5EOOA 1L0DA 1LL9A 3LCEA 5F1GA 1EI5A 4GDBA 2J9OA 4LV0A 3SS4A 3A3JA 1O07A 4JXGA 2HDRA 1HZOA 4GDNA 4JXSA 3IHAA 2Y2MA 1YMSA 1NYMA 2ZC4B 3GR2A 4E3JA 4S2NA 2Y2IA 3FKVA 1FOFA 2B5RA 5DTSA 2CC1A 1YMXA 2XFTA 2ZQ7A 3UE3A 1MWSA 3OPLA 3UE0A 3P09A 4PM7A 5CXWA 4KZBA 5GL9A 4DE1A 1YLWA 5GHYA 4LV2A 1K57A 4XXRA 5EVID 5FAPA 4H8RA 3HVFA 5CRFA 1W7FA 4KZAA 1ES4A 1I5QA 1ES3A 1GA9A 1K4EA 2QPNA 2Y2HA 2Y2KA 3PAGA 3QNCA 1E25A 1W8QA 5I94A 2Y2PA 2WGVA 1L2SA 3BFDA 3C7UA 3FZCA 4WZ4A 4EBNA 3EQUA 5DTKA 2JC7A 4IBRA 5JYOA 1JWVA 4JKTA 4Y0OA 3OPRA 1FSYA 5CGSA 3G30A 1DJAA 1IKGA 1NY0A 4RX3A 3LY3A 3ZG0A 4S2NC 2HPBA 4K0WA 2EX8A 4X56A 3FKWA 4B4ZA 2ZQ9A 2HDSA 5FI7A 3MBZA 1YLTA 4GB7A 1YT4A 2OLVA 2DRWA 2Z2MB 3B3XA 3NDGA 3W4QA 4MBFA 5CGWA 1IEMA 3C4PA 2ZM0A 3DW0A 2QZ6A 1SDNA 5BOHA 3Q07A 3HLFA 1ES2A 5DF9A 2FFFB 5TGFA 1CEGA 4WZ5A 1GHPA 1PWCA 4QU3A 5F1FA 1C3BA 5M19A 5CHUA 3QHYA 1DY6A 4R4RA 1LI0A 3V39A 4M3KA 2PU2A 3OCNA 2QMIA 3HBRA 4OLDA 4HBUA 1K54C 3HLDA 3HUOA 4KZ5A 3HL9A 4JLFA 5EECA 5AQAA 1K57C 2WUQA 2Y2OA 3M2KA 4FH4A 4QD4A 5HL1A 3LY4A 3CZDA 3C4OA 3MXRA 4S2MA 3UE1A 4Y0TA 4PPRA 4LV3A 4S2LA 2J9PA 3G2ZA 1K4FA 5KSHA 3ITBA 4O7DA 3OCLA 1JWZA 5DF7A 3BRMA 3A3EA 1PIOA 1YLZA 2HDQA 4EBLA 2WZZA 4PM9A 1LI9A 3VP0A 4OQHA 3MKEA 1CEFA 3WS0A 3IXDA 4Z9QA 3O87A 3WS5A 5E2EA 1MKIA 1YLJA 3A3IA 2ZM2A 2H0YA 2EXAA 5EVIC 3FWLA 2JBFA 3DWKA 1DJBA 5HARA 1Q2QA 3CMZA 4PM8A 4BL2A 3IH8A 1GCEA 2ZQDA 4ZJ1A 3M2JA 1DJCA 1JTGA 4GKUA 5L2FA 1XXMA 1BLPA 1HVBA 1K25A 2P9VA 2XDMA 3HLBA 3NC8A 4C6YA 5CTNA 2EX6A 3UPOA 3MZEA 1TEMA 1PI5A 2XF3A 2UWXA 2Y91A 3AGDA 3IF6C 4KZ8A 5EUAA 2Y2JA 2ZM8A 5DF8A 5CEBA 4QY5A 2P9VB 4X53A 5GLCA 5TFQA 4EV4A 3G35A 4MNRA 5DVAA 3G4PA 1BLSA 4KZ9A 4E3LA 4QHCA 3W8KA 4ZJ2A 1G6AA 1IKIA 5EVIB 3UDIA 3G31A 5FSRA 2XFSA 4OP5A 1BZAA 1WE4A 1U60A 3IXGA 1IELA 1EWZA 4OQIA 2Y2QA 3E2KA 3BFCA 4IVIA 4MLLA 4JXVA 5FI6A 4KZ4A 4F94A 1ES5A 1M40A 1PYYA 4DKIA 2XK1A 3IWQA 2DCFA 2EX2A 2Y55A 2OV5A 1PW1A 5EVIA 2Z2LB 3TSGA 1ERMA 1PZOA 4R4SA 4GZBA 5CHMA 4RX2A 3TOIA 2WADA 3S1YA 2ZC6B 3W4OA 3ZCZA 3N8RA 5GHXA 5E43A 3E2LA 2IWDA 1L0GA 5FQ9A 1MBLA 2ZJ9A 1XGJA 3EQVA 3IWOA 1TVFA 4IEDA 1VM1A 1WYCA 4FH2A 3RXWA 3RXXA 4P0MA 1KVLA 2XD1A 3HLGA 5CHJA 1Y54A 5F82A 4B88A 3TG9A 1AXBA 1EROA 1NZOA 1MWTA 4WZ5C 2X71A 1SHVA 4KG5A 3ZG5A 3GQZA 3PAEA 1FCOA 2ZQAA 1L0FA 5FQQA 5TR7A 1XGIA 3UPNA 5HAIA 5FAQA 4C3QA 4DE0A 1FR6A 2C6WB 5AQBA 2Y4AA 2Q9MA 1XKZA 4E3MA 1VQQA 2H5SA 4WM9A 3VOYA 5CEDA 4DE3A 5D3OA 3UDFA 4A5RA 4KZ6A 3IF5A 4X68A 2E8IA 3N8LA 4N1XA 2H0TA 1K54A 2RL3A 4DDSA 1PWDA 1I2WA 3S4XA 4C75A 4CPKA 1J9MA 4DDYA 4U3TA 3ZG7B 1NRFA 1BLHA 3GVBA 4OQGA 2VGKA 1O7EA 5A91A 4EWFA 1N9BA 1KGEA 3WS4A 4EQIA 1G68A 1IYSA 2JCHA 4FSFA 5AQ9A 2Y59A 1TDGA 3BM6A 2GDNA 2R9XA 1BSGA 1W8YA 2Y2LA 1K56A 3AGEA 3N8SA 2WKEA 4OQ0A 5KSCA 5FDHA 3N7WA 3NI9A 3ZGAB 4U0TA 3UDXA 1JTDA 3VP3A 2PBYA 1FCMA 2ZQ8A 2EFUA 3G32A 1BT5A 1IYPA 3Q7VB 4R1GA 4PMAA 1K6SA 4OKPA 3PBQA 2JE5A 4JPMA 1S6RA 2WYXA 2V2FF 3RJUA 3ZG8B 4E3NA 3IWIA 1YQSA 2RCXA 3I7JA 4OONA 3UY6A 2BG1A 3Q82A 4P87A 4ZAMA 1KGFA 1RGZA 4BL3A 4PM6A 3D4FA 1PI4A 3FV7A 3BLMA 1RGYA 1ZG6A 3ISGA 2OSUA 4MBKA 1FCNA 1L0EA 5E2HA 3V3SA 4DXCA 4P6BA 5FI2A 3VP2A 4UAAA 3V3RA 4QY6A 3IHBA 3NDEA 3GV9A 2XLNA 3MZFA 4JF6A 5KZHA 5AQ7A 4N9LA 2X01A 2ZD8A 3BFFA 4N9KA 1KE4A 1RCJA 2A49A 4P85A 4E6XA 3AGFA 1Z6FA 1HTZA 5HAQA 3HUMA 5E2FA 3UN7A 1NXYA 4BD0A 4E3OA 1RP5A 3VSKA 3IH9A 4WMCD 4X69A 3HLEA 5FQJA 4KG6A 2WKIA 5GLDA 1CI9A 4K0XA 4S2JA 1ESIA 4WYYA 2EXBA 2ZMAA 4EUZA 1GHIA 4WEJA 5FATA 1W79A 4RVAA 2Q9NA 4RYEA 1K38A 5CTMA 5FQMA 1FQGA 5GLBA 3WS1A 4DF6A 4S2OA 5CERA 3NBLA 4N1HA 1WYBA 4KENB 3HUNA 4ZBEA
chains in the Genus database with same CATH superfamily
2L4RA 2Y8HA 3TE8A 3PBOA 4YOFA 4KZ3A 3QP8A 4X6TA 1XA7A 3LIFA 2VK3A 3IQAA 1X0OA 4OOMA 3M6BA 1MWRA 4U0XA 5IU1A 1TD5A 3N6IA 2XA7M 2JKTM 3KSGA 4IBXA 1VEUA 1KVMA 1PFLA 2G2UA 1SDEA 3GRJA 3JVUA 1FR1A 3OPPA 4GS9A 4MBHA 2VGJA 1BLCA 3EGDC 2KDKA 5CECA 1KDWA 3WWXA 5F69A 4HJ4A 2VLGA 1FSWA 2OLUA 3ITAA 5E2GA 4ESPA 1STZA 3R4KA 5KMWA 3SH8A 1JVJA 2ZC7A 4GNUA 1P97A 1SCWA 4KUOA 2W3GA 1IYQA 3LYXA 5EE8A 2W3EA 3BEBA 3E4PA 3SS3A 3PYPA 4NK3A 3UB9A 2ZC3B 4N92A 2BLSA 4HOIA 4Z1WA 1M6KA 1ONHA 4DE2A 4LENA 4YFMA 1T1AA 2G2WA 3FC7A 4BD1A 5L07A 2IWCA 3NOPC 3JPUA 1LSVA 4OP8A 3SOIA 2JKFA 1HD8A 1LLBA 3EEAA 2WGWA 4OPRA 4BBUA 3CG5A 4XT2B 3IX3A 1ZC2A 2XH9A 4R38A 3CHWP 3PBTA 2XEPA 4Y7PA 3W2ZA 4MN5A 2PU4A 1K55A 1KE0A 3A3DA 4RQ9A 4NXGA 1HLUP 1XA1A 3MKFA 1DP9A 4JF4A 2ACGA 3IF6A 1Z09A 2HP9A 1W63M 4OOLA 4CLCA 2A3UA 1GSWA 1YLPA 4KQDA 4F3LB 3CAXA 2FFYA 3C8CA 4GHIA 3S7OA 2WKRA 5M1AA 4Q8IA 5EPHA 1NRJA 5F1GA 3P7NA 4GDBA 4LRXC 4GJ4A 2HDRA 2Y2MA 3CUEA 3F1PB 2B5RA 3UE3A 2W1TB 2NUTC 5CXWA 4KZBA 1YLWA 5CRFA 3D72A 1W7FA 1ES4A 1I5QA 4EETB 1S1ZA 4EBNA 4Y0OA 4WN5A 3IS2B 3DAVA 5EFWA 3LY3A 3VV4A 2HPBA 4X56A 2V1BA 2GJ3A 2B95A 4K08A 4G3VA 4MBFA 2KLIA 3C4PA 2R78A 3Q07A 5TBMA 2VKSA 5DF9A 2B02A 1PWCA 3QP5A 5M19A 1OTEA 1DY6A 2PHYA 3V39A 2PU2A 2QMIA 4OLDA 5AQAA 4JLFA 2VV6A 1K57C 2WUQA 2Y2OA 5HL1A 3MXRA 3UE1A 4LV3A 3A3EA 4PM9A 5DFXA 1CEFA 3IXDA 3KSFA 1YLJA 3QP4A 2H0YA 5EVIC 5HARA 3A0SA 3CMZA 4BL2A 2ZQDA 1DJCA 1JTGA 5L2FA 3GDIA 2P9VA 3NC8A 5CTNA 3KYZA 1TEMA 4KZ8A 2Y2JA 2VEAA 2ZM8A 2PYPA 2WKPA 3PHYA 5TFQA 3S7PA 1BLSA 3C38A 3W8KA 1IKIA 2XFSA 4OP5A 1WE4A 3IXGA 4HQAA 1EWZA 3MQOA 3BFCA 4JXVA 1M40A 1PYYA 2XK1A 2V8FA 1T19A 3MR0A 2Z2LB 4GZBA 5CHMA 4RX2A 3TOIA 5HDCA 3E2LA 2IWDA 2PYRA 3EQVA 1TVFA 4IEDA 3RXXA 5AVFA 2QHKA 3QP6A 1Y54A 2M1CA 5F82A 4B88A 1EROA 1NZOA 4LRZE 3ZG5A 1T18A 3RTYA 1FCOA 1L0FA 5F68A 1YSQA 4DE0A 1FR6A 2C6WB 1TS7A 5AQBA 4ETZA 1VQQA 4WM9A 3VE4A 4KZ6A 1DP8A 3IF5A 4QWOA 2XA7S 4N1XA 3EOIA 3P01A 2A2LA 4DDYA 4MCWA 4OQGA 4ARZB 1O7EA 5FDSA 1G68A 3JVVA 5AQ9A 2V8CA 2W1TA 3BM6A 4LRYC 3N8SA 4DJ3A 2WKEA 5FDHA 3UDXA 4Y5FA 1VETA 3VP3A 1FCMA 1VHMA 5I5LA 4Q0JA 1BT5A 3Q7VB 1XFNA 1S66L 3UE6A 5G4YA 2G7UA 3PBQA 4R70A 5DJTA 1S6RA 2V2FF 2M7VA 4LLOB 4E3NA 1YQSA 3CUEC 2BG1A 3MXQA 4NXFA 4HP9A 4BL3A 4PM6A 1T1BA 2JKRM 2OSUA 1FCNA 1L0EA 4DXCA 5DKKA 3LIEA 4JF6A 4N9LA 2ZD8A 3BFFA 4HY8A 3RFBA 3AGFA 1HTZA 4YNRA 2JHEA 3IH9A 3HLEA 5FQJA 4KG6A 1CI9A 1ESIA 1GHIA 3LI8A 1NWZA 5FATA 3K2NA 2B18A 1LSWA 1FQGA 2FZ0A 3CPTB 5HPIA 3NBLA 4N1HA 4EW7A 4QPRA 3IT9A 2VA0A 4JGPA 1SKFA 3S22A 1GSVA 1BUEA 3UPPA 2M7UA 3ZVWA 1UGUA 5M18A 2P08A 3IXHA 4L9GA 4GD8A 2XRNA 4BBVA 3P98A 4UA7A 3K3CA 1K6RA 3IXBA 2J3TC 3MQQA 4XUZA 4JF5A 3LR4A 4L9EA 2O99A 4PM5A 4KG2A 5GLAA 1E3UA 2WAFA 3M6HA 3TJZC 3OOVA 1GHMA 1E4DA 3JYIA 3ZG9B 1FIKA 3OBFA 3C5AA 4WBGA 4JGOA 1TF1A 4JBFA 1SKOB 4OPZA 3QP1A 1PZPA 3NULA 1MZUA 1H3QA 2R9WA 3OZHA 1OMEA 1ZG4A 4O8GA 3O88A 4X25A 3O86A 1ZHHB 2HP6A 3UB5P 3VFHA 1PW8A 3ZFZA 4XUXA 5HW3A 4WMCA 1YSPA 3WS2A 4OPYA 2KOIA 5DTTA 1NYYA 1L3LA 4CQHA 4UA6A 4JXWA 3ZDJA 2DNSA 1OTDA 4R23A 4QB8A 2WGIA 2ZC5B 1KGGA 1CI8A 5HAPA 1ONGA 2IA2A 1F9IA 1S1YA 4S2KA 2HJEA 4OVDA 3HLWA 4NETA 4P6ZS 3MXSA 3NY4A 2PT7A 2V20A 3VMAA 5G18A 2W1RA 2WGWB 5A92A 3DTIA 1K56D 2XD5A 3LGOA 4GN2A 2EX9A 5K5BA 4Y17A 4LV1A 3BFGA 3A0RA 2QJ5A 4GD6A 3E4OA 3PBRA 4HHDA 2XQZA 3DTMA 3G2YA 4I3JA 3H9WA 2IWBA 3UNWA 4S2IA 1IYOA 5FEGA 2J3TD 1J3WA 4LV0A 3A3JA 1O07A 4EUVA 3IHAA 3ZQ5A 5LBRA 3GR2A 4S2NA 2Y2IA 1FOFA 2PR6A 4LGWA 2CC1A 4IUHA 1YMXA 2XFTA 5DTSA 1MWSA 2ZOIA 3UE0A 4PM7A 4H6JA 3B47A 4LV2A 5TJJA 4KZAA 4R3AA 5L09A 2Y2KA 1K4EA 2QPNA 3PAGA 3QNCA 3T1RA 1W8QA 5AJGA 5I94A 2WGVA 3FZCA 1ODVA 1JWVA 1FSYA 2A24A 5CGSA 4IUKA 3G30A 2W3HA 2ZL1A 1NY0A 3HCYA 3GECA 2EX8A 3FKWA 2W3DA 2HDSA 2ZQ9A 3MBZA 1YLTA 4GB7A 3B3XA 3H7WA 2VV8A 2GNXA 4X1MA 3DW0A 4GS9B 1SDNA 3HLFA 3SW1A 1ES2A 1CEGA 2HZ5A 4WZ5A 5F1FA 1C3BA 5EM0A 3QP2A 1XFQA 4HBUA 3HLDA 5EECA 2JKRI 4QD4A 3CZDA 3C4OA 1YKDA 1K4FA 5DF7A 1PIOA 1YLZA 2HDQA 1ACFA 2J80A 2WZZA 3S7QA 3WS0A 4Z9QA 3O87A 4G3WA 2JBFA 3DWKA 1CQAA 4PM8A 3KX0X 5C5KA 1GCEA 3M2JA 4GKUA 1XXMA 1HVBA 2O9CA 3T4SA 3C2WA 3HJKA 3IF6C 2Y91A 4I3AA 5EUAA 5L8MA 1IOUA 3R7WA 5FL3A 4X53A 4EV4A 5DVAA 4X1LA 4KZ9A 4E3LA 5HD5A 3UDIA 3UMEA 1IELA 4UQIM 4Q0IA 3T50A 4KZ4A 1ES5A 3IWQA 2DCFA 2Y55A 5EVIA 3TSGA 1ERMA 1PZOA 4R4SA 5E43A 2GZAA 1MBLA 2ZJ9A 4NEED 3IWOA 3RXWA 1WYCA 4HH2A 2PD8A 2W27A 3TG9A 1AXBA 2W0NA 4HIAA 4F3LA 2H28A 5FQQA 4MN6A 3UMDA 2Y4AA 2Q9MA 2H5SA 4DE3A 1S4RA 3T4LA 2L1MA 2V9AA 1K54A 2RL3A 4DDSA 3S4XA 4CPKA 1TS0A 2PD7A 2VGLM 1SZVA 3ZG7B 1NRFA 4HNBA 2YKHA 2VGKA 4EWFA 4JGQA 3WS4A 2JCHA 1TDGA 2HGVA 5HWVA 4PAUA 3UB6A 2PBYA 3EEHA 4R1GA 1XJ4A 5HDDA 4JPMA 3EWKA 3KYQA 2CMNA 2HV1A 3I7JA 4P87A 3Q82A 5HWTA 3T1SA 1RGYA 1ZG6A 3ISGA 5HDSA 4P6BA 3T12B 5FI2A 3VP2A 4UAAA 1MKMA 4QY6A 3IHBA 1CF0A 2QKPA 3GV9A 3MZFA 4PHTA 5HD3A 5AQ7A 5TBMB 5MC7A 4ME4A 4N9KA 2A49A 3MMHA 3E98A 2PBDP 1NXYA 4BD0A 4WYYA 5A8BA 1OJ5A 4JGRA 1W79A 1AWIA 5GLBA 4DF6A 1UWNX 1WYBA 3UO9A 4ZBEA 2K31A 3UB7A 4FD8A 1PRQA 3GTCA 4FUWA 3MFDA 4Y13A 3G6OA 3OC2A 4MDZA 3BLSA 4ZJ3A 3V50A 5HSQA 2P74A 3NIAA 4KZ7A 1XJ2A 3RH8B 2I72A 5EM1A 1YM1A 1N9LA 1XX2A 4X55A 5HX9A 5GHZA 3H82A 1CK3A 1OT9A 3LO7A 4UA9A 1D06A 2OAP1 2ZQCA 1S0WA 2ZLYA 4LCMA 4BENA 4MEZA 3O5YA 4NKPA 3CJMA 5F83A 2EWWA 1H8ZA 1ZKJA 3A3FA 4E3KA 2XSSA 4E6WA 4EBPA 2Y2GA 4R6LA 5A90A 4UQIS 3V5MA 1MPLA 3QNBA 5FA7A 1YLYA 3NECA 3LR5A 4NXBA 3SS5A 5CX7A 1XPBA 5FQKA 2OWJA 1H0MA 1V9YA 5IHVA 3WRTA 4BBTA 2YKFA 3LIBA 3VOZA 1NZUA 2WKHA 5FASA 5EVLA 1G6OA 4XT2A 5FQIA 5F6AA 3OPHA 5A93A 2JKGA 3KO6A 2C5WB 1MXOA 4HBTA 2GX5A 2HDUA 4WELA 1D7EA 1QMFA 3DBAA 4BQMA 2O9BA 4Y0UA 1F98A 4KQRA 3ZYTA 1KDSA 3FPWA 4ID4A 1Y4OA 3IF6B 3Q7VA 4OPQA 4L9FA 2EFXA 5DJUA 2H10A 4R0QA 1JWPA 3C7VA 4O01A 3VFFA 3PTEA 3V67A 3LIDA 2EWVA 3FYZA 3G34A 1LSXA 2J8YA 3WRZA 4HESA 3BY8A 4MMNA 3MSHA 1H5XA 3GSGA 3FG8A 3TRCA 3HLCA 4CLCB 1GA0A 2VV7A 5CGXA 4P6ZM 4WF0A 4GLQA 3LCEA 5L10A 1EI5A 3SS4A 3T1XA 3L9KA 4GDNA 4JXSA 2ZBBA 3FKVA 2ZQ7A 3F1OA 3OPLA 3P09A 2D02A 4KUKA 5GHYA 4XXRA 1OTAA 1DRMA 1ES3A 5HL6A 1E25A 1L2SA 3BFDA 3C7UA 3E4QA 5DTKA 2JC7A 5JYOA 1N9OA 1DJAA 1IKGA 3NOUC 4S2NC 2V0WA 5FI7A 1YT4A 2Z2MB 2PAVP 3W4QA 5CGWA 2ZM0A 2QZ6A 4B93A 4HJ3A 2FFFB 2I9VA 3QHYA 1LI0A 4M3KA 3OCNA 1OJGA 3HBRA 1K54C 2XROA 2K7SA 3DTKA 4FH4A 1WA9A 1NLYA 3MS6A 4Y0TA 2BTFP 3G2ZA 5KSHA 3ITBA 4O7DA 1JWZA 1T1CA 3BRMA 1F2KA 3VP0A 1LI9A 4OQHA 3MKEA 4FTXA 3LICA 5E2EA 3A3IA 2EXAA 1DJBA 4GCZA 1Q2QA 3IX8A 4IJGA 4ZJ1A 1BYWA 1K25A 2XDMA 4C6YA 2EX6A 3MZEA 1PI5A 2XF3A 1LT0A 2P9VB 5GLCA 4EQ1A 4MNRA 3BW6A 3LEQA 4PKYG 1G6AA 3G31A 1BZAA 1U60A 2O9AA 4IVIA 4MLLA 4BWIA 5FI6A 2INWA 1G28A 2OV5A 3CI6A 2WADA 3S1YA 2ZC6B 3W4OA 2PR5A 3N8RA 1L0GA 5FQ9A 3CLOA 1XGJA 5HPFA 4FH2A 4II7A 1KVLA 3OLOA 5CHJA 5HWWA 3T4TA 4WZ5C 2X71A 1SHVA 3PAEA 4AFIA 4G3KA 2ZQAA 5HAIA 1OTBA 3IBJA 1D1JA 2E8JA 1TS6A 1XKZA 4E3MA 3VOYA 5CEDA 3BQAA 1YAXA 3EGXC 3UDFA 4X68A 1FILA 3U2AA 3D9YA 1I2WA 2K2NA 1J9MA 5J3WA 4U3TA 4GW9A 1BLHA 3GVBA 5A91A 5IS1A 1N9BA 5F5YA 4FSFA 3SZTA 3F1OB 4M4XA 2Y59A 2R9XA 1BSGA 1W8YA 2Y2LA 4OQ0A 4H6JB 3NI9A 3ZGAB 1JTDA 1OTIA 3NHQA 5HZHA 4ARZA 2EFUA 3G32A 1IYPA 3UB8A 3LFVA 1K6SA 4OKPA 2BASA 2JE5A 5DFYA 2Y79A 3RJUA 3ZG8B 3IWIA 3HJIA 1KGFA 1RGZA 3FV7A 2D01A 2QJ7A 4EU0A 4MBKA 3LR3A 3V3RA 3BJNA 3NDEA 3T4KA 2XLNA 3DTEA 5KZHA 4PKYA 2X01A 3F1NB 4I39A 1KE4A 4HH3A 3B33A 1P0ZA 4E6XA 1Z6FA 5HAQA 2WKQA 5E2FA 3ULFA 3UN7A 5IT5A 4WMCD 4X69A 5DKLA 2WKIA 4S2JA 4EUZA 2ZMAA 2VJWA 4WEJA 2QYBA 4RYEA 2Q9NA 5CTMA 4S2OA 2V1AA 4PPRA 3OCLA 3T4OA 4CLCE 4HI4A 1H8YA 3HREA 3KSHA 4R3BA 4L0LA 4CLCC 3SH9A 4DRTA 4D2OA 2WZXA 4ZTKA 1ESUA 3Q81A 3ZNTA 4E3IA 1GSXA 1VEUB 2HJ9C 3BQ8A 5EV0A 3Q7ZA 3T4JA 1ERQA 3B42A 4HEFA 4BJPA 4BLMA 4EEPA 3KSIA 3VP4A 2WAEA 3CITA 1E3UD 1QMEA 4QJGA 3SH7A 2Y2NA 3FPVA 1K55C 1EW0A 1BULA 2UV0E 4WL9A 1TDLA 3R7WB 5AVEA 3VP1A 3ZNYA 4YINA 1I2SA 2OAQ1 2ZOHA 3H82B 4GOGA 1SKOA 4DXBA 1LHYA 3C30A 4I5SA 5FAOA 3KYEA 4OLGA 5JYPA 3PBNA 4WEKA 3D3OA 5U47A 1W5DA 5EOEA 4HJ6A 3Q1FA 2Z6CA 1PWGA 1MY8A 2HF6A 2W3FA 4CJNA 3ZHHA 5KIZA 4FOFA 3ZVTA 3PR6A 3BYDA 2V1ZA 3IX4A 3MJQA 3PBSA 1BTLA 3K3DA 1KE3A 3S7NA 2WK0A 2J7VA 4S2PA 4WUJA 2X02A 3MZDA 5HFOA 4MN7A 4LCLA 4EXOA 1YPRA 4UHUA 2JN7A 3GMWA 3DWZA 1H8MA 2XR0A 2JKTI 4K91A 4EERA 4OOYA 3VSLA 3NOTC 1NJ4A 2OOLA 1Q2PA 4NG2A 1XP4A 4D60A 4IVKA 3N4IA 1N4OA 4B4XA 2HP5A 1LL5A 2KX6A 4ETXA 4FCFA 1N9NA 5J8XA 2AVXA 4KQOA 4LPZA 4R3JA 3NJAA 3NCKA 4EESA 3W4PA 3LR0A 3ICYA 1LL8A 1XJ3A 3BECA 4ZDXA 3BFEA 2XGNA 3O3VA 1ZTUA 3LEZA 2MJ6A 4BMWA 4KQQA 2P04A 2Z6DA 4RA7A 1MWUA 4OH0A 1ALQA 3CWFA 5EOOA 1L0DA 1LL9A 3F1PA 2J9OA 1KOUA 3U4LP 4JXGA 2PDRA 1HZOA 4DN0A 1YMSA 1NYMA 2ZC4B 4E3JA 4UEYA 1V9ZA 5GL9A 4DE1A 1K57A 5EVID 1VETB 5FAPA 3IS2A 3HVFA 2ZL1B 4H8RA 2VGLS 1GA9A 2Y2HA 2P7JA 1A0KA 2Y2PA 4WZ4A 3EQUA 1CJFA 4IBRA 3IBRA 1DP6A 3OPRA 4JKTA 5G4ZA 1P9WA 4WLAA 4RX3A 4DMZA 1P9RA 1UWPX 3ZG0A 4Q0HA 4K0WA 5FEFA 4Y15A 4B4ZA 3LI9A 2OLVA 2DRWA 3NDGA 2A24B 1IEMA 3T4QA 5BOHA 1PNEA 5TGFA 1GHPA 4QU3A 3VE3A 3MQ0A 5CHUA 4EEUA 4R4RA 3LIAA 3H7WB 4ZRRA 4KZ5A 3HUOA 3HL9A 3M2KA 3LY4A 4DJ2A 4S2MA 1W63Q 3CPTA 4S2LA 2J9PA 2NUPC 4I38A 2ZMFA 4EBLA 3WS5A 1MKIA 3L7HA 2ZM2A 1S67L 3FWLA 1Y28A 1NLZA 1MC0A 3IH8A 1F5MA 4I3IA 4Y3IA 1BLPA 4Y2FA 1K0KA 3HLBA 2J3WA 3UPOA 2VZWA 2LB5A 2UWXA 3AGDA 5J7EA 1VB6A 2Q0OA 5DF8A 5CEBA 3MF0A 4QY5A 2L0WA 3G35A 3G4PA 4QHCA 4ZJ2A 4LFUA 5EVIB 5FSRA 3TW8A 4OQIA 2Y2QA 3E2KA 3LUQA 4F94A 4DKIA 2EX2A 2PRFA 1PW1A 2QWSA 4IHQA 3ZCZA 5GHXA 1OPXA 4HP4A 3BY9A 1VM1A 4E04A 4P0MA 2XD1A 3HLGA 1MWTA 1OT6A 4KG5A 3GQZA 5TR7A 2DMWA 2EA9A 1XGIA 2LB9A 3UPNA 5FAQA 4C3QA 5D3OA 4A5RA 2E8IA 3N8LA 2H0TA 1TS8A 4NXEA 1PWDA 5J4EA 4C75A 3T1QB 4CLCD 3A0VA 3PXPA 1KGEA 4EQIA 1IYSA 1XJ6A 4B9OA 2GDNA 3AGEA 2OWHA 1K56A 5KSCA 3N7WA 4U0TA 3MFXA 2ZQ8A 4PMAA 2WYXA 4O0PA 2RCXA 3UY6A 4OONA 4ZAMA 3BWLA 3D4FA 1PI4A 3BLMA 2O0YA 3V3SA 5E2HA 2FH5A 2ZMVA 2VX8A 5EVEA 3VOLA 4YWZA 4GHIB 1JNUA 1IFQA 1RCJA 4P85A 3HUMA 4E3OA 1RP5A 1G5UA 3VSKA 5GLDA 3E0YA 4K0XA 2EXBA 1S4SA 3F1NA 4RVAA 5FQMA 1K38A 3WS1A 5CERA 2V0UA 4KENB 3HUNA
chains in the Genus database with same CATH topology
1H8YA 3HREA 3PBOA 4R3BA 4KZ3A 4FD8A 3GTCA 4L0LA 3MFDA 3SH9A 4X6TA 4DRTA 4D2OA 2WZXA 4ZTKA 1ESUA 3OC2A 3Q81A 1XA7A 1SKFA 3BLSA 4ZJ3A 3S22A 3V50A 3ZNTA 4E3IA 1BUEA 2P74A 3NIAA 4KZ7A 3UPPA 3IQAA 3Q7ZA 4OOMA 3ZVWA 1ERQA 3M6BA 4HEFA 1MWRA 3UO9A 5M18A 2I72A 3IXHA 4BJPA 4BLMA 4U0XA 3VP4A 2WAEA 3N6IA 1YM1A 1E3UD 1QMEA 4QJGA 4IBXA 1XX2A 4GD8A 3SH7A 2Y2NA 4X55A 5HX9A 1K55C 3P98A 5GHZA 1KVMA 1BULA 1CK3A 2G2UA 1SDEA 3GRJA 4UA7A 1TDLA 1K6RA 3LO7A 3IXBA 4UA9A 4XUZA 4JF5A 3VP1A 3ZNYA 4YINA 1I2SA 1FR1A 3OPPA 2ZQCA 1S0WA 2ZLYA 4LCMA 4MBHA 4BENA 4GOGA 4MEZA 4DXBA 4PM5A 4KG2A 2VGJA 1BLCA 1E3UA 1LHYA 3CJMA 1H8ZA 5F83A 2WAFA 1ZKJA 5GLAA 5FAOA 5CECA 3M6HA 4OLGA 5JYPA 3PBNA 1KDWA 1GHMA 4WEKA 1E4DA 3JYIA 3A3FA 3ZG9B 3WWXA 5U47A 3C5AA 4E3KA 1W5DA 4WBGA 5EOEA 4JBFA 4E6WA 4OPZA 4EBPA 1FSWA 1PZPA 2OLUA 2Y2GA 3Q1FA 3ITAA 1PWGA 5E2GA 2R9WA 5A90A 3V5MA 3OZHA 1MY8A 1OMEA 1MPLA 5KMWA 1ZG4A 1JVJA 2ZC7A 3QNBA 4GNUA 3SH8A 1SCWA 5FA7A 3O88A 1IYQA 4CJNA 3ZHHA 1YLYA 3O86A 3ZVTA 2HP6A 3BYDA 3VFHA 2V1ZA 5EE8A 1PW8A 3ZFZA 3SS5A 3BEBA 1XPBA 5FQKA 4XUXA 3SS3A 4NK3A 5HW3A 4WMCA 2ZC3B 5IHVA 3PBSA 3WRTA 1BTLA 3WS2A 4N92A 1KE3A 2BLSA 4OPYA 5DTTA 1NYYA 1M6KA 2WK0A 1ONHA 1NZUA 2J7VA 4S2PA 3VOZA 2WKHA 4LENA 4DE2A 5FASA 4UA6A 4YFMA 4JXWA 5EVLA 2G2WA 3ZDJA 4BD1A 2DNSA 2X02A 3MZDA 5HFOA 4R23A 5FQIA 4QB8A 2WGIA 2IWCA 2ZC5B 1KGGA 4LCLA 3OPHA 5A93A 1CI8A 5HAPA 4OP8A 3SOIA 1HD8A 1LLBA 2C5WB 4UHUA 1MXOA 3GMWA 3DWZA 4HBTA 1ONGA 2HDUA 2WGWA 4OPRA 2XR0A 3CG5A 4K91A 4WELA 1QMFA 4S2KA 4OOYA 3VSLA 1ZC2A 2XH9A 1NJ4A 4BQMA 4OVDA 4Y0UA 4KQRA 3HLWA 4NETA 1Q2PA 3MXSA 3NY4A 3PBTA 2V20A 3VMAA 1KDSA 4ID4A 5G18A 1XP4A 3IF6B 2WGWB 2XEPA 4IVKA 4Y7PA 3N4IA 3Q7VA 4OPQA 5A92A 1N4OA 4B4XA 2HP5A 1LL5A 2EFXA 2PU4A 1K55A 1KE0A 3A3DA 4FCFA 2H10A 1K56D 5J8XA 4R0QA 1XA1A 1JWPA 3C7VA 4KQOA 2XD5A 3MKFA 3VFFA 3PTEA 4GN2A 4R3JA 2EX9A 4JF4A 3IF6A 3G34A 3FYZA 3NCKA 4LV1A 2HP9A 2J8YA 3W4PA 3WRZA 4OOLA 3BFGA 2A3UA 4HESA 3BECA 4ZDXA 3BFEA 1YLPA 2XGNA 4GD6A 1H5XA 3PBRA 3O3VA 3GSGA 2FFYA 3LEZA 2XQZA 3DTMA 3G2YA 4KQQA 3HLCA 2IWBA 1GA0A 4RA7A 4S2IA 5M1AA 1MWUA 3UNWA 4Q8IA 5CGXA 1IYOA 5EPHA 4OH0A 3IT9A 1ALQA 5EOOA 1L0DA 1LL9A 3LCEA 5F1GA 1EI5A 4GDBA 2J9OA 4LV0A 3SS4A 3A3JA 1O07A 4JXGA 2HDRA 1HZOA 4GDNA 4JXSA 3IHAA 2Y2MA 1YMSA 1NYMA 2ZC4B 3GR2A 4E3JA 4S2NA 2Y2IA 3FKVA 1FOFA 2B5RA 5DTSA 2CC1A 1YMXA 2XFTA 2ZQ7A 3UE3A 1MWSA 3OPLA 3UE0A 3P09A 4PM7A 5CXWA 4KZBA 5GL9A 4DE1A 1YLWA 5GHYA 4LV2A 1K57A 4XXRA 5EVID 5FAPA 4H8RA 3HVFA 5CRFA 1W7FA 4KZAA 1ES4A 1I5QA 1ES3A 1GA9A 1K4EA 2QPNA 2Y2HA 2Y2KA 3PAGA 3QNCA 1E25A 1W8QA 5I94A 2Y2PA 2WGVA 1L2SA 3BFDA 3C7UA 3FZCA 4WZ4A 4EBNA 3EQUA 5DTKA 2JC7A 4IBRA 5JYOA 1JWVA 4JKTA 4Y0OA 3OPRA 1FSYA 5CGSA 3G30A 1DJAA 1IKGA 1NY0A 4RX3A 3LY3A 3ZG0A 4S2NC 2HPBA 4K0WA 2EX8A 4X56A 3FKWA 4B4ZA 2ZQ9A 2HDSA 5FI7A 3MBZA 1YLTA 4GB7A 1YT4A 2OLVA 2DRWA 2Z2MB 3B3XA 3NDGA 3W4QA 4MBFA 5CGWA 1IEMA 3C4PA 2ZM0A 3DW0A 2QZ6A 1SDNA 5BOHA 3Q07A 3HLFA 1ES2A 5DF9A 2FFFB 5TGFA 1CEGA 4WZ5A 1GHPA 1PWCA 4QU3A 5F1FA 1C3BA 5M19A 5CHUA 3QHYA 1DY6A 4R4RA 1LI0A 3V39A 4M3KA 2PU2A 3OCNA 2QMIA 3HBRA 4OLDA 4HBUA 1K54C 3HLDA 3HUOA 4KZ5A 3HL9A 4JLFA 5EECA 5AQAA 1K57C 2WUQA 2Y2OA 3M2KA 4FH4A 4QD4A 5HL1A 3LY4A 3CZDA 3C4OA 3MXRA 4S2MA 3UE1A 4Y0TA 4PPRA 4LV3A 4S2LA 2J9PA 3G2ZA 1K4FA 5KSHA 3ITBA 4O7DA 3OCLA 1JWZA 5DF7A 3BRMA 3A3EA 1PIOA 1YLZA 2HDQA 4EBLA 2WZZA 4PM9A 1LI9A 3VP0A 4OQHA 3MKEA 1CEFA 3WS0A 3IXDA 4Z9QA 3O87A 3WS5A 5E2EA 1MKIA 1YLJA 3A3IA 2ZM2A 2H0YA 2EXAA 5EVIC 3FWLA 2JBFA 3DWKA 1DJBA 5HARA 1Q2QA 3CMZA 4PM8A 4BL2A 3IH8A 1GCEA 2ZQDA 4ZJ1A 3M2JA 1DJCA 1JTGA 4GKUA 5L2FA 1XXMA 1BLPA 1HVBA 1K25A 2P9VA 2XDMA 3HLBA 3NC8A 4C6YA 5CTNA 2EX6A 3UPOA 3MZEA 1TEMA 1PI5A 2XF3A 2UWXA 2Y91A 3AGDA 3IF6C 4KZ8A 5EUAA 2Y2JA 2ZM8A 5DF8A 5CEBA 4QY5A 2P9VB 4X53A 5GLCA 5TFQA 4EV4A 3G35A 4MNRA 5DVAA 3G4PA 1BLSA 4KZ9A 4E3LA 4QHCA 3W8KA 4ZJ2A 1G6AA 1IKIA 5EVIB 3UDIA 3G31A 5FSRA 2XFSA 4OP5A 1BZAA 1WE4A 1U60A 3IXGA 1IELA 1EWZA 4OQIA 2Y2QA 3E2KA 3BFCA 4IVIA 4MLLA 4JXVA 5FI6A 4KZ4A 4F94A 1ES5A 1M40A 1PYYA 4DKIA 2XK1A 3IWQA 2DCFA 2EX2A 2Y55A 2OV5A 1PW1A 5EVIA 2Z2LB 3TSGA 1ERMA 1PZOA 4R4SA 4GZBA 5CHMA 4RX2A 3TOIA 2WADA 3S1YA 2ZC6B 3W4OA 3ZCZA 3N8RA 5GHXA 5E43A 3E2LA 2IWDA 1L0GA 5FQ9A 1MBLA 2ZJ9A 1XGJA 3EQVA 3IWOA 1TVFA 4IEDA 1VM1A 1WYCA 4FH2A 3RXWA 3RXXA 4P0MA 1KVLA 2XD1A 3HLGA 5CHJA 1Y54A 5F82A 4B88A 3TG9A 1AXBA 1EROA 1NZOA 1MWTA 4WZ5C 2X71A 1SHVA 4KG5A 3ZG5A 3GQZA 3PAEA 1FCOA 2ZQAA 1L0FA 5FQQA 5TR7A 1XGIA 3UPNA 5HAIA 5FAQA 4C3QA 4DE0A 1FR6A 2C6WB 5AQBA 2Y4AA 2Q9MA 1XKZA 4E3MA 1VQQA 2H5SA 4WM9A 3VOYA 5CEDA 4DE3A 5D3OA 3UDFA 4A5RA 4KZ6A 3IF5A 4X68A 2E8IA 3N8LA 4N1XA 2H0TA 1K54A 2RL3A 4DDSA 1PWDA 1I2WA 3S4XA 4C75A 4CPKA 1J9MA 4DDYA 4U3TA 3ZG7B 1NRFA 1BLHA 3GVBA 4OQGA 2VGKA 1O7EA 5A91A 4EWFA 1N9BA 1KGEA 3WS4A 4EQIA 1G68A 1IYSA 2JCHA 4FSFA 5AQ9A 2Y59A 1TDGA 3BM6A 2GDNA 2R9XA 1BSGA 1W8YA 2Y2LA 1K56A 3AGEA 3N8SA 2WKEA 4OQ0A 5KSCA 5FDHA 3N7WA 3NI9A 3ZGAB 4U0TA 3UDXA 1JTDA 3VP3A 2PBYA 1FCMA 2ZQ8A 2EFUA 3G32A 1BT5A 1IYPA 3Q7VB 4R1GA 4PMAA 1K6SA 4OKPA 3PBQA 2JE5A 4JPMA 1S6RA 2WYXA 2V2FF 3RJUA 3ZG8B 4E3NA 3IWIA 1YQSA 2RCXA 3I7JA 4OONA 3UY6A 2BG1A 3Q82A 4P87A 4ZAMA 1KGFA 1RGZA 4BL3A 4PM6A 3D4FA 1PI4A 3FV7A 3BLMA 1RGYA 1ZG6A 3ISGA 2OSUA 4MBKA 1FCNA 1L0EA 5E2HA 3V3SA 4DXCA 4P6BA 5FI2A 3VP2A 4UAAA 3V3RA 4QY6A 3IHBA 3NDEA 3GV9A 2XLNA 3MZFA 4JF6A 5KZHA 5AQ7A 4N9LA 2X01A 2ZD8A 3BFFA 4N9KA 1KE4A 1RCJA 2A49A 4P85A 4E6XA 3AGFA 1Z6FA 1HTZA 5HAQA 3HUMA 5E2FA 3UN7A 1NXYA 4BD0A 4E3OA 1RP5A 3VSKA 3IH9A 4WMCD 4X69A 3HLEA 5FQJA 4KG6A 2WKIA 5GLDA 1CI9A 4K0XA 4S2JA 1ESIA 4WYYA 2EXBA 2ZMAA 4EUZA 1GHIA 4WEJA 5FATA 1W79A 4RVAA 2Q9NA 4RYEA 1K38A 5CTMA 5FQMA 1FQGA 5GLBA 3WS1A 4DF6A 4S2OA 5CERA 3NBLA 4N1HA 1WYBA 4KENB 3HUNA 4ZBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8Y A;  3HRE A;  3PBO A;  4R3B A;  4KZ3 A;  4FD8 A;  3GTC A;  4L0L A;  3MFD A;  3SH9 A;  4X6T A;  4DRT A;  4D2O A;  2WZX A;  4ZTK A;  1ESU A;  3OC2 A;  3Q81 A;  1XA7 A;  1SKF A;  3BLS A;  4ZJ3 A;  3S22 A;  3V50 A;  3ZNT A;  4E3I A;  1BUE A;  2P74 A;  3NIA A;  4KZ7 A;  3UPP A;  3IQA A;  3Q7Z A;  4OOM A;  3ZVW A;  1ERQ A;  3M6B A;  4HEF A;  1MWR A;  3UO9 A;  5M18 A;  2I72 A;  3IXH A;  4BJP A;  4BLM A;  4U0X A;  3VP4 A;  2WAE A;  3N6I A;  1YM1 A;  1E3U D;  1QME A;  4QJG A;  4IBX A;  1XX2 A;  4GD8 A;  3SH7 A;  2Y2N A;  4X55 A;  5HX9 A;  1K55 C;  3P98 A;  5GHZ A;  1KVM A;  1BUL A;  1CK3 A;  2G2U A;  1SDE A;  3GRJ A;  4UA7 A;  1TDL A;  1K6R A;  3LO7 A;  3IXB A;  4UA9 A;  4XUZ A;  4JF5 A;  3VP1 A;  3ZNY A;  4YIN A;  1I2S A;  1FR1 A;  3OPP A;  2ZQC A;  1S0W A;  2ZLY A;  4LCM A;  4MBH A;  4BEN A;  4GOG A;  4MEZ A;  4DXB A;  4PM5 A;  4KG2 A;  2VGJ A;  1BLC A;  1E3U A;  1LHY A;  3CJM A;  1H8Z A;  5F83 A;  2WAF A;  1ZKJ A;  5GLA A;  5FAO A;  5CEC A;  3M6H A;  4OLG A;  5JYP A;  3PBN A;  1KDW A;  1GHM A;  4WEK A;  1E4D A;  3JYI A;  3A3F A;  3ZG9 B;  3WWX A;  5U47 A;  3C5A A;  4E3K A;  1W5D A;  4WBG A;  5EOE A;  4JBF A;  4E6W A;  4OPZ A;  4EBP A;  1FSW A;  1PZP A;  2OLU A;  2Y2G A;  3Q1F A;  3ITA A;  1PWG A;  5E2G A;  2R9W A;  5A90 A;  3V5M A;  3OZH A;  1MY8 A;  1OME A;  1MPL A;  5KMW A;  1ZG4 A;  1JVJ A;  2ZC7 A;  3QNB A;  4GNU A;  3SH8 A;  1SCW A;  5FA7 A;  3O88 A;  1IYQ A;  4CJN A;  3ZHH A;  1YLY A;  3O86 A;  3ZVT A;  2HP6 A;  3BYD A;  3VFH A;  2V1Z A;  5EE8 A;  1PW8 A;  3ZFZ A;  3SS5 A;  3BEB A;  1XPB A;  5FQK A;  4XUX A;  3SS3 A;  4NK3 A;  5HW3 A;  4WMC A;  2ZC3 B;  5IHV A;  3PBS A;  3WRT A;  1BTL A;  3WS2 A;  4N92 A;  1KE3 A;  2BLS A;  4OPY A;  5DTT A;  1NYY A;  1M6K A;  2WK0 A;  1ONH A;  1NZU A;  2J7V A;  4S2P A;  3VOZ A;  2WKH A;  4LEN A;  4DE2 A;  5FAS A;  4UA6 A;  4YFM A;  4JXW A;  5EVL A;  2G2W A;  3ZDJ A;  4BD1 A;  2DNS A;  2X02 A;  3MZD A;  5HFO A;  4R23 A;  5FQI A;  4QB8 A;  2WGI A;  2IWC A;  2ZC5 B;  1KGG A;  4LCL A;  3OPH A;  5A93 A;  1CI8 A;  5HAP A;  4OP8 A;  3SOI A;  1HD8 A;  1LLB A;  2C5W B;  4UHU A;  1MXO A;  3GMW A;  3DWZ A;  4HBT A;  1ONG A;  2HDU A;  2WGW A;  4OPR A;  2XR0 A;  3CG5 A;  4K91 A;  4WEL A;  1QMF A;  4S2K A;  4OOY A;  3VSL A;  1ZC2 A;  2XH9 A;  1NJ4 A;  4BQM A;  4OVD A;  4Y0U A;  4KQR A;  3HLW A;  4NET A;  1Q2P A;  3MXS A;  3NY4 A;  3PBT A;  2V20 A;  3VMA A;  1KDS A;  4ID4 A;  5G18 A;  1XP4 A;  3IF6 B;  2WGW B;  2XEP A;  4IVK A;  4Y7P A;  3N4I A;  3Q7V A;  4OPQ A;  5A92 A;  1N4O A;  4B4X A;  2HP5 A;  1LL5 A;  2EFX A;  2PU4 A;  1K55 A;  1KE0 A;  3A3D A;  4FCF A;  2H10 A;  1K56 D;  5J8X A;  4R0Q A;  1XA1 A;  1JWP A;  3C7V A;  4KQO A;  2XD5 A;  3MKF A;  3VFF A;  3PTE A;  4GN2 A;  4R3J A;  2EX9 A;  4JF4 A;  3IF6 A;  3G34 A;  3FYZ A;  3NCK A;  4LV1 A;  2HP9 A;  2J8Y A;  3W4P A;  3WRZ A;  4OOL A;  3BFG A;  2A3U A;  4HES A;  3BEC A;  4ZDX A;  3BFE A;  1YLP A;  2XGN A;  4GD6 A;  1H5X A;  3PBR A;  3O3V A;  3GSG A;  2FFY A;  3LEZ A;  2XQZ A;  3DTM A;  3G2Y A;  4KQQ A;  3HLC A;  2IWB A;  1GA0 A;  4RA7 A;  4S2I A;  5M1A A;  1MWU A;  3UNW A;  4Q8I A;  5CGX A;  1IYO A;  5EPH A;  4OH0 A;  3IT9 A;  1ALQ A;  5EOO A;  1L0D A;  1LL9 A;  3LCE A;  5F1G A;  1EI5 A;  4GDB A;  2J9O A;  4LV0 A;  3SS4 A;  3A3J A;  1O07 A;  4JXG A;  2HDR A;  1HZO A;  4GDN A;  4JXS A;  3IHA A;  2Y2M A;  1YMS A;  1NYM A;  2ZC4 B;  3GR2 A;  4E3J A;  4S2N A;  2Y2I A;  3FKV A;  1FOF A;  2B5R A;  5DTS A;  2CC1 A;  1YMX A;  2XFT A;  2ZQ7 A;  3UE3 A;  1MWS A;  3OPL A;  3UE0 A;  3P09 A;  4PM7 A;  5CXW A;  4KZB A;  5GL9 A;  4DE1 A;  1YLW A;  5GHY A;  4LV2 A;  1K57 A;  4XXR A;  5EVI D;  5FAP A;  4H8R A;  3HVF A;  5CRF A;  1W7F A;  4KZA A;  1ES4 A;  1I5Q A;  1ES3 A;  1GA9 A;  1K4E A;  2QPN A;  2Y2H A;  2Y2K A;  3PAG A;  3QNC A;  1E25 A;  1W8Q A;  5I94 A;  2Y2P A;  2WGV A;  1L2S A;  3BFD A;  3C7U A;  3FZC A;  4WZ4 A;  4EBN A;  3EQU A;  5DTK A;  2JC7 A;  4IBR A;  5JYO A;  1JWV A;  4JKT A;  4Y0O A;  3OPR A;  1FSY A;  5CGS A;  3G30 A;  1DJA A;  1IKG A;  1NY0 A;  4RX3 A;  3LY3 A;  3ZG0 A;  4S2N C;  2HPB A;  4K0W A;  2EX8 A;  4X56 A;  3FKW A;  4B4Z A;  2ZQ9 A;  2HDS A;  5FI7 A;  3MBZ A;  1YLT A;  4GB7 A;  1YT4 A;  2OLV A;  2DRW A;  2Z2M B;  3B3X A;  3NDG A;  3W4Q A;  4MBF A;  5CGW A;  1IEM A;  3C4P A;  2ZM0 A;  3DW0 A;  2QZ6 A;  1SDN A;  5BOH A;  3Q07 A;  3HLF A;  1ES2 A;  5DF9 A;  2FFF B;  5TGF A;  1CEG A;  4WZ5 A;  1GHP A;  1PWC A;  4QU3 A;  5F1F A;  1C3B A;  5M19 A;  5CHU A;  3QHY A;  1DY6 A;  4R4R A;  1LI0 A;  3V39 A;  4M3K A;  2PU2 A;  3OCN A;  2QMI A;  3HBR A;  4OLD A;  4HBU A;  1K54 C;  3HLD A;  3HUO A;  4KZ5 A;  3HL9 A;  4JLF A;  5EEC A;  5AQA A;  1K57 C;  2WUQ A;  2Y2O A;  3M2K A;  4FH4 A;  4QD4 A;  5HL1 A;  3LY4 A;  3CZD A;  3C4O A;  3MXR A;  4S2M A;  3UE1 A;  4Y0T A;  4PPR A;  4LV3 A;  4S2L A;  2J9P A;  3G2Z A;  1K4F A;  5KSH A;  3ITB A;  4O7D A;  3OCL A;  1JWZ A;  5DF7 A;  3BRM A;  3A3E A;  1PIO A;  1YLZ A;  2HDQ A;  4EBL A;  2WZZ A;  4PM9 A;  1LI9 A;  3VP0 A;  4OQH A;  3MKE A;  1CEF A;  3WS0 A;  3IXD A;  4Z9Q A;  3O87 A;  3WS5 A;  5E2E A;  1MKI A;  1YLJ A;  3A3I A;  2ZM2 A;  2H0Y A;  2EXA A;  5EVI C;  3FWL A;  2JBF A;  3DWK A;  1DJB A;  5HAR A;  1Q2Q A;  3CMZ A;  4PM8 A;  4BL2 A;  3IH8 A;  1GCE A;  2ZQD A;  4ZJ1 A;  3M2J A;  1DJC A;  1JTG A;  4GKU A;  5L2F A;  1XXM A;  1BLP A;  1HVB A;  1K25 A;  2P9V A;  2XDM A;  3HLB A;  3NC8 A;  4C6Y A;  5CTN A;  2EX6 A;  3UPO A;  3MZE A;  1TEM A;  1PI5 A;  2XF3 A;  2UWX A;  2Y91 A;  3AGD A;  3IF6 C;  4KZ8 A;  5EUA A;  2Y2J A;  2ZM8 A;  5DF8 A;  5CEB A;  4QY5 A;  2P9V B;  4X53 A;  5GLC A;  5TFQ A;  4EV4 A;  3G35 A;  4MNR A;  5DVA A;  3G4P A;  1BLS A;  4KZ9 A;  4E3L A;  4QHC A;  3W8K A;  4ZJ2 A;  1G6A A;  1IKI A;  5EVI B;  3UDI A;  3G31 A;  5FSR A;  2XFS A;  4OP5 A;  1BZA A;  1WE4 A;  1U60 A;  3IXG A;  1IEL A;  1EWZ A;  4OQI A;  2Y2Q A;  3E2K A;  3BFC A;  4IVI A;  4MLL A;  4JXV A;  5FI6 A;  4KZ4 A;  4F94 A;  1ES5 A;  1M40 A;  1PYY A;  4DKI A;  2XK1 A;  3IWQ A;  2DCF A;  2EX2 A;  2Y55 A;  2OV5 A;  1PW1 A;  5EVI A;  2Z2L B;  3TSG A;  1ERM A;  1PZO A;  4R4S A;  4GZB A;  5CHM A;  4RX2 A;  3TOI A;  2WAD A;  3S1Y A;  2ZC6 B;  3W4O A;  3ZCZ A;  3N8R A;  5GHX A;  5E43 A;  3E2L A;  2IWD A;  1L0G A;  5FQ9 A;  1MBL A;  2ZJ9 A;  1XGJ A;  3EQV A;  3IWO A;  1TVF A;  4IED A;  1VM1 A;  1WYC A;  4FH2 A;  3RXW A;  3RXX A;  4P0M A;  1KVL A;  2XD1 A;  3HLG A;  5CHJ A;  1Y54 A;  5F82 A;  4B88 A;  3TG9 A;  1AXB A;  1ERO A;  1NZO A;  1MWT A;  4WZ5 C;  2X71 A;  1SHV A;  4KG5 A;  3ZG5 A;  3GQZ A;  3PAE A;  1FCO A;  2ZQA A;  1L0F A;  5FQQ A;  5TR7 A;  1XGI A;  3UPN A;  5HAI A;  5FAQ A;  4C3Q A;  4DE0 A;  1FR6 A;  2C6W B;  5AQB A;  2Y4A A;  2Q9M A;  1XKZ A;  4E3M A;  1VQQ A;  2H5S A;  4WM9 A;  3VOY A;  5CED A;  4DE3 A;  5D3O A;  3UDF A;  4A5R A;  4KZ6 A;  3IF5 A;  4X68 A;  2E8I A;  3N8L A;  4N1X A;  2H0T A;  1K54 A;  2RL3 A;  4DDS A;  1PWD A;  1I2W A;  3S4X A;  4C75 A;  4CPK A;  1J9M A;  4DDY A;  4U3T A;  3ZG7 B;  1NRF A;  1BLH A;  3GVB A;  4OQG A;  2VGK A;  1O7E A;  5A91 A;  4EWF A;  1N9B A;  1KGE A;  3WS4 A;  4EQI A;  1G68 A;  1IYS A;  2JCH A;  4FSF A;  5AQ9 A;  2Y59 A;  1TDG A;  3BM6 A;  2GDN A;  2R9X A;  1BSG A;  1W8Y A;  2Y2L A;  1K56 A;  3AGE A;  3N8S A;  2WKE A;  4OQ0 A;  5KSC A;  5FDH A;  3N7W A;  3NI9 A;  3ZGA B;  4U0T A;  3UDX A;  1JTD A;  3VP3 A;  2PBY A;  1FCM A;  2ZQ8 A;  2EFU A;  3G32 A;  1BT5 A;  1IYP A;  3Q7V B;  4R1G A;  4PMA A;  1K6S A;  4OKP A;  3PBQ A;  2JE5 A;  4JPM A;  1S6R A;  2WYX A;  2V2F F;  3RJU A;  3ZG8 B;  4E3N A;  3IWI A;  1YQS A;  2RCX A;  3I7J A;  4OON A;  3UY6 A;  2BG1 A;  3Q82 A;  4P87 A;  4ZAM A;  1KGF A;  1RGZ A;  4BL3 A;  4PM6 A;  3D4F A;  1PI4 A;  3FV7 A;  3BLM A;  1RGY A;  1ZG6 A;  3ISG A;  2OSU A;  4MBK A;  1FCN A;  1L0E A;  5E2H A;  3V3S A;  4DXC A;  4P6B A;  5FI2 A;  3VP2 A;  4UAA A;  3V3R A;  4QY6 A;  3IHB A;  3NDE A;  3GV9 A;  2XLN A;  3MZF A;  4JF6 A;  5KZH A;  5AQ7 A;  4N9L A;  2X01 A;  2ZD8 A;  3BFF A;  4N9K A;  1KE4 A;  1RCJ A;  2A49 A;  4P85 A;  4E6X A;  3AGF A;  1Z6F A;  1HTZ A;  5HAQ A;  3HUM A;  5E2F A;  3UN7 A;  1NXY A;  4BD0 A;  4E3O A;  1RP5 A;  3VSK A;  3IH9 A;  4WMC D;  4X69 A;  3HLE A;  5FQJ A;  4KG6 A;  2WKI A;  5GLD A;  1CI9 A;  4K0X A;  4S2J A;  1ESI A;  4WYY A;  2EXB A;  2ZMA A;  4EUZ A;  1GHI A;  4WEJ A;  5FAT A;  1W79 A;  4RVA A;  2Q9N A;  4RYE A;  1K38 A;  5CTM A;  5FQM A;  1FQG A;  5GLB A;  3WS1 A;  4DF6 A;  4S2O A;  5CER A;  3NBL A;  4N1H A;  1WYB A;  4KEN B;  3HUN A;  4ZBE A; 
#chains in the Genus database with same CATH topology
 2L4R A;  2Y8H A;  3TE8 A;  3PBO A;  4YOF A;  4KZ3 A;  3QP8 A;  4X6T A;  1XA7 A;  3LIF A;  2VK3 A;  3IQA A;  1X0O A;  4OOM A;  3M6B A;  1MWR A;  4U0X A;  5IU1 A;  1TD5 A;  3N6I A;  2XA7 M;  2JKT M;  3KSG A;  4IBX A;  1VEU A;  1KVM A;  1PFL A;  2G2U A;  1SDE A;  3GRJ A;  3JVU A;  1FR1 A;  3OPP A;  4GS9 A;  4MBH A;  2VGJ A;  1BLC A;  3EGD C;  2KDK A;  5CEC A;  1KDW A;  3WWX A;  5F69 A;  4HJ4 A;  2VLG A;  1FSW A;  2OLU A;  3ITA A;  5E2G A;  4ESP A;  1STZ A;  3R4K A;  5KMW A;  3SH8 A;  1JVJ A;  2ZC7 A;  4GNU A;  1P97 A;  1SCW A;  4KUO A;  2W3G A;  1IYQ A;  3LYX A;  5EE8 A;  2W3E A;  3BEB A;  3E4P A;  3SS3 A;  3PYP A;  4NK3 A;  3UB9 A;  2ZC3 B;  4N92 A;  2BLS A;  4HOI A;  4Z1W A;  1M6K A;  1ONH A;  4DE2 A;  4LEN A;  4YFM A;  1T1A A;  2G2W A;  3FC7 A;  4BD1 A;  5L07 A;  2IWC A;  3NOP C;  3JPU A;  1LSV A;  4OP8 A;  3SOI A;  2JKF A;  1HD8 A;  1LLB A;  3EEA A;  2WGW A;  4OPR A;  4BBU A;  3CG5 A;  4XT2 B;  3IX3 A;  1ZC2 A;  2XH9 A;  4R38 A;  3CHW P;  3PBT A;  2XEP A;  4Y7P A;  3W2Z A;  4MN5 A;  2PU4 A;  1K55 A;  1KE0 A;  3A3D A;  4RQ9 A;  4NXG A;  1HLU P;  1XA1 A;  3MKF A;  1DP9 A;  4JF4 A;  2ACG A;  3IF6 A;  1Z09 A;  2HP9 A;  1W63 M;  4OOL A;  4CLC A;  2A3U A;  1GSW A;  1YLP A;  4KQD A;  4F3L B;  3CAX A;  2FFY A;  3C8C A;  4GHI A;  3S7O A;  2WKR A;  5M1A A;  4Q8I A;  5EPH A;  1NRJ A;  5F1G A;  3P7N A;  4GDB A;  4LRX C;  4GJ4 A;  2HDR A;  2Y2M A;  3CUE A;  3F1P B;  2B5R A;  3UE3 A;  2W1T B;  2NUT C;  5CXW A;  4KZB A;  1YLW A;  5CRF A;  3D72 A;  1W7F A;  1ES4 A;  1I5Q A;  4EET B;  1S1Z A;  4EBN A;  4Y0O A;  4WN5 A;  3IS2 B;  3DAV A;  5EFW A;  3LY3 A;  3VV4 A;  2HPB A;  4X56 A;  2V1B A;  2GJ3 A;  2B95 A;  4K08 A;  4G3V A;  4MBF A;  2KLI A;  3C4P A;  2R78 A;  3Q07 A;  5TBM A;  2VKS A;  5DF9 A;  2B02 A;  1PWC A;  3QP5 A;  5M19 A;  1OTE A;  1DY6 A;  2PHY A;  3V39 A;  2PU2 A;  2QMI A;  4OLD A;  5AQA A;  4JLF A;  2VV6 A;  1K57 C;  2WUQ A;  2Y2O A;  5HL1 A;  3MXR A;  3UE1 A;  4LV3 A;  3A3E A;  4PM9 A;  5DFX A;  1CEF A;  3IXD A;  3KSF A;  1YLJ A;  3QP4 A;  2H0Y A;  5EVI C;  5HAR A;  3A0S A;  3CMZ A;  4BL2 A;  2ZQD A;  1DJC A;  1JTG A;  5L2F A;  3GDI A;  2P9V A;  3NC8 A;  5CTN A;  3KYZ A;  1TEM A;  4KZ8 A;  2Y2J A;  2VEA A;  2ZM8 A;  2PYP A;  2WKP A;  3PHY A;  5TFQ A;  3S7P A;  1BLS A;  3C38 A;  3W8K A;  1IKI A;  2XFS A;  4OP5 A;  1WE4 A;  3IXG A;  4HQA A;  1EWZ A;  3MQO A;  3BFC A;  4JXV A;  1M40 A;  1PYY A;  2XK1 A;  2V8F A;  1T19 A;  3MR0 A;  2Z2L B;  4GZB A;  5CHM A;  4RX2 A;  3TOI A;  5HDC A;  3E2L A;  2IWD A;  2PYR A;  3EQV A;  1TVF A;  4IED A;  3RXX A;  5AVF A;  2QHK A;  3QP6 A;  1Y54 A;  2M1C A;  5F82 A;  4B88 A;  1ERO A;  1NZO A;  4LRZ E;  3ZG5 A;  1T18 A;  3RTY A;  1FCO A;  1L0F A;  5F68 A;  1YSQ A;  4DE0 A;  1FR6 A;  2C6W B;  1TS7 A;  5AQB A;  4ETZ A;  1VQQ A;  4WM9 A;  3VE4 A;  4KZ6 A;  1DP8 A;  3IF5 A;  4QWO A;  2XA7 S;  4N1X A;  3EOI A;  3P01 A;  2A2L A;  4DDY A;  4MCW A;  4OQG A;  4ARZ B;  1O7E A;  5FDS A;  1G68 A;  3JVV A;  5AQ9 A;  2V8C A;  2W1T A;  3BM6 A;  4LRY C;  3N8S A;  4DJ3 A;  2WKE A;  5FDH A;  3UDX A;  4Y5F A;  1VET A;  3VP3 A;  1FCM A;  1VHM A;  5I5L A;  4Q0J A;  1BT5 A;  3Q7V B;  1XFN A;  1S66 L;  3UE6 A;  5G4Y A;  2G7U A;  3PBQ A;  4R70 A;  5DJT A;  1S6R A;  2V2F F;  2M7V A;  4LLO B;  4E3N A;  1YQS A;  3CUE C;  2BG1 A;  3MXQ A;  4NXF A;  4HP9 A;  4BL3 A;  4PM6 A;  1T1B A;  2JKR M;  2OSU A;  1FCN A;  1L0E A;  4DXC A;  5DKK A;  3LIE A;  4JF6 A;  4N9L A;  2ZD8 A;  3BFF A;  4HY8 A;  3RFB A;  3AGF A;  1HTZ A;  4YNR A;  2JHE A;  3IH9 A;  3HLE A;  5FQJ A;  4KG6 A;  1CI9 A;  1ESI A;  1GHI A;  3LI8 A;  1NWZ A;  5FAT A;  3K2N A;  2B18 A;  1LSW A;  1FQG A;  2FZ0 A;  3CPT B;  5HPI A;  3NBL A;  4N1H A;  4EW7 A;  4QPR A;  3IT9 A;  2VA0 A;  4JGP A;  1SKF A;  3S22 A;  1GSV A;  1BUE A;  3UPP A;  2M7U A;  3ZVW A;  1UGU A;  5M18 A;  2P08 A;  3IXH A;  4L9G A;  4GD8 A;  2XRN A;  4BBV A;  3P98 A;  4UA7 A;  3K3C A;  1K6R A;  3IXB A;  2J3T C;  3MQQ A;  4XUZ A;  4JF5 A;  3LR4 A;  4L9E A;  2O99 A;  4PM5 A;  4KG2 A;  5GLA A;  1E3U A;  2WAF A;  3M6H A;  3TJZ C;  3OOV A;  1GHM A;  1E4D A;  3JYI A;  3ZG9 B;  1FIK A;  3OBF A;  3C5A A;  4WBG A;  4JGO A;  1TF1 A;  4JBF A;  1SKO B;  4OPZ A;  3QP1 A;  1PZP A;  3NUL A;  1MZU A;  1H3Q A;  2R9W A;  3OZH A;  1OME A;  1ZG4 A;  4O8G A;  3O88 A;  4X25 A;  3O86 A;  1ZHH B;  2HP6 A;  3UB5 P;  3VFH A;  1PW8 A;  3ZFZ A;  4XUX A;  5HW3 A;  4WMC A;  1YSP A;  3WS2 A;  4OPY A;  2KOI A;  5DTT A;  1NYY A;  1L3L A;  4CQH A;  4UA6 A;  4JXW A;  3ZDJ A;  2DNS A;  1OTD A;  4R23 A;  4QB8 A;  2WGI A;  2ZC5 B;  1KGG A;  1CI8 A;  5HAP A;  1ONG A;  2IA2 A;  1F9I A;  1S1Y A;  4S2K A;  2HJE A;  4OVD A;  3HLW A;  4NET A;  4P6Z S;  3MXS A;  3NY4 A;  2PT7 A;  2V20 A;  3VMA A;  5G18 A;  2W1R A;  2WGW B;  5A92 A;  3DTI A;  1K56 D;  2XD5 A;  3LGO A;  4GN2 A;  2EX9 A;  5K5B A;  4Y17 A;  4LV1 A;  3BFG A;  3A0R A;  2QJ5 A;  4GD6 A;  3E4O A;  3PBR A;  4HHD A;  2XQZ A;  3DTM A;  3G2Y A;  4I3J A;  3H9W A;  2IWB A;  3UNW A;  4S2I A;  1IYO A;  5FEG A;  2J3T D;  1J3W A;  4LV0 A;  3A3J A;  1O07 A;  4EUV A;  3IHA A;  3ZQ5 A;  5LBR A;  3GR2 A;  4S2N A;  2Y2I A;  1FOF A;  2PR6 A;  4LGW A;  2CC1 A;  4IUH A;  1YMX A;  2XFT A;  5DTS A;  1MWS A;  2ZOI A;  3UE0 A;  4PM7 A;  4H6J A;  3B47 A;  4LV2 A;  5TJJ A;  4KZA A;  4R3A A;  5L09 A;  2Y2K A;  1K4E A;  2QPN A;  3PAG A;  3QNC A;  3T1R A;  1W8Q A;  5AJG A;  5I94 A;  2WGV A;  3FZC A;  1ODV A;  1JWV A;  1FSY A;  2A24 A;  5CGS A;  4IUK A;  3G30 A;  2W3H A;  2ZL1 A;  1NY0 A;  3HCY A;  3GEC A;  2EX8 A;  3FKW A;  2W3D A;  2HDS A;  2ZQ9 A;  3MBZ A;  1YLT A;  4GB7 A;  3B3X A;  3H7W A;  2VV8 A;  2GNX A;  4X1M A;  3DW0 A;  4GS9 B;  1SDN A;  3HLF A;  3SW1 A;  1ES2 A;  1CEG A;  2HZ5 A;  4WZ5 A;  5F1F A;  1C3B A;  5EM0 A;  3QP2 A;  1XFQ A;  4HBU A;  3HLD A;  5EEC A;  2JKR I;  4QD4 A;  3CZD A;  3C4O A;  1YKD A;  1K4F A;  5DF7 A;  1PIO A;  1YLZ A;  2HDQ A;  1ACF A;  2J80 A;  2WZZ A;  3S7Q A;  3WS0 A;  4Z9Q A;  3O87 A;  4G3W A;  2JBF A;  3DWK A;  1CQA A;  4PM8 A;  3KX0 X;  5C5K A;  1GCE A;  3M2J A;  4GKU A;  1XXM A;  1HVB A;  2O9C A;  3T4S A;  3C2W A;  3HJK A;  3IF6 C;  2Y91 A;  4I3A A;  5EUA A;  5L8M A;  1IOU A;  3R7W A;  5FL3 A;  4X53 A;  4EV4 A;  5DVA A;  4X1L A;  4KZ9 A;  4E3L A;  5HD5 A;  3UDI A;  3UME A;  1IEL A;  4UQI M;  4Q0I A;  3T50 A;  4KZ4 A;  1ES5 A;  3IWQ A;  2DCF A;  2Y55 A;  5EVI A;  3TSG A;  1ERM A;  1PZO A;  4R4S A;  5E43 A;  2GZA A;  1MBL A;  2ZJ9 A;  4NEE D;  3IWO A;  3RXW A;  1WYC A;  4HH2 A;  2PD8 A;  2W27 A;  3TG9 A;  1AXB A;  2W0N A;  4HIA A;  4F3L A;  2H28 A;  5FQQ A;  4MN6 A;  3UMD A;  2Y4A A;  2Q9M A;  2H5S A;  4DE3 A;  1S4R A;  3T4L A;  2L1M A;  2V9A A;  1K54 A;  2RL3 A;  4DDS A;  3S4X A;  4CPK A;  1TS0 A;  2PD7 A;  2VGL M;  1SZV A;  3ZG7 B;  1NRF A;  4HNB A;  2YKH A;  2VGK A;  4EWF A;  4JGQ A;  3WS4 A;  2JCH A;  1TDG A;  2HGV A;  5HWV A;  4PAU A;  3UB6 A;  2PBY A;  3EEH A;  4R1G A;  1XJ4 A;  5HDD A;  4JPM A;  3EWK A;  3KYQ A;  2CMN A;  2HV1 A;  3I7J A;  4P87 A;  3Q82 A;  5HWT A;  3T1S A;  1RGY A;  1ZG6 A;  3ISG A;  5HDS A;  4P6B A;  3T12 B;  5FI2 A;  3VP2 A;  4UAA A;  1MKM A;  4QY6 A;  3IHB A;  1CF0 A;  2QKP A;  3GV9 A;  3MZF A;  4PHT A;  5HD3 A;  5AQ7 A;  5TBM B;  5MC7 A;  4ME4 A;  4N9K A;  2A49 A;  3MMH A;  3E98 A;  2PBD P;  1NXY A;  4BD0 A;  4WYY A;  5A8B A;  1OJ5 A;  4JGR A;  1W79 A;  1AWI A;  5GLB A;  4DF6 A;  1UWN X;  1WYB A;  3UO9 A;  4ZBE A;  2K31 A;  3UB7 A;  4FD8 A;  1PRQ A;  3GTC A;  4FUW A;  3MFD A;  4Y13 A;  3G6O A;  3OC2 A;  4MDZ A;  3BLS A;  4ZJ3 A;  3V50 A;  5HSQ A;  2P74 A;  3NIA A;  4KZ7 A;  1XJ2 A;  3RH8 B;  2I72 A;  5EM1 A;  1YM1 A;  1N9L A;  1XX2 A;  4X55 A;  5HX9 A;  5GHZ A;  3H82 A;  1CK3 A;  1OT9 A;  3LO7 A;  4UA9 A;  1D06 A;  2OAP 1;  2ZQC A;  1S0W A;  2ZLY A;  4LCM A;  4BEN A;  4MEZ A;  3O5Y A;  4NKP A;  3CJM A;  5F83 A;  2EWW A;  1H8Z A;  1ZKJ A;  3A3F A;  4E3K A;  2XSS A;  4E6W A;  4EBP A;  2Y2G A;  4R6L A;  5A90 A;  4UQI S;  3V5M A;  1MPL A;  3QNB A;  5FA7 A;  1YLY A;  3NEC A;  3LR5 A;  4NXB A;  3SS5 A;  5CX7 A;  1XPB A;  5FQK A;  2OWJ A;  1H0M A;  1V9Y A;  5IHV A;  3WRT A;  4BBT A;  2YKF A;  3LIB A;  3VOZ A;  1NZU A;  2WKH A;  5FAS A;  5EVL A;  1G6O A;  4XT2 A;  5FQI A;  5F6A A;  3OPH A;  5A93 A;  2JKG A;  3KO6 A;  2C5W B;  1MXO A;  4HBT A;  2GX5 A;  2HDU A;  4WEL A;  1D7E A;  1QMF A;  3DBA A;  4BQM A;  2O9B A;  4Y0U A;  1F98 A;  4KQR A;  3ZYT A;  1KDS A;  3FPW A;  4ID4 A;  1Y4O A;  3IF6 B;  3Q7V A;  4OPQ A;  4L9F A;  2EFX A;  5DJU A;  2H10 A;  4R0Q A;  1JWP A;  3C7V A;  4O01 A;  3VFF A;  3PTE A;  3V67 A;  3LID A;  2EWV A;  3FYZ A;  3G34 A;  1LSX A;  2J8Y A;  3WRZ A;  4HES A;  3BY8 A;  4MMN A;  3MSH A;  1H5X A;  3GSG A;  3FG8 A;  3TRC A;  3HLC A;  4CLC B;  1GA0 A;  2VV7 A;  5CGX A;  4P6Z M;  4WF0 A;  4GLQ A;  3LCE A;  5L10 A;  1EI5 A;  3SS4 A;  3T1X A;  3L9K A;  4GDN A;  4JXS A;  2ZBB A;  3FKV A;  2ZQ7 A;  3F1O A;  3OPL A;  3P09 A;  2D02 A;  4KUK A;  5GHY A;  4XXR A;  1OTA A;  1DRM A;  1ES3 A;  5HL6 A;  1E25 A;  1L2S A;  3BFD A;  3C7U A;  3E4Q A;  5DTK A;  2JC7 A;  5JYO A;  1N9O A;  1DJA A;  1IKG A;  3NOU C;  4S2N C;  2V0W A;  5FI7 A;  1YT4 A;  2Z2M B;  2PAV P;  3W4Q A;  5CGW A;  2ZM0 A;  2QZ6 A;  4B93 A;  4HJ3 A;  2FFF B;  2I9V A;  3QHY A;  1LI0 A;  4M3K A;  3OCN A;  1OJG A;  3HBR A;  1K54 C;  2XRO A;  2K7S A;  3DTK A;  4FH4 A;  1WA9 A;  1NLY A;  3MS6 A;  4Y0T A;  2BTF P;  3G2Z A;  5KSH A;  3ITB A;  4O7D A;  1JWZ A;  1T1C A;  3BRM A;  1F2K A;  3VP0 A;  1LI9 A;  4OQH A;  3MKE A;  4FTX A;  3LIC A;  5E2E A;  3A3I A;  2EXA A;  1DJB A;  4GCZ A;  1Q2Q A;  3IX8 A;  4IJG A;  4ZJ1 A;  1BYW A;  1K25 A;  2XDM A;  4C6Y A;  2EX6 A;  3MZE A;  1PI5 A;  2XF3 A;  1LT0 A;  2P9V B;  5GLC A;  4EQ1 A;  4MNR A;  3BW6 A;  3LEQ A;  4PKY G;  1G6A A;  3G31 A;  1BZA A;  1U60 A;  2O9A A;  4IVI A;  4MLL A;  4BWI A;  5FI6 A;  2INW A;  1G28 A;  2OV5 A;  3CI6 A;  2WAD A;  3S1Y A;  2ZC6 B;  3W4O A;  2PR5 A;  3N8R A;  1L0G A;  5FQ9 A;  3CLO A;  1XGJ A;  5HPF A;  4FH2 A;  4II7 A;  1KVL A;  3OLO A;  5CHJ A;  5HWW A;  3T4T A;  4WZ5 C;  2X71 A;  1SHV A;  3PAE A;  4AFI A;  4G3K A;  2ZQA A;  5HAI A;  1OTB A;  3IBJ A;  1D1J A;  2E8J A;  1TS6 A;  1XKZ A;  4E3M A;  3VOY A;  5CED A;  3BQA A;  1YAX A;  3EGX C;  3UDF A;  4X68 A;  1FIL A;  3U2A A;  3D9Y A;  1I2W A;  2K2N A;  1J9M A;  5J3W A;  4U3T A;  4GW9 A;  1BLH A;  3GVB A;  5A91 A;  5IS1 A;  1N9B A;  5F5Y A;  4FSF A;  3SZT A;  3F1O B;  4M4X A;  2Y59 A;  2R9X A;  1BSG A;  1W8Y A;  2Y2L A;  4OQ0 A;  4H6J B;  3NI9 A;  3ZGA B;  1JTD A;  1OTI A;  3NHQ A;  5HZH A;  4ARZ A;  2EFU A;  3G32 A;  1IYP A;  3UB8 A;  3LFV A;  1K6S A;  4OKP A;  2BAS A;  2JE5 A;  5DFY A;  2Y79 A;  3RJU A;  3ZG8 B;  3IWI A;  3HJI A;  1KGF A;  1RGZ A;  3FV7 A;  2D01 A;  2QJ7 A;  4EU0 A;  4MBK A;  3LR3 A;  3V3R A;  3BJN A;  3NDE A;  3T4K A;  2XLN A;  3DTE A;  5KZH A;  4PKY A;  2X01 A;  3F1N B;  4I39 A;  1KE4 A;  4HH3 A;  3B33 A;  1P0Z A;  4E6X A;  1Z6F A;  5HAQ A;  2WKQ A;  5E2F A;  3ULF A;  3UN7 A;  5IT5 A;  4WMC D;  4X69 A;  5DKL A;  2WKI A;  4S2J A;  4EUZ A;  2ZMA A;  2VJW A;  4WEJ A;  2QYB A;  4RYE A;  2Q9N A;  5CTM A;  4S2O A;  2V1A A;  4PPR A;  3OCL A;  3T4O A;  4CLC E;  4HI4 A;  1H8Y A;  3HRE A;  3KSH A;  4R3B A;  4L0L A;  4CLC C;  3SH9 A;  4DRT A;  4D2O A;  2WZX A;  4ZTK A;  1ESU A;  3Q81 A;  3ZNT A;  4E3I A;  1GSX A;  1VEU B;  2HJ9 C;  3BQ8 A;  5EV0 A;  3Q7Z A;  3T4J A;  1ERQ A;  3B42 A;  4HEF A;  4BJP A;  4BLM A;  4EEP A;  3KSI A;  3VP4 A;  2WAE A;  3CIT A;  1E3U D;  1QME A;  4QJG A;  3SH7 A;  2Y2N A;  3FPV A;  1K55 C;  1EW0 A;  1BUL A;  2UV0 E;  4WL9 A;  1TDL A;  3R7W B;  5AVE A;  3VP1 A;  3ZNY A;  4YIN A;  1I2S A;  2OAQ 1;  2ZOH A;  3H82 B;  4GOG A;  1SKO A;  4DXB A;  1LHY A;  3C30 A;  4I5S A;  5FAO A;  3KYE A;  4OLG A;  5JYP A;  3PBN A;  4WEK A;  3D3O A;  5U47 A;  1W5D A;  5EOE A;  4HJ6 A;  3Q1F A;  2Z6C A;  1PWG A;  1MY8 A;  2HF6 A;  2W3F A;  4CJN A;  3ZHH A;  5KIZ A;  4FOF A;  3ZVT A;  3PR6 A;  3BYD A;  2V1Z A;  3IX4 A;  3MJQ A;  3PBS A;  1BTL A;  3K3D A;  1KE3 A;  3S7N A;  2WK0 A;  2J7V A;  4S2P A;  4WUJ A;  2X02 A;  3MZD A;  5HFO A;  4MN7 A;  4LCL A;  4EXO A;  1YPR A;  4UHU A;  2JN7 A;  3GMW A;  3DWZ A;  1H8M A;  2XR0 A;  2JKT I;  4K91 A;  4EER A;  4OOY A;  3VSL A;  3NOT C;  1NJ4 A;  2OOL A;  1Q2P A;  4NG2 A;  1XP4 A;  4D60 A;  4IVK A;  3N4I A;  1N4O A;  4B4X A;  2HP5 A;  1LL5 A;  2KX6 A;  4ETX A;  4FCF A;  1N9N A;  5J8X A;  2AVX A;  4KQO A;  4LPZ A;  4R3J A;  3NJA A;  3NCK A;  4EES A;  3W4P A;  3LR0 A;  3ICY A;  1LL8 A;  1XJ3 A;  3BEC A;  4ZDX A;  3BFE A;  2XGN A;  3O3V A;  1ZTU A;  3LEZ A;  2MJ6 A;  4BMW A;  4KQQ A;  2P04 A;  2Z6D A;  4RA7 A;  1MWU A;  4OH0 A;  1ALQ A;  3CWF A;  5EOO A;  1L0D A;  1LL9 A;  3F1P A;  2J9O A;  1KOU A;  3U4L P;  4JXG A;  2PDR A;  1HZO A;  4DN0 A;  1YMS A;  1NYM A;  2ZC4 B;  4E3J A;  4UEY A;  1V9Z A;  5GL9 A;  4DE1 A;  1K57 A;  5EVI D;  1VET B;  5FAP A;  3IS2 A;  3HVF A;  2ZL1 B;  4H8R A;  2VGL S;  1GA9 A;  2Y2H A;  2P7J A;  1A0K A;  2Y2P A;  4WZ4 A;  3EQU A;  1CJF A;  4IBR A;  3IBR A;  1DP6 A;  3OPR A;  4JKT A;  5G4Z A;  1P9W A;  4WLA A;  4RX3 A;  4DMZ A;  1P9R A;  1UWP X;  3ZG0 A;  4Q0H A;  4K0W A;  5FEF A;  4Y15 A;  4B4Z A;  3LI9 A;  2OLV A;  2DRW A;  3NDG A;  2A24 B;  1IEM A;  3T4Q A;  5BOH A;  1PNE A;  5TGF A;  1GHP A;  4QU3 A;  3VE3 A;  3MQ0 A;  5CHU A;  4EEU A;  4R4R A;  3LIA A;  3H7W B;  4ZRR A;  4KZ5 A;  3HUO A;  3HL9 A;  3M2K A;  3LY4 A;  4DJ2 A;  4S2M A;  1W63 Q;  3CPT A;  4S2L A;  2J9P A;  2NUP C;  4I38 A;  2ZMF A;  4EBL A;  3WS5 A;  1MKI A;  3L7H A;  2ZM2 A;  1S67 L;  3FWL A;  1Y28 A;  1NLZ A;  1MC0 A;  3IH8 A;  1F5M A;  4I3I A;  4Y3I A;  1BLP A;  4Y2F A;  1K0K A;  3HLB A;  2J3W A;  3UPO A;  2VZW A;  2LB5 A;  2UWX A;  3AGD A;  5J7E A;  1VB6 A;  2Q0O A;  5DF8 A;  5CEB A;  3MF0 A;  4QY5 A;  2L0W A;  3G35 A;  3G4P A;  4QHC A;  4ZJ2 A;  4LFU A;  5EVI B;  5FSR A;  3TW8 A;  4OQI A;  2Y2Q A;  3E2K A;  3LUQ A;  4F94 A;  4DKI A;  2EX2 A;  2PRF A;  1PW1 A;  2QWS A;  4IHQ A;  3ZCZ A;  5GHX A;  1OPX A;  4HP4 A;  3BY9 A;  1VM1 A;  4E04 A;  4P0M A;  2XD1 A;  3HLG A;  1MWT A;  1OT6 A;  4KG5 A;  3GQZ A;  5TR7 A;  2DMW A;  2EA9 A;  1XGI A;  2LB9 A;  3UPN A;  5FAQ A;  4C3Q A;  5D3O A;  4A5R A;  2E8I A;  3N8L A;  2H0T A;  1TS8 A;  4NXE A;  1PWD A;  5J4E A;  4C75 A;  3T1Q B;  4CLC D;  3A0V A;  3PXP A;  1KGE A;  4EQI A;  1IYS A;  1XJ6 A;  4B9O A;  2GDN A;  3AGE A;  2OWH A;  1K56 A;  5KSC A;  3N7W A;  4U0T A;  3MFX A;  2ZQ8 A;  4PMA A;  2WYX A;  4O0P A;  2RCX A;  3UY6 A;  4OON A;  4ZAM A;  3BWL A;  3D4F A;  1PI4 A;  3BLM A;  2O0Y A;  3V3S A;  5E2H A;  2FH5 A;  2ZMV A;  2VX8 A;  5EVE A;  3VOL A;  4YWZ A;  4GHI B;  1JNU A;  1IFQ A;  1RCJ A;  4P85 A;  3HUM A;  4E3O A;  1RP5 A;  1G5U A;  3VSK A;  5GLD A;  3E0Y A;  4K0X A;  2EXB A;  1S4S A;  3F1N A;  4RVA A;  5FQM A;  1K38 A;  3WS1 A;  5CER A;  2V0U A;  4KEN B;  3HUN A; 
#chains in the Genus database with same CATH homology
 1H8Y A;  3HRE A;  3PBO A;  4R3B A;  4KZ3 A;  4FD8 A;  3GTC A;  4L0L A;  3MFD A;  3SH9 A;  4X6T A;  4DRT A;  4D2O A;  2WZX A;  4ZTK A;  1ESU A;  3OC2 A;  3Q81 A;  1XA7 A;  1SKF A;  3BLS A;  4ZJ3 A;  3S22 A;  3V50 A;  3ZNT A;  4E3I A;  1BUE A;  2P74 A;  3NIA A;  4KZ7 A;  3UPP A;  3IQA A;  3Q7Z A;  4OOM A;  3ZVW A;  1ERQ A;  3M6B A;  4HEF A;  1MWR A;  3UO9 A;  5M18 A;  2I72 A;  3IXH A;  4BJP A;  4BLM A;  4U0X A;  3VP4 A;  2WAE A;  3N6I A;  1YM1 A;  1E3U D;  1QME A;  4QJG A;  4IBX A;  1XX2 A;  4GD8 A;  3SH7 A;  2Y2N A;  4X55 A;  5HX9 A;  1K55 C;  3P98 A;  5GHZ A;  1KVM A;  1BUL A;  1CK3 A;  2G2U A;  1SDE A;  3GRJ A;  4UA7 A;  1TDL A;  1K6R A;  3LO7 A;  3IXB A;  4UA9 A;  4XUZ A;  4JF5 A;  3VP1 A;  3ZNY A;  4YIN A;  1I2S A;  1FR1 A;  3OPP A;  2ZQC A;  1S0W A;  2ZLY A;  4LCM A;  4MBH A;  4BEN A;  4GOG A;  4MEZ A;  4DXB A;  4PM5 A;  4KG2 A;  2VGJ A;  1BLC A;  1E3U A;  1LHY A;  3CJM A;  1H8Z A;  5F83 A;  2WAF A;  1ZKJ A;  5GLA A;  5FAO A;  5CEC A;  3M6H A;  4OLG A;  5JYP A;  3PBN A;  1KDW A;  1GHM A;  4WEK A;  1E4D A;  3JYI A;  3A3F A;  3ZG9 B;  3WWX A;  5U47 A;  3C5A A;  4E3K A;  1W5D A;  4WBG A;  5EOE A;  4JBF A;  4E6W A;  4OPZ A;  4EBP A;  1FSW A;  1PZP A;  2OLU A;  2Y2G A;  3Q1F A;  3ITA A;  1PWG A;  5E2G A;  2R9W A;  5A90 A;  3V5M A;  3OZH A;  1MY8 A;  1OME A;  1MPL A;  5KMW A;  1ZG4 A;  1JVJ A;  2ZC7 A;  3QNB A;  4GNU A;  3SH8 A;  1SCW A;  5FA7 A;  3O88 A;  1IYQ A;  4CJN A;  3ZHH A;  1YLY A;  3O86 A;  3ZVT A;  2HP6 A;  3BYD A;  3VFH A;  2V1Z A;  5EE8 A;  1PW8 A;  3ZFZ A;  3SS5 A;  3BEB A;  1XPB A;  5FQK A;  4XUX A;  3SS3 A;  4NK3 A;  5HW3 A;  4WMC A;  2ZC3 B;  5IHV A;  3PBS A;  3WRT A;  1BTL A;  3WS2 A;  4N92 A;  1KE3 A;  2BLS A;  4OPY A;  5DTT A;  1NYY A;  1M6K A;  2WK0 A;  1ONH A;  1NZU A;  2J7V A;  4S2P A;  3VOZ A;  2WKH A;  4LEN A;  4DE2 A;  5FAS A;  4UA6 A;  4YFM A;  4JXW A;  5EVL A;  2G2W A;  3ZDJ A;  4BD1 A;  2DNS A;  2X02 A;  3MZD A;  5HFO A;  4R23 A;  5FQI A;  4QB8 A;  2WGI A;  2IWC A;  2ZC5 B;  1KGG A;  4LCL A;  3OPH A;  5A93 A;  1CI8 A;  5HAP A;  4OP8 A;  3SOI A;  1HD8 A;  1LLB A;  2C5W B;  4UHU A;  1MXO A;  3GMW A;  3DWZ A;  4HBT A;  1ONG A;  2HDU A;  2WGW A;  4OPR A;  2XR0 A;  3CG5 A;  4K91 A;  4WEL A;  1QMF A;  4S2K A;  4OOY A;  3VSL A;  1ZC2 A;  2XH9 A;  1NJ4 A;  4BQM A;  4OVD A;  4Y0U A;  4KQR A;  3HLW A;  4NET A;  1Q2P A;  3MXS A;  3NY4 A;  3PBT A;  2V20 A;  3VMA A;  1KDS A;  4ID4 A;  5G18 A;  1XP4 A;  3IF6 B;  2WGW B;  2XEP A;  4IVK A;  4Y7P A;  3N4I A;  3Q7V A;  4OPQ A;  5A92 A;  1N4O A;  4B4X A;  2HP5 A;  1LL5 A;  2EFX A;  2PU4 A;  1K55 A;  1KE0 A;  3A3D A;  4FCF A;  2H10 A;  1K56 D;  5J8X A;  4R0Q A;  1XA1 A;  1JWP A;  3C7V A;  4KQO A;  2XD5 A;  3MKF A;  3VFF A;  3PTE A;  4GN2 A;  4R3J A;  2EX9 A;  4JF4 A;  3IF6 A;  3G34 A;  3FYZ A;  3NCK A;  4LV1 A;  2HP9 A;  2J8Y A;  3W4P A;  3WRZ A;  4OOL A;  3BFG A;  2A3U A;  4HES A;  3BEC A;  4ZDX A;  3BFE A;  1YLP A;  2XGN A;  4GD6 A;  1H5X A;  3PBR A;  3O3V A;  3GSG A;  2FFY A;  3LEZ A;  2XQZ A;  3DTM A;  3G2Y A;  4KQQ A;  3HLC A;  2IWB A;  1GA0 A;  4RA7 A;  4S2I A;  5M1A A;  1MWU A;  3UNW A;  4Q8I A;  5CGX A;  1IYO A;  5EPH A;  4OH0 A;  3IT9 A;  1ALQ A;  5EOO A;  1L0D A;  1LL9 A;  3LCE A;  5F1G A;  1EI5 A;  4GDB A;  2J9O A;  4LV0 A;  3SS4 A;  3A3J A;  1O07 A;  4JXG A;  2HDR A;  1HZO A;  4GDN A;  4JXS A;  3IHA A;  2Y2M A;  1YMS A;  1NYM A;  2ZC4 B;  3GR2 A;  4E3J A;  4S2N A;  2Y2I A;  3FKV A;  1FOF A;  2B5R A;  5DTS A;  2CC1 A;  1YMX A;  2XFT A;  2ZQ7 A;  3UE3 A;  1MWS A;  3OPL A;  3UE0 A;  3P09 A;  4PM7 A;  5CXW A;  4KZB A;  5GL9 A;  4DE1 A;  1YLW A;  5GHY A;  4LV2 A;  1K57 A;  4XXR A;  5EVI D;  5FAP A;  4H8R A;  3HVF A;  5CRF A;  1W7F A;  4KZA A;  1ES4 A;  1I5Q A;  1ES3 A;  1GA9 A;  1K4E A;  2QPN A;  2Y2H A;  2Y2K A;  3PAG A;  3QNC A;  1E25 A;  1W8Q A;  5I94 A;  2Y2P A;  2WGV A;  1L2S A;  3BFD A;  3C7U A;  3FZC A;  4WZ4 A;  4EBN A;  3EQU A;  5DTK A;  2JC7 A;  4IBR A;  5JYO A;  1JWV A;  4JKT A;  4Y0O A;  3OPR A;  1FSY A;  5CGS A;  3G30 A;  1DJA A;  1IKG A;  1NY0 A;  4RX3 A;  3LY3 A;  3ZG0 A;  4S2N C;  2HPB A;  4K0W A;  2EX8 A;  4X56 A;  3FKW A;  4B4Z A;  2ZQ9 A;  2HDS A;  5FI7 A;  3MBZ A;  1YLT A;  4GB7 A;  1YT4 A;  2OLV A;  2DRW A;  2Z2M B;  3B3X A;  3NDG A;  3W4Q A;  4MBF A;  5CGW A;  1IEM A;  3C4P A;  2ZM0 A;  3DW0 A;  2QZ6 A;  1SDN A;  5BOH A;  3Q07 A;  3HLF A;  1ES2 A;  5DF9 A;  2FFF B;  5TGF A;  1CEG A;  4WZ5 A;  1GHP A;  1PWC A;  4QU3 A;  5F1F A;  1C3B A;  5M19 A;  5CHU A;  3QHY A;  1DY6 A;  4R4R A;  1LI0 A;  3V39 A;  4M3K A;  2PU2 A;  3OCN A;  2QMI A;  3HBR A;  4OLD A;  4HBU A;  1K54 C;  3HLD A;  3HUO A;  4KZ5 A;  3HL9 A;  4JLF A;  5EEC A;  5AQA A;  1K57 C;  2WUQ A;  2Y2O A;  3M2K A;  4FH4 A;  4QD4 A;  5HL1 A;  3LY4 A;  3CZD A;  3C4O A;  3MXR A;  4S2M A;  3UE1 A;  4Y0T A;  4PPR A;  4LV3 A;  4S2L A;  2J9P A;  3G2Z A;  1K4F A;  5KSH A;  3ITB A;  4O7D A;  3OCL A;  1JWZ A;  5DF7 A;  3BRM A;  3A3E A;  1PIO A;  1YLZ A;  2HDQ A;  4EBL A;  2WZZ A;  4PM9 A;  1LI9 A;  3VP0 A;  4OQH A;  3MKE A;  1CEF A;  3WS0 A;  3IXD A;  4Z9Q A;  3O87 A;  3WS5 A;  5E2E A;  1MKI A;  1YLJ A;  3A3I A;  2ZM2 A;  2H0Y A;  2EXA A;  5EVI C;  3FWL A;  2JBF A;  3DWK A;  1DJB A;  5HAR A;  1Q2Q A;  3CMZ A;  4PM8 A;  4BL2 A;  3IH8 A;  1GCE A;  2ZQD A;  4ZJ1 A;  3M2J A;  1DJC A;  1JTG A;  4GKU A;  5L2F A;  1XXM A;  1BLP A;  1HVB A;  1K25 A;  2P9V A;  2XDM A;  3HLB A;  3NC8 A;  4C6Y A;  5CTN A;  2EX6 A;  3UPO A;  3MZE A;  1TEM A;  1PI5 A;  2XF3 A;  2UWX A;  2Y91 A;  3AGD A;  3IF6 C;  4KZ8 A;  5EUA A;  2Y2J A;  2ZM8 A;  5DF8 A;  5CEB A;  4QY5 A;  2P9V B;  4X53 A;  5GLC A;  5TFQ A;  4EV4 A;  3G35 A;  4MNR A;  5DVA A;  3G4P A;  1BLS A;  4KZ9 A;  4E3L A;  4QHC A;  3W8K A;  4ZJ2 A;  1G6A A;  1IKI A;  5EVI B;  3UDI A;  3G31 A;  5FSR A;  2XFS A;  4OP5 A;  1BZA A;  1WE4 A;  1U60 A;  3IXG A;  1IEL A;  1EWZ A;  4OQI A;  2Y2Q A;  3E2K A;  3BFC A;  4IVI A;  4MLL A;  4JXV A;  5FI6 A;  4KZ4 A;  4F94 A;  1ES5 A;  1M40 A;  1PYY A;  4DKI A;  2XK1 A;  3IWQ A;  2DCF A;  2EX2 A;  2Y55 A;  2OV5 A;  1PW1 A;  5EVI A;  2Z2L B;  3TSG A;  1ERM A;  1PZO A;  4R4S A;  4GZB A;  5CHM A;  4RX2 A;  3TOI A;  2WAD A;  3S1Y A;  2ZC6 B;  3W4O A;  3ZCZ A;  3N8R A;  5GHX A;  5E43 A;  3E2L A;  2IWD A;  1L0G A;  5FQ9 A;  1MBL A;  2ZJ9 A;  1XGJ A;  3EQV A;  3IWO A;  1TVF A;  4IED A;  1VM1 A;  1WYC A;  4FH2 A;  3RXW A;  3RXX A;  4P0M A;  1KVL A;  2XD1 A;  3HLG A;  5CHJ A;  1Y54 A;  5F82 A;  4B88 A;  3TG9 A;  1AXB A;  1ERO A;  1NZO A;  1MWT A;  4WZ5 C;  2X71 A;  1SHV A;  4KG5 A;  3ZG5 A;  3GQZ A;  3PAE A;  1FCO A;  2ZQA A;  1L0F A;  5FQQ A;  5TR7 A;  1XGI A;  3UPN A;  5HAI A;  5FAQ A;  4C3Q A;  4DE0 A;  1FR6 A;  2C6W B;  5AQB A;  2Y4A A;  2Q9M A;  1XKZ A;  4E3M A;  1VQQ A;  2H5S A;  4WM9 A;  3VOY A;  5CED A;  4DE3 A;  5D3O A;  3UDF A;  4A5R A;  4KZ6 A;  3IF5 A;  4X68 A;  2E8I A;  3N8L A;  4N1X A;  2H0T A;  1K54 A;  2RL3 A;  4DDS A;  1PWD A;  1I2W A;  3S4X A;  4C75 A;  4CPK A;  1J9M A;  4DDY A;  4U3T A;  3ZG7 B;  1NRF A;  1BLH A;  3GVB A;  4OQG A;  2VGK A;  1O7E A;  5A91 A;  4EWF A;  1N9B A;  1KGE A;  3WS4 A;  4EQI A;  1G68 A;  1IYS A;  2JCH A;  4FSF A;  5AQ9 A;  2Y59 A;  1TDG A;  3BM6 A;  2GDN A;  2R9X A;  1BSG A;  1W8Y A;  2Y2L A;  1K56 A;  3AGE A;  3N8S A;  2WKE A;  4OQ0 A;  5KSC A;  5FDH A;  3N7W A;  3NI9 A;  3ZGA B;  4U0T A;  3UDX A;  1JTD A;  3VP3 A;  2PBY A;  1FCM A;  2ZQ8 A;  2EFU A;  3G32 A;  1BT5 A;  1IYP A;  3Q7V B;  4R1G A;  4PMA A;  1K6S A;  4OKP A;  3PBQ A;  2JE5 A;  4JPM A;  1S6R A;  2WYX A;  2V2F F;  3RJU A;  3ZG8 B;  4E3N A;  3IWI A;  1YQS A;  2RCX A;  3I7J A;  4OON A;  3UY6 A;  2BG1 A;  3Q82 A;  4P87 A;  4ZAM A;  1KGF A;  1RGZ A;  4BL3 A;  4PM6 A;  3D4F A;  1PI4 A;  3FV7 A;  3BLM A;  1RGY A;  1ZG6 A;  3ISG A;  2OSU A;  4MBK A;  1FCN A;  1L0E A;  5E2H A;  3V3S A;  4DXC A;  4P6B A;  5FI2 A;  3VP2 A;  4UAA A;  3V3R A;  4QY6 A;  3IHB A;  3NDE A;  3GV9 A;  2XLN A;  3MZF A;  4JF6 A;  5KZH A;  5AQ7 A;  4N9L A;  2X01 A;  2ZD8 A;  3BFF A;  4N9K A;  1KE4 A;  1RCJ A;  2A49 A;  4P85 A;  4E6X A;  3AGF A;  1Z6F A;  1HTZ A;  5HAQ A;  3HUM A;  5E2F A;  3UN7 A;  1NXY A;  4BD0 A;  4E3O A;  1RP5 A;  3VSK A;  3IH9 A;  4WMC D;  4X69 A;  3HLE A;  5FQJ A;  4KG6 A;  2WKI A;  5GLD A;  1CI9 A;  4K0X A;  4S2J A;  1ESI A;  4WYY A;  2EXB A;  2ZMA A;  4EUZ A;  1GHI A;  4WEJ A;  5FAT A;  1W79 A;  4RVA A;  2Q9N A;  4RYE A;  1K38 A;  5CTM A;  5FQM A;  1FQG A;  5GLB A;  3WS1 A;  4DF6 A;  4S2O A;  5CER A;  3NBL A;  4N1H A;  1WYB A;  4KEN B;  3HUN A;  4ZBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...