4WYYA

Crystal structure of p. aeruginosa ampc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
360
structure length
360
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title 4,5-Disubstituted 6-Aryloxy-1,3-dihydrobenzo[c][1,2]oxaboroles Are Broad-Spectrum Serine beta-Lactamase Inhibitors.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Hydrolase/hydrolase inhibitor
total genus 122
structure length 360
sequence length 360
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4wyyA00
3WS4A 4BENA 4U3TA 3PBOA 1PZPA 4P85A 2P9VB 1N4OA 1Y54A 4N9KA 1DJAA 4RYEA 3ZNYA 5A91A 5CGXA 1CEGA 2ZQ8A 3A3DA 3OPLA 4N1XA 5HW3A 2XFSA 1L0DA 2J7VA 3DWKA 3IXBA 4X53A 2ZQDA 5TFQA 3IF6C 5TGFA 3SS4A 1ONHA 1IELA 3ZG8B 5CEDA 1YLJA 5KSHA 3G2ZA 3LO7A 1I5QA 3JYIA 1XA1A 4ID4A 3UE0A 4M3KA 3MZDA 3OCNA 5E2GA 2R9XA 3VP4A 4R1GA 4GKUA 4KQRA 4OPRA 5FAOA 5EUAA 1MWTA 1JTGA 1FCOA 3HUMA 4GD6A 1PI4A 3IHBA 3BLMA 2X71A 5HFOA 3SH8A 5JYPA 4OVDA 5DF8A 1XXMA 3A3EA 5DTSA 5CTNA 1ZKJA 1LI0A 2X01A 4PPRA 1K55A 2H10A 2WKEA 4QD4A 4WMCA 1H8ZA 4YFMA 1SHVA 2BLSA 5HAPA 4BL3A 4MBHA 1MPLA 3BECA 3BFFA 1XGIA 3IF5A 3IT9A 4RVAA 5FQKA 4DKIA 1K4EA 1NXYA 4S2OA 4WEJA 3ZHHA 2VGJA 2G2WA 3VFHA 1YLPA 4R3JA 5GLCA 1CI9A 4GZBA 1SKFA 3G32A 3AGFA 4UA6A 1YMXA 3BEBA 3VP0A 5J8XA 3IF6A 1K6SA 1GHIA 2V20A 2HDUA 4R4SA 4OH0A 4JXVA 2Y2JA 1RCJA 5FI2A 3ZDJA 2QZ6A 1AXBA 3BFDA 3CJMA 1BLSA 1BZAA 4OKPA 3NDGA 3LEZA 3GVBA 3VOYA 1ERQA 3W4QA 1PWCA 1IEMA 2DNSA 4IVIA 3N8SA 4CJNA 5KZHA 1IYQA 1ES5A 3BM6A 2Y2LA 4ZJ3A 4XUZA 3Q7VB 3EQUA 5A92A 2WAEA 2Y2MA 2ZM8A 5EVIA 4BLMA 4DRTA 2HDQA 4PM7A 4B88A 3SH9A 3O3VA 4QHCA 5FATA 3N4IA 4ZBEA 1IKGA 2H0TA 4HBTA 1NZUA 5CECA 4RX2A 3S22A 3N8RA 3HVFA 4S2JA 3O86A 1PW1A 1K38A 1NYMA 4DF6A 1MWUA 4S2MA 3NBLA 1OMEA 3GV9A 3UN7A 4OOMA 1MWSA 5HAIA 1XKZA 3MKEA 1RP5A 3HLDA 4OQHA 4NK3A 4QY6A 1YT4A 1KVLA 4R0QA 1IYPA 3OZHA 4WMCD 3WRZA 2FFYA 4RX3A 1ZC2A 2HP5A 3M6BA 4JBFA 4OLGA 2Q9MA 1FOFA 1BLCA 3ITBA 1BT5A 2ZC5B 3FZCA 4YINA 4EWFA 3HLFA 3P98A 1C3BA 1GHMA 2ZMAA 5HARA 4JKTA 3MZFA 1GA9A 4X6TA 1YM1A 2DCFA 2ZQ9A 1HZOA 5FQQA 2P74A 4F94A 1LHYA 2IWDA 4P6BA 3BRMA 1IKIA 2WKHA 3A3FA 4IVKA 3TSGA 4A5RA 4B4ZA 4JPMA 2Z2LB 2Y2HA 4OP5A 2RL3A 5E43A 4KG2A 2ZC7A 3ZNTA 1LL9A 1ESIA 2C5WB 4IBRA 5M1AA 1TDGA 4MLLA 4WELA 2HDRA 1VM1A 3C7VA 3G34A 4RA7A 1BSGA 2EX8A 5FA7A 5FQIA 1K55C 4KENB 3ZG0A 4DE1A 4Y7PA 2IWBA 4EQIA 4DE0A 4E3MA 4E6XA 1DY6A 1I2WA 5CEBA 1MKIA 2ZD8A 4S2KA 5CHMA 3V5MA 1KE3A 3CMZA 1DJCA 1K56A 5AQAA 5HX9A 1WE4A 3WS0A 4JF4A 2EXAA 3ITAA 3MFDA 4KZ5A 4P87A 2XD5A 1W8QA 2OLUA 4PMAA 3HLCA 1EROA 3PBQA 1W79A 1K4FA 4JXSA 4BQMA 2H5SA 1K6RA 2OLVA 3LY3A 4KQOA 4N1HA 3OPPA 1KGFA 5HAQA 1LI9A 4S2PA 4JF5A 4WZ5A 4GOGA 5F82A 3EQVA 2J9OA 1O7EA 4GDBA 2HDSA 2XGNA 4WBGA 5FASA 3G2YA 3IWQA 3PAEA 3G35A 3IXHA 5FQ9A 3V3RA 5CRFA 1Z6FA 4S2IA 5EPHA 1K54A 1YMSA 2J8YA 2ZC6B 3PAGA 1IYSA 5EVIC 4EBPA 1MBLA 1FR6A 1LL5A 2A49A 4LV1A 2XDMA 1XPBA 4KG6A 4XXRA 3W8KA 2WGIA 3IH9A 4GB7A 1YQSA 2XF3A 3BFGA 2ZJ9A 2EX6A 2WZZA 1JVJA 3FV7A 3RXXA 3IWIA 1RGYA 4MEZA 4DDSA 2HP6A 3B3XA 1ESUA 3FWLA 3UPOA 1K57A 5BOHA 2XLNA 1L2SA 2QMIA 4GN2A 1JWVA 4H8RA 4PM8A 3SH7A 4OPYA 4O7DA 3C4PA 3IHAA 1CK3A 1LLBA 4E3OA 2C6WB 4N9LA 2XR0A 3GRJA 4JF6A 3OPHA 1ES2A 5F1GA 3ZVWA 1KVMA 5GHYA 4UAAA 1K25A 4CPKA 5DF9A 3QHYA 4FCFA 3UY6A 4EBNA 2XD1A 2H0YA 2Z2MB 2ZM0A 3A3JA 4MBKA 5E2HA 5G18A 4QJGA 1E3UA 3HLBA 3AGDA 5A90A 2ZQ7A 4WEKA 4LCMA 4WZ4A 2QPNA 2HP9A 1HVBA 3V39A 3N6IA 4GNUA 2RCXA 3OC2A 1ES3A 4BD1A 4JXGA 3VMAA 5GL9A 4GDNA 5GLBA 1FSYA 3IWOA 3QNCA 5CTMA 1CI8A 2WGWA 4LV2A 2WZXA 3HLWA 1NRFA 3V50A 3O87A 1VQQA 3MBZA 3VSKA 2Y2OA 3IF6B 2V1ZA 4X68A 1XP4A 3ZGAB 3HLGA 1GA0A 4KZ3A 4FH4A 3VOZA 3A3IA 4LCLA 3G31A 1L0GA 1YLWA 1S6RA 5CHJA 3M2JA 3N7WA 4X69A 4OOLA 1J9MA 1QMFA 5L2FA 1FCMA 1W7FA 3GMWA 4OQIA 4C75A 3O88A 5DF7A 4DDYA 1IYOA 2Y2QA 1L0FA 1DJBA 4KQQA 3Q7ZA 1EI5A 1EWZA 2WKIA 1JTDA 1SDEA 3HL9A 5EE8A 5EVIB 4E3KA 1BTLA 2ZC4B 3IXDA 4WYYA 2XQZA 5GLDA 5FSRA 4R3BA 4D2OA 4Y0TA 3IXGA 4WZ5C 4DE2A 5D3OA 3VP1A 1PWGA 3PBRA 1KDSA 1G68A 2I72A 2P9VA 3C5AA 3IH8A 3IQAA 3OCLA 4S2LA 3UE3A 1GCEA 4R4RA 3OPRA 3D4FA 4IBXA 5DTKA 1K54C 4HEFA 5GHZA 3NCKA 4OOYA 2OV5A 2Y2PA 4MNRA 3DTMA 4KZBA 3UDFA 4E3JA 2PBYA 3GTCA 4WM9A 4ZTKA 4OLDA 3MXSA 5EVID 2ZQAA 1PZOA 3PBNA 1JWPA 5FDHA 1RGZA 4EBLA 2Y2NA 1NZOA 3BYDA 2XH9A 1MWRA 3ISGA 1XGJA 4FH2A 2UWXA 5FAPA 5HL1A 2WADA 3E2KA 4IEDA 4ZJ1A 1K57C 1YLZA 4S2NA 4BJPA 1BLHA 5FI6A 4DXBA 1FCNA 1MY8A 3P09A 4K0XA 3VP3A 3UPPA 5JYOA 2WGVA 2JCHA 2XEPA 1NY0A 2FFFB 3PBTA 5FQMA 2J9PA 3FKWA 3M2KA 3V3SA 3WS2A 3ZFZA 4Q8IA 4OONA 1WYBA 2V2FF 4Y0OA 2PU4A 3SOIA 1PI5A 3G30A 1N9BA 2ZQCA 3CG5A 4K91A 2ZM2A 3UDIA 2VGKA 3UNWA 3ZG7B 5AQ9A 2WUQA 4KZ4A 4OQ0A 5KSCA 2EFXA 3DWZA 3GQZA 4KG5A 4KZ8A 1M40A 1L0EA 1G6AA 3ZG5A 3FYZA 4R23A 2B5RA 2Q9NA 5F83A 4OQGA 4E6WA 5F1FA 5CGWA 3PBSA 3TG9A 4XUXA 1ZG6A 4B4XA 3HUNA 5CXWA 3C4OA 4QY5A 3Q82A 4FSFA 1KE4A 1FSWA 2EX2A 1YLTA 2HPBA 5E2FA 1PWDA 2R9WA 3Q7VA 1YLYA 2XFTA 4LENA 3BLSA 3FKVA 5U47A 3ZG9B 5EECA 3BFCA 5TR7A 2JBFA 3WRTA 4C3QA 1PW8A 3TOIA 4E3LA 1NJ4A 1K56D 3HREA 5EOOA 1ES4A 3MXRA 5FI7A 1QMEA 1BUEA 4Z9QA 3MKFA 1JWZA 1E25A 1BLPA 1TEMA 1KGGA 5GLAA 2JC7A 4JXWA 4K0WA 5A93A 1MXOA 2XK1A 1W8YA 5EVLA 4FD8A 4MBFA 4UA9A 3RJUA 3WS5A 2EX9A 2EXBA 4ZJ2A 4GD8A 1O07A 4OP8A 2CC1A 5CERA 2GDNA 3DW0A 2ZC3B 3VSLA 5EOEA 5CGSA 1E4DA 3NIAA 1TVFA 2Y2IA 2Y91A 3HLEA 4UHUA 2IWCA 3VP2A 3RXWA 2Y4AA 2WYXA 2E8IA 4NETA 1NYYA 3NDEA 1U60A 3Q07A 4U0TA 4BD0A 1BULA 3W4OA 5E2EA 4C6YA 4ZAMA 2BG1A 1ERMA 3BFEA 3GR2A 3MZEA 3CZDA 2Y59A 3M6HA 3NC8A 4S2NC 4E3NA 4EUZA 1PIOA 3HBRA 3PTEA 5M19A 3QNBA 2ZLYA 1GHPA 4Y0UA 4KZ9A 3UE1A 5FAQA 1HD8A 4N92A 4PM9A 1SDNA 1ALQA 1SCWA 2X02A 2Y2KA 3GSGA 4QB8A 4X55A 2A3UA 1Q2QA 2Y2GA 2DRWA 3HUOA 4HBUA 2PU2A 3E2LA 3SS5A 4DXCA 5CHUA 2Y55A 1S0WA 3Q81A 3LY4A 2G2UA 1KGEA 1W5DA 2WGWB 1TDLA 4BL2A 3ZCZA 4L0LA 1FR1A 3VFFA 3W4PA 4E3IA 5KMWA 4UA7A 4EV4A 3G4PA 4OPQA 3NY4A 2WAFA 3UPNA 1KDWA 2JE5A 3LCEA 5DVAA 5FQJA 2EFUA 1E3UD 1M6KA 1FQGA 1XA7A 3NI9A 5DTTA 3C7UA 3SS3A 4KZ7A 4PM5A 3S1YA 4ZDXA 1H5XA 4QU3A 3Q1FA 3N8LA 5AQ7A 3UDXA 1I2SA 3WS1A 3ZVTA 4DE3A 1CEFA 4JLFA 2WK0A 1ZG4A 3AGEA 1PYYA 5IHVA 3S4XA 5M18A 1KE0A 1H8YA 1WYCA 4KZAA 4OPZA 5I94A 1XX2A 4PM6A 3WWXA 4P0MA 4U0XA 3I7JA 1HTZA 3UO9A 2OSUA 1ONGA 4HESA 4LV3A 5GHXA 4LV0A 5AQBA 1Q2PA 4KZ6A 4X56A
chains in the Genus database with same CATH superfamily
4U3TA 1PZPA 2P9VB 3GECA 1N4OA 3H9WA 2G7UA 5A91A 3K3DA 5CGXA 3A3DA 3LR3A 1L0DA 3IXBA 5TFQA 1ONHA 5KSHA 1I5QA 1XA1A 1PRQA 1CF0A 3OCNA 4DJ2A 4GKUA 3FPVA 1MWTA 4HP4A 1FCOA 3HUMA 3T4JA 4OVDA 1LI0A 1OTAA 2VJWA 3O5YA 4QD4A 4WMCA 1SHVA 2BLSA 4ETXA 5HAPA 3NECA 4BL3A 4MBHA 1MPLA 3VFHA 4UA6A 3AGFA 2XA7M 3BEBA 3QP1A 3VP0A 2HJEA 5J8XA 3IF6A 1LL8A 1HLUP 2V20A 5FI2A 2Y2JA 2VEAA 3CJMA 1N9NA 4IVIA 3N8SA 5KZHA 5A92A 5HD5A 1YAXA 3UMDA 3MF0A 1LSXA 4B88A 3O3VA 1G6OA 3N4IA 2H0TA 3F1OA 5J3WA 3N8RA 2UV0E 1MWUA 2PYRA 2ZL1A 4MDZA 2V1BA 4CLCA 2XRNA 2HV1A 3HLDA 2YKFA 1IYPA 2Y79A 3KSGA 3LIBA 3ITBA 4GHIA 3P98A 2ZMAA 4QPRA 5HARA 2OWJA 1F98A 1YM1A 2DCFA 2ZQ9A 2XA7S 2P74A 3A3FA 4JPMA 2Z2LB 1MZUA 2M7VA 3S7PA 2ZBBA 2CMNA 2LB5A 2ZC7A 4I3AA 1VM1A 4RA7A 4DE1A 4Y7PA 4ARZB 1UGUA 1YSQA 3CWFA 2A24B 2GZAA 3V5MA 1DJCA 3LR5A 4YOFA 4Q0JA 3VV4A 4GLQA 4PMAA 4BQMA 2M1CA 2OLVA 4LRZE 4N1HA 4I39A 4WZ5A 4GOGA 2AVXA 3IBRA 2XGNA 4BBVA 5FASA 3G2YA 3IWQA 5IU1A 5CRFA 1LSWA 4S2IA 1K54A 3PAGA 1MBLA 2A49A 1LL5A 3BWLA 1XPBA 2B18A 3B47A 4GB7A 1YQSA 1JVJA 3C8CA 3FV7A 1SKOA 4MEZA 4DDSA 3B3XA 3UPOA 4CLCC 5HZHA 1L2SA 3SH7A 2V9AA 3GRJA 3R4KA 3OPHA 4JF6A 2KOIA 4HJ4A 3H82A 4UAAA 1K25A 5LBRA 4CPKA 2M7UA 4MBKA 2ZM0A 5A90A 2ZQ7A 4LCMA 2HP9A 4EUVA 3V39A 4I5SA 3UMEA 3OC2A 1ES3A 3L9KA 5CTMA 1DRMA 3VSKA 4LRYC 1G5UA 2NUTC 2Z6DA 3IF6B 3IX4A 3HLGA 4FH4A 3VOZA 2VZWA 3BJNA 3IX3A 1S6RA 3M2JA 5DFXA 4OOLA 1QMFA 1FCMA 3GMWA 3SW1A 4KUOA 4DDYA 2LB9A 2Y2QA 1DJBA 1EI5A 1S66L 1SDEA 3HL9A 1PNEA 5FSRA 1FILA 3IXGA 4WZ5C 4DE2A 3F1OB 1VB6A 1DP8A 3OPRA 5DTKA 1K54C 4HEFA 2ZL1B 2Y2PA 4Y15A 4CLCB 3GTCA 2P7JA 4OLDA 3MXSA 2JKGA 3PBNA 5FDHA 1JWPA 4QWOA 2I9VA 3S7QA 3BYDA 1XGJA 5FAPA 2UWXA 4GHIB 5HL1A 5TBMA 4ZJ1A 2PD8A 5FI6A 4DXBA 4O8GA 3P09A 4DJ3A 2MJ6A 2K7SA 2FFFB 3V3SA 3ZFZA 3VE4A 3A0VA 4Y0OA 5AVEA 3SOIA 4NKPA 3CG5A 3UDIA 2VGKA 3F1NA 4EERA 5AQ9A 2WUQA 4KG5A 4ETZA 4R23A 5CGWA 3PBSA 3PYPA 5IS1A 3HUNA 1LSVA 3C4OA 3ULFA 1KE4A 1Y4OA 2EX2A 2R9WA 4HH3A 4LENA 3FKVA 3ZG9B 5TR7A 2JBFA 2QWSA 4C3QA 5HDCA 4E3LA 1TS6A 1ES4A 1XJ3A 2JKRM 1QMEA 1BUEA 1GSWA 1KGGA 2INWA 3MQOA 2HZ5A 2K31A 1MXOA 5EVLA 2QKPA 1J3WA 3RJUA 4UA9A 1X0OA 1SKOB 3WS5A 2CC1A 2PHYA 3NIAA 3IS2A 2IWCA 3RXWA 4NETA 1U60A 4KQDA 4M4XA 5E2EA 3H82B 3NC8A 3H7WA 5HL6A 4E3NA 5K5BA 3PTEA 5M19A 1UWPX 3QNBA 4BMWA 4KZ9A 5FAQA 1HD8A 1D7EA 5HD3A 5J7EA 2X02A 2Y2GA 1S0WA 2A2LA 3C2WA 3W4PA 5KMWA 1T1CA 3UPNA 4LFUA 3NI9A 1H5XA 2J80A 4QU3A 3T4QA 3N8LA 1S4RA 1OTDA 4X25A 4IHQA 4DE3A 4JLFA 2WK0A 1ZG4A 3AGEA 5DJUA 5M18A 3S4XA 1WYCA 5I94A 1V9YA 4PM6A 4IUHA 4P0MA 4U0XA 3GDIA 2GX5A 4HESA 4Y13A 5GHXA 4LV0A 4X1MA 2R78A 4BBUA 5AQBA 4II7A 4YWZA 4P85A 3B42A 4N9KA 1DJAA 4RYEA 1W63M 2XFSA 3DWKA 2J7VA 3SS4A 2O99A 3ZG8B 1YLJA 5F68A 5TBMB 3TJZC 5E2GA 1BYWA 4R1GA 5FAOA 5EUAA 2HF6A 5KIZA 4HJ3A 5J4EA 3A0RA 3A3EA 5DTSA 5CTNA 2X01A 4ZRRA 4PPRA 2O0YA 2H10A 4EEPA 4RVAA 1K4EA 3F1NB 3T4OA 3ZHHA 2G2WA 4R3JA 5GLCA 1CI9A 2D01A 3MFXA 4HP9A 3OBFA 3LYXA 3JPUA 4JXVA 1RCJA 3ZDJA 1BLSA 4OKPA 3W4QA 3FG8A 1IEMA 1T1AA 1ES5A 1XFQA 2Y2MA 5EVIA 2HDQA 4QHCA 3KYZA 5FATA 4ZBEA 2QYBA 4RX2A 3S22A 4S2JA 1Z09A 3O86A 3D72A 1PW1A 3RFBA 1NYMA 4DF6A 4S2MA 4I3JA 1OMEA 4OOMA 5HWWA 1MWSA 3T4SA 5HAIA 2KLIA 4OQHA 4NK3A 4QY6A 1YT4A 4R0QA 4WMCD 3M6BA 4OLGA 2ZC5B 1C3BA 1GHMA 3IS2B 4MCWA 2OAP1 5F5YA 2IWDA 4P6BA 2WKHA 4IVKA 4R38A 4B4ZA 3E0YA 2Y2HA 5E43A 3ZNTA 1ESIA 5MC7A 4MLLA 2HDRA 2EX8A 3ZG0A 4LPZA 1GSXA 4HQAA 4E3MA 4E6XA 3QP6A 5CEBA 4S2KA 5CHMA 3CMZA 5HX9A 1K56A 3HJIA 4JF4A 2EXAA 2H28A 4KZ5A 3NOTC 3PBQA 3UB5P 1W79A 3ICYA 2H5SA 1KOUA 4KQOA 5HAQA 4S2PA 3OOVA 4WBGA 3PAEA 3IXHA 5FQ9A 5GLBA 5EVIC 2J8YA 3LR4A 4EBPA 5HPIA 2XDMA 3TW8A 3HCYA 2ZOIA 2ZJ9A 2EX6A 3IWIA 5IT5A 1RGYA 3DAVA 3T4KA 3LGOA 3LUQA 4PM8A 3T4LA 3DTEA 3IHAA 2C6WB 4N9LA 1ES2A 1P9RA 5F1GA 2HJ9C 3UB8A 4JGPA 2H0YA 4QJGA 1E3UA 3AGDA 5EM1A 2QPNA 1HVBA 3N6IA 1UWNX 2EWVA 3LICA 4JXGA 5GL9A 3HJKA 1DP6A 2ZMVA 3UE6A 3CITA 2WZXA 3LI9A 3MBZA 3KYEA 3P7NA 4NXEA 4O01A 4KZ3A 2XROA 3A3IA 2DMWA 3NOUC 4YNRA 2W27A 1L0GA 4BWIA 1J9MA 5L10A 3JVUA 4C75A 1L0FA 4L9GA 3Q7ZA 3MR0A 5EVIB 4E3KA 1BTLA 2ZC4B 5D3OA 3PBRA 3F1PA 1YKDA 1GCEA 5GHZA 3D4FA 4OOYA 2OV5A 4MNRA 3DTMA 3UDFA 4E3JA 3RH8B 1N9OA 3EEAA 1RGZA 4EBLA 1MWRA 2XH9A 1H3QA 2WADA 1YLZA 4BJPA 5HWTA 3IBJA 3G6OA 2O9CA 3UPPA 5JYOA 2FH5A 2WGVA 1NY0A 3PBTA 5FQMA 3FKWA 5L07A 4OONA 1WYBA 4Z1WA 1PI5A 5G4ZA 4O0PA 2ZQCA 4K91A 3ZG7B 2EFXA 4KZ8A 1M40A 1L0EA 2B5RA 2Q9NA 5F83A 4OQGA 3BW6A 3TG9A 1JNUA 4CQHA 1ZG6A 4B4XA 3LR0A 4QY5A 4AFIA 2PYPA 2HPBA 3LIAA 5G4YA 2JHEA 5U47A 1ACFA 3BFCA 5HSQA 3HREA 5EOOA 3MXRA 3VOLA 3C38A 4Z9QA 1E25A 4Q0IA 3KYQA 4I3IA 5GLAA 2JC7A 4JXWA 1IOUA 1P9WA 2XK1A 2J3TD 4ZJ2A 4OP8A 5FDSA 2GDNA 5TJJA 2W1RA 2ZC3B 3VSLA 5FL3A 4R6LA 3MQ0A 1E4DA 1XFNA 4HHDA 4UHUA 3VP2A 2PT7A 2E8IA 1NYYA 4L9EA 4Y2FA 2BG1A 3BFEA 3GR2A 4LRXC 4EUZA 3JVVA 2ZLYA 4IUKA 1A0KA 3UE1A 4B93A 1NLZA 4EXOA 4PM9A 2J3WA 4X55A 2Y2KA 3QP8A 5AJGA 2DRWA 3HUOA 3IX8A 5CHUA 2Y55A 2NUPC 3LY4A 2G2UA 1TDLA 5DKLA 2EA9A 4L0LA 1VHMA 3VFFA 4UA7A 4EV4A 1KDWA 5FQJA 1M6KA 4PM5A 3BQAA 3C7UA 3SS3A 4KZ7A 3Q1FA 3WS1A 1T18A 1CEFA 3LIEA 3MQQA 5IHVA 1KE0A 3T1QB 4OPZA 1HTZA 2OSUA 3DBAA 4Y5FA 4HNBA 4X56A 3WS4A 4BENA 3K2NA 3PBOA 3CUEA 4WUJA 1Y54A 1CJFA 3E4PA 3ZNYA 1H0MA 5TGFA 1V9ZA 1IELA 4F3LA 3G2ZA 3UE0A 4M3KA 1TS8A 2R9XA 3VP4A 3KO6A 1JTGA 2JKTM 1PI4A 5JYPA 3BLMA 1XXMA 2WKEA 1H8ZA 3LFVA 5F69A 3BECA 3BFFA 1XGIA 3IF5A 4HH2A 4WEJA 2VGJA 1YLPA 2BTFP 4GZBA 4HI4A 1SKFA 1S67L 4JGOA 3EOIA 2Z6CA 2KDKA 1GHIA 4CLCE 4R4SA 3BFDA 5HDDA 3VOYA 1ERQA 1PWCA 2DNSA 4FUWA 1IYQA 4ZJ3A 2WAEA 3P01A 2ZM8A 4PM7A 4R70A 3QP4A 1IKGA 4Y17A 3HVFA 4I38A 1K38A 4MN7A 3NBLA 3UN7A 3MKEA 3QP5A 1RP5A 3CUEC 2FFYA 4RX3A 1ZC2A 2HP5A 1VEUA 2L1MA 1FOFA 1BLCA 2ZOHA 1BT5A 4YINA 4EWFA 3HLFA 2V8FA 3MZFA 4X6TA 2GNXA 1PFLA 1IKIA 4EQ1A 2WKPA 1NLYA 4K08A 1XJ6A 5EV0A 4OP5A 2RL3A 4KG2A 4JGRA 3T1RA 1LL9A 2C5WB 2BASA 1TDGA 2PBDP 4WELA 3S7NA 5AVFA 3C7VA 3G34A 5HDSA 2EWWA 4EQIA 4DE0A 1DY6A 4GS9A 1MKIA 5AQAA 1WE4A 3ITAA 4P87A 4DMZA 1W8QA 3HLCA 1EROA 4JXSA 4KUKA 3LY3A 1ZHHB 1KGFA 5F82A 1O7EA 3G35A 3V3RA 1YMSA 2VX8A 1FR6A 4LV1A 4KG6A 4XXRA 3W8KA 3IH9A 2XF3A 3BFGA 5I5LA 2WZZA 5FEFA 3RXXA 3LIFA 2HP6A 2FZ0A 3FWLA 1K57A 2K2NA 3K3CA 5BOHA 2XLNA 2QMIA 4H8RA 1JWVA 4O7DA 3C4PA 4F3LB 1LLBA 1KVMA 1MC0A 4GJ4A 4UEYA 3QHYA 4FCFA 1F9IA 4EBNA 4LGWA 5E2HA 5G18A 4WEKA 4WZ4A 5HWVA 2RCXA 4BD1A 3T1SA 4GDNA 1FSYA 1G28A 3IWOA 3EWKA 3MSHA 1NRFA 1STZA 1VQQA 4PAUA 4E04A 2V1ZA 4LCLA 3G31A 5CHJA 4UQIM 4X69A 4ESPA 3CPTA 5L2FA 1W7FA 4OQIA 3OLOA 5DF7A 1IYOA 1SZVA 2JKTI 2VKSA 4L9FA 1EWZA 2WKIA 1JTDA 2W3DA 3IXDA 5GLDA 3PR6A 4R3BA 3H7WB 1TF1A 3BY9A 2PD7A 1KDSA 2I72A 3C5AA 3IQAA 3OCLA 4S2LA 4IBXA 3NCKA 1OT9A 4EETB 2W3FA 4KZBA 1NRJA 3TRCA 1VEUB 1NZOA 5C5KA 3ISGA 4IEDA 3PXPA 1K57C 1OJ5A 1MY8A 2PDRA 3VP3A 4WN5A 2JCHA 2P04A 4CLCD 4R3AA 4LLOB 3WS2A 4Q8IA 3NHQA 2V0WA 2V2FF 4UQIS 1N9BA 3T4TA 1YSPA 2ZM2A 4KZ4A 3C30A 3GQZA 3DWZA 1P0ZA 3LIDA 3R7WA 3T12B 4GS9B 4E6WA 5F1FA 2QJ7A 3E4QA 3BQ8A 5CXWA 3Q82A 4FSFA 2VV6A 3Q7VA 2Y8HA 3BLSA 3WRTA 1PW8A 4NXBA 3V67A 2PAVP 5FI7A 4EU0A 1OTIA 3MKFA 1JWZA 1OTEA 1TEMA 2W3GA 5A93A 1W8YA 3LEQA 4MN6A 2EX9A 2EXBA 4GD8A 1O07A 5CERA 1ZTUA 3DW0A 5EOEA 1OPXA 3HLEA 1N9LA 2WYXA 3Q07A 4U0TA 4ME4A 1BULA 4C6YA 3FC7A 3MZEA 2Y59A 3M6HA 3DTKA 1PIOA 2V1AA 1OT6A 4PKYA 3U2AA 1H8MA 3D3OA 3T50A 2QJ5A 1XJ2A 4N92A 3MJQA 4XT2A 4QB8A 4BBTA 1Q2QA 1NWZA 3CAXA 2PU2A 3E2LA 4HBUA 4DXCA 3Q81A 2VV7A 4BL2A 3ZCZA 4EW7A 1S1YA 1FR1A 3G4PA 4OPQA 3NY4A 2WAFA 2JE5A 2PRFA 3UB7A 1XA7A 4ZDXA 3KX0X 1IFQA 4EEUA 1OJGA 3S1YA 2P08A 1GSVA 4FOFA 5AQ7A 3ZVTA 3PHYA 1D06A 3CPTB 4HY8A 4NEED 2ACGA 4KZAA 4NG2A 3WWXA 4GCZA 4DN0A 2QHKA 5F6AA 1CEGA 2ZQ8A 2WKQA 3OPLA 4N1XA 5HW3A 4X53A 2ZQDA 3IF6C 1D1JA 5CEDA 3LO7A 3JYIA 4ID4A 3LI8A 3MZDA 1TS0A 1F2KA 2VV8A 2OWHA 4KQRA 4OPRA 4H6JA 3UB9A 4GD6A 3IHBA 5HFOA 2X71A 3SH8A 5DF8A 1ZKJA 1T1BA 1K55A 4YFMA 3A0SA 1EW0A 4X1LA 5FQKA 3IT9A 4DKIA 1NXYA 4S2OA 2V8CA 3G32A 3R7WB 1YMXA 3TE8A 2B95A 1K6SA 1TD5A 3S7OA 2HDUA 4OH0A 2QZ6A 1AXBA 3KSFA 3SZTA 1BZAA 3NDGA 3LEZA 3GVBA 3CHWP 5DKKA 4CJNA 3BM6A 2Y2LA 4XUZA 3Q7VB 3EQUA 5DJTA 4BLMA 4DRTA 1YPRA 3SH9A 2W1TA 4HBTA 4G3WA 1NZUA 5CECA 2JKFA 3NULA 3GV9A 1XKZA 4WL9A 1KVLA 2PR5A 3OZHA 3WRZA 3MMHA 4NXGA 4JBFA 2Q9MA 3FZCA 5EFWA 3T1XA 4JKTA 3KSHA 1GA9A 1HZOA 5EM0A 5FQQA 1LHYA 3BRMA 3TSGA 4A5RA 3EGXC 3EGDC 2O9BA 1S4SA 2GJ3A 5L8MA 3CI6A 1LT0A 4IBRA 5M1AA 1L3LA 1BSGA 5FA7A 5FQIA 1Y28A 4XT2B 1K55C 4KENB 3DTIA 1MKMA 4IJGA 2IWBA 1I2WA 3D9YA 3F1PB 2E8JA 2WKRA 2ZD8A 1KE3A 3WS0A 3MFDA 3KSIA 1VETA 4MMNA 2XD5A 2OLUA 1K4FA 3B33A 1K6RA 2OOLA 3OPPA 3UB6A 1P97A 3ZQ5A 1LI9A 4JF5A 3E98A 3EQVA 2J9OA 4GDBA 2HDSA 5EPHA 1Z6FA 5L09A 2ZC6B 1IYSA 3RTYA 2WGIA 4G3VA 3E4OA 2V0UA 1ESUA 4GN2A 4OPYA 4FTXA 4HIAA 1CK3A 4E3OA 2XR0A 2YKHA 1TS7A 3NOPC 3ZVWA 5GHYA 4H6JB 5DF9A 2XSSA 3UY6A 3U4LP 3ZYTA 2XD1A 3A3JA 2Z2MB 5CX7A 3HLBA 4GNUA 3VMAA 3QNCA 1CI8A 2KX6A 2WGWA 4LV2A 3HLWA 3V50A 3O87A 2Y2OA 1K0KA 3EEHA 3ZGAB 4X68A 1XP4A 2ZMFA 1GA0A 3MS6A 1YLWA 3N7WA 3O88A 4Y3IA 4KQQA 5EE8A 4WYYA 4G3KA 2XQZA 4D2OA 4Y0TA 2J3TC 1ODVA 2W1TB 4PHTA 3VP1A 1PWGA 2VGLM 2O9AA 1G68A 2P9VA 3IH8A 4F94A 3UE3A 4R4RA 2IA2A 1AWIA 3NJAA 2PBYA 4GW9A 4WM9A 2JN7A 4ZTKA 2B02A 5EVID 2ZQAA 1PZOA 4MN5A 2Y2NA 4FH2A 3E2KA 1T19A 4S2NA 4JGQA 5FEGA 1BLHA 1FCNA 4K0XA 2XEPA 2J9PA 3M2KA 2OAQ1 4NXFA 5EVEA 2HGVA 2PU4A 3G30A 1XJ4A 2Q0OA 3UNWA 4OQ0A 5KSCA 1G6AA 3ZG5A 3FYZA 4EESA 2VGLS 4XUXA 1S1ZA 4P6ZM 3QP2A 2W3EA 3CLOA 1VETB 1FSWA 5A8BA 1YLTA 5E2FA 1PWDA 1YLYA 2XFTA 3FPWA 2W3HA 4WF0A 5EECA 4D60A 3TOIA 1NJ4A 1K56D 4RQ9A 5HPFA 1BLPA 4HJ6A 1WA9A 4K0WA 3L7HA 4FD8A 4MBFA 1FIKA 1OTBA 2L0WA 5CGSA 1TVFA 2Y2IA 2Y91A 4PKYG 2PR6A 2Y4AA 3NDEA 1CQAA 4BD0A 3W4OA 4ZAMA 4HOIA 1ERMA 3CZDA 4S2NC 3HBRA 1W63Q 2VLGA 4P6ZS 1GHPA 4Y0UA 2VA0A 1SDNA 1ALQA 1SCWA 3GSGA 2A3UA 1F5MA 3SS5A 4ARZA 1KGEA 1W5DA 2WGWB 2A24A 4E3IA 4Q0HA 5DVAA 3LCEA 2EFUA 1E3UD 1FQGA 5DTTA 3BY8A 4B9OA 3UDXA 1I2SA 2W0NA 3VE3A 2VK3A 3MXQA 1PYYA 1DP9A 1H8YA 1XX2A 2JKRI 3I7JA 4WLAA 5DFYA 2L4RA 1ONGA 3UO9A 4LV3A 3W2ZA 1Q2PA 4KZ6A 2D02A
chains in the Genus database with same CATH topology
3WS4A 4BENA 4U3TA 3PBOA 1PZPA 4P85A 2P9VB 1N4OA 1Y54A 4N9KA 1DJAA 4RYEA 3ZNYA 5A91A 5CGXA 1CEGA 2ZQ8A 3A3DA 3OPLA 4N1XA 5HW3A 2XFSA 1L0DA 2J7VA 3DWKA 3IXBA 4X53A 2ZQDA 5TFQA 3IF6C 5TGFA 3SS4A 1ONHA 1IELA 3ZG8B 5CEDA 1YLJA 5KSHA 3G2ZA 3LO7A 1I5QA 3JYIA 1XA1A 4ID4A 3UE0A 4M3KA 3MZDA 3OCNA 5E2GA 2R9XA 3VP4A 4R1GA 4GKUA 4KQRA 4OPRA 5FAOA 5EUAA 1MWTA 1JTGA 1FCOA 3HUMA 4GD6A 1PI4A 3IHBA 3BLMA 2X71A 5HFOA 3SH8A 5JYPA 4OVDA 5DF8A 1XXMA 3A3EA 5DTSA 5CTNA 1ZKJA 1LI0A 2X01A 4PPRA 1K55A 2H10A 2WKEA 4QD4A 4WMCA 1H8ZA 4YFMA 1SHVA 2BLSA 5HAPA 4BL3A 4MBHA 1MPLA 3BECA 3BFFA 1XGIA 3IF5A 3IT9A 4RVAA 5FQKA 4DKIA 1K4EA 1NXYA 4S2OA 4WEJA 3ZHHA 2VGJA 2G2WA 3VFHA 1YLPA 4R3JA 5GLCA 1CI9A 4GZBA 1SKFA 3G32A 3AGFA 4UA6A 1YMXA 3BEBA 3VP0A 5J8XA 3IF6A 1K6SA 1GHIA 2V20A 2HDUA 4R4SA 4OH0A 4JXVA 2Y2JA 1RCJA 5FI2A 3ZDJA 2QZ6A 1AXBA 3BFDA 3CJMA 1BLSA 1BZAA 4OKPA 3NDGA 3LEZA 3GVBA 3VOYA 1ERQA 3W4QA 1PWCA 1IEMA 2DNSA 4IVIA 3N8SA 4CJNA 5KZHA 1IYQA 1ES5A 3BM6A 2Y2LA 4ZJ3A 4XUZA 3Q7VB 3EQUA 5A92A 2WAEA 2Y2MA 2ZM8A 5EVIA 4BLMA 4DRTA 2HDQA 4PM7A 4B88A 3SH9A 3O3VA 4QHCA 5FATA 3N4IA 4ZBEA 1IKGA 2H0TA 4HBTA 1NZUA 5CECA 4RX2A 3S22A 3N8RA 3HVFA 4S2JA 3O86A 1PW1A 1K38A 1NYMA 4DF6A 1MWUA 4S2MA 3NBLA 1OMEA 3GV9A 3UN7A 4OOMA 1MWSA 5HAIA 1XKZA 3MKEA 1RP5A 3HLDA 4OQHA 4NK3A 4QY6A 1YT4A 1KVLA 4R0QA 1IYPA 3OZHA 4WMCD 3WRZA 2FFYA 4RX3A 1ZC2A 2HP5A 3M6BA 4JBFA 4OLGA 2Q9MA 1FOFA 1BLCA 3ITBA 1BT5A 2ZC5B 3FZCA 4YINA 4EWFA 3HLFA 3P98A 1C3BA 1GHMA 2ZMAA 5HARA 4JKTA 3MZFA 1GA9A 4X6TA 1YM1A 2DCFA 2ZQ9A 1HZOA 5FQQA 2P74A 4F94A 1LHYA 2IWDA 4P6BA 3BRMA 1IKIA 2WKHA 3A3FA 4IVKA 3TSGA 4A5RA 4B4ZA 4JPMA 2Z2LB 2Y2HA 4OP5A 2RL3A 5E43A 4KG2A 2ZC7A 3ZNTA 1LL9A 1ESIA 2C5WB 4IBRA 5M1AA 1TDGA 4MLLA 4WELA 2HDRA 1VM1A 3C7VA 3G34A 4RA7A 1BSGA 2EX8A 5FA7A 5FQIA 1K55C 4KENB 3ZG0A 4DE1A 4Y7PA 2IWBA 4EQIA 4DE0A 4E3MA 4E6XA 1DY6A 1I2WA 5CEBA 1MKIA 2ZD8A 4S2KA 5CHMA 3V5MA 1KE3A 3CMZA 1DJCA 1K56A 5AQAA 5HX9A 1WE4A 3WS0A 4JF4A 2EXAA 3ITAA 3MFDA 4KZ5A 4P87A 2XD5A 1W8QA 2OLUA 4PMAA 3HLCA 1EROA 3PBQA 1W79A 1K4FA 4JXSA 4BQMA 2H5SA 1K6RA 2OLVA 3LY3A 4KQOA 4N1HA 3OPPA 1KGFA 5HAQA 1LI9A 4S2PA 4JF5A 4WZ5A 4GOGA 5F82A 3EQVA 2J9OA 1O7EA 4GDBA 2HDSA 2XGNA 4WBGA 5FASA 3G2YA 3IWQA 3PAEA 3G35A 3IXHA 5FQ9A 3V3RA 5CRFA 1Z6FA 4S2IA 5EPHA 1K54A 1YMSA 2J8YA 2ZC6B 3PAGA 1IYSA 5EVIC 4EBPA 1MBLA 1FR6A 1LL5A 2A49A 4LV1A 2XDMA 1XPBA 4KG6A 4XXRA 3W8KA 2WGIA 3IH9A 4GB7A 1YQSA 2XF3A 3BFGA 2ZJ9A 2EX6A 2WZZA 1JVJA 3FV7A 3RXXA 3IWIA 1RGYA 4MEZA 4DDSA 2HP6A 3B3XA 1ESUA 3FWLA 3UPOA 1K57A 5BOHA 2XLNA 1L2SA 2QMIA 4GN2A 1JWVA 4H8RA 4PM8A 3SH7A 4OPYA 4O7DA 3C4PA 3IHAA 1CK3A 1LLBA 4E3OA 2C6WB 4N9LA 2XR0A 3GRJA 4JF6A 3OPHA 1ES2A 5F1GA 3ZVWA 1KVMA 5GHYA 4UAAA 1K25A 4CPKA 5DF9A 3QHYA 4FCFA 3UY6A 4EBNA 2XD1A 2H0YA 2Z2MB 2ZM0A 3A3JA 4MBKA 5E2HA 5G18A 4QJGA 1E3UA 3HLBA 3AGDA 5A90A 2ZQ7A 4WEKA 4LCMA 4WZ4A 2QPNA 2HP9A 1HVBA 3V39A 3N6IA 4GNUA 2RCXA 3OC2A 1ES3A 4BD1A 4JXGA 3VMAA 5GL9A 4GDNA 5GLBA 1FSYA 3IWOA 3QNCA 5CTMA 1CI8A 2WGWA 4LV2A 2WZXA 3HLWA 1NRFA 3V50A 3O87A 1VQQA 3MBZA 3VSKA 2Y2OA 3IF6B 2V1ZA 4X68A 1XP4A 3ZGAB 3HLGA 1GA0A 4KZ3A 4FH4A 3VOZA 3A3IA 4LCLA 3G31A 1L0GA 1YLWA 1S6RA 5CHJA 3M2JA 3N7WA 4X69A 4OOLA 1J9MA 1QMFA 5L2FA 1FCMA 1W7FA 3GMWA 4OQIA 4C75A 3O88A 5DF7A 4DDYA 1IYOA 2Y2QA 1L0FA 1DJBA 4KQQA 3Q7ZA 1EI5A 1EWZA 2WKIA 1JTDA 1SDEA 3HL9A 5EE8A 5EVIB 4E3KA 1BTLA 2ZC4B 3IXDA 4WYYA 2XQZA 5GLDA 5FSRA 4R3BA 4D2OA 4Y0TA 3IXGA 4WZ5C 4DE2A 5D3OA 3VP1A 1PWGA 3PBRA 1KDSA 1G68A 2I72A 2P9VA 3C5AA 3IH8A 3IQAA 3OCLA 4S2LA 3UE3A 1GCEA 4R4RA 3OPRA 3D4FA 4IBXA 5DTKA 1K54C 4HEFA 5GHZA 3NCKA 4OOYA 2OV5A 2Y2PA 4MNRA 3DTMA 4KZBA 3UDFA 4E3JA 2PBYA 3GTCA 4WM9A 4ZTKA 4OLDA 3MXSA 5EVID 2ZQAA 1PZOA 3PBNA 1JWPA 5FDHA 1RGZA 4EBLA 2Y2NA 1NZOA 3BYDA 2XH9A 1MWRA 3ISGA 1XGJA 4FH2A 2UWXA 5FAPA 5HL1A 2WADA 3E2KA 4IEDA 4ZJ1A 1K57C 1YLZA 4S2NA 4BJPA 1BLHA 5FI6A 4DXBA 1FCNA 1MY8A 3P09A 4K0XA 3VP3A 3UPPA 5JYOA 2WGVA 2JCHA 2XEPA 1NY0A 2FFFB 3PBTA 5FQMA 2J9PA 3FKWA 3M2KA 3V3SA 3WS2A 3ZFZA 4Q8IA 4OONA 1WYBA 2V2FF 4Y0OA 2PU4A 3SOIA 1PI5A 3G30A 1N9BA 2ZQCA 3CG5A 4K91A 2ZM2A 3UDIA 2VGKA 3UNWA 3ZG7B 5AQ9A 2WUQA 4KZ4A 4OQ0A 5KSCA 2EFXA 3DWZA 3GQZA 4KG5A 4KZ8A 1M40A 1L0EA 1G6AA 3ZG5A 3FYZA 4R23A 2B5RA 2Q9NA 5F83A 4OQGA 4E6WA 5F1FA 5CGWA 3PBSA 3TG9A 4XUXA 1ZG6A 4B4XA 3HUNA 5CXWA 3C4OA 4QY5A 3Q82A 4FSFA 1KE4A 1FSWA 2EX2A 1YLTA 2HPBA 5E2FA 1PWDA 2R9WA 3Q7VA 1YLYA 2XFTA 4LENA 3BLSA 3FKVA 5U47A 3ZG9B 5EECA 3BFCA 5TR7A 2JBFA 3WRTA 4C3QA 1PW8A 3TOIA 4E3LA 1NJ4A 1K56D 3HREA 5EOOA 1ES4A 3MXRA 5FI7A 1QMEA 1BUEA 4Z9QA 3MKFA 1JWZA 1E25A 1BLPA 1TEMA 1KGGA 5GLAA 2JC7A 4JXWA 4K0WA 5A93A 1MXOA 2XK1A 1W8YA 5EVLA 4FD8A 4MBFA 4UA9A 3RJUA 3WS5A 2EX9A 2EXBA 4ZJ2A 4GD8A 1O07A 4OP8A 2CC1A 5CERA 2GDNA 3DW0A 2ZC3B 3VSLA 5EOEA 5CGSA 1E4DA 3NIAA 1TVFA 2Y2IA 2Y91A 3HLEA 4UHUA 2IWCA 3VP2A 3RXWA 2Y4AA 2WYXA 2E8IA 4NETA 1NYYA 3NDEA 1U60A 3Q07A 4U0TA 4BD0A 1BULA 3W4OA 5E2EA 4C6YA 4ZAMA 2BG1A 1ERMA 3BFEA 3GR2A 3MZEA 3CZDA 2Y59A 3M6HA 3NC8A 4S2NC 4E3NA 4EUZA 1PIOA 3HBRA 3PTEA 5M19A 3QNBA 2ZLYA 1GHPA 4Y0UA 4KZ9A 3UE1A 5FAQA 1HD8A 4N92A 4PM9A 1SDNA 1ALQA 1SCWA 2X02A 2Y2KA 3GSGA 4QB8A 4X55A 2A3UA 1Q2QA 2Y2GA 2DRWA 3HUOA 4HBUA 2PU2A 3E2LA 3SS5A 4DXCA 5CHUA 2Y55A 1S0WA 3Q81A 3LY4A 2G2UA 1KGEA 1W5DA 2WGWB 1TDLA 4BL2A 3ZCZA 4L0LA 1FR1A 3VFFA 3W4PA 4E3IA 5KMWA 4UA7A 4EV4A 3G4PA 4OPQA 3NY4A 2WAFA 3UPNA 1KDWA 2JE5A 3LCEA 5DVAA 5FQJA 2EFUA 1E3UD 1M6KA 1FQGA 1XA7A 3NI9A 5DTTA 3C7UA 3SS3A 4KZ7A 4PM5A 3S1YA 4ZDXA 1H5XA 4QU3A 3Q1FA 3N8LA 5AQ7A 3UDXA 1I2SA 3WS1A 3ZVTA 4DE3A 1CEFA 4JLFA 2WK0A 1ZG4A 3AGEA 1PYYA 5IHVA 3S4XA 5M18A 1KE0A 1H8YA 1WYCA 4KZAA 4OPZA 5I94A 1XX2A 4PM6A 3WWXA 4P0MA 4U0XA 3I7JA 1HTZA 3UO9A 2OSUA 1ONGA 4HESA 4LV3A 5GHXA 4LV0A 5AQBA 1Q2PA 4KZ6A 4X56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WS4 A;  4BEN A;  4U3T A;  3PBO A;  1PZP A;  4P85 A;  2P9V B;  1N4O A;  1Y54 A;  4N9K A;  1DJA A;  4RYE A;  3ZNY A;  5A91 A;  5CGX A;  1CEG A;  2ZQ8 A;  3A3D A;  3OPL A;  4N1X A;  5HW3 A;  2XFS A;  1L0D A;  2J7V A;  3DWK A;  3IXB A;  4X53 A;  2ZQD A;  5TFQ A;  3IF6 C;  5TGF A;  3SS4 A;  1ONH A;  1IEL A;  3ZG8 B;  5CED A;  1YLJ A;  5KSH A;  3G2Z A;  3LO7 A;  1I5Q A;  3JYI A;  1XA1 A;  4ID4 A;  3UE0 A;  4M3K A;  3MZD A;  3OCN A;  5E2G A;  2R9X A;  3VP4 A;  4R1G A;  4GKU A;  4KQR A;  4OPR A;  5FAO A;  5EUA A;  1MWT A;  1JTG A;  1FCO A;  3HUM A;  4GD6 A;  1PI4 A;  3IHB A;  3BLM A;  2X71 A;  5HFO A;  3SH8 A;  5JYP A;  4OVD A;  5DF8 A;  1XXM A;  3A3E A;  5DTS A;  5CTN A;  1ZKJ A;  1LI0 A;  2X01 A;  4PPR A;  1K55 A;  2H10 A;  2WKE A;  4QD4 A;  4WMC A;  1H8Z A;  4YFM A;  1SHV A;  2BLS A;  5HAP A;  4BL3 A;  4MBH A;  1MPL A;  3BEC A;  3BFF A;  1XGI A;  3IF5 A;  3IT9 A;  4RVA A;  5FQK A;  4DKI A;  1K4E A;  1NXY A;  4S2O A;  4WEJ A;  3ZHH A;  2VGJ A;  2G2W A;  3VFH A;  1YLP A;  4R3J A;  5GLC A;  1CI9 A;  4GZB A;  1SKF A;  3G32 A;  3AGF A;  4UA6 A;  1YMX A;  3BEB A;  3VP0 A;  5J8X A;  3IF6 A;  1K6S A;  1GHI A;  2V20 A;  2HDU A;  4R4S A;  4OH0 A;  4JXV A;  2Y2J A;  1RCJ A;  5FI2 A;  3ZDJ A;  2QZ6 A;  1AXB A;  3BFD A;  3CJM A;  1BLS A;  1BZA A;  4OKP A;  3NDG A;  3LEZ A;  3GVB A;  3VOY A;  1ERQ A;  3W4Q A;  1PWC A;  1IEM A;  2DNS A;  4IVI A;  3N8S A;  4CJN A;  5KZH A;  1IYQ A;  1ES5 A;  3BM6 A;  2Y2L A;  4ZJ3 A;  4XUZ A;  3Q7V B;  3EQU A;  5A92 A;  2WAE A;  2Y2M A;  2ZM8 A;  5EVI A;  4BLM A;  4DRT A;  2HDQ A;  4PM7 A;  4B88 A;  3SH9 A;  3O3V A;  4QHC A;  5FAT A;  3N4I A;  4ZBE A;  1IKG A;  2H0T A;  4HBT A;  1NZU A;  5CEC A;  4RX2 A;  3S22 A;  3N8R A;  3HVF A;  4S2J A;  3O86 A;  1PW1 A;  1K38 A;  1NYM A;  4DF6 A;  1MWU A;  4S2M A;  3NBL A;  1OME A;  3GV9 A;  3UN7 A;  4OOM A;  1MWS A;  5HAI A;  1XKZ A;  3MKE A;  1RP5 A;  3HLD A;  4OQH A;  4NK3 A;  4QY6 A;  1YT4 A;  1KVL A;  4R0Q A;  1IYP A;  3OZH A;  4WMC D;  3WRZ A;  2FFY A;  4RX3 A;  1ZC2 A;  2HP5 A;  3M6B A;  4JBF A;  4OLG A;  2Q9M A;  1FOF A;  1BLC A;  3ITB A;  1BT5 A;  2ZC5 B;  3FZC A;  4YIN A;  4EWF A;  3HLF A;  3P98 A;  1C3B A;  1GHM A;  2ZMA A;  5HAR A;  4JKT A;  3MZF A;  1GA9 A;  4X6T A;  1YM1 A;  2DCF A;  2ZQ9 A;  1HZO A;  5FQQ A;  2P74 A;  4F94 A;  1LHY A;  2IWD A;  4P6B A;  3BRM A;  1IKI A;  2WKH A;  3A3F A;  4IVK A;  3TSG A;  4A5R A;  4B4Z A;  4JPM A;  2Z2L B;  2Y2H A;  4OP5 A;  2RL3 A;  5E43 A;  4KG2 A;  2ZC7 A;  3ZNT A;  1LL9 A;  1ESI A;  2C5W B;  4IBR A;  5M1A A;  1TDG A;  4MLL A;  4WEL A;  2HDR A;  1VM1 A;  3C7V A;  3G34 A;  4RA7 A;  1BSG A;  2EX8 A;  5FA7 A;  5FQI A;  1K55 C;  4KEN B;  3ZG0 A;  4DE1 A;  4Y7P A;  2IWB A;  4EQI A;  4DE0 A;  4E3M A;  4E6X A;  1DY6 A;  1I2W A;  5CEB A;  1MKI A;  2ZD8 A;  4S2K A;  5CHM A;  3V5M A;  1KE3 A;  3CMZ A;  1DJC A;  1K56 A;  5AQA A;  5HX9 A;  1WE4 A;  3WS0 A;  4JF4 A;  2EXA A;  3ITA A;  3MFD A;  4KZ5 A;  4P87 A;  2XD5 A;  1W8Q A;  2OLU A;  4PMA A;  3HLC A;  1ERO A;  3PBQ A;  1W79 A;  1K4F A;  4JXS A;  4BQM A;  2H5S A;  1K6R A;  2OLV A;  3LY3 A;  4KQO A;  4N1H A;  3OPP A;  1KGF A;  5HAQ A;  1LI9 A;  4S2P A;  4JF5 A;  4WZ5 A;  4GOG A;  5F82 A;  3EQV A;  2J9O A;  1O7E A;  4GDB A;  2HDS A;  2XGN A;  4WBG A;  5FAS A;  3G2Y A;  3IWQ A;  3PAE A;  3G35 A;  3IXH A;  5FQ9 A;  3V3R A;  5CRF A;  1Z6F A;  4S2I A;  5EPH A;  1K54 A;  1YMS A;  2J8Y A;  2ZC6 B;  3PAG A;  1IYS A;  5EVI C;  4EBP A;  1MBL A;  1FR6 A;  1LL5 A;  2A49 A;  4LV1 A;  2XDM A;  1XPB A;  4KG6 A;  4XXR A;  3W8K A;  2WGI A;  3IH9 A;  4GB7 A;  1YQS A;  2XF3 A;  3BFG A;  2ZJ9 A;  2EX6 A;  2WZZ A;  1JVJ A;  3FV7 A;  3RXX A;  3IWI A;  1RGY A;  4MEZ A;  4DDS A;  2HP6 A;  3B3X A;  1ESU A;  3FWL A;  3UPO A;  1K57 A;  5BOH A;  2XLN A;  1L2S A;  2QMI A;  4GN2 A;  1JWV A;  4H8R A;  4PM8 A;  3SH7 A;  4OPY A;  4O7D A;  3C4P A;  3IHA A;  1CK3 A;  1LLB A;  4E3O A;  2C6W B;  4N9L A;  2XR0 A;  3GRJ A;  4JF6 A;  3OPH A;  1ES2 A;  5F1G A;  3ZVW A;  1KVM A;  5GHY A;  4UAA A;  1K25 A;  4CPK A;  5DF9 A;  3QHY A;  4FCF A;  3UY6 A;  4EBN A;  2XD1 A;  2H0Y A;  2Z2M B;  2ZM0 A;  3A3J A;  4MBK A;  5E2H A;  5G18 A;  4QJG A;  1E3U A;  3HLB A;  3AGD A;  5A90 A;  2ZQ7 A;  4WEK A;  4LCM A;  4WZ4 A;  2QPN A;  2HP9 A;  1HVB A;  3V39 A;  3N6I A;  4GNU A;  2RCX A;  3OC2 A;  1ES3 A;  4BD1 A;  4JXG A;  3VMA A;  5GL9 A;  4GDN A;  5GLB A;  1FSY A;  3IWO A;  3QNC A;  5CTM A;  1CI8 A;  2WGW A;  4LV2 A;  2WZX A;  3HLW A;  1NRF A;  3V50 A;  3O87 A;  1VQQ A;  3MBZ A;  3VSK A;  2Y2O A;  3IF6 B;  2V1Z A;  4X68 A;  1XP4 A;  3ZGA B;  3HLG A;  1GA0 A;  4KZ3 A;  4FH4 A;  3VOZ A;  3A3I A;  4LCL A;  3G31 A;  1L0G A;  1YLW A;  1S6R A;  5CHJ A;  3M2J A;  3N7W A;  4X69 A;  4OOL A;  1J9M A;  1QMF A;  5L2F A;  1FCM A;  1W7F A;  3GMW A;  4OQI A;  4C75 A;  3O88 A;  5DF7 A;  4DDY A;  1IYO A;  2Y2Q A;  1L0F A;  1DJB A;  4KQQ A;  3Q7Z A;  1EI5 A;  1EWZ A;  2WKI A;  1JTD A;  1SDE A;  3HL9 A;  5EE8 A;  5EVI B;  4E3K A;  1BTL A;  2ZC4 B;  3IXD A;  4WYY A;  2XQZ A;  5GLD A;  5FSR A;  4R3B A;  4D2O A;  4Y0T A;  3IXG A;  4WZ5 C;  4DE2 A;  5D3O A;  3VP1 A;  1PWG A;  3PBR A;  1KDS A;  1G68 A;  2I72 A;  2P9V A;  3C5A A;  3IH8 A;  3IQA A;  3OCL A;  4S2L A;  3UE3 A;  1GCE A;  4R4R A;  3OPR A;  3D4F A;  4IBX A;  5DTK A;  1K54 C;  4HEF A;  5GHZ A;  3NCK A;  4OOY A;  2OV5 A;  2Y2P A;  4MNR A;  3DTM A;  4KZB A;  3UDF A;  4E3J A;  2PBY A;  3GTC A;  4WM9 A;  4ZTK A;  4OLD A;  3MXS A;  5EVI D;  2ZQA A;  1PZO A;  3PBN A;  1JWP A;  5FDH A;  1RGZ A;  4EBL A;  2Y2N A;  1NZO A;  3BYD A;  2XH9 A;  1MWR A;  3ISG A;  1XGJ A;  4FH2 A;  2UWX A;  5FAP A;  5HL1 A;  2WAD A;  3E2K A;  4IED A;  4ZJ1 A;  1K57 C;  1YLZ A;  4S2N A;  4BJP A;  1BLH A;  5FI6 A;  4DXB A;  1FCN A;  1MY8 A;  3P09 A;  4K0X A;  3VP3 A;  3UPP A;  5JYO A;  2WGV A;  2JCH A;  2XEP A;  1NY0 A;  2FFF B;  3PBT A;  5FQM A;  2J9P A;  3FKW A;  3M2K A;  3V3S A;  3WS2 A;  3ZFZ A;  4Q8I A;  4OON A;  1WYB A;  2V2F F;  4Y0O A;  2PU4 A;  3SOI A;  1PI5 A;  3G30 A;  1N9B A;  2ZQC A;  3CG5 A;  4K91 A;  2ZM2 A;  3UDI A;  2VGK A;  3UNW A;  3ZG7 B;  5AQ9 A;  2WUQ A;  4KZ4 A;  4OQ0 A;  5KSC A;  2EFX A;  3DWZ A;  3GQZ A;  4KG5 A;  4KZ8 A;  1M40 A;  1L0E A;  1G6A A;  3ZG5 A;  3FYZ A;  4R23 A;  2B5R A;  2Q9N A;  5F83 A;  4OQG A;  4E6W A;  5F1F A;  5CGW A;  3PBS A;  3TG9 A;  4XUX A;  1ZG6 A;  4B4X A;  3HUN A;  5CXW A;  3C4O A;  4QY5 A;  3Q82 A;  4FSF A;  1KE4 A;  1FSW A;  2EX2 A;  1YLT A;  2HPB A;  5E2F A;  1PWD A;  2R9W A;  3Q7V A;  1YLY A;  2XFT A;  4LEN A;  3BLS A;  3FKV A;  5U47 A;  3ZG9 B;  5EEC A;  3BFC A;  5TR7 A;  2JBF A;  3WRT A;  4C3Q A;  1PW8 A;  3TOI A;  4E3L A;  1NJ4 A;  1K56 D;  3HRE A;  5EOO A;  1ES4 A;  3MXR A;  5FI7 A;  1QME A;  1BUE A;  4Z9Q A;  3MKF A;  1JWZ A;  1E25 A;  1BLP A;  1TEM A;  1KGG A;  5GLA A;  2JC7 A;  4JXW A;  4K0W A;  5A93 A;  1MXO A;  2XK1 A;  1W8Y A;  5EVL A;  4FD8 A;  4MBF A;  4UA9 A;  3RJU A;  3WS5 A;  2EX9 A;  2EXB A;  4ZJ2 A;  4GD8 A;  1O07 A;  4OP8 A;  2CC1 A;  5CER A;  2GDN A;  3DW0 A;  2ZC3 B;  3VSL A;  5EOE A;  5CGS A;  1E4D A;  3NIA A;  1TVF A;  2Y2I A;  2Y91 A;  3HLE A;  4UHU A;  2IWC A;  3VP2 A;  3RXW A;  2Y4A A;  2WYX A;  2E8I A;  4NET A;  1NYY A;  3NDE A;  1U60 A;  3Q07 A;  4U0T A;  4BD0 A;  1BUL A;  3W4O A;  5E2E A;  4C6Y A;  4ZAM A;  2BG1 A;  1ERM A;  3BFE A;  3GR2 A;  3MZE A;  3CZD A;  2Y59 A;  3M6H A;  3NC8 A;  4S2N C;  4E3N A;  4EUZ A;  1PIO A;  3HBR A;  3PTE A;  5M19 A;  3QNB A;  2ZLY A;  1GHP A;  4Y0U A;  4KZ9 A;  3UE1 A;  5FAQ A;  1HD8 A;  4N92 A;  4PM9 A;  1SDN A;  1ALQ A;  1SCW A;  2X02 A;  2Y2K A;  3GSG A;  4QB8 A;  4X55 A;  2A3U A;  1Q2Q A;  2Y2G A;  2DRW A;  3HUO A;  4HBU A;  2PU2 A;  3E2L A;  3SS5 A;  4DXC A;  5CHU A;  2Y55 A;  1S0W A;  3Q81 A;  3LY4 A;  2G2U A;  1KGE A;  1W5D A;  2WGW B;  1TDL A;  4BL2 A;  3ZCZ A;  4L0L A;  1FR1 A;  3VFF A;  3W4P A;  4E3I A;  5KMW A;  4UA7 A;  4EV4 A;  3G4P A;  4OPQ A;  3NY4 A;  2WAF A;  3UPN A;  1KDW A;  2JE5 A;  3LCE A;  5DVA A;  5FQJ A;  2EFU A;  1E3U D;  1M6K A;  1FQG A;  1XA7 A;  3NI9 A;  5DTT A;  3C7U A;  3SS3 A;  4KZ7 A;  4PM5 A;  3S1Y A;  4ZDX A;  1H5X A;  4QU3 A;  3Q1F A;  3N8L A;  5AQ7 A;  3UDX A;  1I2S A;  3WS1 A;  3ZVT A;  4DE3 A;  1CEF A;  4JLF A;  2WK0 A;  1ZG4 A;  3AGE A;  1PYY A;  5IHV A;  3S4X A;  5M18 A;  1KE0 A;  1H8Y A;  1WYC A;  4KZA A;  4OPZ A;  5I94 A;  1XX2 A;  4PM6 A;  3WWX A;  4P0M A;  4U0X A;  3I7J A;  1HTZ A;  3UO9 A;  2OSU A;  1ONG A;  4HES A;  4LV3 A;  5GHX A;  4LV0 A;  5AQB A;  1Q2P A;  4KZ6 A;  4X56 A; 
#chains in the Genus database with same CATH topology
 4U3T A;  1PZP A;  2P9V B;  3GEC A;  1N4O A;  3H9W A;  2G7U A;  5A91 A;  3K3D A;  5CGX A;  3A3D A;  3LR3 A;  1L0D A;  3IXB A;  5TFQ A;  1ONH A;  5KSH A;  1I5Q A;  1XA1 A;  1PRQ A;  1CF0 A;  3OCN A;  4DJ2 A;  4GKU A;  3FPV A;  1MWT A;  4HP4 A;  1FCO A;  3HUM A;  3T4J A;  4OVD A;  1LI0 A;  1OTA A;  2VJW A;  3O5Y A;  4QD4 A;  4WMC A;  1SHV A;  2BLS A;  4ETX A;  5HAP A;  3NEC A;  4BL3 A;  4MBH A;  1MPL A;  3VFH A;  4UA6 A;  3AGF A;  2XA7 M;  3BEB A;  3QP1 A;  3VP0 A;  2HJE A;  5J8X A;  3IF6 A;  1LL8 A;  1HLU P;  2V20 A;  5FI2 A;  2Y2J A;  2VEA A;  3CJM A;  1N9N A;  4IVI A;  3N8S A;  5KZH A;  5A92 A;  5HD5 A;  1YAX A;  3UMD A;  3MF0 A;  1LSX A;  4B88 A;  3O3V A;  1G6O A;  3N4I A;  2H0T A;  3F1O A;  5J3W A;  3N8R A;  2UV0 E;  1MWU A;  2PYR A;  2ZL1 A;  4MDZ A;  2V1B A;  4CLC A;  2XRN A;  2HV1 A;  3HLD A;  2YKF A;  1IYP A;  2Y79 A;  3KSG A;  3LIB A;  3ITB A;  4GHI A;  3P98 A;  2ZMA A;  4QPR A;  5HAR A;  2OWJ A;  1F98 A;  1YM1 A;  2DCF A;  2ZQ9 A;  2XA7 S;  2P74 A;  3A3F A;  4JPM A;  2Z2L B;  1MZU A;  2M7V A;  3S7P A;  2ZBB A;  2CMN A;  2LB5 A;  2ZC7 A;  4I3A A;  1VM1 A;  4RA7 A;  4DE1 A;  4Y7P A;  4ARZ B;  1UGU A;  1YSQ A;  3CWF A;  2A24 B;  2GZA A;  3V5M A;  1DJC A;  3LR5 A;  4YOF A;  4Q0J A;  3VV4 A;  4GLQ A;  4PMA A;  4BQM A;  2M1C A;  2OLV A;  4LRZ E;  4N1H A;  4I39 A;  4WZ5 A;  4GOG A;  2AVX A;  3IBR A;  2XGN A;  4BBV A;  5FAS A;  3G2Y A;  3IWQ A;  5IU1 A;  5CRF A;  1LSW A;  4S2I A;  1K54 A;  3PAG A;  1MBL A;  2A49 A;  1LL5 A;  3BWL A;  1XPB A;  2B18 A;  3B47 A;  4GB7 A;  1YQS A;  1JVJ A;  3C8C A;  3FV7 A;  1SKO A;  4MEZ A;  4DDS A;  3B3X A;  3UPO A;  4CLC C;  5HZH A;  1L2S A;  3SH7 A;  2V9A A;  3GRJ A;  3R4K A;  3OPH A;  4JF6 A;  2KOI A;  4HJ4 A;  3H82 A;  4UAA A;  1K25 A;  5LBR A;  4CPK A;  2M7U A;  4MBK A;  2ZM0 A;  5A90 A;  2ZQ7 A;  4LCM A;  2HP9 A;  4EUV A;  3V39 A;  4I5S A;  3UME A;  3OC2 A;  1ES3 A;  3L9K A;  5CTM A;  1DRM A;  3VSK A;  4LRY C;  1G5U A;  2NUT C;  2Z6D A;  3IF6 B;  3IX4 A;  3HLG A;  4FH4 A;  3VOZ A;  2VZW A;  3BJN A;  3IX3 A;  1S6R A;  3M2J A;  5DFX A;  4OOL A;  1QMF A;  1FCM A;  3GMW A;  3SW1 A;  4KUO A;  4DDY A;  2LB9 A;  2Y2Q A;  1DJB A;  1EI5 A;  1S66 L;  1SDE A;  3HL9 A;  1PNE A;  5FSR A;  1FIL A;  3IXG A;  4WZ5 C;  4DE2 A;  3F1O B;  1VB6 A;  1DP8 A;  3OPR A;  5DTK A;  1K54 C;  4HEF A;  2ZL1 B;  2Y2P A;  4Y15 A;  4CLC B;  3GTC A;  2P7J A;  4OLD A;  3MXS A;  2JKG A;  3PBN A;  5FDH A;  1JWP A;  4QWO A;  2I9V A;  3S7Q A;  3BYD A;  1XGJ A;  5FAP A;  2UWX A;  4GHI B;  5HL1 A;  5TBM A;  4ZJ1 A;  2PD8 A;  5FI6 A;  4DXB A;  4O8G A;  3P09 A;  4DJ3 A;  2MJ6 A;  2K7S A;  2FFF B;  3V3S A;  3ZFZ A;  3VE4 A;  3A0V A;  4Y0O A;  5AVE A;  3SOI A;  4NKP A;  3CG5 A;  3UDI A;  2VGK A;  3F1N A;  4EER A;  5AQ9 A;  2WUQ A;  4KG5 A;  4ETZ A;  4R23 A;  5CGW A;  3PBS A;  3PYP A;  5IS1 A;  3HUN A;  1LSV A;  3C4O A;  3ULF A;  1KE4 A;  1Y4O A;  2EX2 A;  2R9W A;  4HH3 A;  4LEN A;  3FKV A;  3ZG9 B;  5TR7 A;  2JBF A;  2QWS A;  4C3Q A;  5HDC A;  4E3L A;  1TS6 A;  1ES4 A;  1XJ3 A;  2JKR M;  1QME A;  1BUE A;  1GSW A;  1KGG A;  2INW A;  3MQO A;  2HZ5 A;  2K31 A;  1MXO A;  5EVL A;  2QKP A;  1J3W A;  3RJU A;  4UA9 A;  1X0O A;  1SKO B;  3WS5 A;  2CC1 A;  2PHY A;  3NIA A;  3IS2 A;  2IWC A;  3RXW A;  4NET A;  1U60 A;  4KQD A;  4M4X A;  5E2E A;  3H82 B;  3NC8 A;  3H7W A;  5HL6 A;  4E3N A;  5K5B A;  3PTE A;  5M19 A;  1UWP X;  3QNB A;  4BMW A;  4KZ9 A;  5FAQ A;  1HD8 A;  1D7E A;  5HD3 A;  5J7E A;  2X02 A;  2Y2G A;  1S0W A;  2A2L A;  3C2W A;  3W4P A;  5KMW A;  1T1C A;  3UPN A;  4LFU A;  3NI9 A;  1H5X A;  2J80 A;  4QU3 A;  3T4Q A;  3N8L A;  1S4R A;  1OTD A;  4X25 A;  4IHQ A;  4DE3 A;  4JLF A;  2WK0 A;  1ZG4 A;  3AGE A;  5DJU A;  5M18 A;  3S4X A;  1WYC A;  5I94 A;  1V9Y A;  4PM6 A;  4IUH A;  4P0M A;  4U0X A;  3GDI A;  2GX5 A;  4HES A;  4Y13 A;  5GHX A;  4LV0 A;  4X1M A;  2R78 A;  4BBU A;  5AQB A;  4II7 A;  4YWZ A;  4P85 A;  3B42 A;  4N9K A;  1DJA A;  4RYE A;  1W63 M;  2XFS A;  3DWK A;  2J7V A;  3SS4 A;  2O99 A;  3ZG8 B;  1YLJ A;  5F68 A;  5TBM B;  3TJZ C;  5E2G A;  1BYW A;  4R1G A;  5FAO A;  5EUA A;  2HF6 A;  5KIZ A;  4HJ3 A;  5J4E A;  3A0R A;  3A3E A;  5DTS A;  5CTN A;  2X01 A;  4ZRR A;  4PPR A;  2O0Y A;  2H10 A;  4EEP A;  4RVA A;  1K4E A;  3F1N B;  3T4O A;  3ZHH A;  2G2W A;  4R3J A;  5GLC A;  1CI9 A;  2D01 A;  3MFX A;  4HP9 A;  3OBF A;  3LYX A;  3JPU A;  4JXV A;  1RCJ A;  3ZDJ A;  1BLS A;  4OKP A;  3W4Q A;  3FG8 A;  1IEM A;  1T1A A;  1ES5 A;  1XFQ A;  2Y2M A;  5EVI A;  2HDQ A;  4QHC A;  3KYZ A;  5FAT A;  4ZBE A;  2QYB A;  4RX2 A;  3S22 A;  4S2J A;  1Z09 A;  3O86 A;  3D72 A;  1PW1 A;  3RFB A;  1NYM A;  4DF6 A;  4S2M A;  4I3J A;  1OME A;  4OOM A;  5HWW A;  1MWS A;  3T4S A;  5HAI A;  2KLI A;  4OQH A;  4NK3 A;  4QY6 A;  1YT4 A;  4R0Q A;  4WMC D;  3M6B A;  4OLG A;  2ZC5 B;  1C3B A;  1GHM A;  3IS2 B;  4MCW A;  2OAP 1;  5F5Y A;  2IWD A;  4P6B A;  2WKH A;  4IVK A;  4R38 A;  4B4Z A;  3E0Y A;  2Y2H A;  5E43 A;  3ZNT A;  1ESI A;  5MC7 A;  4MLL A;  2HDR A;  2EX8 A;  3ZG0 A;  4LPZ A;  1GSX A;  4HQA A;  4E3M A;  4E6X A;  3QP6 A;  5CEB A;  4S2K A;  5CHM A;  3CMZ A;  5HX9 A;  1K56 A;  3HJI A;  4JF4 A;  2EXA A;  2H28 A;  4KZ5 A;  3NOT C;  3PBQ A;  3UB5 P;  1W79 A;  3ICY A;  2H5S A;  1KOU A;  4KQO A;  5HAQ A;  4S2P A;  3OOV A;  4WBG A;  3PAE A;  3IXH A;  5FQ9 A;  5GLB A;  5EVI C;  2J8Y A;  3LR4 A;  4EBP A;  5HPI A;  2XDM A;  3TW8 A;  3HCY A;  2ZOI A;  2ZJ9 A;  2EX6 A;  3IWI A;  5IT5 A;  1RGY A;  3DAV A;  3T4K A;  3LGO A;  3LUQ A;  4PM8 A;  3T4L A;  3DTE A;  3IHA A;  2C6W B;  4N9L A;  1ES2 A;  1P9R A;  5F1G A;  2HJ9 C;  3UB8 A;  4JGP A;  2H0Y A;  4QJG A;  1E3U A;  3AGD A;  5EM1 A;  2QPN A;  1HVB A;  3N6I A;  1UWN X;  2EWV A;  3LIC A;  4JXG A;  5GL9 A;  3HJK A;  1DP6 A;  2ZMV A;  3UE6 A;  3CIT A;  2WZX A;  3LI9 A;  3MBZ A;  3KYE A;  3P7N A;  4NXE A;  4O01 A;  4KZ3 A;  2XRO A;  3A3I A;  2DMW A;  3NOU C;  4YNR A;  2W27 A;  1L0G A;  4BWI A;  1J9M A;  5L10 A;  3JVU A;  4C75 A;  1L0F A;  4L9G A;  3Q7Z A;  3MR0 A;  5EVI B;  4E3K A;  1BTL A;  2ZC4 B;  5D3O A;  3PBR A;  3F1P A;  1YKD A;  1GCE A;  5GHZ A;  3D4F A;  4OOY A;  2OV5 A;  4MNR A;  3DTM A;  3UDF A;  4E3J A;  3RH8 B;  1N9O A;  3EEA A;  1RGZ A;  4EBL A;  1MWR A;  2XH9 A;  1H3Q A;  2WAD A;  1YLZ A;  4BJP A;  5HWT A;  3IBJ A;  3G6O A;  2O9C A;  3UPP A;  5JYO A;  2FH5 A;  2WGV A;  1NY0 A;  3PBT A;  5FQM A;  3FKW A;  5L07 A;  4OON A;  1WYB A;  4Z1W A;  1PI5 A;  5G4Z A;  4O0P A;  2ZQC A;  4K91 A;  3ZG7 B;  2EFX A;  4KZ8 A;  1M40 A;  1L0E A;  2B5R A;  2Q9N A;  5F83 A;  4OQG A;  3BW6 A;  3TG9 A;  1JNU A;  4CQH A;  1ZG6 A;  4B4X A;  3LR0 A;  4QY5 A;  4AFI A;  2PYP A;  2HPB A;  3LIA A;  5G4Y A;  2JHE A;  5U47 A;  1ACF A;  3BFC A;  5HSQ A;  3HRE A;  5EOO A;  3MXR A;  3VOL A;  3C38 A;  4Z9Q A;  1E25 A;  4Q0I A;  3KYQ A;  4I3I A;  5GLA A;  2JC7 A;  4JXW A;  1IOU A;  1P9W A;  2XK1 A;  2J3T D;  4ZJ2 A;  4OP8 A;  5FDS A;  2GDN A;  5TJJ A;  2W1R A;  2ZC3 B;  3VSL A;  5FL3 A;  4R6L A;  3MQ0 A;  1E4D A;  1XFN A;  4HHD A;  4UHU A;  3VP2 A;  2PT7 A;  2E8I A;  1NYY A;  4L9E A;  4Y2F A;  2BG1 A;  3BFE A;  3GR2 A;  4LRX C;  4EUZ A;  3JVV A;  2ZLY A;  4IUK A;  1A0K A;  3UE1 A;  4B93 A;  1NLZ A;  4EXO A;  4PM9 A;  2J3W A;  4X55 A;  2Y2K A;  3QP8 A;  5AJG A;  2DRW A;  3HUO A;  3IX8 A;  5CHU A;  2Y55 A;  2NUP C;  3LY4 A;  2G2U A;  1TDL A;  5DKL A;  2EA9 A;  4L0L A;  1VHM A;  3VFF A;  4UA7 A;  4EV4 A;  1KDW A;  5FQJ A;  1M6K A;  4PM5 A;  3BQA A;  3C7U A;  3SS3 A;  4KZ7 A;  3Q1F A;  3WS1 A;  1T18 A;  1CEF A;  3LIE A;  3MQQ A;  5IHV A;  1KE0 A;  3T1Q B;  4OPZ A;  1HTZ A;  2OSU A;  3DBA A;  4Y5F A;  4HNB A;  4X56 A;  3WS4 A;  4BEN A;  3K2N A;  3PBO A;  3CUE A;  4WUJ A;  1Y54 A;  1CJF A;  3E4P A;  3ZNY A;  1H0M A;  5TGF A;  1V9Z A;  1IEL A;  4F3L A;  3G2Z A;  3UE0 A;  4M3K A;  1TS8 A;  2R9X A;  3VP4 A;  3KO6 A;  1JTG A;  2JKT M;  1PI4 A;  5JYP A;  3BLM A;  1XXM A;  2WKE A;  1H8Z A;  3LFV A;  5F69 A;  3BEC A;  3BFF A;  1XGI A;  3IF5 A;  4HH2 A;  4WEJ A;  2VGJ A;  1YLP A;  2BTF P;  4GZB A;  4HI4 A;  1SKF A;  1S67 L;  4JGO A;  3EOI A;  2Z6C A;  2KDK A;  1GHI A;  4CLC E;  4R4S A;  3BFD A;  5HDD A;  3VOY A;  1ERQ A;  1PWC A;  2DNS A;  4FUW A;  1IYQ A;  4ZJ3 A;  2WAE A;  3P01 A;  2ZM8 A;  4PM7 A;  4R70 A;  3QP4 A;  1IKG A;  4Y17 A;  3HVF A;  4I38 A;  1K38 A;  4MN7 A;  3NBL A;  3UN7 A;  3MKE A;  3QP5 A;  1RP5 A;  3CUE C;  2FFY A;  4RX3 A;  1ZC2 A;  2HP5 A;  1VEU A;  2L1M A;  1FOF A;  1BLC A;  2ZOH A;  1BT5 A;  4YIN A;  4EWF A;  3HLF A;  2V8F A;  3MZF A;  4X6T A;  2GNX A;  1PFL A;  1IKI A;  4EQ1 A;  2WKP A;  1NLY A;  4K08 A;  1XJ6 A;  5EV0 A;  4OP5 A;  2RL3 A;  4KG2 A;  4JGR A;  3T1R A;  1LL9 A;  2C5W B;  2BAS A;  1TDG A;  2PBD P;  4WEL A;  3S7N A;  5AVF A;  3C7V A;  3G34 A;  5HDS A;  2EWW A;  4EQI A;  4DE0 A;  1DY6 A;  4GS9 A;  1MKI A;  5AQA A;  1WE4 A;  3ITA A;  4P87 A;  4DMZ A;  1W8Q A;  3HLC A;  1ERO A;  4JXS A;  4KUK A;  3LY3 A;  1ZHH B;  1KGF A;  5F82 A;  1O7E A;  3G35 A;  3V3R A;  1YMS A;  2VX8 A;  1FR6 A;  4LV1 A;  4KG6 A;  4XXR A;  3W8K A;  3IH9 A;  2XF3 A;  3BFG A;  5I5L A;  2WZZ A;  5FEF A;  3RXX A;  3LIF A;  2HP6 A;  2FZ0 A;  3FWL A;  1K57 A;  2K2N A;  3K3C A;  5BOH A;  2XLN A;  2QMI A;  4H8R A;  1JWV A;  4O7D A;  3C4P A;  4F3L B;  1LLB A;  1KVM A;  1MC0 A;  4GJ4 A;  4UEY A;  3QHY A;  4FCF A;  1F9I A;  4EBN A;  4LGW A;  5E2H A;  5G18 A;  4WEK A;  4WZ4 A;  5HWV A;  2RCX A;  4BD1 A;  3T1S A;  4GDN A;  1FSY A;  1G28 A;  3IWO A;  3EWK A;  3MSH A;  1NRF A;  1STZ A;  1VQQ A;  4PAU A;  4E04 A;  2V1Z A;  4LCL A;  3G31 A;  5CHJ A;  4UQI M;  4X69 A;  4ESP A;  3CPT A;  5L2F A;  1W7F A;  4OQI A;  3OLO A;  5DF7 A;  1IYO A;  1SZV A;  2JKT I;  2VKS A;  4L9F A;  1EWZ A;  2WKI A;  1JTD A;  2W3D A;  3IXD A;  5GLD A;  3PR6 A;  4R3B A;  3H7W B;  1TF1 A;  3BY9 A;  2PD7 A;  1KDS A;  2I72 A;  3C5A A;  3IQA A;  3OCL A;  4S2L A;  4IBX A;  3NCK A;  1OT9 A;  4EET B;  2W3F A;  4KZB A;  1NRJ A;  3TRC A;  1VEU B;  1NZO A;  5C5K A;  3ISG A;  4IED A;  3PXP A;  1K57 C;  1OJ5 A;  1MY8 A;  2PDR A;  3VP3 A;  4WN5 A;  2JCH A;  2P04 A;  4CLC D;  4R3A A;  4LLO B;  3WS2 A;  4Q8I A;  3NHQ A;  2V0W A;  2V2F F;  4UQI S;  1N9B A;  3T4T A;  1YSP A;  2ZM2 A;  4KZ4 A;  3C30 A;  3GQZ A;  3DWZ A;  1P0Z A;  3LID A;  3R7W A;  3T12 B;  4GS9 B;  4E6W A;  5F1F A;  2QJ7 A;  3E4Q A;  3BQ8 A;  5CXW A;  3Q82 A;  4FSF A;  2VV6 A;  3Q7V A;  2Y8H A;  3BLS A;  3WRT A;  1PW8 A;  4NXB A;  3V67 A;  2PAV P;  5FI7 A;  4EU0 A;  1OTI A;  3MKF A;  1JWZ A;  1OTE A;  1TEM A;  2W3G A;  5A93 A;  1W8Y A;  3LEQ A;  4MN6 A;  2EX9 A;  2EXB A;  4GD8 A;  1O07 A;  5CER A;  1ZTU A;  3DW0 A;  5EOE A;  1OPX A;  3HLE A;  1N9L A;  2WYX A;  3Q07 A;  4U0T A;  4ME4 A;  1BUL A;  4C6Y A;  3FC7 A;  3MZE A;  2Y59 A;  3M6H A;  3DTK A;  1PIO A;  2V1A A;  1OT6 A;  4PKY A;  3U2A A;  1H8M A;  3D3O A;  3T50 A;  2QJ5 A;  1XJ2 A;  4N92 A;  3MJQ A;  4XT2 A;  4QB8 A;  4BBT A;  1Q2Q A;  1NWZ A;  3CAX A;  2PU2 A;  3E2L A;  4HBU A;  4DXC A;  3Q81 A;  2VV7 A;  4BL2 A;  3ZCZ A;  4EW7 A;  1S1Y A;  1FR1 A;  3G4P A;  4OPQ A;  3NY4 A;  2WAF A;  2JE5 A;  2PRF A;  3UB7 A;  1XA7 A;  4ZDX A;  3KX0 X;  1IFQ A;  4EEU A;  1OJG A;  3S1Y A;  2P08 A;  1GSV A;  4FOF A;  5AQ7 A;  3ZVT A;  3PHY A;  1D06 A;  3CPT B;  4HY8 A;  4NEE D;  2ACG A;  4KZA A;  4NG2 A;  3WWX A;  4GCZ A;  4DN0 A;  2QHK A;  5F6A A;  1CEG A;  2ZQ8 A;  2WKQ A;  3OPL A;  4N1X A;  5HW3 A;  4X53 A;  2ZQD A;  3IF6 C;  1D1J A;  5CED A;  3LO7 A;  3JYI A;  4ID4 A;  3LI8 A;  3MZD A;  1TS0 A;  1F2K A;  2VV8 A;  2OWH A;  4KQR A;  4OPR A;  4H6J A;  3UB9 A;  4GD6 A;  3IHB A;  5HFO A;  2X71 A;  3SH8 A;  5DF8 A;  1ZKJ A;  1T1B A;  1K55 A;  4YFM A;  3A0S A;  1EW0 A;  4X1L A;  5FQK A;  3IT9 A;  4DKI A;  1NXY A;  4S2O A;  2V8C A;  3G32 A;  3R7W B;  1YMX A;  3TE8 A;  2B95 A;  1K6S A;  1TD5 A;  3S7O A;  2HDU A;  4OH0 A;  2QZ6 A;  1AXB A;  3KSF A;  3SZT A;  1BZA A;  3NDG A;  3LEZ A;  3GVB A;  3CHW P;  5DKK A;  4CJN A;  3BM6 A;  2Y2L A;  4XUZ A;  3Q7V B;  3EQU A;  5DJT A;  4BLM A;  4DRT A;  1YPR A;  3SH9 A;  2W1T A;  4HBT A;  4G3W A;  1NZU A;  5CEC A;  2JKF A;  3NUL A;  3GV9 A;  1XKZ A;  4WL9 A;  1KVL A;  2PR5 A;  3OZH A;  3WRZ A;  3MMH A;  4NXG A;  4JBF A;  2Q9M A;  3FZC A;  5EFW A;  3T1X A;  4JKT A;  3KSH A;  1GA9 A;  1HZO A;  5EM0 A;  5FQQ A;  1LHY A;  3BRM A;  3TSG A;  4A5R A;  3EGX C;  3EGD C;  2O9B A;  1S4S A;  2GJ3 A;  5L8M A;  3CI6 A;  1LT0 A;  4IBR A;  5M1A A;  1L3L A;  1BSG A;  5FA7 A;  5FQI A;  1Y28 A;  4XT2 B;  1K55 C;  4KEN B;  3DTI A;  1MKM A;  4IJG A;  2IWB A;  1I2W A;  3D9Y A;  3F1P B;  2E8J A;  2WKR A;  2ZD8 A;  1KE3 A;  3WS0 A;  3MFD A;  3KSI A;  1VET A;  4MMN A;  2XD5 A;  2OLU A;  1K4F A;  3B33 A;  1K6R A;  2OOL A;  3OPP A;  3UB6 A;  1P97 A;  3ZQ5 A;  1LI9 A;  4JF5 A;  3E98 A;  3EQV A;  2J9O A;  4GDB A;  2HDS A;  5EPH A;  1Z6F A;  5L09 A;  2ZC6 B;  1IYS A;  3RTY A;  2WGI A;  4G3V A;  3E4O A;  2V0U A;  1ESU A;  4GN2 A;  4OPY A;  4FTX A;  4HIA A;  1CK3 A;  4E3O A;  2XR0 A;  2YKH A;  1TS7 A;  3NOP C;  3ZVW A;  5GHY A;  4H6J B;  5DF9 A;  2XSS A;  3UY6 A;  3U4L P;  3ZYT A;  2XD1 A;  3A3J A;  2Z2M B;  5CX7 A;  3HLB A;  4GNU A;  3VMA A;  3QNC A;  1CI8 A;  2KX6 A;  2WGW A;  4LV2 A;  3HLW A;  3V50 A;  3O87 A;  2Y2O A;  1K0K A;  3EEH A;  3ZGA B;  4X68 A;  1XP4 A;  2ZMF A;  1GA0 A;  3MS6 A;  1YLW A;  3N7W A;  3O88 A;  4Y3I A;  4KQQ A;  5EE8 A;  4WYY A;  4G3K A;  2XQZ A;  4D2O A;  4Y0T A;  2J3T C;  1ODV A;  2W1T B;  4PHT A;  3VP1 A;  1PWG A;  2VGL M;  2O9A A;  1G68 A;  2P9V A;  3IH8 A;  4F94 A;  3UE3 A;  4R4R A;  2IA2 A;  1AWI A;  3NJA A;  2PBY A;  4GW9 A;  4WM9 A;  2JN7 A;  4ZTK A;  2B02 A;  5EVI D;  2ZQA A;  1PZO A;  4MN5 A;  2Y2N A;  4FH2 A;  3E2K A;  1T19 A;  4S2N A;  4JGQ A;  5FEG A;  1BLH A;  1FCN A;  4K0X A;  2XEP A;  2J9P A;  3M2K A;  2OAQ 1;  4NXF A;  5EVE A;  2HGV A;  2PU4 A;  3G30 A;  1XJ4 A;  2Q0O A;  3UNW A;  4OQ0 A;  5KSC A;  1G6A A;  3ZG5 A;  3FYZ A;  4EES A;  2VGL S;  4XUX A;  1S1Z A;  4P6Z M;  3QP2 A;  2W3E A;  3CLO A;  1VET B;  1FSW A;  5A8B A;  1YLT A;  5E2F A;  1PWD A;  1YLY A;  2XFT A;  3FPW A;  2W3H A;  4WF0 A;  5EEC A;  4D60 A;  3TOI A;  1NJ4 A;  1K56 D;  4RQ9 A;  5HPF A;  1BLP A;  4HJ6 A;  1WA9 A;  4K0W A;  3L7H A;  4FD8 A;  4MBF A;  1FIK A;  1OTB A;  2L0W A;  5CGS A;  1TVF A;  2Y2I A;  2Y91 A;  4PKY G;  2PR6 A;  2Y4A A;  3NDE A;  1CQA A;  4BD0 A;  3W4O A;  4ZAM A;  4HOI A;  1ERM A;  3CZD A;  4S2N C;  3HBR A;  1W63 Q;  2VLG A;  4P6Z S;  1GHP A;  4Y0U A;  2VA0 A;  1SDN A;  1ALQ A;  1SCW A;  3GSG A;  2A3U A;  1F5M A;  3SS5 A;  4ARZ A;  1KGE A;  1W5D A;  2WGW B;  2A24 A;  4E3I A;  4Q0H A;  5DVA A;  3LCE A;  2EFU A;  1E3U D;  1FQG A;  5DTT A;  3BY8 A;  4B9O A;  3UDX A;  1I2S A;  2W0N A;  3VE3 A;  2VK3 A;  3MXQ A;  1PYY A;  1DP9 A;  1H8Y A;  1XX2 A;  2JKR I;  3I7J A;  4WLA A;  5DFY A;  2L4R A;  1ONG A;  3UO9 A;  4LV3 A;  3W2Z A;  1Q2P A;  4KZ6 A;  2D02 A; 
#chains in the Genus database with same CATH homology
 3WS4 A;  4BEN A;  4U3T A;  3PBO A;  1PZP A;  4P85 A;  2P9V B;  1N4O A;  1Y54 A;  4N9K A;  1DJA A;  4RYE A;  3ZNY A;  5A91 A;  5CGX A;  1CEG A;  2ZQ8 A;  3A3D A;  3OPL A;  4N1X A;  5HW3 A;  2XFS A;  1L0D A;  2J7V A;  3DWK A;  3IXB A;  4X53 A;  2ZQD A;  5TFQ A;  3IF6 C;  5TGF A;  3SS4 A;  1ONH A;  1IEL A;  3ZG8 B;  5CED A;  1YLJ A;  5KSH A;  3G2Z A;  3LO7 A;  1I5Q A;  3JYI A;  1XA1 A;  4ID4 A;  3UE0 A;  4M3K A;  3MZD A;  3OCN A;  5E2G A;  2R9X A;  3VP4 A;  4R1G A;  4GKU A;  4KQR A;  4OPR A;  5FAO A;  5EUA A;  1MWT A;  1JTG A;  1FCO A;  3HUM A;  4GD6 A;  1PI4 A;  3IHB A;  3BLM A;  2X71 A;  5HFO A;  3SH8 A;  5JYP A;  4OVD A;  5DF8 A;  1XXM A;  3A3E A;  5DTS A;  5CTN A;  1ZKJ A;  1LI0 A;  2X01 A;  4PPR A;  1K55 A;  2H10 A;  2WKE A;  4QD4 A;  4WMC A;  1H8Z A;  4YFM A;  1SHV A;  2BLS A;  5HAP A;  4BL3 A;  4MBH A;  1MPL A;  3BEC A;  3BFF A;  1XGI A;  3IF5 A;  3IT9 A;  4RVA A;  5FQK A;  4DKI A;  1K4E A;  1NXY A;  4S2O A;  4WEJ A;  3ZHH A;  2VGJ A;  2G2W A;  3VFH A;  1YLP A;  4R3J A;  5GLC A;  1CI9 A;  4GZB A;  1SKF A;  3G32 A;  3AGF A;  4UA6 A;  1YMX A;  3BEB A;  3VP0 A;  5J8X A;  3IF6 A;  1K6S A;  1GHI A;  2V20 A;  2HDU A;  4R4S A;  4OH0 A;  4JXV A;  2Y2J A;  1RCJ A;  5FI2 A;  3ZDJ A;  2QZ6 A;  1AXB A;  3BFD A;  3CJM A;  1BLS A;  1BZA A;  4OKP A;  3NDG A;  3LEZ A;  3GVB A;  3VOY A;  1ERQ A;  3W4Q A;  1PWC A;  1IEM A;  2DNS A;  4IVI A;  3N8S A;  4CJN A;  5KZH A;  1IYQ A;  1ES5 A;  3BM6 A;  2Y2L A;  4ZJ3 A;  4XUZ A;  3Q7V B;  3EQU A;  5A92 A;  2WAE A;  2Y2M A;  2ZM8 A;  5EVI A;  4BLM A;  4DRT A;  2HDQ A;  4PM7 A;  4B88 A;  3SH9 A;  3O3V A;  4QHC A;  5FAT A;  3N4I A;  4ZBE A;  1IKG A;  2H0T A;  4HBT A;  1NZU A;  5CEC A;  4RX2 A;  3S22 A;  3N8R A;  3HVF A;  4S2J A;  3O86 A;  1PW1 A;  1K38 A;  1NYM A;  4DF6 A;  1MWU A;  4S2M A;  3NBL A;  1OME A;  3GV9 A;  3UN7 A;  4OOM A;  1MWS A;  5HAI A;  1XKZ A;  3MKE A;  1RP5 A;  3HLD A;  4OQH A;  4NK3 A;  4QY6 A;  1YT4 A;  1KVL A;  4R0Q A;  1IYP A;  3OZH A;  4WMC D;  3WRZ A;  2FFY A;  4RX3 A;  1ZC2 A;  2HP5 A;  3M6B A;  4JBF A;  4OLG A;  2Q9M A;  1FOF A;  1BLC A;  3ITB A;  1BT5 A;  2ZC5 B;  3FZC A;  4YIN A;  4EWF A;  3HLF A;  3P98 A;  1C3B A;  1GHM A;  2ZMA A;  5HAR A;  4JKT A;  3MZF A;  1GA9 A;  4X6T A;  1YM1 A;  2DCF A;  2ZQ9 A;  1HZO A;  5FQQ A;  2P74 A;  4F94 A;  1LHY A;  2IWD A;  4P6B A;  3BRM A;  1IKI A;  2WKH A;  3A3F A;  4IVK A;  3TSG A;  4A5R A;  4B4Z A;  4JPM A;  2Z2L B;  2Y2H A;  4OP5 A;  2RL3 A;  5E43 A;  4KG2 A;  2ZC7 A;  3ZNT A;  1LL9 A;  1ESI A;  2C5W B;  4IBR A;  5M1A A;  1TDG A;  4MLL A;  4WEL A;  2HDR A;  1VM1 A;  3C7V A;  3G34 A;  4RA7 A;  1BSG A;  2EX8 A;  5FA7 A;  5FQI A;  1K55 C;  4KEN B;  3ZG0 A;  4DE1 A;  4Y7P A;  2IWB A;  4EQI A;  4DE0 A;  4E3M A;  4E6X A;  1DY6 A;  1I2W A;  5CEB A;  1MKI A;  2ZD8 A;  4S2K A;  5CHM A;  3V5M A;  1KE3 A;  3CMZ A;  1DJC A;  1K56 A;  5AQA A;  5HX9 A;  1WE4 A;  3WS0 A;  4JF4 A;  2EXA A;  3ITA A;  3MFD A;  4KZ5 A;  4P87 A;  2XD5 A;  1W8Q A;  2OLU A;  4PMA A;  3HLC A;  1ERO A;  3PBQ A;  1W79 A;  1K4F A;  4JXS A;  4BQM A;  2H5S A;  1K6R A;  2OLV A;  3LY3 A;  4KQO A;  4N1H A;  3OPP A;  1KGF A;  5HAQ A;  1LI9 A;  4S2P A;  4JF5 A;  4WZ5 A;  4GOG A;  5F82 A;  3EQV A;  2J9O A;  1O7E A;  4GDB A;  2HDS A;  2XGN A;  4WBG A;  5FAS A;  3G2Y A;  3IWQ A;  3PAE A;  3G35 A;  3IXH A;  5FQ9 A;  3V3R A;  5CRF A;  1Z6F A;  4S2I A;  5EPH A;  1K54 A;  1YMS A;  2J8Y A;  2ZC6 B;  3PAG A;  1IYS A;  5EVI C;  4EBP A;  1MBL A;  1FR6 A;  1LL5 A;  2A49 A;  4LV1 A;  2XDM A;  1XPB A;  4KG6 A;  4XXR A;  3W8K A;  2WGI A;  3IH9 A;  4GB7 A;  1YQS A;  2XF3 A;  3BFG A;  2ZJ9 A;  2EX6 A;  2WZZ A;  1JVJ A;  3FV7 A;  3RXX A;  3IWI A;  1RGY A;  4MEZ A;  4DDS A;  2HP6 A;  3B3X A;  1ESU A;  3FWL A;  3UPO A;  1K57 A;  5BOH A;  2XLN A;  1L2S A;  2QMI A;  4GN2 A;  1JWV A;  4H8R A;  4PM8 A;  3SH7 A;  4OPY A;  4O7D A;  3C4P A;  3IHA A;  1CK3 A;  1LLB A;  4E3O A;  2C6W B;  4N9L A;  2XR0 A;  3GRJ A;  4JF6 A;  3OPH A;  1ES2 A;  5F1G A;  3ZVW A;  1KVM A;  5GHY A;  4UAA A;  1K25 A;  4CPK A;  5DF9 A;  3QHY A;  4FCF A;  3UY6 A;  4EBN A;  2XD1 A;  2H0Y A;  2Z2M B;  2ZM0 A;  3A3J A;  4MBK A;  5E2H A;  5G18 A;  4QJG A;  1E3U A;  3HLB A;  3AGD A;  5A90 A;  2ZQ7 A;  4WEK A;  4LCM A;  4WZ4 A;  2QPN A;  2HP9 A;  1HVB A;  3V39 A;  3N6I A;  4GNU A;  2RCX A;  3OC2 A;  1ES3 A;  4BD1 A;  4JXG A;  3VMA A;  5GL9 A;  4GDN A;  5GLB A;  1FSY A;  3IWO A;  3QNC A;  5CTM A;  1CI8 A;  2WGW A;  4LV2 A;  2WZX A;  3HLW A;  1NRF A;  3V50 A;  3O87 A;  1VQQ A;  3MBZ A;  3VSK A;  2Y2O A;  3IF6 B;  2V1Z A;  4X68 A;  1XP4 A;  3ZGA B;  3HLG A;  1GA0 A;  4KZ3 A;  4FH4 A;  3VOZ A;  3A3I A;  4LCL A;  3G31 A;  1L0G A;  1YLW A;  1S6R A;  5CHJ A;  3M2J A;  3N7W A;  4X69 A;  4OOL A;  1J9M A;  1QMF A;  5L2F A;  1FCM A;  1W7F A;  3GMW A;  4OQI A;  4C75 A;  3O88 A;  5DF7 A;  4DDY A;  1IYO A;  2Y2Q A;  1L0F A;  1DJB A;  4KQQ A;  3Q7Z A;  1EI5 A;  1EWZ A;  2WKI A;  1JTD A;  1SDE A;  3HL9 A;  5EE8 A;  5EVI B;  4E3K A;  1BTL A;  2ZC4 B;  3IXD A;  4WYY A;  2XQZ A;  5GLD A;  5FSR A;  4R3B A;  4D2O A;  4Y0T A;  3IXG A;  4WZ5 C;  4DE2 A;  5D3O A;  3VP1 A;  1PWG A;  3PBR A;  1KDS A;  1G68 A;  2I72 A;  2P9V A;  3C5A A;  3IH8 A;  3IQA A;  3OCL A;  4S2L A;  3UE3 A;  1GCE A;  4R4R A;  3OPR A;  3D4F A;  4IBX A;  5DTK A;  1K54 C;  4HEF A;  5GHZ A;  3NCK A;  4OOY A;  2OV5 A;  2Y2P A;  4MNR A;  3DTM A;  4KZB A;  3UDF A;  4E3J A;  2PBY A;  3GTC A;  4WM9 A;  4ZTK A;  4OLD A;  3MXS A;  5EVI D;  2ZQA A;  1PZO A;  3PBN A;  1JWP A;  5FDH A;  1RGZ A;  4EBL A;  2Y2N A;  1NZO A;  3BYD A;  2XH9 A;  1MWR A;  3ISG A;  1XGJ A;  4FH2 A;  2UWX A;  5FAP A;  5HL1 A;  2WAD A;  3E2K A;  4IED A;  4ZJ1 A;  1K57 C;  1YLZ A;  4S2N A;  4BJP A;  1BLH A;  5FI6 A;  4DXB A;  1FCN A;  1MY8 A;  3P09 A;  4K0X A;  3VP3 A;  3UPP A;  5JYO A;  2WGV A;  2JCH A;  2XEP A;  1NY0 A;  2FFF B;  3PBT A;  5FQM A;  2J9P A;  3FKW A;  3M2K A;  3V3S A;  3WS2 A;  3ZFZ A;  4Q8I A;  4OON A;  1WYB A;  2V2F F;  4Y0O A;  2PU4 A;  3SOI A;  1PI5 A;  3G30 A;  1N9B A;  2ZQC A;  3CG5 A;  4K91 A;  2ZM2 A;  3UDI A;  2VGK A;  3UNW A;  3ZG7 B;  5AQ9 A;  2WUQ A;  4KZ4 A;  4OQ0 A;  5KSC A;  2EFX A;  3DWZ A;  3GQZ A;  4KG5 A;  4KZ8 A;  1M40 A;  1L0E A;  1G6A A;  3ZG5 A;  3FYZ A;  4R23 A;  2B5R A;  2Q9N A;  5F83 A;  4OQG A;  4E6W A;  5F1F A;  5CGW A;  3PBS A;  3TG9 A;  4XUX A;  1ZG6 A;  4B4X A;  3HUN A;  5CXW A;  3C4O A;  4QY5 A;  3Q82 A;  4FSF A;  1KE4 A;  1FSW A;  2EX2 A;  1YLT A;  2HPB A;  5E2F A;  1PWD A;  2R9W A;  3Q7V A;  1YLY A;  2XFT A;  4LEN A;  3BLS A;  3FKV A;  5U47 A;  3ZG9 B;  5EEC A;  3BFC A;  5TR7 A;  2JBF A;  3WRT A;  4C3Q A;  1PW8 A;  3TOI A;  4E3L A;  1NJ4 A;  1K56 D;  3HRE A;  5EOO A;  1ES4 A;  3MXR A;  5FI7 A;  1QME A;  1BUE A;  4Z9Q A;  3MKF A;  1JWZ A;  1E25 A;  1BLP A;  1TEM A;  1KGG A;  5GLA A;  2JC7 A;  4JXW A;  4K0W A;  5A93 A;  1MXO A;  2XK1 A;  1W8Y A;  5EVL A;  4FD8 A;  4MBF A;  4UA9 A;  3RJU A;  3WS5 A;  2EX9 A;  2EXB A;  4ZJ2 A;  4GD8 A;  1O07 A;  4OP8 A;  2CC1 A;  5CER A;  2GDN A;  3DW0 A;  2ZC3 B;  3VSL A;  5EOE A;  5CGS A;  1E4D A;  3NIA A;  1TVF A;  2Y2I A;  2Y91 A;  3HLE A;  4UHU A;  2IWC A;  3VP2 A;  3RXW A;  2Y4A A;  2WYX A;  2E8I A;  4NET A;  1NYY A;  3NDE A;  1U60 A;  3Q07 A;  4U0T A;  4BD0 A;  1BUL A;  3W4O A;  5E2E A;  4C6Y A;  4ZAM A;  2BG1 A;  1ERM A;  3BFE A;  3GR2 A;  3MZE A;  3CZD A;  2Y59 A;  3M6H A;  3NC8 A;  4S2N C;  4E3N A;  4EUZ A;  1PIO A;  3HBR A;  3PTE A;  5M19 A;  3QNB A;  2ZLY A;  1GHP A;  4Y0U A;  4KZ9 A;  3UE1 A;  5FAQ A;  1HD8 A;  4N92 A;  4PM9 A;  1SDN A;  1ALQ A;  1SCW A;  2X02 A;  2Y2K A;  3GSG A;  4QB8 A;  4X55 A;  2A3U A;  1Q2Q A;  2Y2G A;  2DRW A;  3HUO A;  4HBU A;  2PU2 A;  3E2L A;  3SS5 A;  4DXC A;  5CHU A;  2Y55 A;  1S0W A;  3Q81 A;  3LY4 A;  2G2U A;  1KGE A;  1W5D A;  2WGW B;  1TDL A;  4BL2 A;  3ZCZ A;  4L0L A;  1FR1 A;  3VFF A;  3W4P A;  4E3I A;  5KMW A;  4UA7 A;  4EV4 A;  3G4P A;  4OPQ A;  3NY4 A;  2WAF A;  3UPN A;  1KDW A;  2JE5 A;  3LCE A;  5DVA A;  5FQJ A;  2EFU A;  1E3U D;  1M6K A;  1FQG A;  1XA7 A;  3NI9 A;  5DTT A;  3C7U A;  3SS3 A;  4KZ7 A;  4PM5 A;  3S1Y A;  4ZDX A;  1H5X A;  4QU3 A;  3Q1F A;  3N8L A;  5AQ7 A;  3UDX A;  1I2S A;  3WS1 A;  3ZVT A;  4DE3 A;  1CEF A;  4JLF A;  2WK0 A;  1ZG4 A;  3AGE A;  1PYY A;  5IHV A;  3S4X A;  5M18 A;  1KE0 A;  1H8Y A;  1WYC A;  4KZA A;  4OPZ A;  5I94 A;  1XX2 A;  4PM6 A;  3WWX A;  4P0M A;  4U0X A;  3I7J A;  1HTZ A;  3UO9 A;  2OSU A;  1ONG A;  4HES A;  4LV3 A;  5GHX A;  4LV0 A;  5AQB A;  1Q2P A;  4KZ6 A;  4X56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...