4WYYA

Crystal structure of p. aeruginosa ampc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
360
structure length
360
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title 4,5-Disubstituted 6-Aryloxy-1,3-dihydrobenzo[c][1,2]oxaboroles Are Broad-Spectrum Serine beta-Lactamase Inhibitors.
pubmed doi rcsb
source organism Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
molecule tags Hydrolase/hydrolase inhibitor
total genus 122
structure length 360
sequence length 360
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4wyyA00
1Z6FA 1K25A 4JLFA 4CPKA 5CHJA 3HLEA 1I5QA 1BLPA 1KGEA 1ONHA 3G34A 3N6IA 4FSFA 3C4PA 3O88A 4KZ3A 4OOLA 3A3JA 3G2YA 4Q8IA 5KMWA 2WAFA 5EVIA 1EWZA 1L0FA 2ZC3B 3WRZA 4PM6A 5FSRA 3HUNA 3OPLA 4B4ZA 3FV7A 3HUMA 4OQIA 3NBLA 4PM7A 1S0WA 1W5DA 3AGEA 1JWVA 3G2ZA 2J9OA 4N92A 4QU3A 4JPMA 4S2NC 3UPOA 4R23A 5CEBA 1G6AA 2HPBA 3CG5A 2WYXA 3W8KA 5EOEA 1KDWA 1ZC2A 5GL9A 1HD8A 1KE3A 3A3EA 2P9VA 2VGKA 4EQIA 3OZHA 5E2FA 2Q9NA 1K4FA 3GRJA 4R4SA 4ZJ2A 3TOIA 4LV1A 3VP1A 4OQGA 4OH0A 4ZTKA 3BM6A 1IYOA 1CI8A 1MPLA 2XQZA 1NZOA 1W7FA 4C75A 2HDQA 5E2HA 5CERA 4EBNA 4IBRA 1ERQA 3I7JA 3UN7A 3A3DA 3IXHA 3N8SA 4IVKA 3N8RA 4DDSA 5GLAA 3PAGA 3IHAA 3P98A 4RX2A 1L0DA 2OSUA 1N9BA 4ZBEA 4OQHA 4OOMA 4N1XA 1HZOA 2XDMA 5AQ7A 1CEFA 3P09A 4P0MA 3DW0A 3A3IA 3PAEA 1BTLA 4RVAA 1L2SA 1M6KA 3V3RA 4U0XA 2Z2MB 1DJBA 4KG2A 1ALQA 2Y2OA 3W4PA 3ZHHA 2EXAA 4P85A 1NJ4A 5EVIC 3NI9A 3G30A 5CHUA 3HLDA 5U47A 4Y0OA 1LLBA 5FQIA 4O7DA 1BLHA 1M40A 2PU2A 1WYCA 4ZDXA 5DF7A 5FQ9A 2IWBA 4FCFA 2JE5A 5AQBA 5HARA 3IXGA 4OPYA 4R3JA 1EROA 5CECA 3GR2A 4KQRA 3BFFA 3CZDA 4JF5A 3OPHA 3PBSA 1QMEA 2XD1A 1GHPA 3AGDA 3O87A 4PPRA 4NETA 5CGXA 2EFUA 1E3UA 2V1ZA 2XD5A 4MEZA 4UAAA 5F1GA 5FI7A 3ZFZA 4FH4A 1XGJA 5EVLA 4BQMA 1XGIA 4P87A 5KSHA 3O3VA 5L2FA 3MKEA 3C5AA 1EI5A 1LL5A 4GDNA 4JBFA 3ITBA 2WGVA 4N1HA 4DRTA 2ZQAA 5FQQA 2V2FF 5TGFA 3BLSA 1K38A 5EUAA 1W8YA 3W4QA 4A5RA 4RA7A 2XF3A 5JYPA 1TDLA 5GHZA 4IVIA 5EPHA 1TEMA 2Y2IA 2HDSA 1PZPA 4MBFA 2EFXA 4WEJA 4OKPA 3Q7VA 1ESUA 5HL1A 5D3OA 2XGNA 4S2OA 3UPPA 2OLUA 4E3LA 2H10A 4LCLA 3NCKA 3ZCZA 4KQOA 3B3XA 5FAOA 4P6BA 4HEFA 4HBTA 5AQAA 4GN2A 5CGSA 4D2OA 2Y2LA 5FASA 1MWSA 4S2MA 2ZC4B 5DF8A 1YLWA 3PBNA 4WELA 2Y2PA 4K0WA 1XPBA 3EQUA 4RX3A 3VFHA 5CTMA 4XXRA 2B5RA 3GV9A 3HLBA 4HBUA 2ZQ9A 1BULA 4WBGA 3PBOA 4JXWA 1N4OA 2WGWA 1J9MA 3Q81A 5FI2A 3RJUA 1K54A 3LCEA 4YFMA 1YM1A 4KZAA 1O7EA 2WZXA 2XEPA 2IWDA 1ES3A 1S6RA 4BD0A 2HP6A 2EXBA 3VOZA 3SOIA 3VSLA 3DWZA 5I94A 3IF6A 1ES2A 3HLCA 2XLNA 3BYDA 1IYPA 1XA1A 5FDHA 1U60A 5DF9A 4X68A 3MZFA 5G18A 1FCOA 2ZM0A 4KENB 2J8YA 4R3BA 5A90A 2BG1A 1JTGA 3SS4A 4JKTA 2WAEA 4OP8A 1MY8A 4KG5A 1DY6A 2EX6A 4WEKA 1XP4A 2EX8A 4GB7A 3NIAA 3VMAA 1RGZA 4RYEA 3UDFA 3Q07A 4UA6A 1MWUA 2HDRA 3VOYA 5FQKA 2FFYA 2P74A 4S2IA 5IHVA 2ZJ9A 4KZ4A 2WUQA 3GSGA 1PW8A 5AQ9A 2H5SA 2C6WB 5FA7A 3MZEA 1GHIA 4N9LA 1BLSA 1K57A 1JWPA 4E3IA 4HESA 2Y2QA 1XA7A 3SH8A 3A3FA 1ZG6A 3BFCA 1Q2QA 3IH9A 3IWIA 1KGFA 2WZZA 3BRMA 3C7VA 4BJPA 1CEGA 3BLMA 5EVID 4BL3A 1DJAA 3WS5A 1GA0A 4OQ0A 3LY3A 4LV2A 5FATA 3TSGA 5F82A 4EUZA 3OCLA 3PBTA 3OCNA 3VP3A 3C4OA 4MBHA 3Q1FA 3NY4A 3G32A 5DTKA 1IEMA 2RCXA 4JXSA 1YLYA 2I72A 3UE0A 2CC1A 1GCEA 4PM9A 1GA9A 4OLDA 4QY5A 3UPNA 5EVIB 2ZC7A 5CHMA 3D4FA 2EX2A 5GLDA 1K56A 3M6HA 4EV4A 1JVJA 4DE2A 3MZDA 5EE8A 4QD4A 3LY4A 2JC7A 5GHYA 2GDNA 3EQVA 5GLBA 4H8RA 1Q2PA 4PMAA 4KQQA 5HX9A 3HLFA 4BD1A 4DE1A 2Y2NA 1BZAA 1G68A 1YLZA 2ZQ8A 1JTDA 2DCFA 1L0EA 3G4PA 1PWDA 5GHXA 1PWCA 3HREA 1ES5A 5KZHA 1LL9A 3HL9A 4E3KA 3BFDA 2P9VB 2UWXA 1HVBA 3ZNYA 4UA9A 4UHUA 1PYYA 4Z9QA 3ZG8B 1YQSA 4OOYA 2QMIA 1AXBA 2EX9A 4OVDA 3MFDA 3O86A 4JXVA 4C3QA 3M6BA 2DNSA 1K57C 3VSKA 2A3UA 3VP2A 4ID4A 4QY6A 2OV5A 4WM9A 2Y2GA 5E43A 3HBRA 1BT5A 1SKFA 5HAIA 1GHMA 2DRWA 3ZG5A 3FZCA 3C7UA 3FKVA 2XFTA 1KVLA 4IBXA 4MBKA 4LCMA 4MNRA 2ZM8A 3UDXA 5A91A 3PBQA 3PTEA 4PM8A 4GD8A 2R9WA 3IHBA 1YLTA 4OONA 1NYMA 1MXOA 3V3SA 4S2JA 4DXCA 5EOOA 3BFEA 1PI5A 5FI6A 2BLSA 1K55A 3BECA 1ZKJA 4JF4A 1K6SA 1SDEA 3QNBA 4ZAMA 1WYBA 3IWOA 3N4IA 1PZOA 4DE3A 4DKIA 2X02A 3AGFA 4S2LA 5HW3A 1KGGA 4QJGA 3VFFA 2X71A 4X56A 1E3UD 3HUOA 1NRFA 3N8LA 5DVAA 4S2NA 3OPRA 2XFSA 4U0TA 2Y2HA 3OC2A 2Z2LB 3IWQA 1WE4A 2V20A 2VGJA 3W4OA 3ISGA 3NDGA 1VQQA 3NC8A 3V39A 1SHVA 4F94A 1BUEA 1VM1A 1XXMA 1SCWA 1I2SA 1KDSA 1W79A 1PWGA 1LI0A 4Y0TA 3ZNTA 2G2WA 1BSGA 5BOHA 3S22A 4EWFA 2XH9A 1ERMA 1XKZA 3DTMA 1LHYA 4M3KA 4OPQA 3UE1A 3M2KA 5HFOA 1NZUA 3V50A 3WWXA 2HP9A 1IKIA 4N9KA 2HDUA 3FYZA 4QHCA 1PI4A 3OPPA 5F1FA 3ZVTA 1FCMA 4FH2A 4E6XA 3ZGAB 1KE4A 1PIOA 4KZ7A 1IELA 2ZMAA 5DTSA 3ZG0A 4KZBA 4WMCD 1K6RA 5M1AA 2X01A 1FOFA 2PU4A 2Y2JA 1E4DA 2WKHA 3RXWA 5KSCA 3Q7VB 3SH7A 4B4XA 5CXWA 2XR0A 1YMXA 3WRTA 3CJMA 3RXXA 3ZG7B 3ITAA 2J7VA 3VP0A 1YMSA 3PBRA 1I2WA 2IWCA 4CJNA 1K55C 4OP5A 4YINA 2RL3A 1TVFA 2WKEA 1YT4A 5FAPA 1RP5A 1ZG4A 1HTZA 1H8YA 4DF6A 2Q9MA 1PW1A 1JWZA 4NK3A 2C5WB 2ZLYA 1KE0A 4X6TA 3GMWA 4UA7A 1MKIA 4WZ5A 4LV0A 4S2KA 2WGWB 4OPZA 4Y0UA 3UNWA 3LEZA 1MBLA 3IXDA 1MWRA 3FWLA 1CK3A 4LV3A 4FD8A 1K54C 4PM5A 3UDIA 2JCHA 5A93A 5CEDA 1FSYA 4BL2A 1O07A 3LO7A 5TR7A 4K91A 3MBZA 1TDGA 5HAQA 2E8IA 4GD6A 3IF6B 2H0YA 1C3BA 4IEDA 3SS3A 3IF6C 3ZDJA 4X69A 3GQZA 4GZBA 1ONGA 5FQJA 5JYOA 1FCNA 1BLCA 4JXGA 5J8XA 1K4EA 5FQMA 3IXBA 4R4RA 2J9PA 2R9XA 4ZJ1A 1KVMA 1ES4A 4KZ5A 4R1GA 1FQGA 3HLWA 4KZ9A 3IF5A 4K0XA 2ZQDA 4C6YA 2QZ6A 1RGYA 4GDBA 2ZQ7A 4LENA 4OPRA 3GTCA 4EBPA 1FR6A 1IKGA 1OMEA 2PBYA 1RCJA 1Y54A 4GOGA 2WKIA 3Q82A 4X53A 4E6WA 1ESIA 1LI9A 5E2EA 5CGWA 2JBFA 4X55A 1NYYA 4KG6A 4QB8A 5GLCA 3Q7ZA 4WZ4A 1FR1A 4S2PA 4DE0A 4L0LA 5M19A 1IYSA 2Y4AA 5TFQA 4GKUA 3BFGA 4Y7PA 3WS0A 3IT9A 3NDEA 2ZD8A 2Y55A 2ZC5B 2G2UA 3MXRA 4DXBA 4KZ8A 5M18A 3GVBA 5F83A 3MXSA 3E2KA 4GNUA 4WZ5C 3M2JA 1K56D 1QMFA 3G35A 3QNCA 3S4XA 3UY6A 5A92A 2H0TA 1YLPA 4BLMA 3G31A 3N7WA 1W8QA 4EBLA 2WK0A 5CRFA 3BEBA 1NXYA 4E3NA 1SDNA 5FAQA 2ZM2A 3V5MA 4U3TA 5DTTA 3WS1A 2ZC6B 2WGIA 3ZG9B 3CMZA 3VP4A 1FSWA 4XUZA 2OLVA 3DWKA 3UE3A 1H5XA 1YLJA 4E3JA 4R0QA 3IH8A 3IQAA 4JF6A 4E3OA 3MKFA 2XK1A 3HLGA 3SS5A 3TG9A 3UO9A 3JYIA 5E2GA 4ZJ3A 1H8ZA 4B88A 2Y91A 4MLLA 1XX2A 3HVFA 3E2LA 4KZ6A 1DJCA 2HP5A 2QPNA 3WS4A 5HAPA 1IYQA 1MWTA 2FFFB 4WMCA 4BENA 1NY0A 2ZQCA 5EECA 3WS2A 4OLGA 3SH9A 2WADA 4WYYA 1L0GA 5CTNA 2Y2MA 1E25A 3FKWA 3ZVWA 3S1YA 2A49A 2Y2KA 4XUXA 4DDYA 2Y59A 3QHYA 4E3MA 1CI9A
chains in the Genus database with same CATH superfamily
1I5QA 4Q8IA 4PM6A 3OPLA 4GHIB 1S0WA 4EEUA 1JWVA 4N92A 1T1BA 3CUEA 2WYXA 2M1CA 5GL9A 1KE3A 3MQ0A 2VGKA 4LRYC 4ZJ2A 1K4FA 3GRJA 4LV1A 4OQGA 4ZTKA 3T4SA 4EUVA 2PAVP 1MPLA 2XQZA 1NZOA 1W7FA 4C75A 4EBNA 3N8SA 4X1LA 3N8RA 3T4JA 2J80A 1VHMA 3LR3A 5IT5A 4GS9B 2VGLS 5AQ7A 4Y13A 3UMDA 5DKKA 2Y2OA 3W4PA 3ICYA 3C30A 4ZDXA 2L4RA 5FQ9A 3CI6A 5HARA 5CECA 1EROA 1ZTUA 3E98A 3PBSA 1QMEA 3KYEA 3AGDA 3CITA 1P9RA 5CGXA 2EFUA 3KSGA 3ZFZA 1XGIA 3K3CA 5FDSA 1PNEA 2NUPC 4YNRA 1EI5A 4B93A 2WGVA 3KSHA 5FQQA 1W8YA 4RA7A 3E0YA 3F1PB 4EXOA 5JYPA 2A24A 1TEMA 2EFXA 1ESUA 5D3OA 3LR0A 2J3TD 3ZCZA 4KQOA 3QP8A 2PT7A 5AVFA 4GN2A 1TS6A 4HOIA 4NXGA 5HSQA 2O0YA 3EQUA 4RX3A 5CTMA 4XXRA 1BULA 1WA9A 2A2LA 1J9MA 3EGXC 3LCEA 1TS8A 1O7EA 1N9OA 1ES3A 2XLNA 1XA1A 2Q0OA 2IA2A 5G18A 1FCOA 1F5MA 2Y79A 2WAEA 4UQIS 4WEKA 1XP4A 3MMHA 3F1NB 3QP4A 1XFNA 3VMAA 4NG2A 2VK3A 3NHQA 3LI8A 5FQKA 2ZJ9A 3EEHA 5HPIA 5AJGA 2C6WB 1EW0A 1V9ZA 5MC7A 1XA7A 3IH9A 4DJ3A 2WZZA 3BRMA 1CEGA 3BLMA 4BL3A 1DJAA 5EVEA 3U2AA 5FATA 1V9YA 1FIKA 2QYBA 3VP3A 3Q1FA 1GCEA 2WKQA 3VV4A 3D4FA 4HP9A 1GSXA 2G7UA 3EQVA 2ZQ8A 1T18A 2DCFA 2VKSA 1AWIA 2P9VB 4UA9A 2V0WA 1AXBA 2EX9A 3PR6A 5J3WA 2DMWA 3O86A 4JXVA 5HD5A 2DNSA 3VSKA 4MN6A 4IUKA 2OV5A 4WM9A 3TE8A 1SKFA 5FEFA 1GHMA 3FZCA 3C8CA 4G3VA 5L09A 3GDIA 1KVLA 4IBXA 4MBKA 2VJWA 2ZM8A 4LPZA 3PTEA 4PM8A 1BYWA 1NYMA 1MXOA 2P04A 4S2JA 5FI6A 2KLIA 3DTKA 2BLSA 1ZKJA 1VETB 1K6SA 2W3GA 3VE4A 3E4QA 4DKIA 1PZOA 2W3FA 3AGFA 3DAVA 2M7VA 2K31A 4GHIA 1KGGA 4QJGA 2MJ6A 1NRFA 3N8LA 4RQ9A 4U0TA 1DRMA 2Y2HA 2Z2LB 1J3WA 1WE4A 2V20A 2VGJA 1VQQA 3V39A 1SHVA 1BUEA 1NLZA 1XXMA 1KDSA 2XH9A 3DTMA 3UE1A 4OPQA 4KUOA 3M2KA 5HFOA 4BBVA 2EWVA 1LSWA 3PXPA 5F1FA 2P7JA 5EM0A 5DTSA 1K6RA 5M1AA 4GS9A 4FTXA 3SH7A 5CXWA 2XR0A 1YMXA 3CJMA 3RXXA 3ZG7B 3NOPC 5HL6A 4Q0HA 3VP0A 1YMSA 2IWCA 2WKPA 4I38A 1TVFA 5FAPA 1ZG4A 2V1BA 2BTFP 2R78A 4OPZA 3LEZA 1MWRA 3G6OA 4FD8A 5DJUA 3UDIA 2JCHA 5TR7A 3LIDA 4K91A 3MBZA 1TDGA 2E8IA 3IF6B 2H0YA 4IEDA 2OOLA 4GZBA 1GSWA 3QP6A 1ES4A 2HGVA 4KZ5A 3IF5A 3F1PA 4GDBA 3CHWP 4LENA 4EBPA 4HNBA 1Y54A 2NUTC 4E6WA 3MXQA 5FL3A 2JBFA 3SZTA 4DE0A 4PKYA 1MC0A 3IX8A 3IT9A 3S7OA 2ZC5B 4L9FA 4KZ8A 3MXSA 1K56D 2O9AA 2H0TA 2WK0A 5LBRA 3CAXA 5J4EA 3WS1A 2WGIA 3ZG9B 2Z6CA 2OAP1 1FSWA 3DWKA 1H5XA 1YLJA 3F1NA 2PR6A 4E3OA 3MKFA 3TG9A 3SS5A 3UO9A 3JYIA 3U4LP 4ZJ3A 4WUJA 3HVFA 4KZ6A 2QPNA 1OT9A 1OJGA 2XA7S 4WMCA 4WYYA 3QP1A 3JVUA 1E25A 1UGUA 2J3TC 3ZVWA 1D06A 3L9KA 3QHYA 4O7DA 1Z6FA 2W27A 4JLFA 3VE3A 1LSXA 1KGEA 1BLPA 3G34A 4FSFA 4WL9A 3T1XA 2ZL1B 2WAFA 1L0FA 4LFUA 4I3IA 4OQIA 3HUMA 4G3KA 4PM7A 1F2KA 1W5DA 3AGEA 4S2NC 3UPOA 4R23A 5CEBA 1G6AA 2K7SA 1HD8A 1XJ6A 3A3EA 4PAUA 2P9VA 5EV0A 5E2FA 3TJZC 3LIAA 1CF0A 1CI8A 2HDQA 3A3DA 1TF1A 5GLAA 3IHAA 2PDRA 4RX2A 4ZBEA 4MMNA 4OOMA 2OWHA 3P09A 4P0MA 4Z1WA 3A3IA 1BTLA 2XROA 1M6KA 3V3RA 4KG2A 3ZHHA 1VETA 2EXAA 1NJ4A 3NI9A 3G30A 5CHUA 1LLBA 1M40A 5DF7A 2OAQ1 2QJ7A 1H3QA 4PKYG 2HJEA 4FCFA 2B95A 3IXGA 4R3JA 3GR2A 4KQRA 4JF5A 2XD1A 1GHPA 4PPRA 2JKRM 2XD5A 5FI7A 3FPVA 5EVLA 5L2FA 5HWWA 3O3VA 4N1HA 2PHYA 3LGOA 5HZHA 2ZQAA 1T1CA 4A5RA 4BMWA 1TDLA 5GHZA 3T50A 2Y2IA 2O99A 1N9LA 1TS0A 3D9YA 3OBFA 5HL1A 3K3DA 5HPFA 2OLUA 4R38A 3NCKA 2W0NA 4L9GA 3T12B 1MWSA 4S2MA 2ZC4B 4WELA 3DTEA 3GV9A 2ZQ9A 4JXWA 2W3DA 1YM1A 4KZAA 1OTAA 1S1ZA 2HP6A 2EXBA 3VOZA 3IF6A 1ES2A 2VV7A 4HH3A 1U60A 5DF9A 5TBMB 2BG1A 1JTGA 4JKTA 4OP8A 4O01A 4KG5A 4KQDA 4Q0IA 4GB7A 4RYEA 3Q07A 1MWUA 2HDRA 3B42A 3DTIA 4S2IA 1XJ4A 2VZWA 3MFXA 5FA7A 5G4ZA 5C5KA 1BLSA 1K57A 4EU0A 1JWPA 2Y2QA 3SH8A 2EA9A 3BFCA 2E8JA 1TS7A 5EVID 1YSPA 3WS5A 1GA0A 1W63Q 4OQ0A 3TSGA 4LV2A 4EUZA 1D7EA 3PBTA 3G32A 4GCZA 5DTKA 2RCXA 5I5LA 4CLCE 5EVIB 3B47A 4EV4A 2EX2A 5GLDA 1K56A 1JVJA 4DE2A 5EE8A 3BY9A 3LY4A 3T1SA 2JC7A 4H8RA 5HX9A 4BD1A 3HLFA 2Y2NA 1JTDA 3C2WA 3TRCA 3CUEC 3G4PA 5GHXA 3HREA 5KZHA 3UB7A 4P6ZM 2YKFA 4UHUA 1YAXA 1YQSA 2JN7A 4OVDA 3R4KA 3M6BA 1K57C 4LRXC 1OTEA 3HJKA 3IS2A 3P01A 1BT5A 5HAIA 3BWLA 3C7UA 3FKVA 4LCMA 2GZAA 2KDKA 3D3OA 4OONA 1NLYA 3OOVA 1PI5A 1K55A 2ZL1A 4X1MA 3N4IA 5HW3A 5J7EA 4X56A 3HUOA 5DVAA 1OTIA 3OPRA 4JGOA 5DJTA 3OC2A 4YOFA 3IWQA 2W1RA 3W4OA 3IX4A 4EETB 1W79A 2PD8A 2G2WA 5L07A 2V9AA 3LICA 5FEGA 1ERMA 1OT6A 4M3KA 2UV0E 2Y8HA 2B18A 3WWXA 1IKIA 5DFYA 1F98A 3FYZA 4K08A 1A0KA 3ZVTA 2ZOIA 3ZGAB 4KZBA 4WMCD 5EM1A 1Y4OA 3UB9A 3RXWA 3WRTA 3ITAA 3IX3A 2PRFA 3LFVA 1K55C 2RL3A 1H8YA 2Q9MA 4NK3A 1KE0A 2VGLM 4X6TA 3IXDA 3T1RA 3LIFA 4ZRRA 4BL2A 1O07A 3F1OB 4I3JA 5HWTA 1S66L 3SS3A 4Q0JA 3KSFA 4X69A 5JYOA 1BLCA 1G5UA 4HQAA 2R9XA 4R1GA 4KZ9A 4Y2FA 2ZQDA 5DKLA 4EW7A 1RGYA 5HD3A 2JKFA 1OMEA 1RCJA 4GOGA 3Q82A 1LI9A 5EFWA 5GLCA 4WZ4A 5M19A 4L0LA 1IYSA 3C38A 2Y4AA 5TFQA 5IS1A 3UB6A 3VOLA 2Y55A 5M18A 3GVBA 5F83A 4AFIA 3M2JA 3QNCA 1QMFA 5HDDA 5DFXA 4BLMA 3G31A 5CRFA 1NXYA 3V5MA 4U3TA 5DTTA 3L7HA 5TBMA 3UE3A 3IH8A 3IQAA 4CLCD 3A0SA 3MSHA 1N9NA 5E2GA 1H0MA 1JNUA 2Y91A 4B88A 3ZYTA 4F3LB 4MLLA 4MN5A 3E2LA 1DJCA 3WS4A 1IYQA 4DJ2A 2BASA 4CLCB 1G6OA 1NY0A 5EECA 3WS2A 2WADA 4GJ4A 1G28A 3KO6A 1CQAA 2GJ3A 3A0VA 2Y59A 1IOUA 4E3MA 5EOEA 4CPKA 4O8GA 3HLEA 3N6IA 1ONHA 3A3JA 3G2YA 5EVIA 1EWZA 3T4OA 1ACFA 3HUNA 4B4ZA 2HZ5A 3NBLA 4Y5FA 3CG5A 3W8KA 1KDWA 4EQIA 3ULFA 1UWPX 3OZHA 3TOIA 4OH0A 4NXEA 3BM6A 2GNXA 1IYOA 5A8BA 4HJ6A 4X25A 1OTBA 4IBRA 3UN7A 3IXHA 4IVKA 3SW1A 4DDSA 4H6JB 3NOUC 3P98A 1L0DA 2OSUA 1N9BA 4ETZA 4OQHA 2XDMA 4MDZA 3DW0A 3PAEA 4RVAA 1DP9A 1L2SA 4U0XA 3E4PA 1ALQA 4IHQA 5EVIC 4R70A 3HLDA 1BLHA 1WYCA 2V8CA 3HJIA 2IWBA 5AQBA 3UE6A 2YKHA 3BFFA 4JGPA 3O87A 1YKDA 2V1ZA 5F1GA 4BWIA 4FH4A 1XGJA 4BQMA 1YPRA 2QJ5A 3C5AA 4GDNA 4JBFA 4QWOA 3H7WB 5TGFA 1K38A 5EUAA 4HH2A 3H82B 4NXBA 2HDSA 4Y17A 3CWFA 4S2OA 3UPPA 4HP4A 4LCLA 2KX6A 5FAOA 4FUWA 4HBTA 2KOIA 4D2OA 4MCWA 4L9EA 5DF8A 5TJJA 2L1MA 2J3WA 4K0WA 1XPBA 3IS2B 3VFHA 2B5RA 4WBGA 1N4OA 1ZHHB 3Q81A 5FI2A 1K54A 4HI4A 4YFMA 3MJQA 2WZXA 3W2ZA 1S67L 4BD0A 3F1OA 3DWZA 3UMEA 3T4KA 3HLCA 3BYDA 1IYPA 4ESPA 4KENB 2J8YA 4R3BA 5A90A 3BW6A 1MY8A 3FPWA 1DY6A 3NIAA 1RGZA 4UA6A 3VOYA 3KX0X 2P74A 4KZ4A 5HDCA 2WUQA 5AQ9A 1GHIA 4N9LA 4E3IA 3NOTC 3A3FA 4D60A 3LI9A 1F9IA 3OCLA 3LR4A 3C4OA 4MBHA 1IEMA 3PHYA 1YLYA 2I72A 2CC1A 4QY5A 2ZC7A 5CHMA 3M6HA 3MR0A 4QD4A 3CPTB 4YWZA 4KQQA 3S7QA 1BZAA 1G68A 1YLZA 4EERA 1PRQA 3IBJA 1PWDA 1KOUA 1PWCA 1ES5A 4F3LA 1LL9A 3HL9A 4E3KA 1P0ZA 1HVBA 3ZNYA 1PYYA 4Z9QA 4CLCA 4NEED 2VV6A 4C3QA 2L0WA 3V67A 3VP2A 4ID4A 4QY6A 3MS6A 3RFBA 3HBRA 3ZG5A 1OPXA 1LL8A 3BQ8A 2XFTA 4MNRA 5A91A 3PBQA 3B33A 2R9WA 1FILA 1Y28A 1YLTA 4DXCA 5EOOA 3BFEA 3UB8A 3BECA 4JF4A 1WYBA 3IWOA 4DE3A 2X02A 4R3AA 4S2LA 3VFFA 1E3UD 3ISGA 2ZOHA 4F94A 2LB5A 4GLQA 1VM1A 1SCWA 1I2SA 1PWGA 1BSGA 3BJNA 3S22A 4CLCC 1LHYA 2ACGA 4HIAA 4I39A 3V50A 4N9KA 2HP9A 3A0RA 4QHCA 4NXFA 4H6JA 4LRZE 4E6XA 4KZ7A 3HCYA 1IELA 3KYZA 2PU4A 2Y2JA 1E4DA 3Q7VB 2V8FA 3PBRA 1I2WA 4CJNA 4WN5A 2GX5A 4ARZB 2WKEA 1RP5A 1HTZA 4DF6A 3H9WA 2ZLYA 1MZUA 3NJAA 4II7A 1X0OA 2P08A 4WZ5A 1MKIA 4UA7A 4LV0A 1YSQA 4S2KA 2WGWB 3UNWA 4Y0UA 3BQAA 2HJ9C 5CEDA 3LO7A 4I5SA 4GD6A 1C3BA 5L10A 3IF6C 3K2NA 3ZDJA 1ONGA 3MF0A 5FQJA 1FCNA 1W63M 2VLGA 4JXGA 3LYXA 5J8XA 3IXBA 3H7WA 2J9PA 3TW8A 4ZJ1A 1KVMA 1K0KA 2H28A 3S7PA 1SKOB 2M7UA 3H82A 5F6AA 2ZQ7A 4OPRA 3GTCA 1FR6A 5F69A 1GSVA 1S4RA 2WKIA 1ESIA 5E2EA 4X55A 1NYYA 4KG6A 4QB8A 1FR1A 4HHDA 2HF6A 4GKUA 3BFGA 4Y7PA 3WS0A 2QHKA 2G2UA 3NULA 2JKTM 3E2KA 4GNUA 4WZ5C 1XJ3A 2VA0A 2VV8A 4EBLA 1W8QA 4Y3IA 3BEBA 4E3NA 2ZC6B 2FH5A 3VP4A 4XUZA 2OLVA 2ZMFA 1CJFA 4E3JA 1VEUB 4R0QA 4G3WA 3KSIA 2XK1A 3HLGA 4B9OA 1XJ2A 1XX2A 2HP5A 2INWA 4BENA 2ZQCA 4OLGA 4WF0A 3SH9A 1L0GA 2Y2MA 2O9CA 2A49A 2XRNA 2QWSA 1K25A 5CHJA 4WLAA 4KZ3A 3C4PA 3O88A 4OOLA 5KMWA 2ZC3B 3WRZA 5FSRA 1LSVA 3FV7A 2WKRA 2JHEA 3CPTA 1STZA 3G2ZA 2J9OA 4QU3A 4JPMA 2HPBA 1PFLA 1OJ5A 1ZC2A 3OLOA 2PYRA 5CX7A 4FOFA 4KUKA 2Q9NA 4R4SA 3VP1A 2EWWA 3EGDC 5E2HA 5CERA 1DP8A 1ERQA 3I7JA 2V1AA 1ODVA 3PAGA 5K5BA 4N1XA 1HZOA 1CEFA 3E4OA 2VEAA 2ZMVA 4XT2B 2Z2MB 1DJBA 4QPRA 3T1QB 4P85A 5U47A 4Y0OA 5FQIA 2PU2A 2OWJA 4HJ3A 4CQHA 2JE5A 3S7NA 4OPYA 3CZDA 2ZBBA 3OPHA 3QP5A 2V0UA 3T4TA 4NETA 1E3UA 2W1TB 4MEZA 4UAAA 2W3EA 4P87A 5KSHA 3MKEA 1LL5A 3ITBA 4DRTA 2V2FF 3BLSA 3W4QA 2XF3A 4IVIA 5EPHA 1PZPA 4MBFA 4WEJA 4OKPA 3O5YA 3Q7VA 2XGNA 4E3LA 3LEQA 2H10A 3B3XA 4MN7A 3LUQA 4P6BA 4HEFA 4ARZA 5AQAA 2I9VA 5CGSA 1S4SA 4NKPA 2Y2LA 5FASA 1YLWA 3PBNA 2Y2PA 4UQIM 3BY8A 3QP2A 3EEAA 3HLBA 4HBUA 3PBOA 2WGWA 3RJUA 2XEPA 2IWDA 2O9BA 1S6RA 2Z6DA 3SOIA 3VSLA 5I94A 2FZ0A 5FDHA 1DP6A 3ZQ5A 4X68A 3MZFA 2ZM0A 3R7WB 1T1AA 3SS4A 1SKOA 2EX6A 1NRJA 2JKRI 2EX8A 4IJGA 3UDFA 2PBDP 4GW9A 2FFYA 5IHVA 3GSGA 1PW8A 3EWKA 2H5SA 3MZEA 1SZVA 4HESA 4ETXA 1ZG6A 1Q2QA 3MQOA 3IWIA 1KGFA 2PD7A 3C7VA 4BJPA 4E04A 3LY3A 5F82A 3OCNA 3KYQA 3JPUA 3FC7A 2PR5A 3NY4A 4IUHA 4JXSA 3UE0A 4PM9A 1GA9A 4OLDA 3UPNA 3MZDA 5G4YA 5GHYA 2GDNA 2AVXA 5GLBA 4DN0A 3RH8B 1Q2PA 4PMAA 1VEUA 4DE1A 1L0EA 2K2NA 5F68A 5AVEA 4EESA 3LIBA 4HY8A 3BFDA 2UWXA 3ZG8B 4OOYA 2QMIA 3MFDA 5HDSA 2A3UA 3D72A 2Y2GA 5E43A 2DRWA 1NWZA 3UDXA 2B02A 1OTDA 4GD8A 3IHBA 3V3SA 4LGWA 1SDEA 3QNBA 4ZAMA 1IFQA 3EOIA 2X71A 1XFQA 4S2NA 3NECA 2XFSA 3NDGA 3NC8A 1D1JA 4JGQA 3P7NA 1LI0A 4Y0TA 3ZNTA 3PYPA 5BOHA 2HV1A 4EWFA 1XKZA 3T4QA 1NZUA 5F5YA 3LIEA 3IBRA 2HDUA 2W3HA 1PI4A 3OPPA 1FCMA 4FH2A 1L3LA 4ME4A 1KE4A 1PIOA 2ZMAA 2QKPA 3ZG0A 2X01A 2A24B 1FOFA 2WKHA 5KSCA 4B4XA 5HWVA 4XT2A 2CMNA 2J7VA 4OP5A 4YINA 2JKTI 1YT4A 2D01A 2PYPA 1PW1A 1JWZA 2C5WB 4BBUA 2XSSA 3GMWA 2D02A 1MBLA 3FWLA 1CK3A 4LV3A 1K54C 4PM5A 4EEPA 5A93A 1FSYA 3FG8A 2W1TA 4BBTA 5HAQA 3GECA 5KIZA 1VB6A 3GQZA 2LB9A 1K4EA 5FQMA 4R4RA 5L8MA 1P97A 4I3AA 3UB5P 1FQGA 3HLWA 3CLOA 4K0XA 1TD5A 4C6YA 1Z09A 2QZ6A 4LLOB 1IKGA 2PBYA 4X53A 1T19A 5CGWA 4DMZA 3Q7ZA 4S2PA 4HJ4A 3JVVA 4R6LA 1LT0A 3NDEA 2ZD8A 3MXRA 4DXBA 3UY6A 3G35A 3S4XA 5A92A 4JGRA 1YLPA 2JKGA 4O0PA 3N7WA 1MKMA 1SDNA 2XA7M 5FAQA 2ZM2A 4P6ZS 4PHTA 3CMZA 1S1YA 4EQ1A 3DBAA 4UEYA 3R7WA 1H8MA 4JF6A 3T4LA 2VX8A 1H8ZA 1HLUP 5HAPA 1MWTA 3MQQA 2FFFB 5IU1A 3LR5A 1P9WA 1UWNX 5CTNA 3RTYA 4Y15A 3FKWA 3S1YA 2Y2KA 4XUXA 4DDYA 4M4XA 1CI9A
chains in the Genus database with same CATH topology
1Z6FA 1K25A 4JLFA 4CPKA 5CHJA 3HLEA 1I5QA 1BLPA 1KGEA 1ONHA 3G34A 3N6IA 4FSFA 3C4PA 3O88A 4KZ3A 4OOLA 3A3JA 3G2YA 4Q8IA 5KMWA 2WAFA 5EVIA 1EWZA 1L0FA 2ZC3B 3WRZA 4PM6A 5FSRA 3HUNA 3OPLA 4B4ZA 3FV7A 3HUMA 4OQIA 3NBLA 4PM7A 1S0WA 1W5DA 3AGEA 1JWVA 3G2ZA 2J9OA 4N92A 4QU3A 4JPMA 4S2NC 3UPOA 4R23A 5CEBA 1G6AA 2HPBA 3CG5A 2WYXA 3W8KA 5EOEA 1KDWA 1ZC2A 5GL9A 1HD8A 1KE3A 3A3EA 2P9VA 2VGKA 4EQIA 3OZHA 5E2FA 2Q9NA 1K4FA 3GRJA 4R4SA 4ZJ2A 3TOIA 4LV1A 3VP1A 4OQGA 4OH0A 4ZTKA 3BM6A 1IYOA 1CI8A 1MPLA 2XQZA 1NZOA 1W7FA 4C75A 2HDQA 5E2HA 5CERA 4EBNA 4IBRA 1ERQA 3I7JA 3UN7A 3A3DA 3IXHA 3N8SA 4IVKA 3N8RA 4DDSA 5GLAA 3PAGA 3IHAA 3P98A 4RX2A 1L0DA 2OSUA 1N9BA 4ZBEA 4OQHA 4OOMA 4N1XA 1HZOA 2XDMA 5AQ7A 1CEFA 3P09A 4P0MA 3DW0A 3A3IA 3PAEA 1BTLA 4RVAA 1L2SA 1M6KA 3V3RA 4U0XA 2Z2MB 1DJBA 4KG2A 1ALQA 2Y2OA 3W4PA 3ZHHA 2EXAA 4P85A 1NJ4A 5EVIC 3NI9A 3G30A 5CHUA 3HLDA 5U47A 4Y0OA 1LLBA 5FQIA 4O7DA 1BLHA 1M40A 2PU2A 1WYCA 4ZDXA 5DF7A 5FQ9A 2IWBA 4FCFA 2JE5A 5AQBA 5HARA 3IXGA 4OPYA 4R3JA 1EROA 5CECA 3GR2A 4KQRA 3BFFA 3CZDA 4JF5A 3OPHA 3PBSA 1QMEA 2XD1A 1GHPA 3AGDA 3O87A 4PPRA 4NETA 5CGXA 2EFUA 1E3UA 2V1ZA 2XD5A 4MEZA 4UAAA 5F1GA 5FI7A 3ZFZA 4FH4A 1XGJA 5EVLA 4BQMA 1XGIA 4P87A 5KSHA 3O3VA 5L2FA 3MKEA 3C5AA 1EI5A 1LL5A 4GDNA 4JBFA 3ITBA 2WGVA 4N1HA 4DRTA 2ZQAA 5FQQA 2V2FF 5TGFA 3BLSA 1K38A 5EUAA 1W8YA 3W4QA 4A5RA 4RA7A 2XF3A 5JYPA 1TDLA 5GHZA 4IVIA 5EPHA 1TEMA 2Y2IA 2HDSA 1PZPA 4MBFA 2EFXA 4WEJA 4OKPA 3Q7VA 1ESUA 5HL1A 5D3OA 2XGNA 4S2OA 3UPPA 2OLUA 4E3LA 2H10A 4LCLA 3NCKA 3ZCZA 4KQOA 3B3XA 5FAOA 4P6BA 4HEFA 4HBTA 5AQAA 4GN2A 5CGSA 4D2OA 2Y2LA 5FASA 1MWSA 4S2MA 2ZC4B 5DF8A 1YLWA 3PBNA 4WELA 2Y2PA 4K0WA 1XPBA 3EQUA 4RX3A 3VFHA 5CTMA 4XXRA 2B5RA 3GV9A 3HLBA 4HBUA 2ZQ9A 1BULA 4WBGA 3PBOA 4JXWA 1N4OA 2WGWA 1J9MA 3Q81A 5FI2A 3RJUA 1K54A 3LCEA 4YFMA 1YM1A 4KZAA 1O7EA 2WZXA 2XEPA 2IWDA 1ES3A 1S6RA 4BD0A 2HP6A 2EXBA 3VOZA 3SOIA 3VSLA 3DWZA 5I94A 3IF6A 1ES2A 3HLCA 2XLNA 3BYDA 1IYPA 1XA1A 5FDHA 1U60A 5DF9A 4X68A 3MZFA 5G18A 1FCOA 2ZM0A 4KENB 2J8YA 4R3BA 5A90A 2BG1A 1JTGA 3SS4A 4JKTA 2WAEA 4OP8A 1MY8A 4KG5A 1DY6A 2EX6A 4WEKA 1XP4A 2EX8A 4GB7A 3NIAA 3VMAA 1RGZA 4RYEA 3UDFA 3Q07A 4UA6A 1MWUA 2HDRA 3VOYA 5FQKA 2FFYA 2P74A 4S2IA 5IHVA 2ZJ9A 4KZ4A 2WUQA 3GSGA 1PW8A 5AQ9A 2H5SA 2C6WB 5FA7A 3MZEA 1GHIA 4N9LA 1BLSA 1K57A 1JWPA 4E3IA 4HESA 2Y2QA 1XA7A 3SH8A 3A3FA 1ZG6A 3BFCA 1Q2QA 3IH9A 3IWIA 1KGFA 2WZZA 3BRMA 3C7VA 4BJPA 1CEGA 3BLMA 5EVID 4BL3A 1DJAA 3WS5A 1GA0A 4OQ0A 3LY3A 4LV2A 5FATA 3TSGA 5F82A 4EUZA 3OCLA 3PBTA 3OCNA 3VP3A 3C4OA 4MBHA 3Q1FA 3NY4A 3G32A 5DTKA 1IEMA 2RCXA 4JXSA 1YLYA 2I72A 3UE0A 2CC1A 1GCEA 4PM9A 1GA9A 4OLDA 4QY5A 3UPNA 5EVIB 2ZC7A 5CHMA 3D4FA 2EX2A 5GLDA 1K56A 3M6HA 4EV4A 1JVJA 4DE2A 3MZDA 5EE8A 4QD4A 3LY4A 2JC7A 5GHYA 2GDNA 3EQVA 5GLBA 4H8RA 1Q2PA 4PMAA 4KQQA 5HX9A 3HLFA 4BD1A 4DE1A 2Y2NA 1BZAA 1G68A 1YLZA 2ZQ8A 1JTDA 2DCFA 1L0EA 3G4PA 1PWDA 5GHXA 1PWCA 3HREA 1ES5A 5KZHA 1LL9A 3HL9A 4E3KA 3BFDA 2P9VB 2UWXA 1HVBA 3ZNYA 4UA9A 4UHUA 1PYYA 4Z9QA 3ZG8B 1YQSA 4OOYA 2QMIA 1AXBA 2EX9A 4OVDA 3MFDA 3O86A 4JXVA 4C3QA 3M6BA 2DNSA 1K57C 3VSKA 2A3UA 3VP2A 4ID4A 4QY6A 2OV5A 4WM9A 2Y2GA 5E43A 3HBRA 1BT5A 1SKFA 5HAIA 1GHMA 2DRWA 3ZG5A 3FZCA 3C7UA 3FKVA 2XFTA 1KVLA 4IBXA 4MBKA 4LCMA 4MNRA 2ZM8A 3UDXA 5A91A 3PBQA 3PTEA 4PM8A 4GD8A 2R9WA 3IHBA 1YLTA 4OONA 1NYMA 1MXOA 3V3SA 4S2JA 4DXCA 5EOOA 3BFEA 1PI5A 5FI6A 2BLSA 1K55A 3BECA 1ZKJA 4JF4A 1K6SA 1SDEA 3QNBA 4ZAMA 1WYBA 3IWOA 3N4IA 1PZOA 4DE3A 4DKIA 2X02A 3AGFA 4S2LA 5HW3A 1KGGA 4QJGA 3VFFA 2X71A 4X56A 1E3UD 3HUOA 1NRFA 3N8LA 5DVAA 4S2NA 3OPRA 2XFSA 4U0TA 2Y2HA 3OC2A 2Z2LB 3IWQA 1WE4A 2V20A 2VGJA 3W4OA 3ISGA 3NDGA 1VQQA 3NC8A 3V39A 1SHVA 4F94A 1BUEA 1VM1A 1XXMA 1SCWA 1I2SA 1KDSA 1W79A 1PWGA 1LI0A 4Y0TA 3ZNTA 2G2WA 1BSGA 5BOHA 3S22A 4EWFA 2XH9A 1ERMA 1XKZA 3DTMA 1LHYA 4M3KA 4OPQA 3UE1A 3M2KA 5HFOA 1NZUA 3V50A 3WWXA 2HP9A 1IKIA 4N9KA 2HDUA 3FYZA 4QHCA 1PI4A 3OPPA 5F1FA 3ZVTA 1FCMA 4FH2A 4E6XA 3ZGAB 1KE4A 1PIOA 4KZ7A 1IELA 2ZMAA 5DTSA 3ZG0A 4KZBA 4WMCD 1K6RA 5M1AA 2X01A 1FOFA 2PU4A 2Y2JA 1E4DA 2WKHA 3RXWA 5KSCA 3Q7VB 3SH7A 4B4XA 5CXWA 2XR0A 1YMXA 3WRTA 3CJMA 3RXXA 3ZG7B 3ITAA 2J7VA 3VP0A 1YMSA 3PBRA 1I2WA 2IWCA 4CJNA 1K55C 4OP5A 4YINA 2RL3A 1TVFA 2WKEA 1YT4A 5FAPA 1RP5A 1ZG4A 1HTZA 1H8YA 4DF6A 2Q9MA 1PW1A 1JWZA 4NK3A 2C5WB 2ZLYA 1KE0A 4X6TA 3GMWA 4UA7A 1MKIA 4WZ5A 4LV0A 4S2KA 2WGWB 4OPZA 4Y0UA 3UNWA 3LEZA 1MBLA 3IXDA 1MWRA 3FWLA 1CK3A 4LV3A 4FD8A 1K54C 4PM5A 3UDIA 2JCHA 5A93A 5CEDA 1FSYA 4BL2A 1O07A 3LO7A 5TR7A 4K91A 3MBZA 1TDGA 5HAQA 2E8IA 4GD6A 3IF6B 2H0YA 1C3BA 4IEDA 3SS3A 3IF6C 3ZDJA 4X69A 3GQZA 4GZBA 1ONGA 5FQJA 5JYOA 1FCNA 1BLCA 4JXGA 5J8XA 1K4EA 5FQMA 3IXBA 4R4RA 2J9PA 2R9XA 4ZJ1A 1KVMA 1ES4A 4KZ5A 4R1GA 1FQGA 3HLWA 4KZ9A 3IF5A 4K0XA 2ZQDA 4C6YA 2QZ6A 1RGYA 4GDBA 2ZQ7A 4LENA 4OPRA 3GTCA 4EBPA 1FR6A 1IKGA 1OMEA 2PBYA 1RCJA 1Y54A 4GOGA 2WKIA 3Q82A 4X53A 4E6WA 1ESIA 1LI9A 5E2EA 5CGWA 2JBFA 4X55A 1NYYA 4KG6A 4QB8A 5GLCA 3Q7ZA 4WZ4A 1FR1A 4S2PA 4DE0A 4L0LA 5M19A 1IYSA 2Y4AA 5TFQA 4GKUA 3BFGA 4Y7PA 3WS0A 3IT9A 3NDEA 2ZD8A 2Y55A 2ZC5B 2G2UA 3MXRA 4DXBA 4KZ8A 5M18A 3GVBA 5F83A 3MXSA 3E2KA 4GNUA 4WZ5C 3M2JA 1K56D 1QMFA 3G35A 3QNCA 3S4XA 3UY6A 5A92A 2H0TA 1YLPA 4BLMA 3G31A 3N7WA 1W8QA 4EBLA 2WK0A 5CRFA 3BEBA 1NXYA 4E3NA 1SDNA 5FAQA 2ZM2A 3V5MA 4U3TA 5DTTA 3WS1A 2ZC6B 2WGIA 3ZG9B 3CMZA 3VP4A 1FSWA 4XUZA 2OLVA 3DWKA 3UE3A 1H5XA 1YLJA 4E3JA 4R0QA 3IH8A 3IQAA 4JF6A 4E3OA 3MKFA 2XK1A 3HLGA 3SS5A 3TG9A 3UO9A 3JYIA 5E2GA 4ZJ3A 1H8ZA 4B88A 2Y91A 4MLLA 1XX2A 3HVFA 3E2LA 4KZ6A 1DJCA 2HP5A 2QPNA 3WS4A 5HAPA 1IYQA 1MWTA 2FFFB 4WMCA 4BENA 1NY0A 2ZQCA 5EECA 3WS2A 4OLGA 3SH9A 2WADA 4WYYA 1L0GA 5CTNA 2Y2MA 1E25A 3FKWA 3ZVWA 3S1YA 2A49A 2Y2KA 4XUXA 4DDYA 2Y59A 3QHYA 4E3MA 1CI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z6F A;  1K25 A;  4JLF A;  4CPK A;  5CHJ A;  3HLE A;  1I5Q A;  1BLP A;  1KGE A;  1ONH A;  3G34 A;  3N6I A;  4FSF A;  3C4P A;  3O88 A;  4KZ3 A;  4OOL A;  3A3J A;  3G2Y A;  4Q8I A;  5KMW A;  2WAF A;  5EVI A;  1EWZ A;  1L0F A;  2ZC3 B;  3WRZ A;  4PM6 A;  5FSR A;  3HUN A;  3OPL A;  4B4Z A;  3FV7 A;  3HUM A;  4OQI A;  3NBL A;  4PM7 A;  1S0W A;  1W5D A;  3AGE A;  1JWV A;  3G2Z A;  2J9O A;  4N92 A;  4QU3 A;  4JPM A;  4S2N C;  3UPO A;  4R23 A;  5CEB A;  1G6A A;  2HPB A;  3CG5 A;  2WYX A;  3W8K A;  5EOE A;  1KDW A;  1ZC2 A;  5GL9 A;  1HD8 A;  1KE3 A;  3A3E A;  2P9V A;  2VGK A;  4EQI A;  3OZH A;  5E2F A;  2Q9N A;  1K4F A;  3GRJ A;  4R4S A;  4ZJ2 A;  3TOI A;  4LV1 A;  3VP1 A;  4OQG A;  4OH0 A;  4ZTK A;  3BM6 A;  1IYO A;  1CI8 A;  1MPL A;  2XQZ A;  1NZO A;  1W7F A;  4C75 A;  2HDQ A;  5E2H A;  5CER A;  4EBN A;  4IBR A;  1ERQ A;  3I7J A;  3UN7 A;  3A3D A;  3IXH A;  3N8S A;  4IVK A;  3N8R A;  4DDS A;  5GLA A;  3PAG A;  3IHA A;  3P98 A;  4RX2 A;  1L0D A;  2OSU A;  1N9B A;  4ZBE A;  4OQH A;  4OOM A;  4N1X A;  1HZO A;  2XDM A;  5AQ7 A;  1CEF A;  3P09 A;  4P0M A;  3DW0 A;  3A3I A;  3PAE A;  1BTL A;  4RVA A;  1L2S A;  1M6K A;  3V3R A;  4U0X A;  2Z2M B;  1DJB A;  4KG2 A;  1ALQ A;  2Y2O A;  3W4P A;  3ZHH A;  2EXA A;  4P85 A;  1NJ4 A;  5EVI C;  3NI9 A;  3G30 A;  5CHU A;  3HLD A;  5U47 A;  4Y0O A;  1LLB A;  5FQI A;  4O7D A;  1BLH A;  1M40 A;  2PU2 A;  1WYC A;  4ZDX A;  5DF7 A;  5FQ9 A;  2IWB A;  4FCF A;  2JE5 A;  5AQB A;  5HAR A;  3IXG A;  4OPY A;  4R3J A;  1ERO A;  5CEC A;  3GR2 A;  4KQR A;  3BFF A;  3CZD A;  4JF5 A;  3OPH A;  3PBS A;  1QME A;  2XD1 A;  1GHP A;  3AGD A;  3O87 A;  4PPR A;  4NET A;  5CGX A;  2EFU A;  1E3U A;  2V1Z A;  2XD5 A;  4MEZ A;  4UAA A;  5F1G A;  5FI7 A;  3ZFZ A;  4FH4 A;  1XGJ A;  5EVL A;  4BQM A;  1XGI A;  4P87 A;  5KSH A;  3O3V A;  5L2F A;  3MKE A;  3C5A A;  1EI5 A;  1LL5 A;  4GDN A;  4JBF A;  3ITB A;  2WGV A;  4N1H A;  4DRT A;  2ZQA A;  5FQQ A;  2V2F F;  5TGF A;  3BLS A;  1K38 A;  5EUA A;  1W8Y A;  3W4Q A;  4A5R A;  4RA7 A;  2XF3 A;  5JYP A;  1TDL A;  5GHZ A;  4IVI A;  5EPH A;  1TEM A;  2Y2I A;  2HDS A;  1PZP A;  4MBF A;  2EFX A;  4WEJ A;  4OKP A;  3Q7V A;  1ESU A;  5HL1 A;  5D3O A;  2XGN A;  4S2O A;  3UPP A;  2OLU A;  4E3L A;  2H10 A;  4LCL A;  3NCK A;  3ZCZ A;  4KQO A;  3B3X A;  5FAO A;  4P6B A;  4HEF A;  4HBT A;  5AQA A;  4GN2 A;  5CGS A;  4D2O A;  2Y2L A;  5FAS A;  1MWS A;  4S2M A;  2ZC4 B;  5DF8 A;  1YLW A;  3PBN A;  4WEL A;  2Y2P A;  4K0W A;  1XPB A;  3EQU A;  4RX3 A;  3VFH A;  5CTM A;  4XXR A;  2B5R A;  3GV9 A;  3HLB A;  4HBU A;  2ZQ9 A;  1BUL A;  4WBG A;  3PBO A;  4JXW A;  1N4O A;  2WGW A;  1J9M A;  3Q81 A;  5FI2 A;  3RJU A;  1K54 A;  3LCE A;  4YFM A;  1YM1 A;  4KZA A;  1O7E A;  2WZX A;  2XEP A;  2IWD A;  1ES3 A;  1S6R A;  4BD0 A;  2HP6 A;  2EXB A;  3VOZ A;  3SOI A;  3VSL A;  3DWZ A;  5I94 A;  3IF6 A;  1ES2 A;  3HLC A;  2XLN A;  3BYD A;  1IYP A;  1XA1 A;  5FDH A;  1U60 A;  5DF9 A;  4X68 A;  3MZF A;  5G18 A;  1FCO A;  2ZM0 A;  4KEN B;  2J8Y A;  4R3B A;  5A90 A;  2BG1 A;  1JTG A;  3SS4 A;  4JKT A;  2WAE A;  4OP8 A;  1MY8 A;  4KG5 A;  1DY6 A;  2EX6 A;  4WEK A;  1XP4 A;  2EX8 A;  4GB7 A;  3NIA A;  3VMA A;  1RGZ A;  4RYE A;  3UDF A;  3Q07 A;  4UA6 A;  1MWU A;  2HDR A;  3VOY A;  5FQK A;  2FFY A;  2P74 A;  4S2I A;  5IHV A;  2ZJ9 A;  4KZ4 A;  2WUQ A;  3GSG A;  1PW8 A;  5AQ9 A;  2H5S A;  2C6W B;  5FA7 A;  3MZE A;  1GHI A;  4N9L A;  1BLS A;  1K57 A;  1JWP A;  4E3I A;  4HES A;  2Y2Q A;  1XA7 A;  3SH8 A;  3A3F A;  1ZG6 A;  3BFC A;  1Q2Q A;  3IH9 A;  3IWI A;  1KGF A;  2WZZ A;  3BRM A;  3C7V A;  4BJP A;  1CEG A;  3BLM A;  5EVI D;  4BL3 A;  1DJA A;  3WS5 A;  1GA0 A;  4OQ0 A;  3LY3 A;  4LV2 A;  5FAT A;  3TSG A;  5F82 A;  4EUZ A;  3OCL A;  3PBT A;  3OCN A;  3VP3 A;  3C4O A;  4MBH A;  3Q1F A;  3NY4 A;  3G32 A;  5DTK A;  1IEM A;  2RCX A;  4JXS A;  1YLY A;  2I72 A;  3UE0 A;  2CC1 A;  1GCE A;  4PM9 A;  1GA9 A;  4OLD A;  4QY5 A;  3UPN A;  5EVI B;  2ZC7 A;  5CHM A;  3D4F A;  2EX2 A;  5GLD A;  1K56 A;  3M6H A;  4EV4 A;  1JVJ A;  4DE2 A;  3MZD A;  5EE8 A;  4QD4 A;  3LY4 A;  2JC7 A;  5GHY A;  2GDN A;  3EQV A;  5GLB A;  4H8R A;  1Q2P A;  4PMA A;  4KQQ A;  5HX9 A;  3HLF A;  4BD1 A;  4DE1 A;  2Y2N A;  1BZA A;  1G68 A;  1YLZ A;  2ZQ8 A;  1JTD A;  2DCF A;  1L0E A;  3G4P A;  1PWD A;  5GHX A;  1PWC A;  3HRE A;  1ES5 A;  5KZH A;  1LL9 A;  3HL9 A;  4E3K A;  3BFD A;  2P9V B;  2UWX A;  1HVB A;  3ZNY A;  4UA9 A;  4UHU A;  1PYY A;  4Z9Q A;  3ZG8 B;  1YQS A;  4OOY A;  2QMI A;  1AXB A;  2EX9 A;  4OVD A;  3MFD A;  3O86 A;  4JXV A;  4C3Q A;  3M6B A;  2DNS A;  1K57 C;  3VSK A;  2A3U A;  3VP2 A;  4ID4 A;  4QY6 A;  2OV5 A;  4WM9 A;  2Y2G A;  5E43 A;  3HBR A;  1BT5 A;  1SKF A;  5HAI A;  1GHM A;  2DRW A;  3ZG5 A;  3FZC A;  3C7U A;  3FKV A;  2XFT A;  1KVL A;  4IBX A;  4MBK A;  4LCM A;  4MNR A;  2ZM8 A;  3UDX A;  5A91 A;  3PBQ A;  3PTE A;  4PM8 A;  4GD8 A;  2R9W A;  3IHB A;  1YLT A;  4OON A;  1NYM A;  1MXO A;  3V3S A;  4S2J A;  4DXC A;  5EOO A;  3BFE A;  1PI5 A;  5FI6 A;  2BLS A;  1K55 A;  3BEC A;  1ZKJ A;  4JF4 A;  1K6S A;  1SDE A;  3QNB A;  4ZAM A;  1WYB A;  3IWO A;  3N4I A;  1PZO A;  4DE3 A;  4DKI A;  2X02 A;  3AGF A;  4S2L A;  5HW3 A;  1KGG A;  4QJG A;  3VFF A;  2X71 A;  4X56 A;  1E3U D;  3HUO A;  1NRF A;  3N8L A;  5DVA A;  4S2N A;  3OPR A;  2XFS A;  4U0T A;  2Y2H A;  3OC2 A;  2Z2L B;  3IWQ A;  1WE4 A;  2V20 A;  2VGJ A;  3W4O A;  3ISG A;  3NDG A;  1VQQ A;  3NC8 A;  3V39 A;  1SHV A;  4F94 A;  1BUE A;  1VM1 A;  1XXM A;  1SCW A;  1I2S A;  1KDS A;  1W79 A;  1PWG A;  1LI0 A;  4Y0T A;  3ZNT A;  2G2W A;  1BSG A;  5BOH A;  3S22 A;  4EWF A;  2XH9 A;  1ERM A;  1XKZ A;  3DTM A;  1LHY A;  4M3K A;  4OPQ A;  3UE1 A;  3M2K A;  5HFO A;  1NZU A;  3V50 A;  3WWX A;  2HP9 A;  1IKI A;  4N9K A;  2HDU A;  3FYZ A;  4QHC A;  1PI4 A;  3OPP A;  5F1F A;  3ZVT A;  1FCM A;  4FH2 A;  4E6X A;  3ZGA B;  1KE4 A;  1PIO A;  4KZ7 A;  1IEL A;  2ZMA A;  5DTS A;  3ZG0 A;  4KZB A;  4WMC D;  1K6R A;  5M1A A;  2X01 A;  1FOF A;  2PU4 A;  2Y2J A;  1E4D A;  2WKH A;  3RXW A;  5KSC A;  3Q7V B;  3SH7 A;  4B4X A;  5CXW A;  2XR0 A;  1YMX A;  3WRT A;  3CJM A;  3RXX A;  3ZG7 B;  3ITA A;  2J7V A;  3VP0 A;  1YMS A;  3PBR A;  1I2W A;  2IWC A;  4CJN A;  1K55 C;  4OP5 A;  4YIN A;  2RL3 A;  1TVF A;  2WKE A;  1YT4 A;  5FAP A;  1RP5 A;  1ZG4 A;  1HTZ A;  1H8Y A;  4DF6 A;  2Q9M A;  1PW1 A;  1JWZ A;  4NK3 A;  2C5W B;  2ZLY A;  1KE0 A;  4X6T A;  3GMW A;  4UA7 A;  1MKI A;  4WZ5 A;  4LV0 A;  4S2K A;  2WGW B;  4OPZ A;  4Y0U A;  3UNW A;  3LEZ A;  1MBL A;  3IXD A;  1MWR A;  3FWL A;  1CK3 A;  4LV3 A;  4FD8 A;  1K54 C;  4PM5 A;  3UDI A;  2JCH A;  5A93 A;  5CED A;  1FSY A;  4BL2 A;  1O07 A;  3LO7 A;  5TR7 A;  4K91 A;  3MBZ A;  1TDG A;  5HAQ A;  2E8I A;  4GD6 A;  3IF6 B;  2H0Y A;  1C3B A;  4IED A;  3SS3 A;  3IF6 C;  3ZDJ A;  4X69 A;  3GQZ A;  4GZB A;  1ONG A;  5FQJ A;  5JYO A;  1FCN A;  1BLC A;  4JXG A;  5J8X A;  1K4E A;  5FQM A;  3IXB A;  4R4R A;  2J9P A;  2R9X A;  4ZJ1 A;  1KVM A;  1ES4 A;  4KZ5 A;  4R1G A;  1FQG A;  3HLW A;  4KZ9 A;  3IF5 A;  4K0X A;  2ZQD A;  4C6Y A;  2QZ6 A;  1RGY A;  4GDB A;  2ZQ7 A;  4LEN A;  4OPR A;  3GTC A;  4EBP A;  1FR6 A;  1IKG A;  1OME A;  2PBY A;  1RCJ A;  1Y54 A;  4GOG A;  2WKI A;  3Q82 A;  4X53 A;  4E6W A;  1ESI A;  1LI9 A;  5E2E A;  5CGW A;  2JBF A;  4X55 A;  1NYY A;  4KG6 A;  4QB8 A;  5GLC A;  3Q7Z A;  4WZ4 A;  1FR1 A;  4S2P A;  4DE0 A;  4L0L A;  5M19 A;  1IYS A;  2Y4A A;  5TFQ A;  4GKU A;  3BFG A;  4Y7P A;  3WS0 A;  3IT9 A;  3NDE A;  2ZD8 A;  2Y55 A;  2ZC5 B;  2G2U A;  3MXR A;  4DXB A;  4KZ8 A;  5M18 A;  3GVB A;  5F83 A;  3MXS A;  3E2K A;  4GNU A;  4WZ5 C;  3M2J A;  1K56 D;  1QMF A;  3G35 A;  3QNC A;  3S4X A;  3UY6 A;  5A92 A;  2H0T A;  1YLP A;  4BLM A;  3G31 A;  3N7W A;  1W8Q A;  4EBL A;  2WK0 A;  5CRF A;  3BEB A;  1NXY A;  4E3N A;  1SDN A;  5FAQ A;  2ZM2 A;  3V5M A;  4U3T A;  5DTT A;  3WS1 A;  2ZC6 B;  2WGI A;  3ZG9 B;  3CMZ A;  3VP4 A;  1FSW A;  4XUZ A;  2OLV A;  3DWK A;  3UE3 A;  1H5X A;  1YLJ A;  4E3J A;  4R0Q A;  3IH8 A;  3IQA A;  4JF6 A;  4E3O A;  3MKF A;  2XK1 A;  3HLG A;  3SS5 A;  3TG9 A;  3UO9 A;  3JYI A;  5E2G A;  4ZJ3 A;  1H8Z A;  4B88 A;  2Y91 A;  4MLL A;  1XX2 A;  3HVF A;  3E2L A;  4KZ6 A;  1DJC A;  2HP5 A;  2QPN A;  3WS4 A;  5HAP A;  1IYQ A;  1MWT A;  2FFF B;  4WMC A;  4BEN A;  1NY0 A;  2ZQC A;  5EEC A;  3WS2 A;  4OLG A;  3SH9 A;  2WAD A;  4WYY A;  1L0G A;  5CTN A;  2Y2M A;  1E25 A;  3FKW A;  3ZVW A;  3S1Y A;  2A49 A;  2Y2K A;  4XUX A;  4DDY A;  2Y59 A;  3QHY A;  4E3M A;  1CI9 A; 
#chains in the Genus database with same CATH topology
 1I5Q A;  4Q8I A;  4PM6 A;  3OPL A;  4GHI B;  1S0W A;  4EEU A;  1JWV A;  4N92 A;  1T1B A;  3CUE A;  2WYX A;  2M1C A;  5GL9 A;  1KE3 A;  3MQ0 A;  2VGK A;  4LRY C;  4ZJ2 A;  1K4F A;  3GRJ A;  4LV1 A;  4OQG A;  4ZTK A;  3T4S A;  4EUV A;  2PAV P;  1MPL A;  2XQZ A;  1NZO A;  1W7F A;  4C75 A;  4EBN A;  3N8S A;  4X1L A;  3N8R A;  3T4J A;  2J80 A;  1VHM A;  3LR3 A;  5IT5 A;  4GS9 B;  2VGL S;  5AQ7 A;  4Y13 A;  3UMD A;  5DKK A;  2Y2O A;  3W4P A;  3ICY A;  3C30 A;  4ZDX A;  2L4R A;  5FQ9 A;  3CI6 A;  5HAR A;  5CEC A;  1ERO A;  1ZTU A;  3E98 A;  3PBS A;  1QME A;  3KYE A;  3AGD A;  3CIT A;  1P9R A;  5CGX A;  2EFU A;  3KSG A;  3ZFZ A;  1XGI A;  3K3C A;  5FDS A;  1PNE A;  2NUP C;  4YNR A;  1EI5 A;  4B93 A;  2WGV A;  3KSH A;  5FQQ A;  1W8Y A;  4RA7 A;  3E0Y A;  3F1P B;  4EXO A;  5JYP A;  2A24 A;  1TEM A;  2EFX A;  1ESU A;  5D3O A;  3LR0 A;  2J3T D;  3ZCZ A;  4KQO A;  3QP8 A;  2PT7 A;  5AVF A;  4GN2 A;  1TS6 A;  4HOI A;  4NXG A;  5HSQ A;  2O0Y A;  3EQU A;  4RX3 A;  5CTM A;  4XXR A;  1BUL A;  1WA9 A;  2A2L A;  1J9M A;  3EGX C;  3LCE A;  1TS8 A;  1O7E A;  1N9O A;  1ES3 A;  2XLN A;  1XA1 A;  2Q0O A;  2IA2 A;  5G18 A;  1FCO A;  1F5M A;  2Y79 A;  2WAE A;  4UQI S;  4WEK A;  1XP4 A;  3MMH A;  3F1N B;  3QP4 A;  1XFN A;  3VMA A;  4NG2 A;  2VK3 A;  3NHQ A;  3LI8 A;  5FQK A;  2ZJ9 A;  3EEH A;  5HPI A;  5AJG A;  2C6W B;  1EW0 A;  1V9Z A;  5MC7 A;  1XA7 A;  3IH9 A;  4DJ3 A;  2WZZ A;  3BRM A;  1CEG A;  3BLM A;  4BL3 A;  1DJA A;  5EVE A;  3U2A A;  5FAT A;  1V9Y A;  1FIK A;  2QYB A;  3VP3 A;  3Q1F A;  1GCE A;  2WKQ A;  3VV4 A;  3D4F A;  4HP9 A;  1GSX A;  2G7U A;  3EQV A;  2ZQ8 A;  1T18 A;  2DCF A;  2VKS A;  1AWI A;  2P9V B;  4UA9 A;  2V0W A;  1AXB A;  2EX9 A;  3PR6 A;  5J3W A;  2DMW A;  3O86 A;  4JXV A;  5HD5 A;  2DNS A;  3VSK A;  4MN6 A;  4IUK A;  2OV5 A;  4WM9 A;  3TE8 A;  1SKF A;  5FEF A;  1GHM A;  3FZC A;  3C8C A;  4G3V A;  5L09 A;  3GDI A;  1KVL A;  4IBX A;  4MBK A;  2VJW A;  2ZM8 A;  4LPZ A;  3PTE A;  4PM8 A;  1BYW A;  1NYM A;  1MXO A;  2P04 A;  4S2J A;  5FI6 A;  2KLI A;  3DTK A;  2BLS A;  1ZKJ A;  1VET B;  1K6S A;  2W3G A;  3VE4 A;  3E4Q A;  4DKI A;  1PZO A;  2W3F A;  3AGF A;  3DAV A;  2M7V A;  2K31 A;  4GHI A;  1KGG A;  4QJG A;  2MJ6 A;  1NRF A;  3N8L A;  4RQ9 A;  4U0T A;  1DRM A;  2Y2H A;  2Z2L B;  1J3W A;  1WE4 A;  2V20 A;  2VGJ A;  1VQQ A;  3V39 A;  1SHV A;  1BUE A;  1NLZ A;  1XXM A;  1KDS A;  2XH9 A;  3DTM A;  3UE1 A;  4OPQ A;  4KUO A;  3M2K A;  5HFO A;  4BBV A;  2EWV A;  1LSW A;  3PXP A;  5F1F A;  2P7J A;  5EM0 A;  5DTS A;  1K6R A;  5M1A A;  4GS9 A;  4FTX A;  3SH7 A;  5CXW A;  2XR0 A;  1YMX A;  3CJM A;  3RXX A;  3ZG7 B;  3NOP C;  5HL6 A;  4Q0H A;  3VP0 A;  1YMS A;  2IWC A;  2WKP A;  4I38 A;  1TVF A;  5FAP A;  1ZG4 A;  2V1B A;  2BTF P;  2R78 A;  4OPZ A;  3LEZ A;  1MWR A;  3G6O A;  4FD8 A;  5DJU A;  3UDI A;  2JCH A;  5TR7 A;  3LID A;  4K91 A;  3MBZ A;  1TDG A;  2E8I A;  3IF6 B;  2H0Y A;  4IED A;  2OOL A;  4GZB A;  1GSW A;  3QP6 A;  1ES4 A;  2HGV A;  4KZ5 A;  3IF5 A;  3F1P A;  4GDB A;  3CHW P;  4LEN A;  4EBP A;  4HNB A;  1Y54 A;  2NUT C;  4E6W A;  3MXQ A;  5FL3 A;  2JBF A;  3SZT A;  4DE0 A;  4PKY A;  1MC0 A;  3IX8 A;  3IT9 A;  3S7O A;  2ZC5 B;  4L9F A;  4KZ8 A;  3MXS A;  1K56 D;  2O9A A;  2H0T A;  2WK0 A;  5LBR A;  3CAX A;  5J4E A;  3WS1 A;  2WGI A;  3ZG9 B;  2Z6C A;  2OAP 1;  1FSW A;  3DWK A;  1H5X A;  1YLJ A;  3F1N A;  2PR6 A;  4E3O A;  3MKF A;  3TG9 A;  3SS5 A;  3UO9 A;  3JYI A;  3U4L P;  4ZJ3 A;  4WUJ A;  3HVF A;  4KZ6 A;  2QPN A;  1OT9 A;  1OJG A;  2XA7 S;  4WMC A;  4WYY A;  3QP1 A;  3JVU A;  1E25 A;  1UGU A;  2J3T C;  3ZVW A;  1D06 A;  3L9K A;  3QHY A;  4O7D A;  1Z6F A;  2W27 A;  4JLF A;  3VE3 A;  1LSX A;  1KGE A;  1BLP A;  3G34 A;  4FSF A;  4WL9 A;  3T1X A;  2ZL1 B;  2WAF A;  1L0F A;  4LFU A;  4I3I A;  4OQI A;  3HUM A;  4G3K A;  4PM7 A;  1F2K A;  1W5D A;  3AGE A;  4S2N C;  3UPO A;  4R23 A;  5CEB A;  1G6A A;  2K7S A;  1HD8 A;  1XJ6 A;  3A3E A;  4PAU A;  2P9V A;  5EV0 A;  5E2F A;  3TJZ C;  3LIA A;  1CF0 A;  1CI8 A;  2HDQ A;  3A3D A;  1TF1 A;  5GLA A;  3IHA A;  2PDR A;  4RX2 A;  4ZBE A;  4MMN A;  4OOM A;  2OWH A;  3P09 A;  4P0M A;  4Z1W A;  3A3I A;  1BTL A;  2XRO A;  1M6K A;  3V3R A;  4KG2 A;  3ZHH A;  1VET A;  2EXA A;  1NJ4 A;  3NI9 A;  3G30 A;  5CHU A;  1LLB A;  1M40 A;  5DF7 A;  2OAQ 1;  2QJ7 A;  1H3Q A;  4PKY G;  2HJE A;  4FCF A;  2B95 A;  3IXG A;  4R3J A;  3GR2 A;  4KQR A;  4JF5 A;  2XD1 A;  1GHP A;  4PPR A;  2JKR M;  2XD5 A;  5FI7 A;  3FPV A;  5EVL A;  5L2F A;  5HWW A;  3O3V A;  4N1H A;  2PHY A;  3LGO A;  5HZH A;  2ZQA A;  1T1C A;  4A5R A;  4BMW A;  1TDL A;  5GHZ A;  3T50 A;  2Y2I A;  2O99 A;  1N9L A;  1TS0 A;  3D9Y A;  3OBF A;  5HL1 A;  3K3D A;  5HPF A;  2OLU A;  4R38 A;  3NCK A;  2W0N A;  4L9G A;  3T12 B;  1MWS A;  4S2M A;  2ZC4 B;  4WEL A;  3DTE A;  3GV9 A;  2ZQ9 A;  4JXW A;  2W3D A;  1YM1 A;  4KZA A;  1OTA A;  1S1Z A;  2HP6 A;  2EXB A;  3VOZ A;  3IF6 A;  1ES2 A;  2VV7 A;  4HH3 A;  1U60 A;  5DF9 A;  5TBM B;  2BG1 A;  1JTG A;  4JKT A;  4OP8 A;  4O01 A;  4KG5 A;  4KQD A;  4Q0I A;  4GB7 A;  4RYE A;  3Q07 A;  1MWU A;  2HDR A;  3B42 A;  3DTI A;  4S2I A;  1XJ4 A;  2VZW A;  3MFX A;  5FA7 A;  5G4Z A;  5C5K A;  1BLS A;  1K57 A;  4EU0 A;  1JWP A;  2Y2Q A;  3SH8 A;  2EA9 A;  3BFC A;  2E8J A;  1TS7 A;  5EVI D;  1YSP A;  3WS5 A;  1GA0 A;  1W63 Q;  4OQ0 A;  3TSG A;  4LV2 A;  4EUZ A;  1D7E A;  3PBT A;  3G32 A;  4GCZ A;  5DTK A;  2RCX A;  5I5L A;  4CLC E;  5EVI B;  3B47 A;  4EV4 A;  2EX2 A;  5GLD A;  1K56 A;  1JVJ A;  4DE2 A;  5EE8 A;  3BY9 A;  3LY4 A;  3T1S A;  2JC7 A;  4H8R A;  5HX9 A;  4BD1 A;  3HLF A;  2Y2N A;  1JTD A;  3C2W A;  3TRC A;  3CUE C;  3G4P A;  5GHX A;  3HRE A;  5KZH A;  3UB7 A;  4P6Z M;  2YKF A;  4UHU A;  1YAX A;  1YQS A;  2JN7 A;  4OVD A;  3R4K A;  3M6B A;  1K57 C;  4LRX C;  1OTE A;  3HJK A;  3IS2 A;  3P01 A;  1BT5 A;  5HAI A;  3BWL A;  3C7U A;  3FKV A;  4LCM A;  2GZA A;  2KDK A;  3D3O A;  4OON A;  1NLY A;  3OOV A;  1PI5 A;  1K55 A;  2ZL1 A;  4X1M A;  3N4I A;  5HW3 A;  5J7E A;  4X56 A;  3HUO A;  5DVA A;  1OTI A;  3OPR A;  4JGO A;  5DJT A;  3OC2 A;  4YOF A;  3IWQ A;  2W1R A;  3W4O A;  3IX4 A;  4EET B;  1W79 A;  2PD8 A;  2G2W A;  5L07 A;  2V9A A;  3LIC A;  5FEG A;  1ERM A;  1OT6 A;  4M3K A;  2UV0 E;  2Y8H A;  2B18 A;  3WWX A;  1IKI A;  5DFY A;  1F98 A;  3FYZ A;  4K08 A;  1A0K A;  3ZVT A;  2ZOI A;  3ZGA B;  4KZB A;  4WMC D;  5EM1 A;  1Y4O A;  3UB9 A;  3RXW A;  3WRT A;  3ITA A;  3IX3 A;  2PRF A;  3LFV A;  1K55 C;  2RL3 A;  1H8Y A;  2Q9M A;  4NK3 A;  1KE0 A;  2VGL M;  4X6T A;  3IXD A;  3T1R A;  3LIF A;  4ZRR A;  4BL2 A;  1O07 A;  3F1O B;  4I3J A;  5HWT A;  1S66 L;  3SS3 A;  4Q0J A;  3KSF A;  4X69 A;  5JYO A;  1BLC A;  1G5U A;  4HQA A;  2R9X A;  4R1G A;  4KZ9 A;  4Y2F A;  2ZQD A;  5DKL A;  4EW7 A;  1RGY A;  5HD3 A;  2JKF A;  1OME A;  1RCJ A;  4GOG A;  3Q82 A;  1LI9 A;  5EFW A;  5GLC A;  4WZ4 A;  5M19 A;  4L0L A;  1IYS A;  3C38 A;  2Y4A A;  5TFQ A;  5IS1 A;  3UB6 A;  3VOL A;  2Y55 A;  5M18 A;  3GVB A;  5F83 A;  4AFI A;  3M2J A;  3QNC A;  1QMF A;  5HDD A;  5DFX A;  4BLM A;  3G31 A;  5CRF A;  1NXY A;  3V5M A;  4U3T A;  5DTT A;  3L7H A;  5TBM A;  3UE3 A;  3IH8 A;  3IQA A;  4CLC D;  3A0S A;  3MSH A;  1N9N A;  5E2G A;  1H0M A;  1JNU A;  2Y91 A;  4B88 A;  3ZYT A;  4F3L B;  4MLL A;  4MN5 A;  3E2L A;  1DJC A;  3WS4 A;  1IYQ A;  4DJ2 A;  2BAS A;  4CLC B;  1G6O A;  1NY0 A;  5EEC A;  3WS2 A;  2WAD A;  4GJ4 A;  1G28 A;  3KO6 A;  1CQA A;  2GJ3 A;  3A0V A;  2Y59 A;  1IOU A;  4E3M A;  5EOE A;  4CPK A;  4O8G A;  3HLE A;  3N6I A;  1ONH A;  3A3J A;  3G2Y A;  5EVI A;  1EWZ A;  3T4O A;  1ACF A;  3HUN A;  4B4Z A;  2HZ5 A;  3NBL A;  4Y5F A;  3CG5 A;  3W8K A;  1KDW A;  4EQI A;  3ULF A;  1UWP X;  3OZH A;  3TOI A;  4OH0 A;  4NXE A;  3BM6 A;  2GNX A;  1IYO A;  5A8B A;  4HJ6 A;  4X25 A;  1OTB A;  4IBR A;  3UN7 A;  3IXH A;  4IVK A;  3SW1 A;  4DDS A;  4H6J B;  3NOU C;  3P98 A;  1L0D A;  2OSU A;  1N9B A;  4ETZ A;  4OQH A;  2XDM A;  4MDZ A;  3DW0 A;  3PAE A;  4RVA A;  1DP9 A;  1L2S A;  4U0X A;  3E4P A;  1ALQ A;  4IHQ A;  5EVI C;  4R70 A;  3HLD A;  1BLH A;  1WYC A;  2V8C A;  3HJI A;  2IWB A;  5AQB A;  3UE6 A;  2YKH A;  3BFF A;  4JGP A;  3O87 A;  1YKD A;  2V1Z A;  5F1G A;  4BWI A;  4FH4 A;  1XGJ A;  4BQM A;  1YPR A;  2QJ5 A;  3C5A A;  4GDN A;  4JBF A;  4QWO A;  3H7W B;  5TGF A;  1K38 A;  5EUA A;  4HH2 A;  3H82 B;  4NXB A;  2HDS A;  4Y17 A;  3CWF A;  4S2O A;  3UPP A;  4HP4 A;  4LCL A;  2KX6 A;  5FAO A;  4FUW A;  4HBT A;  2KOI A;  4D2O A;  4MCW A;  4L9E A;  5DF8 A;  5TJJ A;  2L1M A;  2J3W A;  4K0W A;  1XPB A;  3IS2 B;  3VFH A;  2B5R A;  4WBG A;  1N4O A;  1ZHH B;  3Q81 A;  5FI2 A;  1K54 A;  4HI4 A;  4YFM A;  3MJQ A;  2WZX A;  3W2Z A;  1S67 L;  4BD0 A;  3F1O A;  3DWZ A;  3UME A;  3T4K A;  3HLC A;  3BYD A;  1IYP A;  4ESP A;  4KEN B;  2J8Y A;  4R3B A;  5A90 A;  3BW6 A;  1MY8 A;  3FPW A;  1DY6 A;  3NIA A;  1RGZ A;  4UA6 A;  3VOY A;  3KX0 X;  2P74 A;  4KZ4 A;  5HDC A;  2WUQ A;  5AQ9 A;  1GHI A;  4N9L A;  4E3I A;  3NOT C;  3A3F A;  4D60 A;  3LI9 A;  1F9I A;  3OCL A;  3LR4 A;  3C4O A;  4MBH A;  1IEM A;  3PHY A;  1YLY A;  2I72 A;  2CC1 A;  4QY5 A;  2ZC7 A;  5CHM A;  3M6H A;  3MR0 A;  4QD4 A;  3CPT B;  4YWZ A;  4KQQ A;  3S7Q A;  1BZA A;  1G68 A;  1YLZ A;  4EER A;  1PRQ A;  3IBJ A;  1PWD A;  1KOU A;  1PWC A;  1ES5 A;  4F3L A;  1LL9 A;  3HL9 A;  4E3K A;  1P0Z A;  1HVB A;  3ZNY A;  1PYY A;  4Z9Q A;  4CLC A;  4NEE D;  2VV6 A;  4C3Q A;  2L0W A;  3V67 A;  3VP2 A;  4ID4 A;  4QY6 A;  3MS6 A;  3RFB A;  3HBR A;  3ZG5 A;  1OPX A;  1LL8 A;  3BQ8 A;  2XFT A;  4MNR A;  5A91 A;  3PBQ A;  3B33 A;  2R9W A;  1FIL A;  1Y28 A;  1YLT A;  4DXC A;  5EOO A;  3BFE A;  3UB8 A;  3BEC A;  4JF4 A;  1WYB A;  3IWO A;  4DE3 A;  2X02 A;  4R3A A;  4S2L A;  3VFF A;  1E3U D;  3ISG A;  2ZOH A;  4F94 A;  2LB5 A;  4GLQ A;  1VM1 A;  1SCW A;  1I2S A;  1PWG A;  1BSG A;  3BJN A;  3S22 A;  4CLC C;  1LHY A;  2ACG A;  4HIA A;  4I39 A;  3V50 A;  4N9K A;  2HP9 A;  3A0R A;  4QHC A;  4NXF A;  4H6J A;  4LRZ E;  4E6X A;  4KZ7 A;  3HCY A;  1IEL A;  3KYZ A;  2PU4 A;  2Y2J A;  1E4D A;  3Q7V B;  2V8F A;  3PBR A;  1I2W A;  4CJN A;  4WN5 A;  2GX5 A;  4ARZ B;  2WKE A;  1RP5 A;  1HTZ A;  4DF6 A;  3H9W A;  2ZLY A;  1MZU A;  3NJA A;  4II7 A;  1X0O A;  2P08 A;  4WZ5 A;  1MKI A;  4UA7 A;  4LV0 A;  1YSQ A;  4S2K A;  2WGW B;  3UNW A;  4Y0U A;  3BQA A;  2HJ9 C;  5CED A;  3LO7 A;  4I5S A;  4GD6 A;  1C3B A;  5L10 A;  3IF6 C;  3K2N A;  3ZDJ A;  1ONG A;  3MF0 A;  5FQJ A;  1FCN A;  1W63 M;  2VLG A;  4JXG A;  3LYX A;  5J8X A;  3IXB A;  3H7W A;  2J9P A;  3TW8 A;  4ZJ1 A;  1KVM A;  1K0K A;  2H28 A;  3S7P A;  1SKO B;  2M7U A;  3H82 A;  5F6A A;  2ZQ7 A;  4OPR A;  3GTC A;  1FR6 A;  5F69 A;  1GSV A;  1S4R A;  2WKI A;  1ESI A;  5E2E A;  4X55 A;  1NYY A;  4KG6 A;  4QB8 A;  1FR1 A;  4HHD A;  2HF6 A;  4GKU A;  3BFG A;  4Y7P A;  3WS0 A;  2QHK A;  2G2U A;  3NUL A;  2JKT M;  3E2K A;  4GNU A;  4WZ5 C;  1XJ3 A;  2VA0 A;  2VV8 A;  4EBL A;  1W8Q A;  4Y3I A;  3BEB A;  4E3N A;  2ZC6 B;  2FH5 A;  3VP4 A;  4XUZ A;  2OLV A;  2ZMF A;  1CJF A;  4E3J A;  1VEU B;  4R0Q A;  4G3W A;  3KSI A;  2XK1 A;  3HLG A;  4B9O A;  1XJ2 A;  1XX2 A;  2HP5 A;  2INW A;  4BEN A;  2ZQC A;  4OLG A;  4WF0 A;  3SH9 A;  1L0G A;  2Y2M A;  2O9C A;  2A49 A;  2XRN A;  2QWS A;  1K25 A;  5CHJ A;  4WLA A;  4KZ3 A;  3C4P A;  3O88 A;  4OOL A;  5KMW A;  2ZC3 B;  3WRZ A;  5FSR A;  1LSV A;  3FV7 A;  2WKR A;  2JHE A;  3CPT A;  1STZ A;  3G2Z A;  2J9O A;  4QU3 A;  4JPM A;  2HPB A;  1PFL A;  1OJ5 A;  1ZC2 A;  3OLO A;  2PYR A;  5CX7 A;  4FOF A;  4KUK A;  2Q9N A;  4R4S A;  3VP1 A;  2EWW A;  3EGD C;  5E2H A;  5CER A;  1DP8 A;  1ERQ A;  3I7J A;  2V1A A;  1ODV A;  3PAG A;  5K5B A;  4N1X A;  1HZO A;  1CEF A;  3E4O A;  2VEA A;  2ZMV A;  4XT2 B;  2Z2M B;  1DJB A;  4QPR A;  3T1Q B;  4P85 A;  5U47 A;  4Y0O A;  5FQI A;  2PU2 A;  2OWJ A;  4HJ3 A;  4CQH A;  2JE5 A;  3S7N A;  4OPY A;  3CZD A;  2ZBB A;  3OPH A;  3QP5 A;  2V0U A;  3T4T A;  4NET A;  1E3U A;  2W1T B;  4MEZ A;  4UAA A;  2W3E A;  4P87 A;  5KSH A;  3MKE A;  1LL5 A;  3ITB A;  4DRT A;  2V2F F;  3BLS A;  3W4Q A;  2XF3 A;  4IVI A;  5EPH A;  1PZP A;  4MBF A;  4WEJ A;  4OKP A;  3O5Y A;  3Q7V A;  2XGN A;  4E3L A;  3LEQ A;  2H10 A;  3B3X A;  4MN7 A;  3LUQ A;  4P6B A;  4HEF A;  4ARZ A;  5AQA A;  2I9V A;  5CGS A;  1S4S A;  4NKP A;  2Y2L A;  5FAS A;  1YLW A;  3PBN A;  2Y2P A;  4UQI M;  3BY8 A;  3QP2 A;  3EEA A;  3HLB A;  4HBU A;  3PBO A;  2WGW A;  3RJU A;  2XEP A;  2IWD A;  2O9B A;  1S6R A;  2Z6D A;  3SOI A;  3VSL A;  5I94 A;  2FZ0 A;  5FDH A;  1DP6 A;  3ZQ5 A;  4X68 A;  3MZF A;  2ZM0 A;  3R7W B;  1T1A A;  3SS4 A;  1SKO A;  2EX6 A;  1NRJ A;  2JKR I;  2EX8 A;  4IJG A;  3UDF A;  2PBD P;  4GW9 A;  2FFY A;  5IHV A;  3GSG A;  1PW8 A;  3EWK A;  2H5S A;  3MZE A;  1SZV A;  4HES A;  4ETX A;  1ZG6 A;  1Q2Q A;  3MQO A;  3IWI A;  1KGF A;  2PD7 A;  3C7V A;  4BJP A;  4E04 A;  3LY3 A;  5F82 A;  3OCN A;  3KYQ A;  3JPU A;  3FC7 A;  2PR5 A;  3NY4 A;  4IUH A;  4JXS A;  3UE0 A;  4PM9 A;  1GA9 A;  4OLD A;  3UPN A;  3MZD A;  5G4Y A;  5GHY A;  2GDN A;  2AVX A;  5GLB A;  4DN0 A;  3RH8 B;  1Q2P A;  4PMA A;  1VEU A;  4DE1 A;  1L0E A;  2K2N A;  5F68 A;  5AVE A;  4EES A;  3LIB A;  4HY8 A;  3BFD A;  2UWX A;  3ZG8 B;  4OOY A;  2QMI A;  3MFD A;  5HDS A;  2A3U A;  3D72 A;  2Y2G A;  5E43 A;  2DRW A;  1NWZ A;  3UDX A;  2B02 A;  1OTD A;  4GD8 A;  3IHB A;  3V3S A;  4LGW A;  1SDE A;  3QNB A;  4ZAM A;  1IFQ A;  3EOI A;  2X71 A;  1XFQ A;  4S2N A;  3NEC A;  2XFS A;  3NDG A;  3NC8 A;  1D1J A;  4JGQ A;  3P7N A;  1LI0 A;  4Y0T A;  3ZNT A;  3PYP A;  5BOH A;  2HV1 A;  4EWF A;  1XKZ A;  3T4Q A;  1NZU A;  5F5Y A;  3LIE A;  3IBR A;  2HDU A;  2W3H A;  1PI4 A;  3OPP A;  1FCM A;  4FH2 A;  1L3L A;  4ME4 A;  1KE4 A;  1PIO A;  2ZMA A;  2QKP A;  3ZG0 A;  2X01 A;  2A24 B;  1FOF A;  2WKH A;  5KSC A;  4B4X A;  5HWV A;  4XT2 A;  2CMN A;  2J7V A;  4OP5 A;  4YIN A;  2JKT I;  1YT4 A;  2D01 A;  2PYP A;  1PW1 A;  1JWZ A;  2C5W B;  4BBU A;  2XSS A;  3GMW A;  2D02 A;  1MBL A;  3FWL A;  1CK3 A;  4LV3 A;  1K54 C;  4PM5 A;  4EEP A;  5A93 A;  1FSY A;  3FG8 A;  2W1T A;  4BBT A;  5HAQ A;  3GEC A;  5KIZ A;  1VB6 A;  3GQZ A;  2LB9 A;  1K4E A;  5FQM A;  4R4R A;  5L8M A;  1P97 A;  4I3A A;  3UB5 P;  1FQG A;  3HLW A;  3CLO A;  4K0X A;  1TD5 A;  4C6Y A;  1Z09 A;  2QZ6 A;  4LLO B;  1IKG A;  2PBY A;  4X53 A;  1T19 A;  5CGW A;  4DMZ A;  3Q7Z A;  4S2P A;  4HJ4 A;  3JVV A;  4R6L A;  1LT0 A;  3NDE A;  2ZD8 A;  3MXR A;  4DXB A;  3UY6 A;  3G35 A;  3S4X A;  5A92 A;  4JGR A;  1YLP A;  2JKG A;  4O0P A;  3N7W A;  1MKM A;  1SDN A;  2XA7 M;  5FAQ A;  2ZM2 A;  4P6Z S;  4PHT A;  3CMZ A;  1S1Y A;  4EQ1 A;  3DBA A;  4UEY A;  3R7W A;  1H8M A;  4JF6 A;  3T4L A;  2VX8 A;  1H8Z A;  1HLU P;  5HAP A;  1MWT A;  3MQQ A;  2FFF B;  5IU1 A;  3LR5 A;  1P9W A;  1UWN X;  5CTN A;  3RTY A;  4Y15 A;  3FKW A;  3S1Y A;  2Y2K A;  4XUX A;  4DDY A;  4M4X A;  1CI9 A; 
#chains in the Genus database with same CATH homology
 1Z6F A;  1K25 A;  4JLF A;  4CPK A;  5CHJ A;  3HLE A;  1I5Q A;  1BLP A;  1KGE A;  1ONH A;  3G34 A;  3N6I A;  4FSF A;  3C4P A;  3O88 A;  4KZ3 A;  4OOL A;  3A3J A;  3G2Y A;  4Q8I A;  5KMW A;  2WAF A;  5EVI A;  1EWZ A;  1L0F A;  2ZC3 B;  3WRZ A;  4PM6 A;  5FSR A;  3HUN A;  3OPL A;  4B4Z A;  3FV7 A;  3HUM A;  4OQI A;  3NBL A;  4PM7 A;  1S0W A;  1W5D A;  3AGE A;  1JWV A;  3G2Z A;  2J9O A;  4N92 A;  4QU3 A;  4JPM A;  4S2N C;  3UPO A;  4R23 A;  5CEB A;  1G6A A;  2HPB A;  3CG5 A;  2WYX A;  3W8K A;  5EOE A;  1KDW A;  1ZC2 A;  5GL9 A;  1HD8 A;  1KE3 A;  3A3E A;  2P9V A;  2VGK A;  4EQI A;  3OZH A;  5E2F A;  2Q9N A;  1K4F A;  3GRJ A;  4R4S A;  4ZJ2 A;  3TOI A;  4LV1 A;  3VP1 A;  4OQG A;  4OH0 A;  4ZTK A;  3BM6 A;  1IYO A;  1CI8 A;  1MPL A;  2XQZ A;  1NZO A;  1W7F A;  4C75 A;  2HDQ A;  5E2H A;  5CER A;  4EBN A;  4IBR A;  1ERQ A;  3I7J A;  3UN7 A;  3A3D A;  3IXH A;  3N8S A;  4IVK A;  3N8R A;  4DDS A;  5GLA A;  3PAG A;  3IHA A;  3P98 A;  4RX2 A;  1L0D A;  2OSU A;  1N9B A;  4ZBE A;  4OQH A;  4OOM A;  4N1X A;  1HZO A;  2XDM A;  5AQ7 A;  1CEF A;  3P09 A;  4P0M A;  3DW0 A;  3A3I A;  3PAE A;  1BTL A;  4RVA A;  1L2S A;  1M6K A;  3V3R A;  4U0X A;  2Z2M B;  1DJB A;  4KG2 A;  1ALQ A;  2Y2O A;  3W4P A;  3ZHH A;  2EXA A;  4P85 A;  1NJ4 A;  5EVI C;  3NI9 A;  3G30 A;  5CHU A;  3HLD A;  5U47 A;  4Y0O A;  1LLB A;  5FQI A;  4O7D A;  1BLH A;  1M40 A;  2PU2 A;  1WYC A;  4ZDX A;  5DF7 A;  5FQ9 A;  2IWB A;  4FCF A;  2JE5 A;  5AQB A;  5HAR A;  3IXG A;  4OPY A;  4R3J A;  1ERO A;  5CEC A;  3GR2 A;  4KQR A;  3BFF A;  3CZD A;  4JF5 A;  3OPH A;  3PBS A;  1QME A;  2XD1 A;  1GHP A;  3AGD A;  3O87 A;  4PPR A;  4NET A;  5CGX A;  2EFU A;  1E3U A;  2V1Z A;  2XD5 A;  4MEZ A;  4UAA A;  5F1G A;  5FI7 A;  3ZFZ A;  4FH4 A;  1XGJ A;  5EVL A;  4BQM A;  1XGI A;  4P87 A;  5KSH A;  3O3V A;  5L2F A;  3MKE A;  3C5A A;  1EI5 A;  1LL5 A;  4GDN A;  4JBF A;  3ITB A;  2WGV A;  4N1H A;  4DRT A;  2ZQA A;  5FQQ A;  2V2F F;  5TGF A;  3BLS A;  1K38 A;  5EUA A;  1W8Y A;  3W4Q A;  4A5R A;  4RA7 A;  2XF3 A;  5JYP A;  1TDL A;  5GHZ A;  4IVI A;  5EPH A;  1TEM A;  2Y2I A;  2HDS A;  1PZP A;  4MBF A;  2EFX A;  4WEJ A;  4OKP A;  3Q7V A;  1ESU A;  5HL1 A;  5D3O A;  2XGN A;  4S2O A;  3UPP A;  2OLU A;  4E3L A;  2H10 A;  4LCL A;  3NCK A;  3ZCZ A;  4KQO A;  3B3X A;  5FAO A;  4P6B A;  4HEF A;  4HBT A;  5AQA A;  4GN2 A;  5CGS A;  4D2O A;  2Y2L A;  5FAS A;  1MWS A;  4S2M A;  2ZC4 B;  5DF8 A;  1YLW A;  3PBN A;  4WEL A;  2Y2P A;  4K0W A;  1XPB A;  3EQU A;  4RX3 A;  3VFH A;  5CTM A;  4XXR A;  2B5R A;  3GV9 A;  3HLB A;  4HBU A;  2ZQ9 A;  1BUL A;  4WBG A;  3PBO A;  4JXW A;  1N4O A;  2WGW A;  1J9M A;  3Q81 A;  5FI2 A;  3RJU A;  1K54 A;  3LCE A;  4YFM A;  1YM1 A;  4KZA A;  1O7E A;  2WZX A;  2XEP A;  2IWD A;  1ES3 A;  1S6R A;  4BD0 A;  2HP6 A;  2EXB A;  3VOZ A;  3SOI A;  3VSL A;  3DWZ A;  5I94 A;  3IF6 A;  1ES2 A;  3HLC A;  2XLN A;  3BYD A;  1IYP A;  1XA1 A;  5FDH A;  1U60 A;  5DF9 A;  4X68 A;  3MZF A;  5G18 A;  1FCO A;  2ZM0 A;  4KEN B;  2J8Y A;  4R3B A;  5A90 A;  2BG1 A;  1JTG A;  3SS4 A;  4JKT A;  2WAE A;  4OP8 A;  1MY8 A;  4KG5 A;  1DY6 A;  2EX6 A;  4WEK A;  1XP4 A;  2EX8 A;  4GB7 A;  3NIA A;  3VMA A;  1RGZ A;  4RYE A;  3UDF A;  3Q07 A;  4UA6 A;  1MWU A;  2HDR A;  3VOY A;  5FQK A;  2FFY A;  2P74 A;  4S2I A;  5IHV A;  2ZJ9 A;  4KZ4 A;  2WUQ A;  3GSG A;  1PW8 A;  5AQ9 A;  2H5S A;  2C6W B;  5FA7 A;  3MZE A;  1GHI A;  4N9L A;  1BLS A;  1K57 A;  1JWP A;  4E3I A;  4HES A;  2Y2Q A;  1XA7 A;  3SH8 A;  3A3F A;  1ZG6 A;  3BFC A;  1Q2Q A;  3IH9 A;  3IWI A;  1KGF A;  2WZZ A;  3BRM A;  3C7V A;  4BJP A;  1CEG A;  3BLM A;  5EVI D;  4BL3 A;  1DJA A;  3WS5 A;  1GA0 A;  4OQ0 A;  3LY3 A;  4LV2 A;  5FAT A;  3TSG A;  5F82 A;  4EUZ A;  3OCL A;  3PBT A;  3OCN A;  3VP3 A;  3C4O A;  4MBH A;  3Q1F A;  3NY4 A;  3G32 A;  5DTK A;  1IEM A;  2RCX A;  4JXS A;  1YLY A;  2I72 A;  3UE0 A;  2CC1 A;  1GCE A;  4PM9 A;  1GA9 A;  4OLD A;  4QY5 A;  3UPN A;  5EVI B;  2ZC7 A;  5CHM A;  3D4F A;  2EX2 A;  5GLD A;  1K56 A;  3M6H A;  4EV4 A;  1JVJ A;  4DE2 A;  3MZD A;  5EE8 A;  4QD4 A;  3LY4 A;  2JC7 A;  5GHY A;  2GDN A;  3EQV A;  5GLB A;  4H8R A;  1Q2P A;  4PMA A;  4KQQ A;  5HX9 A;  3HLF A;  4BD1 A;  4DE1 A;  2Y2N A;  1BZA A;  1G68 A;  1YLZ A;  2ZQ8 A;  1JTD A;  2DCF A;  1L0E A;  3G4P A;  1PWD A;  5GHX A;  1PWC A;  3HRE A;  1ES5 A;  5KZH A;  1LL9 A;  3HL9 A;  4E3K A;  3BFD A;  2P9V B;  2UWX A;  1HVB A;  3ZNY A;  4UA9 A;  4UHU A;  1PYY A;  4Z9Q A;  3ZG8 B;  1YQS A;  4OOY A;  2QMI A;  1AXB A;  2EX9 A;  4OVD A;  3MFD A;  3O86 A;  4JXV A;  4C3Q A;  3M6B A;  2DNS A;  1K57 C;  3VSK A;  2A3U A;  3VP2 A;  4ID4 A;  4QY6 A;  2OV5 A;  4WM9 A;  2Y2G A;  5E43 A;  3HBR A;  1BT5 A;  1SKF A;  5HAI A;  1GHM A;  2DRW A;  3ZG5 A;  3FZC A;  3C7U A;  3FKV A;  2XFT A;  1KVL A;  4IBX A;  4MBK A;  4LCM A;  4MNR A;  2ZM8 A;  3UDX A;  5A91 A;  3PBQ A;  3PTE A;  4PM8 A;  4GD8 A;  2R9W A;  3IHB A;  1YLT A;  4OON A;  1NYM A;  1MXO A;  3V3S A;  4S2J A;  4DXC A;  5EOO A;  3BFE A;  1PI5 A;  5FI6 A;  2BLS A;  1K55 A;  3BEC A;  1ZKJ A;  4JF4 A;  1K6S A;  1SDE A;  3QNB A;  4ZAM A;  1WYB A;  3IWO A;  3N4I A;  1PZO A;  4DE3 A;  4DKI A;  2X02 A;  3AGF A;  4S2L A;  5HW3 A;  1KGG A;  4QJG A;  3VFF A;  2X71 A;  4X56 A;  1E3U D;  3HUO A;  1NRF A;  3N8L A;  5DVA A;  4S2N A;  3OPR A;  2XFS A;  4U0T A;  2Y2H A;  3OC2 A;  2Z2L B;  3IWQ A;  1WE4 A;  2V20 A;  2VGJ A;  3W4O A;  3ISG A;  3NDG A;  1VQQ A;  3NC8 A;  3V39 A;  1SHV A;  4F94 A;  1BUE A;  1VM1 A;  1XXM A;  1SCW A;  1I2S A;  1KDS A;  1W79 A;  1PWG A;  1LI0 A;  4Y0T A;  3ZNT A;  2G2W A;  1BSG A;  5BOH A;  3S22 A;  4EWF A;  2XH9 A;  1ERM A;  1XKZ A;  3DTM A;  1LHY A;  4M3K A;  4OPQ A;  3UE1 A;  3M2K A;  5HFO A;  1NZU A;  3V50 A;  3WWX A;  2HP9 A;  1IKI A;  4N9K A;  2HDU A;  3FYZ A;  4QHC A;  1PI4 A;  3OPP A;  5F1F A;  3ZVT A;  1FCM A;  4FH2 A;  4E6X A;  3ZGA B;  1KE4 A;  1PIO A;  4KZ7 A;  1IEL A;  2ZMA A;  5DTS A;  3ZG0 A;  4KZB A;  4WMC D;  1K6R A;  5M1A A;  2X01 A;  1FOF A;  2PU4 A;  2Y2J A;  1E4D A;  2WKH A;  3RXW A;  5KSC A;  3Q7V B;  3SH7 A;  4B4X A;  5CXW A;  2XR0 A;  1YMX A;  3WRT A;  3CJM A;  3RXX A;  3ZG7 B;  3ITA A;  2J7V A;  3VP0 A;  1YMS A;  3PBR A;  1I2W A;  2IWC A;  4CJN A;  1K55 C;  4OP5 A;  4YIN A;  2RL3 A;  1TVF A;  2WKE A;  1YT4 A;  5FAP A;  1RP5 A;  1ZG4 A;  1HTZ A;  1H8Y A;  4DF6 A;  2Q9M A;  1PW1 A;  1JWZ A;  4NK3 A;  2C5W B;  2ZLY A;  1KE0 A;  4X6T A;  3GMW A;  4UA7 A;  1MKI A;  4WZ5 A;  4LV0 A;  4S2K A;  2WGW B;  4OPZ A;  4Y0U A;  3UNW A;  3LEZ A;  1MBL A;  3IXD A;  1MWR A;  3FWL A;  1CK3 A;  4LV3 A;  4FD8 A;  1K54 C;  4PM5 A;  3UDI A;  2JCH A;  5A93 A;  5CED A;  1FSY A;  4BL2 A;  1O07 A;  3LO7 A;  5TR7 A;  4K91 A;  3MBZ A;  1TDG A;  5HAQ A;  2E8I A;  4GD6 A;  3IF6 B;  2H0Y A;  1C3B A;  4IED A;  3SS3 A;  3IF6 C;  3ZDJ A;  4X69 A;  3GQZ A;  4GZB A;  1ONG A;  5FQJ A;  5JYO A;  1FCN A;  1BLC A;  4JXG A;  5J8X A;  1K4E A;  5FQM A;  3IXB A;  4R4R A;  2J9P A;  2R9X A;  4ZJ1 A;  1KVM A;  1ES4 A;  4KZ5 A;  4R1G A;  1FQG A;  3HLW A;  4KZ9 A;  3IF5 A;  4K0X A;  2ZQD A;  4C6Y A;  2QZ6 A;  1RGY A;  4GDB A;  2ZQ7 A;  4LEN A;  4OPR A;  3GTC A;  4EBP A;  1FR6 A;  1IKG A;  1OME A;  2PBY A;  1RCJ A;  1Y54 A;  4GOG A;  2WKI A;  3Q82 A;  4X53 A;  4E6W A;  1ESI A;  1LI9 A;  5E2E A;  5CGW A;  2JBF A;  4X55 A;  1NYY A;  4KG6 A;  4QB8 A;  5GLC A;  3Q7Z A;  4WZ4 A;  1FR1 A;  4S2P A;  4DE0 A;  4L0L A;  5M19 A;  1IYS A;  2Y4A A;  5TFQ A;  4GKU A;  3BFG A;  4Y7P A;  3WS0 A;  3IT9 A;  3NDE A;  2ZD8 A;  2Y55 A;  2ZC5 B;  2G2U A;  3MXR A;  4DXB A;  4KZ8 A;  5M18 A;  3GVB A;  5F83 A;  3MXS A;  3E2K A;  4GNU A;  4WZ5 C;  3M2J A;  1K56 D;  1QMF A;  3G35 A;  3QNC A;  3S4X A;  3UY6 A;  5A92 A;  2H0T A;  1YLP A;  4BLM A;  3G31 A;  3N7W A;  1W8Q A;  4EBL A;  2WK0 A;  5CRF A;  3BEB A;  1NXY A;  4E3N A;  1SDN A;  5FAQ A;  2ZM2 A;  3V5M A;  4U3T A;  5DTT A;  3WS1 A;  2ZC6 B;  2WGI A;  3ZG9 B;  3CMZ A;  3VP4 A;  1FSW A;  4XUZ A;  2OLV A;  3DWK A;  3UE3 A;  1H5X A;  1YLJ A;  4E3J A;  4R0Q A;  3IH8 A;  3IQA A;  4JF6 A;  4E3O A;  3MKF A;  2XK1 A;  3HLG A;  3SS5 A;  3TG9 A;  3UO9 A;  3JYI A;  5E2G A;  4ZJ3 A;  1H8Z A;  4B88 A;  2Y91 A;  4MLL A;  1XX2 A;  3HVF A;  3E2L A;  4KZ6 A;  1DJC A;  2HP5 A;  2QPN A;  3WS4 A;  5HAP A;  1IYQ A;  1MWT A;  2FFF B;  4WMC A;  4BEN A;  1NY0 A;  2ZQC A;  5EEC A;  3WS2 A;  4OLG A;  3SH9 A;  2WAD A;  4WYY A;  1L0G A;  5CTN A;  2Y2M A;  1E25 A;  3FKW A;  3ZVW A;  3S1Y A;  2A49 A;  2Y2K A;  4XUX A;  4DDY A;  2Y59 A;  3QHY A;  4E3M A;  1CI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...