4WZ4A

Crystal structure of p. aeruginosa ampc
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
360
structure length
360
Chain Sequence
b'APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
molecule tags Hydrolase/hydrolase inhibitor
source organism Pseudomonas aeruginosa pao1
publication title 4,5-Disubstituted 6-Aryloxy-1,3-dihydrobenzo[c][1,2]oxaboroles Are Broad-Spectrum Serine beta-Lactamase Inhibitors.
pubmed doi rcsb
total genus 123
structure length 360
sequence length 360
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4wz4A00
2G2WA 3A3EA 1E3UA 2HPBA 4OKPA 4R4SA 3IWQA 4LV1A 4Q8IA 5GL9A 4IVKA 3ZNYA 5E2EA 2HDUA 3VP0A 4EWFA 1OMEA 1ZG4A 3V3RA 1IYSA 4OH0A 4BD0A 4QHCA 5FI7A 3PBTA 1Q2PA 3A3IA 1YM1A 1EROA 4ZJ2A 5EVIC 1LL5A 3UE3A 2Y2QA 1ONHA 3UE0A 1LL9A 2ZJ9A 4C3QA 5F83A 2RCXA 4PMAA 1IEMA 2I72A 2ZC6B 1SDNA 2ZM2A 1L0EA 2ZQDA 3C7UA 1EWZA 2J9PA 2ZC3B 5KMWA 3N8SA 3HLDA 1CI8A 5FAOA 3PAEA 3EQVA 3Q7ZA 3ZNTA 5JYOA 1NYMA 4JF6A 1I2WA 1IYPA 3PBOA 4JXGA 5M1AA 1O07A 2WK0A 1K25A 3V5MA 2WGWA 1BLPA 3Q82A 3LCEA 1YT4A 4PM9A 4KQRA 1PI4A 5FQIA 1S6RA 3DWZA 1PZPA 4K91A 4OPZA 2OV5A 1XGIA 3SS4A 3G35A 3SS3A 1SCWA 1ES5A 5FQ9A 2WUQA 5CERA 5M19A 3HLGA 5F1GA 4KG2A 3ZG0A 5AQBA 2V2FF 5F82A 3NDEA 1CI9A 2J7VA 3UPNA 4JXWA 4U0TA 1M6KA 5F1FA 1FQGA 2P74A 1VQQA 1KE0A 4DDSA 1K54C 1H8YA 5AQ7A 5FQMA 3BLMA 1G6AA 1M40A 5A93A 3MZFA 1L0GA 1K6RA 5EVID 5HARA 3IQAA 4BL3A 2DNSA 4P87A 2XEPA 1BZAA 4NETA 4LCLA 5GLBA 4DE2A 4OOYA 5DVAA 1RGYA 5IHVA 1LLBA 2XFSA 2ZM0A 1MBLA 3A3FA 4DKIA 2JBFA 2XR0A 4N9KA 5CHMA 3HLEA 3MKFA 5DF9A 3UDXA 4PPRA 4RVAA 2EX9A 2Y2PA 3ISGA 2ZC5B 1ZG6A 1XA7A 5DF8A 1K54A 4H8RA 3UY6A 1MXOA 4GDNA 4WM9A 1C3BA 2ZQ8A 1YLJA 5EVLA 1Q2QA 4ZTKA 4GD6A 3IF6A 4WZ5C 2XQZA 5FAPA 2Y2IA 3UPOA 4WMCD 4PM7A 3ZDJA 4IVIA 3S4XA 2OSUA 3ZG7B 2B5RA 2A3UA 3OPLA 3IH9A 1BT5A 1JTGA 1NY0A 4N92A 2Y2HA 5AQAA 2JCHA 4S2MA 2DRWA 2C5WB 3D4FA 3VP2A 3VOYA 3IH8A 3FYZA 1FR1A 4Z9QA 1H5XA 4BENA 2FFFB 4WBGA 3V39A 1LHYA 4R4RA 2XDMA 3O86A 1CEFA 1TDGA 2EX2A 4JXSA 1K38A 4HBTA 3LEZA 3BEBA 5FI6A 3FKWA 3C4OA 3I7JA 4EV4A 4XUXA 4JPMA 2IWDA 1GCEA 1YQSA 2E8IA 4BQMA 4HEFA 4ID4A 4WEKA 5CTNA 4WYYA 5EPHA 4P6BA 3VFFA 5HW3A 3WS2A 4E6WA 5FQQA 3IHAA 2Y2KA 2HDQA 5EUAA 1PW1A 1ES4A 1Y54A 3EQUA 1BUEA 2X71A 4LENA 5EOEA 4OQGA 5TFQA 5HL1A 2IWCA 4KG6A 3S22A 5CHUA 1ES2A 1XA1A 2WYXA 3HL9A 1DJCA 4OPYA 1PWGA 3OPPA 3PBQA 1MWTA 4ZJ3A 3VP3A 3IXBA 2Y4AA 1KGGA 3V50A 3ZG9B 5DTTA 1JTDA 3HREA 3HBRA 3MXSA 1PYYA 3UNWA 2EXBA 4JF4A 5FI2A 2C6WB 3CMZA 2ZQAA 4YFMA 5E2GA 3WS1A 4HBUA 3G2YA 4S2JA 4KZ6A 4OOMA 4JLFA 4ZJ1A 3UN7A 4FH2A 3FKVA 4GOGA 5CGSA 5CECA 3MXRA 3NIAA 3OZHA 2OLUA 3AGDA 3TG9A 1IYOA 3IF6B 1KDSA 5A91A 2R9WA 5FAQA 3G31A 4LCMA 1RCJA 1ESUA 1Z6FA 4S2NA 5JYPA 4R0QA 4KQQA 4X55A 2OLVA 1GA9A 2J9OA 1KGFA 4WZ4A 3W4OA 2WADA 4BD1A 4OQ0A 4LV0A 1K55C 4K0XA 2VGJA 4KZ7A 3CG5A 1LI0A 4KZ8A 4JF5A 2JC7A 1SKFA 1HZOA 2ZD8A 1MKIA 4S2KA 3NCKA 3Q07A 4CPKA 4X53A 2XLNA 4JKTA 1SHVA 1I2SA 4IEDA 5CGXA 1BLCA 2CC1A 1ERMA 4Y0TA 1NZUA 4DXCA 3SH7A 5BOHA 1XP4A 2ZLYA 3HLFA 3IXGA 2X02A 2ZM8A 4EBNA 2UWXA 4X69A 3WS4A 2PU2A 4LV2A 2PBYA 1BLSA 4RA7A 3GMWA 3LY3A 1K55A 1PWDA 1MWUA 4UA7A 1S0WA 4S2PA 1ERQA 4UHUA 3N8RA 4OONA 1TDLA 3C5AA 3MBZA 4MLLA 4EQIA 5HAIA 5FQJA 1KGEA 2ZQ9A 1WYCA 3O3VA 4GD8A 4O7DA 4U0XA 1L0DA 1FCMA 3OC2A 4C6YA 4RX2A 1ONGA 1MY8A 4FH4A 2Q9MA 5TR7A 4OPRA 5HAPA 3BFGA 1HVBA 4FSFA 4QY6A 2VGKA 5CGWA 4OVDA 3VMAA 3O87A 1BTLA 5HAQA 1QMFA 3IWIA 4UA9A 3WS0A 2Y2MA 2ZMAA 5CTMA 3DWKA 4C75A 1PWCA 2A49A 3P98A 1ES3A 4N1HA 3NY4A 3W8KA 2WGWB 3M6BA 1FCNA 3TSGA 4GZBA 3VOZA 5GLAA 3M2KA 1K4FA 3GVBA 5HX9A 2Q9NA 1TEMA 1PZOA 4OQHA 1GA0A 3N6IA 3QNBA 3GRJA 3SH8A 1VM1A 2Z2MB 1HTZA 3GQZA 2QZ6A 1KVLA 4MEZA 2G2UA 3S1YA 1MPLA 3A3DA 3Q81A 4KENB 4DDYA 3BFEA 5EE8A 4OOLA 3M2JA 3RJUA 2WKEA 1O7EA 2GDNA 2WAEA 4L0LA 4OLGA 3ZVTA 1MWRA 3BFDA 4M3KA 1K6SA 4N9LA 4IBXA 4F94A 3BRMA 1AXBA 5U47A 5EOOA 1GHPA 3MZEA 1I5QA 4X56A 5G18A 2JE5A 2ZQCA 5EVIA 2X01A 1K56A 1L0FA 3FV7A 4QY5A 5HFOA 2XF3A 4XUZA 3G4PA 2XK1A 1NYYA 1KE3A 5AQ9A 2Y2GA 4KZ9A 4BL2A 2PU4A 1H8ZA 1PIOA 4WEJA 2EFXA 3HLCA 5CXWA 4ZBEA 3ZGAB 2WZXA 3Q1FA 4E3JA 2Y2NA 4A5RA 4E3NA 3MFDA 5KZHA 1ZC2A 1HD8A 2WGVA 5I94A 4Y0OA 2ZQ7A 3UDIA 4Y0UA 4CJNA 2XFTA 3IF6C 4B4ZA 5DF7A 1IKIA 1J9MA 1XKZA 2Y91A 2HDRA 3MZDA 3W4PA 4GKUA 3N8LA 4E3OA 5CHJA 5FQKA 2WKIA 5FATA 5GHZA 5CEDA 2WKHA 4R3JA 4X68A 3RXXA 3W4QA 3N4IA 3C4PA 5GLCA 1YLYA 2ZC4B 3C7VA 1BSGA 4MBKA 1FSWA 3BYDA 1K57C 4XXRA 4GB7A 3IHBA 4KZAA 3NI9A 4KQOA 5DTKA 5E43A 5CRFA 3ZCZA 1CEGA 5TGFA 2XD5A 5E2HA 4S2OA 3ZG8B 5FSRA 4KZBA 2QPNA 1EI5A 4UAAA 1XXMA 4OP8A 1KE4A 1E3UD 1E4DA 1W7FA 5FA7A 4P0MA 5A92A 3LO7A 3WRTA 4E3IA 1FSYA 1K4EA 2ZC7A 3GV9A 1GHIA 3MKEA 4U3TA 3ZHHA 2P9VB 4WELA 1JVJA 3A3JA 2EX6A 2HP9A 3BFFA 3Q7VB 3ZVWA 5EECA 3OPRA 3ZFZA 4LV3A 4Y7PA 5GHXA 1W8YA 3HUOA 5FDHA 4OLDA 4PM5A 1K57A 1LI9A 3QHYA 5KSHA 4FD8A 2Y59A 3RXWA 1PW8A 2BLSA 3SOIA 3JYIA 5FASA 2P9VA 3VSKA 4DF6A 3IXDA 1YLTA 4R23A 2XH9A 3CJMA 3ITBA 4WMCA 3IWOA 1JWPA 4WZ5A 1MWSA 4OP5A 3HVFA 3O88A 2H0TA 3UDFA 3WS5A 4QJGA 4DXBA 4EUZA 2V1ZA 4RX3A 1XPBA 1NRFA 4ZAMA 2FFYA 4B88A 1FR6A 3V3SA 2HP5A 2H5SA 1XX2A 4KG5A 2XD1A 3QNCA 1ZKJA 1KDWA 3PBRA 4B4XA 5J8XA 2Y2LA 1RGZA 2Y2JA 3BFCA 4R3BA 1BULA 1NJ4A 1NZOA 3B3XA 2XGNA 3UPPA 1WE4A 3ZG5A 3E2KA 5GHYA 5KSCA 4ZDXA 1IELA 1W5DA 2EX8A 1YMSA 3HUNA 4KZ5A 2H0YA 4UA6A 1RP5A 3P09A 4DRTA 5A90A 3CZDA 1YMXA 4OQIA 2Z2LB 3PBNA 1ESIA 4E3MA 3DTMA 2HDSA 2HP6A 3FZCA 4IBRA 1G68A 3DW0A 3SH9A 2WZZA 4S2LA 3BLSA 1YLPA 3HLWA 4S2IA 3UE1A 5CEBA 4DE0A 4PM6A 1CK3A 4GDBA 3LY4A 2QMIA 1FCOA 1JWZA 4PM8A 4E6XA 3GTCA 4E3KA 4MBHA 4MNRA 1W79A 3M6HA 3WRZA 1PI5A 5EVIB 5GLDA 1N4OA 4BJPA 1XGJA 3HLBA 4RYEA 4EBPA 1NXYA 3G2ZA 3IT9A 3NBLA 5D3OA 3IXHA 1IKGA 1IYQA 3G32A 3N7WA 3UO9A 1W8QA 1QMEA 1K56D 3BM6A 4FCFA 3GR2A 3GSGA 4YINA 2Y55A 3E2LA 3OCLA 3BECA 4R1GA 3PTEA 4KZ4A 2RL3A 3OCNA 1E25A 1YLZA 2BG1A 4MBFA 4S2NC 4BLMA 3Q7VA 4JBFA 1DJAA 4HESA 2EFUA 4NK3A 4K0WA 5DTSA 1BLHA 3SS5A 5M18A 3VP4A 4QB8A 3VFHA 4EBLA 3VSLA 4P85A 3PAGA 4DE1A 3AGEA 1DY6A 1N9BA 4X6TA 3G30A 1DJBA 1KVMA 4KZ3A 3ITAA 1GHMA 2H10A 3NDGA 1SDEA 3NC8A 1YLWA 2WGIA 2WAFA 2DCFA 2V20A 3IF5A 4OPQA 1L2SA 4GNUA 4E3LA 5L2FA 4N1XA 2Y2OA 1FOFA 4JXVA 5E2FA 3VP1A 4QD4A 2EXAA 2IWBA 1U60A 3PBSA 3G34A 4GN2A 3WWXA 3OPHA 1JWVA 1WYBA 1TVFA 3AGFA 2R9XA 1ALQA 3HUMA 4DE3A 2J8YA 3FWLA 4D2OA 3TOIA 4QU3A
chains in the Genus database with same CATH superfamily
4OKPA 2HJEA 4LV1A 4BD0A 3LI9A 1EROA 3UE3A 1LL5A 4NG2A 2ZJ9A 2PD8A 1IEMA 2O9AA 2ZC6B 3T1XA 2J9PA 2ZC3B 5HDCA 5KMWA 3N8SA 4BBUA 1CI8A 3F1NA 3C8CA 5FAOA 1NYMA 1I2WA 1IYPA 1O07A 5DFYA 2WK0A 1K25A 2WGWA 1YT4A 4KQRA 1PZPA 4PM5A 3G35A 1SCWA 5FQ9A 5AQBA 2V2FF 2GJ3A 2PRFA 1S4SA 4JXWA 4U0TA 2P74A 1VQQA 4DN0A 1M40A 5A93A 1K6RA 5HARA 2XEPA 4NETA 1FIKA 4DE2A 4OOYA 1OTDA 5IHVA 1LLBA 3HLEA 4PPRA 2VGLM 2Y2PA 3MMHA 3ISGA 1ZG6A 2INWA 1XA7A 1K54A 3UY6A 4WM9A 4QPRA 1A0KA 2VV6A 4WMCD 4PM7A 3S4XA 2Z6CA 3VP2A 1LHYA 3HJIA 1TDGA 4ARZA 1K38A 1GCEA 1S66L 4WYYA 3VFFA 5HW3A 3F1OB 1L3LA 2HDQA 1PW1A 1S67L 4HOIA 4OQGA 5HL1A 4KG6A 3T4TA 1NLZA 3R7WA 3HL9A 4I3IA 3OPPA 4CLCD 3VP3A 3IXBA 3L9KA 3V50A 5DTTA 1JTDA 3U2AA 3UB7A 4YWZA 2C6WB 3CMZA 2ZQAA 4O0PA 4HBUA 3G2YA 4ZJ1A 4KZ6A 3UN7A 1Z09A 3VFHA 5CECA 3LIAA 4Y17A 3MXRA 4BBVA 1F98A 3R4KA 1ODVA 4MDZA 1KDSA 3LR3A 3CITA 1Z6FA 2B95A 4R0QA 3T4KA 4D60A 3DTKA 2QKPA 4WZ4A 2WADA 2GNXA 4OQ0A 5AVFA 1K55C 1OTEA 1SKFA 1HZOA 3NJAA 2KOIA 2XLNA 4JKTA 1SHVA 1UWNX 2CC1A 5HWTA 1NZUA 3SH7A 1XP4A 2UWXA 4LV2A 1HLUP 3LY3A 3OLOA 1S0WA 4UHUA 1T1BA 2NUTC 4YNRA 1TDLA 3C5AA 2PYPA 4EQIA 3C38A 5HAIA 1KGEA 1L0DA 1FCMA 5EV0A 4ETZA 2JKRI 5TR7A 3ZQ5A 4FSFA 5HPIA 3EEHA 4IUKA 4OVDA 3IX3A 3P7NA 2ZMAA 3DWKA 4PKYG 2YKFA 3NY4A 4HNBA 2WGWB 3TSGA 3VOZA 5HX9A 1K4FA 2VV7A 3EOIA 4OQHA 3QNBA 2J80A 1ZHHB 1HTZA 2Z2MB 1KVLA 2G2UA 3Q81A 5EE8A 2UV0E 3VE4A 2GDNA 2WAEA 4L0LA 1MWRA 3BFDA 4M3KA 1ACFA 4X56A 2JE5A 2ZQCA 1K56A 1L0FA 4QY5A 4XUZA 2V8CA 4ESPA 2Y2GA 2V1BA 4KZ9A 1H0MA 2PBDP 2V8FA 4ZBEA 3Q1FA 3RH8B 4E3JA 3MFDA 1ZC2A 1HD8A 3CAXA 5I5LA 2WGVA 2JKTI 2ZQ7A 4CJNA 5DF7A 4KUOA 3W4PA 2HDRA 4WF0A 1YPRA 3T4OA 5FQKA 2WKIA 5CEDA 3W4QA 5LBRA 1BSGA 3CWFA 4GB7A 2BASA 4KQOA 5CRFA 1CEGA 4PKYA 1N9LA 5G4ZA 3DAVA 1EI5A 4P0MA 2ZC7A 3GV9A 4YOFA 3A3JA 2XA7M 2EX6A 3ZVWA 5EECA 4LV3A 3HUOA 2B18A 1K57A 3QHYA 5KSHA 2BLSA 1XFQA 3H82A 4DXBA 2FFYA 4BBTA 3V3SA 2H5SA 2XD1A 4GHIA 4B4XA 2Y2LA 4R3BA 1NJ4A 4B93A 1ZTUA 3UPPA 4Q0JA 3ZG5A 4ZDXA 1W5DA 2EX8A 1YMSA 1RP5A 5A90A 4OQIA 1VEUB 2ZL1A 3PBNA 3NECA 3LIDA 2VK3A 2HDSA 3E4OA 1N9NA 1CK3A 4GDBA 4PM8A 1FCOA 3GTCA 3QP1A 4E3KA 4HP9A 1XGJA 4Y15A 4RYEA 4EBPA 1NXYA 2OOLA 5D3OA 1YSPA 2PDRA 3IXHA 4O01A 3UO9A 1W8QA 3E0YA 3U4LP 3BM6A 4IHQA 2GZAA 4HY8A 4PHTA 4CLCE 3OCLA 4GS9A 4II7A 3BECA 2XRNA 3PTEA 3OCNA 5HPFA 3T12B 1DJAA 4HESA 4NK3A 3BQAA 4K0WA 3VP4A 4QB8A 3VSLA 2W3EA 1OTAA 3PAGA 1H3QA 1SDEA 2WGIA 5DFXA 2JN7A 2DCFA 2V20A 4OPQA 2O0YA 4N1XA 1FOFA 4QD4A 2VA0A 2R9XA 1ALQA 4DE3A 3QP6A 5I94A 1GSWA 2AVXA 3QP4A 1E3UA 4HQAA 4R4SA 3IWQA 5GL9A 4EWFA 1OMEA 2P08A 2W3DA 1IYSA 3W2ZA 5FI7A 4MN5A 1NWZA 4PMAA 4G3VA 1CJFA 1L0EA 2ZQDA 2JKRM 1EWZA 5CX7A 3ZNTA 5JYOA 4JXGA 5M1AA 1BLPA 3Q82A 3LCEA 4LLOB 5FQIA 2PR5A 1S6RA 2OV5A 3SS3A 1XGIA 1ES5A 5HSQA 2WUQA 5M19A 5IU1A 5HD5A 3DBAA 3FPWA 3UPNA 1LSXA 1H8MA 5F1FA 3H7WA 4JGQA 1K54C 5AQ7A 5FQMA 2W3HA 3IQAA 4BL3A 4P87A 5F68A 1OT9A 4H6JA 1RGYA 3A3FA 3ZYTA 5DF9A 5CHMA 5DF8A 1MXOA 4GDNA 1C3BA 2ZQ8A 1YLJA 1FILA 1Q2QA 1N9OA 4WZ5C 3ZDJA 2OSUA 2VJWA 2A3UA 3CI6A 3OPLA 4EESA 1JTGA 2ZBBA 4NXFA 2V1AA 3MQOA 2JCHA 3TW8A 3VOYA 4R70A 2YKHA 3T4SA 4R4RA 3CLOA 3O86A 4JXSA 4HBTA 3B42A 3C4OA 3I7JA 3MXQA 4XUXA 4JPMA 3PR6A 4ID4A 3WS2A 4E6WA 5FQQA 3IHAA 1YAXA 5EUAA 4LENA 5EOEA 2Y79A 4WN5A 1MC0A 2WYXA 2D02A 3LFVA 5FDSA 1T18A 1KGGA 3MXSA 2BTFP 4I5SA 3TE8A 1PYYA 5FI2A 4JF4A 1XFNA 4KUKA 5J7EA 3E4QA 4YFMA 3WS1A 2ZOHA 4FH2A 4GOGA 3OZHA 3D9YA 4BWIA 1IYOA 5A91A 1IOUA 4LCMA 4X55A 2KX6A 2OLVA 1GA9A 5HL6A 1KGFA 2K2NA 2L4RA 3LR5A 1MKIA 5F5YA 3Q07A 4XT2B 4IEDA 5CGXA 1ERMA 3A0VA 3UE6A 4Y0TA 5BOHA 3GECA 5G4YA 3HLFA 3IXGA 3T1SA 3MQQA 3WS4A 1MZUA 1PWDA 1MWUA 3N8RA 3LIBA 2VV8A 1BYWA 4WUJA 3O3VA 4U0XA 5TJJA 3OC2A 4RX2A 2WKPA 2OWJA 1MY8A 4FH4A 5HAPA 3BFGA 3OOVA 4QY6A 2PYRA 5CGWA 5HDDA 2V0WA 3VMAA 2VLGA 3IWIA 5A8BA 3WS0A 2M1CA 5CTMA 1ES3A 4L9GA 3M6BA 1FCNA 3H9WA 1TEMA 1PZOA 3BWLA 1Y28A 2QJ5A 3GRJA 3SH8A 4FOFA 4DDYA 4KENB 5FEGA 3BFEA 2WKEA 1O7EA 3EEAA 1X0OA 2JKTM 1AXBA 3KYZA 5HD3A 3MZEA 2OAQ1 1G28A 3K3CA 2X01A 4X25A 2XF3A 2PR6A 5EFWA 5EVEA 1PIOA 2EFXA 5CXWA 3ZGAB 2WZXA 4E3NA 5KZHA 5HZHA 4Y0OA 2PHYA 3R7WB 3IF6C 3BJNA 3FPVA 1V9YA 2OWHA 3CUEA 4L9FA 5FEFA 2WKHA 3C4PA 2ZC4B 2ZMFA 4MBKA 5EM0A 1K57C 4LRZE 5DTKA 3ZCZA 5FSRA 4EU0A 4EEPA 1XXMA 1E3UD 1E4DA 3LO7A 3WRTA 2G7UA 4E3IA 2QYBA 3ZHHA 3NOUC 2P9VB 1JVJA 2LB9A 4OLDA 3KSGA 4FD8A 3SOIA 5FASA 5J4EA 1PNEA 4R23A 2XH9A 4WZ5A 1J3WA 1MWSA 3HVFA 1TF1A 2H0TA 1F2KA 3TRCA 2V1ZA 4RX3A 3NOPC 4ZAMA 2HGVA 2ZOIA 3K2NA 3PBRA 5J8XA 3MR0A 1WE4A 5KSCA 5GHYA 3MQ0A 1IELA 2H0YA 4UA6A 4DRTA 5HWWA 3QP8A 4DMZA 2Z2LB 2VX8A 4E3MA 3GDIA 3DTMA 1P9RA 2HP6A 5K5BA 2WZZA 4S2LA 4S2IA 3HLWA 3UE1A 4Q0IA 4DE0A 4PM6A 3LY4A 2QMIA 4MNRA 1PI5A 1N4OA 4EEUA 3HLBA 1SKOA 3IT9A 4IJGA 1T1AA 3GR2A 4YINA 1Y4OA 2J3TC 4NEED 4KZ4A 2L0WA 4MBFA 4BLMA 1S4RA 5DJUA 5AVEA 4HI4A 2W1RA 4DE1A 3UB6A 3G30A 1DJBA 1GHMA 2H10A 3KSFA 5L2FA 2Y2OA 1LSVA 1F5MA 3IS2B 4LFUA 3PBSA 4GN2A 3FWLA 3TOIA 4QU3A 2HPBA 3LR0A 4IVKA 2HDUA 5DJTA 2KLIA 3VP0A 4CLCB 3V3RA 4OH0A 3DTEA 1YM1A 4ZJ2A 5EVIC 2Y2QA 2HV1A 1ONHA 3UE0A 1LL9A 4C3QA 3UMDA 4B9OA 1SDNA 1VETB 2ZM2A 3S7NA 3V5MA 3IBJA 4PM9A 1PI4A 1UWPX 3DWZA 4K91A 4OPZA 5F1GA 4KG2A 4HH2A 3ZG0A 5F82A 3NDEA 2PT7A 1FQGA 1KE0A 1W63Q 1H8YA 1G6AA 2DNSA 4F3LA 1BZAA 1OPXA 2XFSA 4DKIA 3UDXA 2HJ9C 3KYQA 5TBMB 2ZC5B 5EVLA 3IF6A 3UPOA 2Y2IA 4MCWA 2B5RA 1NY0A 4N92A 5AQAA 3D4FA 2C5WB 2R78A 3FYZA 3KSIA 4Z9QA 1H5XA 1T19A 4LRYC 2XDMA 1CEFA 4GJ4A 3LEZA 3BEBA 5FI6A 4EV4A 2IWDA 1YQSA 2E8IA 3CUEC 4HEFA 2HZ5A 4WEKA 5EPHA 4P6BA 2A24A 2Y2KA 1ES4A 3EQUA 2X71A 2K31A 5TFQA 3V67A 3S22A 5CHUA 4E04A 4Y5FA 1XA1A 2EWWA 4OPYA 3LICA 2W3FA 4ZJ3A 2Y4AA 3HREA 2QWSA 4CQHA 3IS2A 3KYEA 5DKLA 5E2GA 4S2JA 1TS0A 3KX0X 4JLFA 4OOMA 3FKVA 3DTIA 3F1PA 3NIAA 4R6LA 3TG9A 3B47A 3IF6B 2R9WA 5FAQA 1RCJA 3A0RA 4I38A 1LSWA 5JYPA 4I3JA 3F1OA 5TBMA 2V9AA 2J9OA 4G3WA 2VGJA 4KZ7A 4KZ8A 4JF5A 2JC7A 4S2KA 2M7UA 4CPKA 4ETXA 1I2SA 3KSHA 3G6OA 4DXCA 2ZLYA 2X02A 4ARZB 1BLSA 4XT2A 4UA7A 3IBRA 1TD5A 3IX8A 5FQJA 1WYCA 3RFBA 3LIEA 3C2WA 1ONGA 4MMNA 5F69A 2Q9MA 1TS7A 2A24B 1NLYA 5HAQA 3ULFA 1WA9A 4UA9A 2Y2MA 2A49A 4N1HA 3W8KA 4HHDA 5GLAA 1YSQA 1GA0A 2IA2A 4MEZA 3S1YA 1MPLA 3A3DA 3S7PA 1D7EA 2MJ6A 3RJUA 4G3KA 3ZVTA 4IBXA 3BRMA 5C5KA 1LT0A 5EVIA 3FV7A 4EERA 3G4PA 2XK1A 2WKQA 1KE3A 1XJ4A 5J3WA 5AJGA 3CPTA 1H8ZA 4WEJA 2Y2NA 4A5RA 4GLQA 3VV4A 3LI8A 4HJ3A 3UDIA 4Y0UA 4GS9B 2XFTA 3LUQA 4B4ZA 1IKIA 1J9MA 1XKZA 3MZDA 3N8LA 4E3OA 5CHJA 5FATA 3H7WB 4M4XA 4X68A 2EWVA 3N4IA 5GLCA 3C7VA 2DMWA 3BYDA 5TGFA 2XD5A 4S2OA 2H28A 4KZBA 4UAAA 4OP8A 1KE4A 5A92A 1K4EA 4JGPA 4U3TA 4WELA 2D01A 2HP9A 3ZFZA 3OPRA 4I39A 4Y7PA 1W8YA 4Y13A 1LI9A 4Z1WA 4HH3A 3K3DA 3C30A 3RXWA 3IXDA 4X1LA 4WMCA 3IWOA 3WS5A 4QJGA 4HJ6A 3O88A 3LYXA 4EUZA 1SZVA 1XPBA 4B88A 4RQ9A 2HP5A 3PXPA 1XX2A 4KG5A 3NHQA 3QNCA 1OTIA 1KDWA 3QP2A 1RGZA 1VHMA 1F9IA 3B3XA 4LRXC 3T1QB 4X1MA 3CHWP 5MC7A 3HUNA 4KZ5A 3BY8A 3P09A 3CZDA 4QWOA 1T1CA 3LGOA 2VKSA 3FZCA 4L9EA 3DW0A 3CPTB 3SH9A 3BLSA 1YLPA 2VGLS 3JPUA 1JWZA 1MKMA 4MBHA 4JGOA 1EW0A 3M6HA 5EVIB 5GLDA 4AFIA 5F6AA 4ZRRA 3MJQA 3NBLA 1IKGA 1IYQA 3G32A 2W1TA 3N7WA 3MFXA 4UEYA 4FCFA 3E4PA 3E2LA 4R1GA 2RL3A 1E25A 2Z6DA 3Q7VA 1BLHA 3MS6A 3SS5A 4EBLA 4P85A 1DP6A 1G6OA 1KOUA 3AGEA 3MF0A 4KZ3A 4NKPA 3BY9A 3NDGA 1YLWA 4E3LA 3IF5A 2ZL1B 5E2FA 3VP1A 2EXAA 3WWXA 1JWVA 1WYBA 1TVFA 3AGFA 3HUMA 1GSVA 4D2OA 2G2WA 3A3EA 2QHKA 2OAP1 4Q8IA 1OT6A 3ZNYA 5E2EA 5L10A 1ZG4A 4QHCA 3PBTA 1Q2PA 3A3IA 2E8JA 3UMEA 5F83A 2RCXA 3A0SA 1VEUA 2I72A 3C7UA 3HLDA 3D72A 3PAEA 3EQVA 3Q7ZA 4JF6A 3PBOA 4EETB 2O9CA 4GHIB 4UQIS 4P6ZM 3SS4A 3UB9A 1XJ3A 5CERA 3HLGA 3EGDC 1CI9A 3F1PB 2PAVP 2J7VA 2J3TD 1D1JA 3TJZC 1M6KA 2CMNA 4NXGA 3HCYA 2I9VA 4DDSA 3LR4A 4K08A 3BLMA 3MZFA 1L0GA 5EVID 4R3AA 3T50A 5IT5A 2LB5A 1SKOB 4LCLA 5GLBA 5DVAA 2ZM0A 1MBLA 2FH5A 2JBFA 2XR0A 4N9KA 3MKFA 4RVAA 2EX9A 3EWKA 2GX5A 3VE3A 3S7OA 4H8RA 4ZTKA 4GD6A 5FAPA 2XQZA 4IVIA 4CLCC 3ZG7B 4GW9A 4FUWA 4MN6A 3IH9A 1BT5A 3PYPA 2Y2HA 4S2MA 2DRWA 4KQDA 3IH8A 1FR1A 4BENA 2FFFB 4WBGA 3V39A 2EX2A 1OJ5A 3FKWA 3T4JA 3RTYA 1V9ZA 3FG8A 4BQMA 5CTNA 5L09A 3NULA 2KDKA 3BQ8A 2XSSA 2P04A 2HF6A 1P0ZA 1Y54A 1BUEA 2NUPC 2ZMVA 2IWCA 1ES2A 1DJCA 1PWGA 3PBQA 1MWTA 3LEQA 4HJ4A 4FTXA 4NXBA 3ZG9B 3HBRA 3UNWA 2EXBA 2XROA 5CGSA 1CQAA 3JVUA 2OLUA 3AGDA 2L1MA 1GSXA 1P9WA 3G31A 1ESUA 2Y8HA 4S2NA 2O9BA 2VEAA 5DKKA 2M7VA 4KQQA 1W63M 1PFLA 2Q0OA 4WL9A 4F3LB 3W4OA 4JGRA 3O5YA 4BD1A 4LV0A 1VETA 4K0XA 3CG5A 1LI0A 2ZD8A 3B33A 3NCKA 4I3AA 3JVVA 4X53A 3UB5P 1BLCA 2B02A 2JKFA 2ZM8A 4EBNA 4X69A 2PU2A 2PBYA 4RA7A 3GMWA 1K55A 1XJ6A 1G5UA 1XJ2A 3ICYA 4S2PA 1ERQA 4OONA 3MBZA 4MLLA 4Y3IA 2ZQ9A 4O7DA 1UGUA 4GD8A 2W27A 4C6YA 1TS8A 1VB6A 4OPRA 2JKGA 1HVBA 4UQIM 2VGKA 3UB8A 4P6ZS 1NRJA 3O87A 1BTLA 4LGWA 1K0KA 1QMFA 4C75A 4EXOA 1PWCA 3P98A 2W0NA 4PAUA 4BMWA 4GZBA 3M2KA 3GVBA 4R38A 2Q9NA 2QJ7A 2XA7S 3N6IA 1VM1A 3GQZA 2QZ6A 1OJGA 4OOLA 3M2JA 4OLGA 2V0UA 1K6SA 4N9LA 4F94A 5U47A 5EOOA 1GHPA 1I5QA 5G18A 3IX4A 4O8GA 5HFOA 3EGXC 1AWIA 4WLAA 1NYYA 5AQ9A 3VOLA 4BL2A 2PU4A 2A2LA 2ACGA 3HLCA 4H6JB 1DP8A 2P7JA 2K7SA 3QP5A 2Y91A 4GKUA 3L7HA 5GHZA 3BW6A 4R3JA 3RXXA 1YLYA 1D06A 1FSWA 4XXRA 3IHBA 4KZAA 3NI9A 5E43A 4ME4A 5E2HA 3ZG8B 2VZWA 2QPNA 1S1ZA 1YKDA 4HP4A 1W7FA 5FA7A 4DJ3A 3SW1A 1FSYA 3MKEA 1GHIA 4EQ1A 3BFFA 3Q7VB 5GHXA 5FDHA 3E98A 3KO6A 4DJ2A 2Y59A 4EW7A 1PW8A 1LL8A 3JYIA 2P9VA 3VSKA 4DF6A 1YLTA 3T4QA 3CJMA 1IFQA 3ITBA 1JWPA 4OP5A 3UDFA 4CLCA 1NRFA 1FR6A 3FC7A 2JHEA 1ZKJA 2W3GA 3BFCA 2Y2JA 1BULA 1NZOA 3H82B 2W1TB 2XGNA 3E2KA 1OTBA 3F1NB 3OBFA 3LIFA 1DRMA 4HIAA 1YMXA 2WKRA 1ESIA 3P01A 3NOTC 3S7QA 2EA9A 4IBRA 1G68A 1S1YA 2FZ0A 3D3OA 2J3WA 5CEBA 4E6XA 1W79A 3MSHA 4BJPA 1PRQA 5IS1A 3SZTA 3G2ZA 4LPZA 1P97A 5EM1A 5HDSA 1QMEA 1K56D 1STZA 3GSGA 2Y55A 3T4LA 5FL3A 3T1RA 1YLZA 2BG1A 4S2NC 4JBFA 5DTSA 2EFUA 5M18A 4MN7A 4EUVA 1DP9A 5HWVA 4Q0HA 1DY6A 1N9BA 4X6TA 5L8MA 1KVMA 4GCZA 3ITAA 4NXEA 3NC8A 4Y2FA 3PHYA 2WAFA 2O99A 2PD7A 5L07A 1L2SA 4GNUA 4JXVA 1CF0A 5KIZA 4IUHA 1TS6A 2IWBA 1U60A 3G34A 1JNUA 3OPHA 3HJKA 2J8YA 3WRZA
chains in the Genus database with same CATH topology
2G2WA 3A3EA 1E3UA 2HPBA 4OKPA 4R4SA 3IWQA 4LV1A 4Q8IA 5GL9A 4IVKA 3ZNYA 5E2EA 2HDUA 3VP0A 4EWFA 1OMEA 1ZG4A 3V3RA 1IYSA 4OH0A 4BD0A 4QHCA 5FI7A 3PBTA 1Q2PA 3A3IA 1YM1A 1EROA 4ZJ2A 5EVIC 1LL5A 3UE3A 2Y2QA 1ONHA 3UE0A 1LL9A 2ZJ9A 4C3QA 5F83A 2RCXA 4PMAA 1IEMA 2I72A 2ZC6B 1SDNA 2ZM2A 1L0EA 2ZQDA 3C7UA 1EWZA 2J9PA 2ZC3B 5KMWA 3N8SA 3HLDA 1CI8A 5FAOA 3PAEA 3EQVA 3Q7ZA 3ZNTA 5JYOA 1NYMA 4JF6A 1I2WA 1IYPA 3PBOA 4JXGA 5M1AA 1O07A 2WK0A 1K25A 3V5MA 2WGWA 1BLPA 3Q82A 3LCEA 1YT4A 4PM9A 4KQRA 1PI4A 5FQIA 1S6RA 3DWZA 1PZPA 4K91A 4OPZA 2OV5A 1XGIA 3SS4A 3G35A 3SS3A 1SCWA 1ES5A 5FQ9A 2WUQA 5CERA 5M19A 3HLGA 5F1GA 4KG2A 3ZG0A 5AQBA 2V2FF 5F82A 3NDEA 1CI9A 2J7VA 3UPNA 4JXWA 4U0TA 1M6KA 5F1FA 1FQGA 2P74A 1VQQA 1KE0A 4DDSA 1K54C 1H8YA 5AQ7A 5FQMA 3BLMA 1G6AA 1M40A 5A93A 3MZFA 1L0GA 1K6RA 5EVID 5HARA 3IQAA 4BL3A 2DNSA 4P87A 2XEPA 1BZAA 4NETA 4LCLA 5GLBA 4DE2A 4OOYA 5DVAA 1RGYA 5IHVA 1LLBA 2XFSA 2ZM0A 1MBLA 3A3FA 4DKIA 2JBFA 2XR0A 4N9KA 5CHMA 3HLEA 3MKFA 5DF9A 3UDXA 4PPRA 4RVAA 2EX9A 2Y2PA 3ISGA 2ZC5B 1ZG6A 1XA7A 5DF8A 1K54A 4H8RA 3UY6A 1MXOA 4GDNA 4WM9A 1C3BA 2ZQ8A 1YLJA 5EVLA 1Q2QA 4ZTKA 4GD6A 3IF6A 4WZ5C 2XQZA 5FAPA 2Y2IA 3UPOA 4WMCD 4PM7A 3ZDJA 4IVIA 3S4XA 2OSUA 3ZG7B 2B5RA 2A3UA 3OPLA 3IH9A 1BT5A 1JTGA 1NY0A 4N92A 2Y2HA 5AQAA 2JCHA 4S2MA 2DRWA 2C5WB 3D4FA 3VP2A 3VOYA 3IH8A 3FYZA 1FR1A 4Z9QA 1H5XA 4BENA 2FFFB 4WBGA 3V39A 1LHYA 4R4RA 2XDMA 3O86A 1CEFA 1TDGA 2EX2A 4JXSA 1K38A 4HBTA 3LEZA 3BEBA 5FI6A 3FKWA 3C4OA 3I7JA 4EV4A 4XUXA 4JPMA 2IWDA 1GCEA 1YQSA 2E8IA 4BQMA 4HEFA 4ID4A 4WEKA 5CTNA 4WYYA 5EPHA 4P6BA 3VFFA 5HW3A 3WS2A 4E6WA 5FQQA 3IHAA 2Y2KA 2HDQA 5EUAA 1PW1A 1ES4A 1Y54A 3EQUA 1BUEA 2X71A 4LENA 5EOEA 4OQGA 5TFQA 5HL1A 2IWCA 4KG6A 3S22A 5CHUA 1ES2A 1XA1A 2WYXA 3HL9A 1DJCA 4OPYA 1PWGA 3OPPA 3PBQA 1MWTA 4ZJ3A 3VP3A 3IXBA 2Y4AA 1KGGA 3V50A 3ZG9B 5DTTA 1JTDA 3HREA 3HBRA 3MXSA 1PYYA 3UNWA 2EXBA 4JF4A 5FI2A 2C6WB 3CMZA 2ZQAA 4YFMA 5E2GA 3WS1A 4HBUA 3G2YA 4S2JA 4KZ6A 4OOMA 4JLFA 4ZJ1A 3UN7A 4FH2A 3FKVA 4GOGA 5CGSA 5CECA 3MXRA 3NIAA 3OZHA 2OLUA 3AGDA 3TG9A 1IYOA 3IF6B 1KDSA 5A91A 2R9WA 5FAQA 3G31A 4LCMA 1RCJA 1ESUA 1Z6FA 4S2NA 5JYPA 4R0QA 4KQQA 4X55A 2OLVA 1GA9A 2J9OA 1KGFA 4WZ4A 3W4OA 2WADA 4BD1A 4OQ0A 4LV0A 1K55C 4K0XA 2VGJA 4KZ7A 3CG5A 1LI0A 4KZ8A 4JF5A 2JC7A 1SKFA 1HZOA 2ZD8A 1MKIA 4S2KA 3NCKA 3Q07A 4CPKA 4X53A 2XLNA 4JKTA 1SHVA 1I2SA 4IEDA 5CGXA 1BLCA 2CC1A 1ERMA 4Y0TA 1NZUA 4DXCA 3SH7A 5BOHA 1XP4A 2ZLYA 3HLFA 3IXGA 2X02A 2ZM8A 4EBNA 2UWXA 4X69A 3WS4A 2PU2A 4LV2A 2PBYA 1BLSA 4RA7A 3GMWA 3LY3A 1K55A 1PWDA 1MWUA 4UA7A 1S0WA 4S2PA 1ERQA 4UHUA 3N8RA 4OONA 1TDLA 3C5AA 3MBZA 4MLLA 4EQIA 5HAIA 5FQJA 1KGEA 2ZQ9A 1WYCA 3O3VA 4GD8A 4O7DA 4U0XA 1L0DA 1FCMA 3OC2A 4C6YA 4RX2A 1ONGA 1MY8A 4FH4A 2Q9MA 5TR7A 4OPRA 5HAPA 3BFGA 1HVBA 4FSFA 4QY6A 2VGKA 5CGWA 4OVDA 3VMAA 3O87A 1BTLA 5HAQA 1QMFA 3IWIA 4UA9A 3WS0A 2Y2MA 2ZMAA 5CTMA 3DWKA 4C75A 1PWCA 2A49A 3P98A 1ES3A 4N1HA 3NY4A 3W8KA 2WGWB 3M6BA 1FCNA 3TSGA 4GZBA 3VOZA 5GLAA 3M2KA 1K4FA 3GVBA 5HX9A 2Q9NA 1TEMA 1PZOA 4OQHA 1GA0A 3N6IA 3QNBA 3GRJA 3SH8A 1VM1A 2Z2MB 1HTZA 3GQZA 2QZ6A 1KVLA 4MEZA 2G2UA 3S1YA 1MPLA 3A3DA 3Q81A 4KENB 4DDYA 3BFEA 5EE8A 4OOLA 3M2JA 3RJUA 2WKEA 1O7EA 2GDNA 2WAEA 4L0LA 4OLGA 3ZVTA 1MWRA 3BFDA 4M3KA 1K6SA 4N9LA 4IBXA 4F94A 3BRMA 1AXBA 5U47A 5EOOA 1GHPA 3MZEA 1I5QA 4X56A 5G18A 2JE5A 2ZQCA 5EVIA 2X01A 1K56A 1L0FA 3FV7A 4QY5A 5HFOA 2XF3A 4XUZA 3G4PA 2XK1A 1NYYA 1KE3A 5AQ9A 2Y2GA 4KZ9A 4BL2A 2PU4A 1H8ZA 1PIOA 4WEJA 2EFXA 3HLCA 5CXWA 4ZBEA 3ZGAB 2WZXA 3Q1FA 4E3JA 2Y2NA 4A5RA 4E3NA 3MFDA 5KZHA 1ZC2A 1HD8A 2WGVA 5I94A 4Y0OA 2ZQ7A 3UDIA 4Y0UA 4CJNA 2XFTA 3IF6C 4B4ZA 5DF7A 1IKIA 1J9MA 1XKZA 2Y91A 2HDRA 3MZDA 3W4PA 4GKUA 3N8LA 4E3OA 5CHJA 5FQKA 2WKIA 5FATA 5GHZA 5CEDA 2WKHA 4R3JA 4X68A 3RXXA 3W4QA 3N4IA 3C4PA 5GLCA 1YLYA 2ZC4B 3C7VA 1BSGA 4MBKA 1FSWA 3BYDA 1K57C 4XXRA 4GB7A 3IHBA 4KZAA 3NI9A 4KQOA 5DTKA 5E43A 5CRFA 3ZCZA 1CEGA 5TGFA 2XD5A 5E2HA 4S2OA 3ZG8B 5FSRA 4KZBA 2QPNA 1EI5A 4UAAA 1XXMA 4OP8A 1KE4A 1E3UD 1E4DA 1W7FA 5FA7A 4P0MA 5A92A 3LO7A 3WRTA 4E3IA 1FSYA 1K4EA 2ZC7A 3GV9A 1GHIA 3MKEA 4U3TA 3ZHHA 2P9VB 4WELA 1JVJA 3A3JA 2EX6A 2HP9A 3BFFA 3Q7VB 3ZVWA 5EECA 3OPRA 3ZFZA 4LV3A 4Y7PA 5GHXA 1W8YA 3HUOA 5FDHA 4OLDA 4PM5A 1K57A 1LI9A 3QHYA 5KSHA 4FD8A 2Y59A 3RXWA 1PW8A 2BLSA 3SOIA 3JYIA 5FASA 2P9VA 3VSKA 4DF6A 3IXDA 1YLTA 4R23A 2XH9A 3CJMA 3ITBA 4WMCA 3IWOA 1JWPA 4WZ5A 1MWSA 4OP5A 3HVFA 3O88A 2H0TA 3UDFA 3WS5A 4QJGA 4DXBA 4EUZA 2V1ZA 4RX3A 1XPBA 1NRFA 4ZAMA 2FFYA 4B88A 1FR6A 3V3SA 2HP5A 2H5SA 1XX2A 4KG5A 2XD1A 3QNCA 1ZKJA 1KDWA 3PBRA 4B4XA 5J8XA 2Y2LA 1RGZA 2Y2JA 3BFCA 4R3BA 1BULA 1NJ4A 1NZOA 3B3XA 2XGNA 3UPPA 1WE4A 3ZG5A 3E2KA 5GHYA 5KSCA 4ZDXA 1IELA 1W5DA 2EX8A 1YMSA 3HUNA 4KZ5A 2H0YA 4UA6A 1RP5A 3P09A 4DRTA 5A90A 3CZDA 1YMXA 4OQIA 2Z2LB 3PBNA 1ESIA 4E3MA 3DTMA 2HDSA 2HP6A 3FZCA 4IBRA 1G68A 3DW0A 3SH9A 2WZZA 4S2LA 3BLSA 1YLPA 3HLWA 4S2IA 3UE1A 5CEBA 4DE0A 4PM6A 1CK3A 4GDBA 3LY4A 2QMIA 1FCOA 1JWZA 4PM8A 4E6XA 3GTCA 4E3KA 4MBHA 4MNRA 1W79A 3M6HA 3WRZA 1PI5A 5EVIB 5GLDA 1N4OA 4BJPA 1XGJA 3HLBA 4RYEA 4EBPA 1NXYA 3G2ZA 3IT9A 3NBLA 5D3OA 3IXHA 1IKGA 1IYQA 3G32A 3N7WA 3UO9A 1W8QA 1QMEA 1K56D 3BM6A 4FCFA 3GR2A 3GSGA 4YINA 2Y55A 3E2LA 3OCLA 3BECA 4R1GA 3PTEA 4KZ4A 2RL3A 3OCNA 1E25A 1YLZA 2BG1A 4MBFA 4S2NC 4BLMA 3Q7VA 4JBFA 1DJAA 4HESA 2EFUA 4NK3A 4K0WA 5DTSA 1BLHA 3SS5A 5M18A 3VP4A 4QB8A 3VFHA 4EBLA 3VSLA 4P85A 3PAGA 4DE1A 3AGEA 1DY6A 1N9BA 4X6TA 3G30A 1DJBA 1KVMA 4KZ3A 3ITAA 1GHMA 2H10A 3NDGA 1SDEA 3NC8A 1YLWA 2WGIA 2WAFA 2DCFA 2V20A 3IF5A 4OPQA 1L2SA 4GNUA 4E3LA 5L2FA 4N1XA 2Y2OA 1FOFA 4JXVA 5E2FA 3VP1A 4QD4A 2EXAA 2IWBA 1U60A 3PBSA 3G34A 4GN2A 3WWXA 3OPHA 1JWVA 1WYBA 1TVFA 3AGFA 2R9XA 1ALQA 3HUMA 4DE3A 2J8YA 3FWLA 4D2OA 3TOIA 4QU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G2W A;  3A3E A;  1E3U A;  2HPB A;  4OKP A;  4R4S A;  3IWQ A;  4LV1 A;  4Q8I A;  5GL9 A;  4IVK A;  3ZNY A;  5E2E A;  2HDU A;  3VP0 A;  4EWF A;  1OME A;  1ZG4 A;  3V3R A;  1IYS A;  4OH0 A;  4BD0 A;  4QHC A;  5FI7 A;  3PBT A;  1Q2P A;  3A3I A;  1YM1 A;  1ERO A;  4ZJ2 A;  5EVI C;  1LL5 A;  3UE3 A;  2Y2Q A;  1ONH A;  3UE0 A;  1LL9 A;  2ZJ9 A;  4C3Q A;  5F83 A;  2RCX A;  4PMA A;  1IEM A;  2I72 A;  2ZC6 B;  1SDN A;  2ZM2 A;  1L0E A;  2ZQD A;  3C7U A;  1EWZ A;  2J9P A;  2ZC3 B;  5KMW A;  3N8S A;  3HLD A;  1CI8 A;  5FAO A;  3PAE A;  3EQV A;  3Q7Z A;  3ZNT A;  5JYO A;  1NYM A;  4JF6 A;  1I2W A;  1IYP A;  3PBO A;  4JXG A;  5M1A A;  1O07 A;  2WK0 A;  1K25 A;  3V5M A;  2WGW A;  1BLP A;  3Q82 A;  3LCE A;  1YT4 A;  4PM9 A;  4KQR A;  1PI4 A;  5FQI A;  1S6R A;  3DWZ A;  1PZP A;  4K91 A;  4OPZ A;  2OV5 A;  1XGI A;  3SS4 A;  3G35 A;  3SS3 A;  1SCW A;  1ES5 A;  5FQ9 A;  2WUQ A;  5CER A;  5M19 A;  3HLG A;  5F1G A;  4KG2 A;  3ZG0 A;  5AQB A;  2V2F F;  5F82 A;  3NDE A;  1CI9 A;  2J7V A;  3UPN A;  4JXW A;  4U0T A;  1M6K A;  5F1F A;  1FQG A;  2P74 A;  1VQQ A;  1KE0 A;  4DDS A;  1K54 C;  1H8Y A;  5AQ7 A;  5FQM A;  3BLM A;  1G6A A;  1M40 A;  5A93 A;  3MZF A;  1L0G A;  1K6R A;  5EVI D;  5HAR A;  3IQA A;  4BL3 A;  2DNS A;  4P87 A;  2XEP A;  1BZA A;  4NET A;  4LCL A;  5GLB A;  4DE2 A;  4OOY A;  5DVA A;  1RGY A;  5IHV A;  1LLB A;  2XFS A;  2ZM0 A;  1MBL A;  3A3F A;  4DKI A;  2JBF A;  2XR0 A;  4N9K A;  5CHM A;  3HLE A;  3MKF A;  5DF9 A;  3UDX A;  4PPR A;  4RVA A;  2EX9 A;  2Y2P A;  3ISG A;  2ZC5 B;  1ZG6 A;  1XA7 A;  5DF8 A;  1K54 A;  4H8R A;  3UY6 A;  1MXO A;  4GDN A;  4WM9 A;  1C3B A;  2ZQ8 A;  1YLJ A;  5EVL A;  1Q2Q A;  4ZTK A;  4GD6 A;  3IF6 A;  4WZ5 C;  2XQZ A;  5FAP A;  2Y2I A;  3UPO A;  4WMC D;  4PM7 A;  3ZDJ A;  4IVI A;  3S4X A;  2OSU A;  3ZG7 B;  2B5R A;  2A3U A;  3OPL A;  3IH9 A;  1BT5 A;  1JTG A;  1NY0 A;  4N92 A;  2Y2H A;  5AQA A;  2JCH A;  4S2M A;  2DRW A;  2C5W B;  3D4F A;  3VP2 A;  3VOY A;  3IH8 A;  3FYZ A;  1FR1 A;  4Z9Q A;  1H5X A;  4BEN A;  2FFF B;  4WBG A;  3V39 A;  1LHY A;  4R4R A;  2XDM A;  3O86 A;  1CEF A;  1TDG A;  2EX2 A;  4JXS A;  1K38 A;  4HBT A;  3LEZ A;  3BEB A;  5FI6 A;  3FKW A;  3C4O A;  3I7J A;  4EV4 A;  4XUX A;  4JPM A;  2IWD A;  1GCE A;  1YQS A;  2E8I A;  4BQM A;  4HEF A;  4ID4 A;  4WEK A;  5CTN A;  4WYY A;  5EPH A;  4P6B A;  3VFF A;  5HW3 A;  3WS2 A;  4E6W A;  5FQQ A;  3IHA A;  2Y2K A;  2HDQ A;  5EUA A;  1PW1 A;  1ES4 A;  1Y54 A;  3EQU A;  1BUE A;  2X71 A;  4LEN A;  5EOE A;  4OQG A;  5TFQ A;  5HL1 A;  2IWC A;  4KG6 A;  3S22 A;  5CHU A;  1ES2 A;  1XA1 A;  2WYX A;  3HL9 A;  1DJC A;  4OPY A;  1PWG A;  3OPP A;  3PBQ A;  1MWT A;  4ZJ3 A;  3VP3 A;  3IXB A;  2Y4A A;  1KGG A;  3V50 A;  3ZG9 B;  5DTT A;  1JTD A;  3HRE A;  3HBR A;  3MXS A;  1PYY A;  3UNW A;  2EXB A;  4JF4 A;  5FI2 A;  2C6W B;  3CMZ A;  2ZQA A;  4YFM A;  5E2G A;  3WS1 A;  4HBU A;  3G2Y A;  4S2J A;  4KZ6 A;  4OOM A;  4JLF A;  4ZJ1 A;  3UN7 A;  4FH2 A;  3FKV A;  4GOG A;  5CGS A;  5CEC A;  3MXR A;  3NIA A;  3OZH A;  2OLU A;  3AGD A;  3TG9 A;  1IYO A;  3IF6 B;  1KDS A;  5A91 A;  2R9W A;  5FAQ A;  3G31 A;  4LCM A;  1RCJ A;  1ESU A;  1Z6F A;  4S2N A;  5JYP A;  4R0Q A;  4KQQ A;  4X55 A;  2OLV A;  1GA9 A;  2J9O A;  1KGF A;  4WZ4 A;  3W4O A;  2WAD A;  4BD1 A;  4OQ0 A;  4LV0 A;  1K55 C;  4K0X A;  2VGJ A;  4KZ7 A;  3CG5 A;  1LI0 A;  4KZ8 A;  4JF5 A;  2JC7 A;  1SKF A;  1HZO A;  2ZD8 A;  1MKI A;  4S2K A;  3NCK A;  3Q07 A;  4CPK A;  4X53 A;  2XLN A;  4JKT A;  1SHV A;  1I2S A;  4IED A;  5CGX A;  1BLC A;  2CC1 A;  1ERM A;  4Y0T A;  1NZU A;  4DXC A;  3SH7 A;  5BOH A;  1XP4 A;  2ZLY A;  3HLF A;  3IXG A;  2X02 A;  2ZM8 A;  4EBN A;  2UWX A;  4X69 A;  3WS4 A;  2PU2 A;  4LV2 A;  2PBY A;  1BLS A;  4RA7 A;  3GMW A;  3LY3 A;  1K55 A;  1PWD A;  1MWU A;  4UA7 A;  1S0W A;  4S2P A;  1ERQ A;  4UHU A;  3N8R A;  4OON A;  1TDL A;  3C5A A;  3MBZ A;  4MLL A;  4EQI A;  5HAI A;  5FQJ A;  1KGE A;  2ZQ9 A;  1WYC A;  3O3V A;  4GD8 A;  4O7D A;  4U0X A;  1L0D A;  1FCM A;  3OC2 A;  4C6Y A;  4RX2 A;  1ONG A;  1MY8 A;  4FH4 A;  2Q9M A;  5TR7 A;  4OPR A;  5HAP A;  3BFG A;  1HVB A;  4FSF A;  4QY6 A;  2VGK A;  5CGW A;  4OVD A;  3VMA A;  3O87 A;  1BTL A;  5HAQ A;  1QMF A;  3IWI A;  4UA9 A;  3WS0 A;  2Y2M A;  2ZMA A;  5CTM A;  3DWK A;  4C75 A;  1PWC A;  2A49 A;  3P98 A;  1ES3 A;  4N1H A;  3NY4 A;  3W8K A;  2WGW B;  3M6B A;  1FCN A;  3TSG A;  4GZB A;  3VOZ A;  5GLA A;  3M2K A;  1K4F A;  3GVB A;  5HX9 A;  2Q9N A;  1TEM A;  1PZO A;  4OQH A;  1GA0 A;  3N6I A;  3QNB A;  3GRJ A;  3SH8 A;  1VM1 A;  2Z2M B;  1HTZ A;  3GQZ A;  2QZ6 A;  1KVL A;  4MEZ A;  2G2U A;  3S1Y A;  1MPL A;  3A3D A;  3Q81 A;  4KEN B;  4DDY A;  3BFE A;  5EE8 A;  4OOL A;  3M2J A;  3RJU A;  2WKE A;  1O7E A;  2GDN A;  2WAE A;  4L0L A;  4OLG A;  3ZVT A;  1MWR A;  3BFD A;  4M3K A;  1K6S A;  4N9L A;  4IBX A;  4F94 A;  3BRM A;  1AXB A;  5U47 A;  5EOO A;  1GHP A;  3MZE A;  1I5Q A;  4X56 A;  5G18 A;  2JE5 A;  2ZQC A;  5EVI A;  2X01 A;  1K56 A;  1L0F A;  3FV7 A;  4QY5 A;  5HFO A;  2XF3 A;  4XUZ A;  3G4P A;  2XK1 A;  1NYY A;  1KE3 A;  5AQ9 A;  2Y2G A;  4KZ9 A;  4BL2 A;  2PU4 A;  1H8Z A;  1PIO A;  4WEJ A;  2EFX A;  3HLC A;  5CXW A;  4ZBE A;  3ZGA B;  2WZX A;  3Q1F A;  4E3J A;  2Y2N A;  4A5R A;  4E3N A;  3MFD A;  5KZH A;  1ZC2 A;  1HD8 A;  2WGV A;  5I94 A;  4Y0O A;  2ZQ7 A;  3UDI A;  4Y0U A;  4CJN A;  2XFT A;  3IF6 C;  4B4Z A;  5DF7 A;  1IKI A;  1J9M A;  1XKZ A;  2Y91 A;  2HDR A;  3MZD A;  3W4P A;  4GKU A;  3N8L A;  4E3O A;  5CHJ A;  5FQK A;  2WKI A;  5FAT A;  5GHZ A;  5CED A;  2WKH A;  4R3J A;  4X68 A;  3RXX A;  3W4Q A;  3N4I A;  3C4P A;  5GLC A;  1YLY A;  2ZC4 B;  3C7V A;  1BSG A;  4MBK A;  1FSW A;  3BYD A;  1K57 C;  4XXR A;  4GB7 A;  3IHB A;  4KZA A;  3NI9 A;  4KQO A;  5DTK A;  5E43 A;  5CRF A;  3ZCZ A;  1CEG A;  5TGF A;  2XD5 A;  5E2H A;  4S2O A;  3ZG8 B;  5FSR A;  4KZB A;  2QPN A;  1EI5 A;  4UAA A;  1XXM A;  4OP8 A;  1KE4 A;  1E3U D;  1E4D A;  1W7F A;  5FA7 A;  4P0M A;  5A92 A;  3LO7 A;  3WRT A;  4E3I A;  1FSY A;  1K4E A;  2ZC7 A;  3GV9 A;  1GHI A;  3MKE A;  4U3T A;  3ZHH A;  2P9V B;  4WEL A;  1JVJ A;  3A3J A;  2EX6 A;  2HP9 A;  3BFF A;  3Q7V B;  3ZVW A;  5EEC A;  3OPR A;  3ZFZ A;  4LV3 A;  4Y7P A;  5GHX A;  1W8Y A;  3HUO A;  5FDH A;  4OLD A;  4PM5 A;  1K57 A;  1LI9 A;  3QHY A;  5KSH A;  4FD8 A;  2Y59 A;  3RXW A;  1PW8 A;  2BLS A;  3SOI A;  3JYI A;  5FAS A;  2P9V A;  3VSK A;  4DF6 A;  3IXD A;  1YLT A;  4R23 A;  2XH9 A;  3CJM A;  3ITB A;  4WMC A;  3IWO A;  1JWP A;  4WZ5 A;  1MWS A;  4OP5 A;  3HVF A;  3O88 A;  2H0T A;  3UDF A;  3WS5 A;  4QJG A;  4DXB A;  4EUZ A;  2V1Z A;  4RX3 A;  1XPB A;  1NRF A;  4ZAM A;  2FFY A;  4B88 A;  1FR6 A;  3V3S A;  2HP5 A;  2H5S A;  1XX2 A;  4KG5 A;  2XD1 A;  3QNC A;  1ZKJ A;  1KDW A;  3PBR A;  4B4X A;  5J8X A;  2Y2L A;  1RGZ A;  2Y2J A;  3BFC A;  4R3B A;  1BUL A;  1NJ4 A;  1NZO A;  3B3X A;  2XGN A;  3UPP A;  1WE4 A;  3ZG5 A;  3E2K A;  5GHY A;  5KSC A;  4ZDX A;  1IEL A;  1W5D A;  2EX8 A;  1YMS A;  3HUN A;  4KZ5 A;  2H0Y A;  4UA6 A;  1RP5 A;  3P09 A;  4DRT A;  5A90 A;  3CZD A;  1YMX A;  4OQI A;  2Z2L B;  3PBN A;  1ESI A;  4E3M A;  3DTM A;  2HDS A;  2HP6 A;  3FZC A;  4IBR A;  1G68 A;  3DW0 A;  3SH9 A;  2WZZ A;  4S2L A;  3BLS A;  1YLP A;  3HLW A;  4S2I A;  3UE1 A;  5CEB A;  4DE0 A;  4PM6 A;  1CK3 A;  4GDB A;  3LY4 A;  2QMI A;  1FCO A;  1JWZ A;  4PM8 A;  4E6X A;  3GTC A;  4E3K A;  4MBH A;  4MNR A;  1W79 A;  3M6H A;  3WRZ A;  1PI5 A;  5EVI B;  5GLD A;  1N4O A;  4BJP A;  1XGJ A;  3HLB A;  4RYE A;  4EBP A;  1NXY A;  3G2Z A;  3IT9 A;  3NBL A;  5D3O A;  3IXH A;  1IKG A;  1IYQ A;  3G32 A;  3N7W A;  3UO9 A;  1W8Q A;  1QME A;  1K56 D;  3BM6 A;  4FCF A;  3GR2 A;  3GSG A;  4YIN A;  2Y55 A;  3E2L A;  3OCL A;  3BEC A;  4R1G A;  3PTE A;  4KZ4 A;  2RL3 A;  3OCN A;  1E25 A;  1YLZ A;  2BG1 A;  4MBF A;  4S2N C;  4BLM A;  3Q7V A;  4JBF A;  1DJA A;  4HES A;  2EFU A;  4NK3 A;  4K0W A;  5DTS A;  1BLH A;  3SS5 A;  5M18 A;  3VP4 A;  4QB8 A;  3VFH A;  4EBL A;  3VSL A;  4P85 A;  3PAG A;  4DE1 A;  3AGE A;  1DY6 A;  1N9B A;  4X6T A;  3G30 A;  1DJB A;  1KVM A;  4KZ3 A;  3ITA A;  1GHM A;  2H10 A;  3NDG A;  1SDE A;  3NC8 A;  1YLW A;  2WGI A;  2WAF A;  2DCF A;  2V20 A;  3IF5 A;  4OPQ A;  1L2S A;  4GNU A;  4E3L A;  5L2F A;  4N1X A;  2Y2O A;  1FOF A;  4JXV A;  5E2F A;  3VP1 A;  4QD4 A;  2EXA A;  2IWB A;  1U60 A;  3PBS A;  3G34 A;  4GN2 A;  3WWX A;  3OPH A;  1JWV A;  1WYB A;  1TVF A;  3AGF A;  2R9X A;  1ALQ A;  3HUM A;  4DE3 A;  2J8Y A;  3FWL A;  4D2O A;  3TOI A;  4QU3 A; 
#chains in the Genus database with same CATH topology
 4OKP A;  2HJE A;  4LV1 A;  4BD0 A;  3LI9 A;  1ERO A;  3UE3 A;  1LL5 A;  4NG2 A;  2ZJ9 A;  2PD8 A;  1IEM A;  2O9A A;  2ZC6 B;  3T1X A;  2J9P A;  2ZC3 B;  5HDC A;  5KMW A;  3N8S A;  4BBU A;  1CI8 A;  3F1N A;  3C8C A;  5FAO A;  1NYM A;  1I2W A;  1IYP A;  1O07 A;  5DFY A;  2WK0 A;  1K25 A;  2WGW A;  1YT4 A;  4KQR A;  1PZP A;  4PM5 A;  3G35 A;  1SCW A;  5FQ9 A;  5AQB A;  2V2F F;  2GJ3 A;  2PRF A;  1S4S A;  4JXW A;  4U0T A;  2P74 A;  1VQQ A;  4DN0 A;  1M40 A;  5A93 A;  1K6R A;  5HAR A;  2XEP A;  4NET A;  1FIK A;  4DE2 A;  4OOY A;  1OTD A;  5IHV A;  1LLB A;  3HLE A;  4PPR A;  2VGL M;  2Y2P A;  3MMH A;  3ISG A;  1ZG6 A;  2INW A;  1XA7 A;  1K54 A;  3UY6 A;  4WM9 A;  4QPR A;  1A0K A;  2VV6 A;  4WMC D;  4PM7 A;  3S4X A;  2Z6C A;  3VP2 A;  1LHY A;  3HJI A;  1TDG A;  4ARZ A;  1K38 A;  1GCE A;  1S66 L;  4WYY A;  3VFF A;  5HW3 A;  3F1O B;  1L3L A;  2HDQ A;  1PW1 A;  1S67 L;  4HOI A;  4OQG A;  5HL1 A;  4KG6 A;  3T4T A;  1NLZ A;  3R7W A;  3HL9 A;  4I3I A;  3OPP A;  4CLC D;  3VP3 A;  3IXB A;  3L9K A;  3V50 A;  5DTT A;  1JTD A;  3U2A A;  3UB7 A;  4YWZ A;  2C6W B;  3CMZ A;  2ZQA A;  4O0P A;  4HBU A;  3G2Y A;  4ZJ1 A;  4KZ6 A;  3UN7 A;  1Z09 A;  3VFH A;  5CEC A;  3LIA A;  4Y17 A;  3MXR A;  4BBV A;  1F98 A;  3R4K A;  1ODV A;  4MDZ A;  1KDS A;  3LR3 A;  3CIT A;  1Z6F A;  2B95 A;  4R0Q A;  3T4K A;  4D60 A;  3DTK A;  2QKP A;  4WZ4 A;  2WAD A;  2GNX A;  4OQ0 A;  5AVF A;  1K55 C;  1OTE A;  1SKF A;  1HZO A;  3NJA A;  2KOI A;  2XLN A;  4JKT A;  1SHV A;  1UWN X;  2CC1 A;  5HWT A;  1NZU A;  3SH7 A;  1XP4 A;  2UWX A;  4LV2 A;  1HLU P;  3LY3 A;  3OLO A;  1S0W A;  4UHU A;  1T1B A;  2NUT C;  4YNR A;  1TDL A;  3C5A A;  2PYP A;  4EQI A;  3C38 A;  5HAI A;  1KGE A;  1L0D A;  1FCM A;  5EV0 A;  4ETZ A;  2JKR I;  5TR7 A;  3ZQ5 A;  4FSF A;  5HPI A;  3EEH A;  4IUK A;  4OVD A;  3IX3 A;  3P7N A;  2ZMA A;  3DWK A;  4PKY G;  2YKF A;  3NY4 A;  4HNB A;  2WGW B;  3TSG A;  3VOZ A;  5HX9 A;  1K4F A;  2VV7 A;  3EOI A;  4OQH A;  3QNB A;  2J80 A;  1ZHH B;  1HTZ A;  2Z2M B;  1KVL A;  2G2U A;  3Q81 A;  5EE8 A;  2UV0 E;  3VE4 A;  2GDN A;  2WAE A;  4L0L A;  1MWR A;  3BFD A;  4M3K A;  1ACF A;  4X56 A;  2JE5 A;  2ZQC A;  1K56 A;  1L0F A;  4QY5 A;  4XUZ A;  2V8C A;  4ESP A;  2Y2G A;  2V1B A;  4KZ9 A;  1H0M A;  2PBD P;  2V8F A;  4ZBE A;  3Q1F A;  3RH8 B;  4E3J A;  3MFD A;  1ZC2 A;  1HD8 A;  3CAX A;  5I5L A;  2WGV A;  2JKT I;  2ZQ7 A;  4CJN A;  5DF7 A;  4KUO A;  3W4P A;  2HDR A;  4WF0 A;  1YPR A;  3T4O A;  5FQK A;  2WKI A;  5CED A;  3W4Q A;  5LBR A;  1BSG A;  3CWF A;  4GB7 A;  2BAS A;  4KQO A;  5CRF A;  1CEG A;  4PKY A;  1N9L A;  5G4Z A;  3DAV A;  1EI5 A;  4P0M A;  2ZC7 A;  3GV9 A;  4YOF A;  3A3J A;  2XA7 M;  2EX6 A;  3ZVW A;  5EEC A;  4LV3 A;  3HUO A;  2B18 A;  1K57 A;  3QHY A;  5KSH A;  2BLS A;  1XFQ A;  3H82 A;  4DXB A;  2FFY A;  4BBT A;  3V3S A;  2H5S A;  2XD1 A;  4GHI A;  4B4X A;  2Y2L A;  4R3B A;  1NJ4 A;  4B93 A;  1ZTU A;  3UPP A;  4Q0J A;  3ZG5 A;  4ZDX A;  1W5D A;  2EX8 A;  1YMS A;  1RP5 A;  5A90 A;  4OQI A;  1VEU B;  2ZL1 A;  3PBN A;  3NEC A;  3LID A;  2VK3 A;  2HDS A;  3E4O A;  1N9N A;  1CK3 A;  4GDB A;  4PM8 A;  1FCO A;  3GTC A;  3QP1 A;  4E3K A;  4HP9 A;  1XGJ A;  4Y15 A;  4RYE A;  4EBP A;  1NXY A;  2OOL A;  5D3O A;  1YSP A;  2PDR A;  3IXH A;  4O01 A;  3UO9 A;  1W8Q A;  3E0Y A;  3U4L P;  3BM6 A;  4IHQ A;  2GZA A;  4HY8 A;  4PHT A;  4CLC E;  3OCL A;  4GS9 A;  4II7 A;  3BEC A;  2XRN A;  3PTE A;  3OCN A;  5HPF A;  3T12 B;  1DJA A;  4HES A;  4NK3 A;  3BQA A;  4K0W A;  3VP4 A;  4QB8 A;  3VSL A;  2W3E A;  1OTA A;  3PAG A;  1H3Q A;  1SDE A;  2WGI A;  5DFX A;  2JN7 A;  2DCF A;  2V20 A;  4OPQ A;  2O0Y A;  4N1X A;  1FOF A;  4QD4 A;  2VA0 A;  2R9X A;  1ALQ A;  4DE3 A;  3QP6 A;  5I94 A;  1GSW A;  2AVX A;  3QP4 A;  1E3U A;  4HQA A;  4R4S A;  3IWQ A;  5GL9 A;  4EWF A;  1OME A;  2P08 A;  2W3D A;  1IYS A;  3W2Z A;  5FI7 A;  4MN5 A;  1NWZ A;  4PMA A;  4G3V A;  1CJF A;  1L0E A;  2ZQD A;  2JKR M;  1EWZ A;  5CX7 A;  3ZNT A;  5JYO A;  4JXG A;  5M1A A;  1BLP A;  3Q82 A;  3LCE A;  4LLO B;  5FQI A;  2PR5 A;  1S6R A;  2OV5 A;  3SS3 A;  1XGI A;  1ES5 A;  5HSQ A;  2WUQ A;  5M19 A;  5IU1 A;  5HD5 A;  3DBA A;  3FPW A;  3UPN A;  1LSX A;  1H8M A;  5F1F A;  3H7W A;  4JGQ A;  1K54 C;  5AQ7 A;  5FQM A;  2W3H A;  3IQA A;  4BL3 A;  4P87 A;  5F68 A;  1OT9 A;  4H6J A;  1RGY A;  3A3F A;  3ZYT A;  5DF9 A;  5CHM A;  5DF8 A;  1MXO A;  4GDN A;  1C3B A;  2ZQ8 A;  1YLJ A;  1FIL A;  1Q2Q A;  1N9O A;  4WZ5 C;  3ZDJ A;  2OSU A;  2VJW A;  2A3U A;  3CI6 A;  3OPL A;  4EES A;  1JTG A;  2ZBB A;  4NXF A;  2V1A A;  3MQO A;  2JCH A;  3TW8 A;  3VOY A;  4R70 A;  2YKH A;  3T4S A;  4R4R A;  3CLO A;  3O86 A;  4JXS A;  4HBT A;  3B42 A;  3C4O A;  3I7J A;  3MXQ A;  4XUX A;  4JPM A;  3PR6 A;  4ID4 A;  3WS2 A;  4E6W A;  5FQQ A;  3IHA A;  1YAX A;  5EUA A;  4LEN A;  5EOE A;  2Y79 A;  4WN5 A;  1MC0 A;  2WYX A;  2D02 A;  3LFV A;  5FDS A;  1T18 A;  1KGG A;  3MXS A;  2BTF P;  4I5S A;  3TE8 A;  1PYY A;  5FI2 A;  4JF4 A;  1XFN A;  4KUK A;  5J7E A;  3E4Q A;  4YFM A;  3WS1 A;  2ZOH A;  4FH2 A;  4GOG A;  3OZH A;  3D9Y A;  4BWI A;  1IYO A;  5A91 A;  1IOU A;  4LCM A;  4X55 A;  2KX6 A;  2OLV A;  1GA9 A;  5HL6 A;  1KGF A;  2K2N A;  2L4R A;  3LR5 A;  1MKI A;  5F5Y A;  3Q07 A;  4XT2 B;  4IED A;  5CGX A;  1ERM A;  3A0V A;  3UE6 A;  4Y0T A;  5BOH A;  3GEC A;  5G4Y A;  3HLF A;  3IXG A;  3T1S A;  3MQQ A;  3WS4 A;  1MZU A;  1PWD A;  1MWU A;  3N8R A;  3LIB A;  2VV8 A;  1BYW A;  4WUJ A;  3O3V A;  4U0X A;  5TJJ A;  3OC2 A;  4RX2 A;  2WKP A;  2OWJ A;  1MY8 A;  4FH4 A;  5HAP A;  3BFG A;  3OOV A;  4QY6 A;  2PYR A;  5CGW A;  5HDD A;  2V0W A;  3VMA A;  2VLG A;  3IWI A;  5A8B A;  3WS0 A;  2M1C A;  5CTM A;  1ES3 A;  4L9G A;  3M6B A;  1FCN A;  3H9W A;  1TEM A;  1PZO A;  3BWL A;  1Y28 A;  2QJ5 A;  3GRJ A;  3SH8 A;  4FOF A;  4DDY A;  4KEN B;  5FEG A;  3BFE A;  2WKE A;  1O7E A;  3EEA A;  1X0O A;  2JKT M;  1AXB A;  3KYZ A;  5HD3 A;  3MZE A;  2OAQ 1;  1G28 A;  3K3C A;  2X01 A;  4X25 A;  2XF3 A;  2PR6 A;  5EFW A;  5EVE A;  1PIO A;  2EFX A;  5CXW A;  3ZGA B;  2WZX A;  4E3N A;  5KZH A;  5HZH A;  4Y0O A;  2PHY A;  3R7W B;  3IF6 C;  3BJN A;  3FPV A;  1V9Y A;  2OWH A;  3CUE A;  4L9F A;  5FEF A;  2WKH A;  3C4P A;  2ZC4 B;  2ZMF A;  4MBK A;  5EM0 A;  1K57 C;  4LRZ E;  5DTK A;  3ZCZ A;  5FSR A;  4EU0 A;  4EEP A;  1XXM A;  1E3U D;  1E4D A;  3LO7 A;  3WRT A;  2G7U A;  4E3I A;  2QYB A;  3ZHH A;  3NOU C;  2P9V B;  1JVJ A;  2LB9 A;  4OLD A;  3KSG A;  4FD8 A;  3SOI A;  5FAS A;  5J4E A;  1PNE A;  4R23 A;  2XH9 A;  4WZ5 A;  1J3W A;  1MWS A;  3HVF A;  1TF1 A;  2H0T A;  1F2K A;  3TRC A;  2V1Z A;  4RX3 A;  3NOP C;  4ZAM A;  2HGV A;  2ZOI A;  3K2N A;  3PBR A;  5J8X A;  3MR0 A;  1WE4 A;  5KSC A;  5GHY A;  3MQ0 A;  1IEL A;  2H0Y A;  4UA6 A;  4DRT A;  5HWW A;  3QP8 A;  4DMZ A;  2Z2L B;  2VX8 A;  4E3M A;  3GDI A;  3DTM A;  1P9R A;  2HP6 A;  5K5B A;  2WZZ A;  4S2L A;  4S2I A;  3HLW A;  3UE1 A;  4Q0I A;  4DE0 A;  4PM6 A;  3LY4 A;  2QMI A;  4MNR A;  1PI5 A;  1N4O A;  4EEU A;  3HLB A;  1SKO A;  3IT9 A;  4IJG A;  1T1A A;  3GR2 A;  4YIN A;  1Y4O A;  2J3T C;  4NEE D;  4KZ4 A;  2L0W A;  4MBF A;  4BLM A;  1S4R A;  5DJU A;  5AVE A;  4HI4 A;  2W1R A;  4DE1 A;  3UB6 A;  3G30 A;  1DJB A;  1GHM A;  2H10 A;  3KSF A;  5L2F A;  2Y2O A;  1LSV A;  1F5M A;  3IS2 B;  4LFU A;  3PBS A;  4GN2 A;  3FWL A;  3TOI A;  4QU3 A;  2HPB A;  3LR0 A;  4IVK A;  2HDU A;  5DJT A;  2KLI A;  3VP0 A;  4CLC B;  3V3R A;  4OH0 A;  3DTE A;  1YM1 A;  4ZJ2 A;  5EVI C;  2Y2Q A;  2HV1 A;  1ONH A;  3UE0 A;  1LL9 A;  4C3Q A;  3UMD A;  4B9O A;  1SDN A;  1VET B;  2ZM2 A;  3S7N A;  3V5M A;  3IBJ A;  4PM9 A;  1PI4 A;  1UWP X;  3DWZ A;  4K91 A;  4OPZ A;  5F1G A;  4KG2 A;  4HH2 A;  3ZG0 A;  5F82 A;  3NDE A;  2PT7 A;  1FQG A;  1KE0 A;  1W63 Q;  1H8Y A;  1G6A A;  2DNS A;  4F3L A;  1BZA A;  1OPX A;  2XFS A;  4DKI A;  3UDX A;  2HJ9 C;  3KYQ A;  5TBM B;  2ZC5 B;  5EVL A;  3IF6 A;  3UPO A;  2Y2I A;  4MCW A;  2B5R A;  1NY0 A;  4N92 A;  5AQA A;  3D4F A;  2C5W B;  2R78 A;  3FYZ A;  3KSI A;  4Z9Q A;  1H5X A;  1T19 A;  4LRY C;  2XDM A;  1CEF A;  4GJ4 A;  3LEZ A;  3BEB A;  5FI6 A;  4EV4 A;  2IWD A;  1YQS A;  2E8I A;  3CUE C;  4HEF A;  2HZ5 A;  4WEK A;  5EPH A;  4P6B A;  2A24 A;  2Y2K A;  1ES4 A;  3EQU A;  2X71 A;  2K31 A;  5TFQ A;  3V67 A;  3S22 A;  5CHU A;  4E04 A;  4Y5F A;  1XA1 A;  2EWW A;  4OPY A;  3LIC A;  2W3F A;  4ZJ3 A;  2Y4A A;  3HRE A;  2QWS A;  4CQH A;  3IS2 A;  3KYE A;  5DKL A;  5E2G A;  4S2J A;  1TS0 A;  3KX0 X;  4JLF A;  4OOM A;  3FKV A;  3DTI A;  3F1P A;  3NIA A;  4R6L A;  3TG9 A;  3B47 A;  3IF6 B;  2R9W A;  5FAQ A;  1RCJ A;  3A0R A;  4I38 A;  1LSW A;  5JYP A;  4I3J A;  3F1O A;  5TBM A;  2V9A A;  2J9O A;  4G3W A;  2VGJ A;  4KZ7 A;  4KZ8 A;  4JF5 A;  2JC7 A;  4S2K A;  2M7U A;  4CPK A;  4ETX A;  1I2S A;  3KSH A;  3G6O A;  4DXC A;  2ZLY A;  2X02 A;  4ARZ B;  1BLS A;  4XT2 A;  4UA7 A;  3IBR A;  1TD5 A;  3IX8 A;  5FQJ A;  1WYC A;  3RFB A;  3LIE A;  3C2W A;  1ONG A;  4MMN A;  5F69 A;  2Q9M A;  1TS7 A;  2A24 B;  1NLY A;  5HAQ A;  3ULF A;  1WA9 A;  4UA9 A;  2Y2M A;  2A49 A;  4N1H A;  3W8K A;  4HHD A;  5GLA A;  1YSQ A;  1GA0 A;  2IA2 A;  4MEZ A;  3S1Y A;  1MPL A;  3A3D A;  3S7P A;  1D7E A;  2MJ6 A;  3RJU A;  4G3K A;  3ZVT A;  4IBX A;  3BRM A;  5C5K A;  1LT0 A;  5EVI A;  3FV7 A;  4EER A;  3G4P A;  2XK1 A;  2WKQ A;  1KE3 A;  1XJ4 A;  5J3W A;  5AJG A;  3CPT A;  1H8Z A;  4WEJ A;  2Y2N A;  4A5R A;  4GLQ A;  3VV4 A;  3LI8 A;  4HJ3 A;  3UDI A;  4Y0U A;  4GS9 B;  2XFT A;  3LUQ A;  4B4Z A;  1IKI A;  1J9M A;  1XKZ A;  3MZD A;  3N8L A;  4E3O A;  5CHJ A;  5FAT A;  3H7W B;  4M4X A;  4X68 A;  2EWV A;  3N4I A;  5GLC A;  3C7V A;  2DMW A;  3BYD A;  5TGF A;  2XD5 A;  4S2O A;  2H28 A;  4KZB A;  4UAA A;  4OP8 A;  1KE4 A;  5A92 A;  1K4E A;  4JGP A;  4U3T A;  4WEL A;  2D01 A;  2HP9 A;  3ZFZ A;  3OPR A;  4I39 A;  4Y7P A;  1W8Y A;  4Y13 A;  1LI9 A;  4Z1W A;  4HH3 A;  3K3D A;  3C30 A;  3RXW A;  3IXD A;  4X1L A;  4WMC A;  3IWO A;  3WS5 A;  4QJG A;  4HJ6 A;  3O88 A;  3LYX A;  4EUZ A;  1SZV A;  1XPB A;  4B88 A;  4RQ9 A;  2HP5 A;  3PXP A;  1XX2 A;  4KG5 A;  3NHQ A;  3QNC A;  1OTI A;  1KDW A;  3QP2 A;  1RGZ A;  1VHM A;  1F9I A;  3B3X A;  4LRX C;  3T1Q B;  4X1M A;  3CHW P;  5MC7 A;  3HUN A;  4KZ5 A;  3BY8 A;  3P09 A;  3CZD A;  4QWO A;  1T1C A;  3LGO A;  2VKS A;  3FZC A;  4L9E A;  3DW0 A;  3CPT B;  3SH9 A;  3BLS A;  1YLP A;  2VGL S;  3JPU A;  1JWZ A;  1MKM A;  4MBH A;  4JGO A;  1EW0 A;  3M6H A;  5EVI B;  5GLD A;  4AFI A;  5F6A A;  4ZRR A;  3MJQ A;  3NBL A;  1IKG A;  1IYQ A;  3G32 A;  2W1T A;  3N7W A;  3MFX A;  4UEY A;  4FCF A;  3E4P A;  3E2L A;  4R1G A;  2RL3 A;  1E25 A;  2Z6D A;  3Q7V A;  1BLH A;  3MS6 A;  3SS5 A;  4EBL A;  4P85 A;  1DP6 A;  1G6O A;  1KOU A;  3AGE A;  3MF0 A;  4KZ3 A;  4NKP A;  3BY9 A;  3NDG A;  1YLW A;  4E3L A;  3IF5 A;  2ZL1 B;  5E2F A;  3VP1 A;  2EXA A;  3WWX A;  1JWV A;  1WYB A;  1TVF A;  3AGF A;  3HUM A;  1GSV A;  4D2O A;  2G2W A;  3A3E A;  2QHK A;  2OAP 1;  4Q8I A;  1OT6 A;  3ZNY A;  5E2E A;  5L10 A;  1ZG4 A;  4QHC A;  3PBT A;  1Q2P A;  3A3I A;  2E8J A;  3UME A;  5F83 A;  2RCX A;  3A0S A;  1VEU A;  2I72 A;  3C7U A;  3HLD A;  3D72 A;  3PAE A;  3EQV A;  3Q7Z A;  4JF6 A;  3PBO A;  4EET B;  2O9C A;  4GHI B;  4UQI S;  4P6Z M;  3SS4 A;  3UB9 A;  1XJ3 A;  5CER A;  3HLG A;  3EGD C;  1CI9 A;  3F1P B;  2PAV P;  2J7V A;  2J3T D;  1D1J A;  3TJZ C;  1M6K A;  2CMN A;  4NXG A;  3HCY A;  2I9V A;  4DDS A;  3LR4 A;  4K08 A;  3BLM A;  3MZF A;  1L0G A;  5EVI D;  4R3A A;  3T50 A;  5IT5 A;  2LB5 A;  1SKO B;  4LCL A;  5GLB A;  5DVA A;  2ZM0 A;  1MBL A;  2FH5 A;  2JBF A;  2XR0 A;  4N9K A;  3MKF A;  4RVA A;  2EX9 A;  3EWK A;  2GX5 A;  3VE3 A;  3S7O A;  4H8R A;  4ZTK A;  4GD6 A;  5FAP A;  2XQZ A;  4IVI A;  4CLC C;  3ZG7 B;  4GW9 A;  4FUW A;  4MN6 A;  3IH9 A;  1BT5 A;  3PYP A;  2Y2H A;  4S2M A;  2DRW A;  4KQD A;  3IH8 A;  1FR1 A;  4BEN A;  2FFF B;  4WBG A;  3V39 A;  2EX2 A;  1OJ5 A;  3FKW A;  3T4J A;  3RTY A;  1V9Z A;  3FG8 A;  4BQM A;  5CTN A;  5L09 A;  3NUL A;  2KDK A;  3BQ8 A;  2XSS A;  2P04 A;  2HF6 A;  1P0Z A;  1Y54 A;  1BUE A;  2NUP C;  2ZMV A;  2IWC A;  1ES2 A;  1DJC A;  1PWG A;  3PBQ A;  1MWT A;  3LEQ A;  4HJ4 A;  4FTX A;  4NXB A;  3ZG9 B;  3HBR A;  3UNW A;  2EXB A;  2XRO A;  5CGS A;  1CQA A;  3JVU A;  2OLU A;  3AGD A;  2L1M A;  1GSX A;  1P9W A;  3G31 A;  1ESU A;  2Y8H A;  4S2N A;  2O9B A;  2VEA A;  5DKK A;  2M7V A;  4KQQ A;  1W63 M;  1PFL A;  2Q0O A;  4WL9 A;  4F3L B;  3W4O A;  4JGR A;  3O5Y A;  4BD1 A;  4LV0 A;  1VET A;  4K0X A;  3CG5 A;  1LI0 A;  2ZD8 A;  3B33 A;  3NCK A;  4I3A A;  3JVV A;  4X53 A;  3UB5 P;  1BLC A;  2B02 A;  2JKF A;  2ZM8 A;  4EBN A;  4X69 A;  2PU2 A;  2PBY A;  4RA7 A;  3GMW A;  1K55 A;  1XJ6 A;  1G5U A;  1XJ2 A;  3ICY A;  4S2P A;  1ERQ A;  4OON A;  3MBZ A;  4MLL A;  4Y3I A;  2ZQ9 A;  4O7D A;  1UGU A;  4GD8 A;  2W27 A;  4C6Y A;  1TS8 A;  1VB6 A;  4OPR A;  2JKG A;  1HVB A;  4UQI M;  2VGK A;  3UB8 A;  4P6Z S;  1NRJ A;  3O87 A;  1BTL A;  4LGW A;  1K0K A;  1QMF A;  4C75 A;  4EXO A;  1PWC A;  3P98 A;  2W0N A;  4PAU A;  4BMW A;  4GZB A;  3M2K A;  3GVB A;  4R38 A;  2Q9N A;  2QJ7 A;  2XA7 S;  3N6I A;  1VM1 A;  3GQZ A;  2QZ6 A;  1OJG A;  4OOL A;  3M2J A;  4OLG A;  2V0U A;  1K6S A;  4N9L A;  4F94 A;  5U47 A;  5EOO A;  1GHP A;  1I5Q A;  5G18 A;  3IX4 A;  4O8G A;  5HFO A;  3EGX C;  1AWI A;  4WLA A;  1NYY A;  5AQ9 A;  3VOL A;  4BL2 A;  2PU4 A;  2A2L A;  2ACG A;  3HLC A;  4H6J B;  1DP8 A;  2P7J A;  2K7S A;  3QP5 A;  2Y91 A;  4GKU A;  3L7H A;  5GHZ A;  3BW6 A;  4R3J A;  3RXX A;  1YLY A;  1D06 A;  1FSW A;  4XXR A;  3IHB A;  4KZA A;  3NI9 A;  5E43 A;  4ME4 A;  5E2H A;  3ZG8 B;  2VZW A;  2QPN A;  1S1Z A;  1YKD A;  4HP4 A;  1W7F A;  5FA7 A;  4DJ3 A;  3SW1 A;  1FSY A;  3MKE A;  1GHI A;  4EQ1 A;  3BFF A;  3Q7V B;  5GHX A;  5FDH A;  3E98 A;  3KO6 A;  4DJ2 A;  2Y59 A;  4EW7 A;  1PW8 A;  1LL8 A;  3JYI A;  2P9V A;  3VSK A;  4DF6 A;  1YLT A;  3T4Q A;  3CJM A;  1IFQ A;  3ITB A;  1JWP A;  4OP5 A;  3UDF A;  4CLC A;  1NRF A;  1FR6 A;  3FC7 A;  2JHE A;  1ZKJ A;  2W3G A;  3BFC A;  2Y2J A;  1BUL A;  1NZO A;  3H82 B;  2W1T B;  2XGN A;  3E2K A;  1OTB A;  3F1N B;  3OBF A;  3LIF A;  1DRM A;  4HIA A;  1YMX A;  2WKR A;  1ESI A;  3P01 A;  3NOT C;  3S7Q A;  2EA9 A;  4IBR A;  1G68 A;  1S1Y A;  2FZ0 A;  3D3O A;  2J3W A;  5CEB A;  4E6X A;  1W79 A;  3MSH A;  4BJP A;  1PRQ A;  5IS1 A;  3SZT A;  3G2Z A;  4LPZ A;  1P97 A;  5EM1 A;  5HDS A;  1QME A;  1K56 D;  1STZ A;  3GSG A;  2Y55 A;  3T4L A;  5FL3 A;  3T1R A;  1YLZ A;  2BG1 A;  4S2N C;  4JBF A;  5DTS A;  2EFU A;  5M18 A;  4MN7 A;  4EUV A;  1DP9 A;  5HWV A;  4Q0H A;  1DY6 A;  1N9B A;  4X6T A;  5L8M A;  1KVM A;  4GCZ A;  3ITA A;  4NXE A;  3NC8 A;  4Y2F A;  3PHY A;  2WAF A;  2O99 A;  2PD7 A;  5L07 A;  1L2S A;  4GNU A;  4JXV A;  1CF0 A;  5KIZ A;  4IUH A;  1TS6 A;  2IWB A;  1U60 A;  3G34 A;  1JNU A;  3OPH A;  3HJK A;  2J8Y A;  3WRZ A; 
#chains in the Genus database with same CATH homology
 2G2W A;  3A3E A;  1E3U A;  2HPB A;  4OKP A;  4R4S A;  3IWQ A;  4LV1 A;  4Q8I A;  5GL9 A;  4IVK A;  3ZNY A;  5E2E A;  2HDU A;  3VP0 A;  4EWF A;  1OME A;  1ZG4 A;  3V3R A;  1IYS A;  4OH0 A;  4BD0 A;  4QHC A;  5FI7 A;  3PBT A;  1Q2P A;  3A3I A;  1YM1 A;  1ERO A;  4ZJ2 A;  5EVI C;  1LL5 A;  3UE3 A;  2Y2Q A;  1ONH A;  3UE0 A;  1LL9 A;  2ZJ9 A;  4C3Q A;  5F83 A;  2RCX A;  4PMA A;  1IEM A;  2I72 A;  2ZC6 B;  1SDN A;  2ZM2 A;  1L0E A;  2ZQD A;  3C7U A;  1EWZ A;  2J9P A;  2ZC3 B;  5KMW A;  3N8S A;  3HLD A;  1CI8 A;  5FAO A;  3PAE A;  3EQV A;  3Q7Z A;  3ZNT A;  5JYO A;  1NYM A;  4JF6 A;  1I2W A;  1IYP A;  3PBO A;  4JXG A;  5M1A A;  1O07 A;  2WK0 A;  1K25 A;  3V5M A;  2WGW A;  1BLP A;  3Q82 A;  3LCE A;  1YT4 A;  4PM9 A;  4KQR A;  1PI4 A;  5FQI A;  1S6R A;  3DWZ A;  1PZP A;  4K91 A;  4OPZ A;  2OV5 A;  1XGI A;  3SS4 A;  3G35 A;  3SS3 A;  1SCW A;  1ES5 A;  5FQ9 A;  2WUQ A;  5CER A;  5M19 A;  3HLG A;  5F1G A;  4KG2 A;  3ZG0 A;  5AQB A;  2V2F F;  5F82 A;  3NDE A;  1CI9 A;  2J7V A;  3UPN A;  4JXW A;  4U0T A;  1M6K A;  5F1F A;  1FQG A;  2P74 A;  1VQQ A;  1KE0 A;  4DDS A;  1K54 C;  1H8Y A;  5AQ7 A;  5FQM A;  3BLM A;  1G6A A;  1M40 A;  5A93 A;  3MZF A;  1L0G A;  1K6R A;  5EVI D;  5HAR A;  3IQA A;  4BL3 A;  2DNS A;  4P87 A;  2XEP A;  1BZA A;  4NET A;  4LCL A;  5GLB A;  4DE2 A;  4OOY A;  5DVA A;  1RGY A;  5IHV A;  1LLB A;  2XFS A;  2ZM0 A;  1MBL A;  3A3F A;  4DKI A;  2JBF A;  2XR0 A;  4N9K A;  5CHM A;  3HLE A;  3MKF A;  5DF9 A;  3UDX A;  4PPR A;  4RVA A;  2EX9 A;  2Y2P A;  3ISG A;  2ZC5 B;  1ZG6 A;  1XA7 A;  5DF8 A;  1K54 A;  4H8R A;  3UY6 A;  1MXO A;  4GDN A;  4WM9 A;  1C3B A;  2ZQ8 A;  1YLJ A;  5EVL A;  1Q2Q A;  4ZTK A;  4GD6 A;  3IF6 A;  4WZ5 C;  2XQZ A;  5FAP A;  2Y2I A;  3UPO A;  4WMC D;  4PM7 A;  3ZDJ A;  4IVI A;  3S4X A;  2OSU A;  3ZG7 B;  2B5R A;  2A3U A;  3OPL A;  3IH9 A;  1BT5 A;  1JTG A;  1NY0 A;  4N92 A;  2Y2H A;  5AQA A;  2JCH A;  4S2M A;  2DRW A;  2C5W B;  3D4F A;  3VP2 A;  3VOY A;  3IH8 A;  3FYZ A;  1FR1 A;  4Z9Q A;  1H5X A;  4BEN A;  2FFF B;  4WBG A;  3V39 A;  1LHY A;  4R4R A;  2XDM A;  3O86 A;  1CEF A;  1TDG A;  2EX2 A;  4JXS A;  1K38 A;  4HBT A;  3LEZ A;  3BEB A;  5FI6 A;  3FKW A;  3C4O A;  3I7J A;  4EV4 A;  4XUX A;  4JPM A;  2IWD A;  1GCE A;  1YQS A;  2E8I A;  4BQM A;  4HEF A;  4ID4 A;  4WEK A;  5CTN A;  4WYY A;  5EPH A;  4P6B A;  3VFF A;  5HW3 A;  3WS2 A;  4E6W A;  5FQQ A;  3IHA A;  2Y2K A;  2HDQ A;  5EUA A;  1PW1 A;  1ES4 A;  1Y54 A;  3EQU A;  1BUE A;  2X71 A;  4LEN A;  5EOE A;  4OQG A;  5TFQ A;  5HL1 A;  2IWC A;  4KG6 A;  3S22 A;  5CHU A;  1ES2 A;  1XA1 A;  2WYX A;  3HL9 A;  1DJC A;  4OPY A;  1PWG A;  3OPP A;  3PBQ A;  1MWT A;  4ZJ3 A;  3VP3 A;  3IXB A;  2Y4A A;  1KGG A;  3V50 A;  3ZG9 B;  5DTT A;  1JTD A;  3HRE A;  3HBR A;  3MXS A;  1PYY A;  3UNW A;  2EXB A;  4JF4 A;  5FI2 A;  2C6W B;  3CMZ A;  2ZQA A;  4YFM A;  5E2G A;  3WS1 A;  4HBU A;  3G2Y A;  4S2J A;  4KZ6 A;  4OOM A;  4JLF A;  4ZJ1 A;  3UN7 A;  4FH2 A;  3FKV A;  4GOG A;  5CGS A;  5CEC A;  3MXR A;  3NIA A;  3OZH A;  2OLU A;  3AGD A;  3TG9 A;  1IYO A;  3IF6 B;  1KDS A;  5A91 A;  2R9W A;  5FAQ A;  3G31 A;  4LCM A;  1RCJ A;  1ESU A;  1Z6F A;  4S2N A;  5JYP A;  4R0Q A;  4KQQ A;  4X55 A;  2OLV A;  1GA9 A;  2J9O A;  1KGF A;  4WZ4 A;  3W4O A;  2WAD A;  4BD1 A;  4OQ0 A;  4LV0 A;  1K55 C;  4K0X A;  2VGJ A;  4KZ7 A;  3CG5 A;  1LI0 A;  4KZ8 A;  4JF5 A;  2JC7 A;  1SKF A;  1HZO A;  2ZD8 A;  1MKI A;  4S2K A;  3NCK A;  3Q07 A;  4CPK A;  4X53 A;  2XLN A;  4JKT A;  1SHV A;  1I2S A;  4IED A;  5CGX A;  1BLC A;  2CC1 A;  1ERM A;  4Y0T A;  1NZU A;  4DXC A;  3SH7 A;  5BOH A;  1XP4 A;  2ZLY A;  3HLF A;  3IXG A;  2X02 A;  2ZM8 A;  4EBN A;  2UWX A;  4X69 A;  3WS4 A;  2PU2 A;  4LV2 A;  2PBY A;  1BLS A;  4RA7 A;  3GMW A;  3LY3 A;  1K55 A;  1PWD A;  1MWU A;  4UA7 A;  1S0W A;  4S2P A;  1ERQ A;  4UHU A;  3N8R A;  4OON A;  1TDL A;  3C5A A;  3MBZ A;  4MLL A;  4EQI A;  5HAI A;  5FQJ A;  1KGE A;  2ZQ9 A;  1WYC A;  3O3V A;  4GD8 A;  4O7D A;  4U0X A;  1L0D A;  1FCM A;  3OC2 A;  4C6Y A;  4RX2 A;  1ONG A;  1MY8 A;  4FH4 A;  2Q9M A;  5TR7 A;  4OPR A;  5HAP A;  3BFG A;  1HVB A;  4FSF A;  4QY6 A;  2VGK A;  5CGW A;  4OVD A;  3VMA A;  3O87 A;  1BTL A;  5HAQ A;  1QMF A;  3IWI A;  4UA9 A;  3WS0 A;  2Y2M A;  2ZMA A;  5CTM A;  3DWK A;  4C75 A;  1PWC A;  2A49 A;  3P98 A;  1ES3 A;  4N1H A;  3NY4 A;  3W8K A;  2WGW B;  3M6B A;  1FCN A;  3TSG A;  4GZB A;  3VOZ A;  5GLA A;  3M2K A;  1K4F A;  3GVB A;  5HX9 A;  2Q9N A;  1TEM A;  1PZO A;  4OQH A;  1GA0 A;  3N6I A;  3QNB A;  3GRJ A;  3SH8 A;  1VM1 A;  2Z2M B;  1HTZ A;  3GQZ A;  2QZ6 A;  1KVL A;  4MEZ A;  2G2U A;  3S1Y A;  1MPL A;  3A3D A;  3Q81 A;  4KEN B;  4DDY A;  3BFE A;  5EE8 A;  4OOL A;  3M2J A;  3RJU A;  2WKE A;  1O7E A;  2GDN A;  2WAE A;  4L0L A;  4OLG A;  3ZVT A;  1MWR A;  3BFD A;  4M3K A;  1K6S A;  4N9L A;  4IBX A;  4F94 A;  3BRM A;  1AXB A;  5U47 A;  5EOO A;  1GHP A;  3MZE A;  1I5Q A;  4X56 A;  5G18 A;  2JE5 A;  2ZQC A;  5EVI A;  2X01 A;  1K56 A;  1L0F A;  3FV7 A;  4QY5 A;  5HFO A;  2XF3 A;  4XUZ A;  3G4P A;  2XK1 A;  1NYY A;  1KE3 A;  5AQ9 A;  2Y2G A;  4KZ9 A;  4BL2 A;  2PU4 A;  1H8Z A;  1PIO A;  4WEJ A;  2EFX A;  3HLC A;  5CXW A;  4ZBE A;  3ZGA B;  2WZX A;  3Q1F A;  4E3J A;  2Y2N A;  4A5R A;  4E3N A;  3MFD A;  5KZH A;  1ZC2 A;  1HD8 A;  2WGV A;  5I94 A;  4Y0O A;  2ZQ7 A;  3UDI A;  4Y0U A;  4CJN A;  2XFT A;  3IF6 C;  4B4Z A;  5DF7 A;  1IKI A;  1J9M A;  1XKZ A;  2Y91 A;  2HDR A;  3MZD A;  3W4P A;  4GKU A;  3N8L A;  4E3O A;  5CHJ A;  5FQK A;  2WKI A;  5FAT A;  5GHZ A;  5CED A;  2WKH A;  4R3J A;  4X68 A;  3RXX A;  3W4Q A;  3N4I A;  3C4P A;  5GLC A;  1YLY A;  2ZC4 B;  3C7V A;  1BSG A;  4MBK A;  1FSW A;  3BYD A;  1K57 C;  4XXR A;  4GB7 A;  3IHB A;  4KZA A;  3NI9 A;  4KQO A;  5DTK A;  5E43 A;  5CRF A;  3ZCZ A;  1CEG A;  5TGF A;  2XD5 A;  5E2H A;  4S2O A;  3ZG8 B;  5FSR A;  4KZB A;  2QPN A;  1EI5 A;  4UAA A;  1XXM A;  4OP8 A;  1KE4 A;  1E3U D;  1E4D A;  1W7F A;  5FA7 A;  4P0M A;  5A92 A;  3LO7 A;  3WRT A;  4E3I A;  1FSY A;  1K4E A;  2ZC7 A;  3GV9 A;  1GHI A;  3MKE A;  4U3T A;  3ZHH A;  2P9V B;  4WEL A;  1JVJ A;  3A3J A;  2EX6 A;  2HP9 A;  3BFF A;  3Q7V B;  3ZVW A;  5EEC A;  3OPR A;  3ZFZ A;  4LV3 A;  4Y7P A;  5GHX A;  1W8Y A;  3HUO A;  5FDH A;  4OLD A;  4PM5 A;  1K57 A;  1LI9 A;  3QHY A;  5KSH A;  4FD8 A;  2Y59 A;  3RXW A;  1PW8 A;  2BLS A;  3SOI A;  3JYI A;  5FAS A;  2P9V A;  3VSK A;  4DF6 A;  3IXD A;  1YLT A;  4R23 A;  2XH9 A;  3CJM A;  3ITB A;  4WMC A;  3IWO A;  1JWP A;  4WZ5 A;  1MWS A;  4OP5 A;  3HVF A;  3O88 A;  2H0T A;  3UDF A;  3WS5 A;  4QJG A;  4DXB A;  4EUZ A;  2V1Z A;  4RX3 A;  1XPB A;  1NRF A;  4ZAM A;  2FFY A;  4B88 A;  1FR6 A;  3V3S A;  2HP5 A;  2H5S A;  1XX2 A;  4KG5 A;  2XD1 A;  3QNC A;  1ZKJ A;  1KDW A;  3PBR A;  4B4X A;  5J8X A;  2Y2L A;  1RGZ A;  2Y2J A;  3BFC A;  4R3B A;  1BUL A;  1NJ4 A;  1NZO A;  3B3X A;  2XGN A;  3UPP A;  1WE4 A;  3ZG5 A;  3E2K A;  5GHY A;  5KSC A;  4ZDX A;  1IEL A;  1W5D A;  2EX8 A;  1YMS A;  3HUN A;  4KZ5 A;  2H0Y A;  4UA6 A;  1RP5 A;  3P09 A;  4DRT A;  5A90 A;  3CZD A;  1YMX A;  4OQI A;  2Z2L B;  3PBN A;  1ESI A;  4E3M A;  3DTM A;  2HDS A;  2HP6 A;  3FZC A;  4IBR A;  1G68 A;  3DW0 A;  3SH9 A;  2WZZ A;  4S2L A;  3BLS A;  1YLP A;  3HLW A;  4S2I A;  3UE1 A;  5CEB A;  4DE0 A;  4PM6 A;  1CK3 A;  4GDB A;  3LY4 A;  2QMI A;  1FCO A;  1JWZ A;  4PM8 A;  4E6X A;  3GTC A;  4E3K A;  4MBH A;  4MNR A;  1W79 A;  3M6H A;  3WRZ A;  1PI5 A;  5EVI B;  5GLD A;  1N4O A;  4BJP A;  1XGJ A;  3HLB A;  4RYE A;  4EBP A;  1NXY A;  3G2Z A;  3IT9 A;  3NBL A;  5D3O A;  3IXH A;  1IKG A;  1IYQ A;  3G32 A;  3N7W A;  3UO9 A;  1W8Q A;  1QME A;  1K56 D;  3BM6 A;  4FCF A;  3GR2 A;  3GSG A;  4YIN A;  2Y55 A;  3E2L A;  3OCL A;  3BEC A;  4R1G A;  3PTE A;  4KZ4 A;  2RL3 A;  3OCN A;  1E25 A;  1YLZ A;  2BG1 A;  4MBF A;  4S2N C;  4BLM A;  3Q7V A;  4JBF A;  1DJA A;  4HES A;  2EFU A;  4NK3 A;  4K0W A;  5DTS A;  1BLH A;  3SS5 A;  5M18 A;  3VP4 A;  4QB8 A;  3VFH A;  4EBL A;  3VSL A;  4P85 A;  3PAG A;  4DE1 A;  3AGE A;  1DY6 A;  1N9B A;  4X6T A;  3G30 A;  1DJB A;  1KVM A;  4KZ3 A;  3ITA A;  1GHM A;  2H10 A;  3NDG A;  1SDE A;  3NC8 A;  1YLW A;  2WGI A;  2WAF A;  2DCF A;  2V20 A;  3IF5 A;  4OPQ A;  1L2S A;  4GNU A;  4E3L A;  5L2F A;  4N1X A;  2Y2O A;  1FOF A;  4JXV A;  5E2F A;  3VP1 A;  4QD4 A;  2EXA A;  2IWB A;  1U60 A;  3PBS A;  3G34 A;  4GN2 A;  3WWX A;  3OPH A;  1JWV A;  1WYB A;  1TVF A;  3AGF A;  2R9X A;  1ALQ A;  3HUM A;  4DE3 A;  2J8Y A;  3FWL A;  4D2O A;  3TOI A;  4QU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...