4WZ4A

Crystal structure of p. aeruginosa ampc
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
360
structure length
360
Chain Sequence
APADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title 4,5-Disubstituted 6-Aryloxy-1,3-dihydrobenzo[c][1,2]oxaboroles Are Broad-Spectrum Serine beta-Lactamase Inhibitors.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Hydrolase/hydrolase inhibitor
total genus 123
structure length 360
sequence length 360
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4wz4A00
4F94A 4XUXA 4WEJA 1KE4A 3VP3A 4EBLA 2V1ZA 3BFFA 3SS5A 3OPRA 1NZUA 1EROA 5DF8A 4NK3A 4R4SA 4DXBA 4GDBA 1XA7A 2X01A 3FKWA 3NI9A 2EX2A 3ZVWA 5FQ9A 3NIAA 3E2KA 2J7VA 3CMZA 5J8XA 4X53A 1U60A 2A49A 2B5RA 1IKGA 4OKPA 3V5MA 5EOOA 5KSCA 1ERMA 5AQAA 2XF3A 3Q7ZA 1BZAA 2XD1A 3BRMA 4DDYA 3V50A 2WKEA 3LY4A 4C75A 5F1FA 3PBOA 1FR1A 2ZQDA 1JTDA 3MZEA 3QNBA 5FQJA 1HZOA 2HP5A 3AGFA 1MWTA 1VM1A 1ES3A 3QHYA 3O88A 3Q1FA 2XD5A 4DF6A 2RCXA 1GA9A 1SDNA 2Y2KA 3FV7A 3GTCA 3WRZA 5BOHA 3LCEA 2EX6A 1O7EA 1E3UD 1ONHA 3ISGA 3IXDA 2WGVA 4X56A 3UPNA 2EX8A 4XUZA 4S2LA 5GHXA 3LY3A 2ZQ9A 2XEPA 3JYIA 1ES4A 3MBZA 4UAAA 4FH2A 2JBFA 3G32A 2QZ6A 4B4XA 4GKUA 2OLVA 1CEFA 4KZ7A 1G68A 1YMXA 2WAFA 3ZCZA 3O87A 4H8RA 2Y2QA 3HREA 4GD8A 5FQQA 1S0WA 4OOLA 5GLAA 5TR7A 1SDEA 2A3UA 1S6RA 3O86A 3UN7A 2X71A 2VGKA 4B4ZA 1ERQA 5HAPA 3HLWA 3Q7VB 3MKFA 3FYZA 5EVIA 1VQQA 5FQIA 3PBSA 4OOMA 3ZG5A 2DNSA 5CEBA 4YFMA 1TVFA 1YLJA 3IWQA 4IBXA 3WWXA 4LENA 2Y2OA 2ZLYA 1LL9A 1I5QA 1O07A 4KG2A 4WMCD 1MKIA 3FWLA 3IH9A 1KDSA 3LO7A 3VP1A 5GL9A 4KQRA 3IHBA 3V3RA 2H5SA 3OC2A 1BTLA 5CTNA 3ZG7B 1MWRA 4X68A 1FSWA 1K55A 4BD0A 5HAIA 4ZJ1A 5KZHA 2C5WB 2ZD8A 4Z9QA 2HDUA 5F1GA 5A91A 1W8QA 5CGWA 5IHVA 1PZOA 3NCKA 4RA7A 5EUAA 3SS3A 3VOZA 5KMWA 3NC8A 2WGIA 3ZG0A 5A90A 3FKVA 1PWDA 1LL5A 4UA9A 3IH8A 3WS2A 4E3KA 3C5AA 4WBGA 3G34A 4X55A 3UE1A 3GRJA 4A5RA 3LEZA 2Y2GA 3PBRA 1IEMA 1HVBA 4D2OA 2EFXA 4S2PA 4OQIA 4PM6A 2ZC5B 1ESUA 5G18A 2EXBA 1DJCA 2Y59A 3BFCA 5TGFA 1FSYA 1WE4A 1K6RA 3ZDJA 3SOIA 4DE2A 4WEKA 2Z2MB 4PM7A 1NXYA 3O3VA 1W79A 4QD4A 1PZPA 2QPNA 2ZC4B 1ZG4A 4Y0UA 1XP4A 1PW1A 3W4OA 4GOGA 5FAPA 2Y2IA 1IYSA 4RVAA 5M18A 5M19A 3HLBA 4ZJ3A 3S4XA 4OPRA 1BLPA 1PW8A 4U3TA 2XFSA 2XR0A 4HESA 1W8YA 5HAQA 1PYYA 4X6TA 1SHVA 4OVDA 2VGJA 4DE0A 1ES2A 3DWKA 3VMAA 5FI2A 2XLNA 5DTSA 5HFOA 1HTZA 4GB7A 3WS5A 1FCNA 4KQOA 1SKFA 1IKIA 2Y4AA 4BL3A 4E3IA 4Y0TA 5FSRA 2ZM8A 2PU4A 5AQBA 2J8YA 1IYOA 3N8LA 2G2UA 1FQGA 5FQKA 3NBLA 3BM6A 3WS0A 4OONA 1GHIA 1RCJA 4PM5A 4KZ4A 4ID4A 1XGIA 5EVID 1L0EA 4CPKA 1FOFA 1ZKJA 5HW3A 4IVKA 4DRTA 3EQVA 2WADA 4MBFA 2OV5A 2DRWA 5CRFA 2CC1A 2WGWA 4KZBA 5A93A 3IXHA 1BUEA 3C7VA 1EI5A 1Q2QA 1K38A 3CJMA 2Y2LA 3M2KA 2X02A 3EQUA 4S2OA 1LHYA 5DTKA 5FAOA 1TDGA 2HDSA 3OCLA 4U0TA 5CHUA 4N9KA 3CG5A 4YINA 5FA7A 3VP0A 4RX2A 4ZJ2A 4IEDA 4E3JA 3PAEA 4OQHA 3PAGA 1NZOA 4UA7A 4ZAMA 3P09A 2EX9A 4GN2A 3IXBA 4BLMA 5DF7A 1DJBA 4R3JA 2ZQCA 4E3LA 4N92A 4S2MA 4ZBEA 3MZFA 2R9XA 4OP8A 1K56A 4PMAA 2PU2A 3W8KA 3UDFA 4Q8IA 3VP2A 3W4PA 1MXOA 4N9LA 2WAEA 1WYCA 5CTMA 4E3MA 4E6WA 4QY5A 1YQSA 4WZ5A 4OPYA 4DE3A 3IWIA 4WM9A 1IYPA 5CERA 3BLMA 3SH7A 2ZQ7A 5CHJA 3I7JA 1JWPA 5EOEA 3IXGA 5HARA 4QB8A 3UDXA 1BLHA 1NYYA 1RGZA 2HPBA 2GDNA 3GV9A 5FQMA 1H8YA 3TOIA 1ZC2A 1BSGA 2Q9NA 3CZDA 5AQ7A 3N8SA 1DJAA 5FASA 4HBUA 2P9VB 4MBHA 3HLGA 1JWZA 3ZGAB 1RP5A 4JBFA 1L2SA 4MLLA 1KDWA 3SH9A 1L0GA 3PBTA 3ZG8B 1IELA 3Q82A 1H8ZA 5EE8A 1M6KA 2WZZA 4BJPA 1MPLA 1K54A 3SS4A 2WYXA 3BFDA 1XKZA 2IWDA 3GMWA 4KZ9A 1YMSA 5FI6A 1BLSA 3C4PA 3Q7VA 1I2WA 4P87A 1CI9A 3V39A 1WYBA 3MZDA 2ZC3B 4P0MA 2WZXA 3RXXA 1MY8A 4QY6A 4OPZA 4R0QA 3IF6A 1CK3A 1FCMA 3HLFA 4PM8A 3S1YA 3SH8A 4JXGA 1K57C 3VP4A 3G30A 2QMIA 1H5XA 5DF9A 5DVAA 3HUMA 3HLEA 3IHAA 1PI4A 1YLWA 3M6BA 2Y91A 3P98A 1ZG6A 3BFGA 3DTMA 4S2NA 4CJNA 4LCMA 1TDLA 5EVIC 1J9MA 2Y2HA 3BYDA 4EWFA 4UA6A 1YLTA 5CGSA 3NY4A 4HBTA 2BG1A 4LV0A 3W4QA 4PPRA 5M1AA 3N6IA 2V20A 5D3OA 2ZQAA 5GLCA 1KE0A 1BT5A 3OPLA 3IWOA 3HLDA 4OOYA 4X69A 5FAQA 1YT4A 4R4RA 4EV4A 4K0XA 1G6AA 2XQZA 1KGEA 2XK1A 3HUOA 4MNRA 3DWZA 1GA0A 3ZHHA 4E3OA 4KZ3A 1CI8A 1DY6A 3M6HA 3OCNA 1KVMA 4B88A 1K55C 2UWXA 2ZJ9A 2Y2JA 4NETA 3A3FA 4FH4A 5EPHA 1NY0A 4N1XA 2XDMA 1E4DA 1MWUA 2R9WA 3GR2A 3M2JA 4JF6A 4OQGA 3HLCA 3OPPA 4LCLA 2XGNA 2H0TA 1KE3A 4JKTA 4QHCA 3QNCA 1LLBA 1N9BA 2ZM0A 3PBNA 3ZNYA 4FD8A 4JF5A 2IWBA 4GD6A 4QU3A 1Z6FA 2FFYA 4OLDA 2JC7A 2WGWB 1W5DA 3ZNTA 2WK0A 4BD1A 1JWVA 3GVBA 4GNUA 4P85A 2PBYA 4GZBA 3S22A 1NJ4A 4R23A 1K6SA 2JCHA 5E2FA 4RYEA 4L0LA 4LV1A 1XPBA 2FFFB 3GSGA 4KZ8A 3VSKA 1XA1A 3AGEA 2ZC7A 3IT9A 2XFTA 2Y2PA 3G35A 2ZM2A 1PWGA 4RX3A 3TSGA 3WRTA 1XX2A 4S2IA 5GLBA 5E2EA 1Y54A 4XXRA 5EECA 1YLPA 5EVLA 4UHUA 3G2YA 1JVJA 3VSLA 3BEBA 1K25A 1KGFA 2ZMAA 3NDGA 4WYYA 3UY6A 3PTEA 4DXCA 1E25A 4C6YA 3HL9A 3D4FA 3IQAA 5HL1A 2Y2NA 5KSHA 1K4FA 1YM1A 2EFUA 2HDRA 3BFEA 2J9PA 5CXWA 2WKIA 2P74A 4U0XA 1GHPA 2HP6A 3N7WA 4JXSA 1N4OA 5DTTA 3ZFZA 3GQZA 5HX9A 5JYPA 4R3BA 3UO9A 4M3KA 1C3BA 4FCFA 5EVIB 4DE1A 1BLCA 3VFHA 2ZC6B 3VFFA 1LI9A 5AQ9A 3HBRA 5I94A 3HVFA 1I2SA 2I72A 4GDNA 5CHMA 4OQ0A 2H0YA 2H10A 4JF4A 4JXWA 4DKIA 4K0WA 1NYMA 4LV2A 3ZVTA 4O7DA 1L0DA 5CEDA 2Q9MA 4KG5A 4FSFA 5GHZA 3WS1A 1LI0A 4PM9A 1ONGA 1M40A 3UE0A 4KG6A 3BECA 4BQMA 1K57A 2E8IA 3A3IA 4IVIA 4KENB 4KZAA 3UPOA 2WUQA 2OSUA 1Q2PA 3G31A 4OP5A 1K4EA 1XGJA 4R1GA 4WZ4A 1EWZA 1YLYA 3VOYA 4JXVA 4EUZA 3PBQA 3B3XA 2V2FF 4ZDXA 2EXAA 2WKHA 3E2LA 5E2GA 3V3SA 1YLZA 3A3EA 3IF6B 2IWCA 3AGDA 1QMEA 1PIOA 2HP9A 4WZ5C 1QMFA 3UPPA 1FCOA 2P9VA 1W7FA 3MFDA 3RXWA 4S2KA 4IBRA 3OZHA 1ESIA 4MBKA 4DDSA 1XXMA 5FATA 3ZG9B 3ITBA 5FDHA 1CEGA 2RL3A 1HD8A 3N8RA 3UNWA 1PI5A 1SCWA 1KVLA 3WS4A 1E3UA 4JPMA 2JE5A 4Y7PA 4WELA 1ALQA 4KZ6A 1AXBA 4K91A 5CGXA 5E2HA 2Y55A 3UE3A 5L2FA 4OH0A 4KQQA 3RJUA 4KZ5A 4LV3A 2Y2MA 3BLSA 3N4IA 1GHMA 1PWCA 3NDEA 2C6WB 2HDQA 3HUNA 3Q81A 3MXSA 4HEFA 4OPQA 1MBLA 3DW0A 3Q07A 1KGGA 4OLGA 3ITAA 4QJGA 3G2ZA 1K54C 1L0FA 2BLSA 4N1HA 3OPHA 1NRFA 5A92A 5E43A 5F82A 1TEMA 1OMEA 3C7UA 2Z2LB 4JLFA 1K56D 3TG9A 3MXRA 4EQIA 3A3DA 4BL2A 5F83A 5TFQA 3IF5A 3IF6C 4S2JA 4P6BA 4BENA 2ZQ8A 4WMCA 1GCEA 1ES5A 5U47A 4E6XA 4Y0OA 4ZTKA 2J9OA 5GHYA 3UDIA 4MEZA 1JTGA 3MKEA 4S2NC 3A3JA 1RGYA 3FZCA 3C4OA 3G4PA 4E3NA 2G2WA 2XH9A 5GLDA 2OLUA 1IYQA 1BULA 1FR6A 1MWSA 4C3QA 4EBPA 4EBNA 2DCFA 5FI7A 5CECA 5JYOA
chains in the Genus database with same CATH superfamily
3LIDA 3S7OA 1KE4A 5EM0A 3BY8A 4WN5A 3SS5A 3E4OA 1EROA 1Y28A 3FKWA 3NIAA 4OKPA 3CAXA 2AVXA 4JGQA 2XF3A 3BRMA 4DDYA 4C75A 1CF0A 5F1FA 1FR1A 2QJ5A 4Y13A 4NXBA 1GA9A 1UWPX 3FV7A 1NWZA 4QPRA 5BOHA 1E3UD 3ISGA 4X56A 3S7NA 4XUZA 3LY3A 3JYIA 1ES4A 3G32A 2J3WA 2NUTC 1CEFA 1G68A 1YMXA 2Y2QA 1S0WA 1SDEA 3U4LP 1S4RA 1ERQA 4KUKA 3HJKA 3Q7VB 3FYZA 4OOMA 3ZG5A 5HSQA 3H7WA 1YLJA 3KSIA 2BTFP 1F98A 3IH9A 1J3WA 3MQ0A 3R7WB 1KDSA 3LO7A 3VP1A 5HPFA 1T1AA 2H5SA 1K55A 4BD0A 5HAIA 2C5WB 1W8QA 1PZOA 4LRYC 3NC8A 4GJ4A 3ZG0A 3CHWP 5A90A 3H82A 3WS2A 4E3KA 3C5AA 4WBGA 5TJJA 4A5RA 2EFXA 2EXBA 1DJCA 2Y59A 1FSYA 1WE4A 1TS7A 3O3VA 2KLIA 3MSHA 4I5SA 1PZPA 2MJ6A 1ACFA 1PW1A 2J3TC 4BBVA 3W4OA 5FAPA 2Y2IA 4K08A 4RVAA 5M19A 4KQDA 3KSHA 3S4XA 4OPRA 1BLPA 2XR0A 2PYRA 4DJ3A 1W8YA 1PYYA 4DE0A 4OVDA 1ES2A 5HFOA 4KQOA 5FSRA 2ZM8A 4F3LB 4PM5A 1RCJA 4KZ4A 1VETA 4CPKA 4Z1WA 3EQVA 4MBFA 4MMNA 5CRFA 2O9CA 4LRZE 5J7EA 1Q2QA 3CJMA 2Y2LA 3SZTA 4S2OA 4YOFA 4P6ZS 3OCLA 3UB7A 3LYXA 1NZOA 1G5UA 2EX9A 4GN2A 1ZTUA 3K3CA 3T4TA 5FDSA 4R3JA 3UB6A 3VP2A 3W4PA 4N9LA 1YQSA 4OPYA 5TBMB 5CERA 1CJFA 3BLMA 3SH7A 4HJ4A 3T50A 4EW7A 3IBJA 5EOEA 5HARA 3EGXC 4MN5A 1NYYA 2HPBA 3GV9A 2INWA 1OTIA 3IS2B 1TD5A 3GDIA 4HBUA 2P04A 4MBHA 3MXQA 3ZGAB 3BY9A 4EQ1A 4GHIA 2VLGA 2JKTI 1H8ZA 3R4KA 4G3VA 1YKDA 3SS4A 2VK3A 2W0NA 3QP5A 2HJ9C 3S7QA 4R0QA 3IF6A 4PM8A 2LB5A 1H5XA 4Q0IA 2D01A 1YLWA 1ZG6A 3DTMA 1N9LA 2FZ0A 5HZHA 3BYDA 4IUKA 3W4QA 1H3QA 3N6IA 3VE4A 2WKQA 3PXPA 4OOYA 1KGEA 4HOIA 3DWZA 3ZHHA 1CI8A 3OCNA 1P9RA 3FPVA 1K55C 4B88A 1D7EA 4CLCE 1E4DA 4OQGA 3M2JA 3OLOA 4L9EA 3HLCA 4CLCA 4JKTA 4QHCA 3QNCA 1LLBA 2IWBA 1Z6FA 4OLDA 2WGWB 1W5DA 4BD1A 3GVBA 3P01A 2PBYA 4GZBA 1NJ4A 2PT7A 4L0LA 4LV1A 2YKFA 3SW1A 2XFTA 2Y2PA 4NEED 5GLBA 1Y4OA 4L9GA 4XXRA 5EVLA 3G2YA 2ZMAA 3OOVA 1E25A 3BQAA 4C6YA 3KO6A 5KSHA 1YM1A 2EFUA 3BFEA 5DKKA 1UGUA 2P74A 3IBRA 4JXSA 4R3BA 3UO9A 1C3BA 4FCFA 1BLCA 4B93A 2ZC6B 1LI9A 5AQ9A 1L3LA 4ARZA 4OQ0A 3B33A 2ZOIA 3RTYA 4K0WA 3NULA 3ZVTA 2Q9MA 4KG5A 3WS1A 2VX8A 4PM9A 2VA0A 3UE0A 5EM1A 3A3IA 4IVIA 3UPOA 3UB5P 4WZ4A 3G31A 1K4EA 1XGJA 4I3JA 3PBQA 4HNBA 2GJ3A 2EXAA 2ZMFA 3E2LA 4HJ3A 1YLZA 2HP9A 5FL3A 1QMFA 2P9VA 3B42A 3RXWA 3O5YA 4IBRA 3ZG9B 5FDHA 3N8RA 3UNWA 1SCWA 1PFLA 2A24A 1ZHHB 4KZ6A 3UE3A 2W1TA 4KQQA 3RJUA 4LV3A 2HDQA 3HUNA 1DP9A 4OLGA 5C5KA 1G28A 2BLSA 1LSVA 1OTEA 3OPHA 4I3AA 4JLFA 1K56D 3MXRA 2O99A 3LIFA 5TFQA 3IF6C 4H6JA 4P6BA 2ZQ8A 1GCEA 1ES5A 2J9OA 5GHYA 3UDIA 2K31A 4C3QA 1BULA 4GW9A 2DCFA 1SKOA 5CECA 5HDDA 5JYOA 4ETXA 4F94A 1T1CA 4XUXA 4WEJA 4YNRA 4EBLA 3BFFA 4YWZA 3OPRA 4PAUA 4R4SA 1LT0A 1XA7A 3NI9A 2VKSA 1V9ZA 1UWNX 1TF1A 3E2KA 1IKGA 4NXGA 2JKGA 5KSCA 2K2NA 5DJTA 1YSQA 3V50A 3PBOA 4CLCC 4BWIA 3MZEA 5FQJA 1NLZA 3MS6A 1HZOA 2KOIA 3AGFA 1MWTA 3QHYA 1S67L 3WRZA 3KSGA 2A2LA 2EX6A 4Y5FA 3IXDA 2WGVA 4S2LA 5GHXA 2ZQ9A 2XEPA 2LB9A 2QZ6A 1YSPA 3MQOA 4H8RA 3HREA 5FQQA 4B9OA 4B4ZA 2K7SA 5EVIA 2W3FA 4L9FA 3PBSA 3TE8A 1DP6A 5CEBA 1TVFA 3WWXA 3IWQA 4IBXA 4LENA 3K2NA 1I5QA 1O07A 4WMCD 2V9AA 3FWLA 4Y15A 1F2KA 4KQRA 3V3RA 3LI8A 2CMNA 3DTIA 5CTNA 1MWRA 4X68A 5KZHA 1YPRA 2B02A 2ZD8A 2HDUA 5F1GA 3SS3A 5CGWA 5KMWA 2WGIA 3FKVA 1PWDA 1LL5A 4G3WA 3D3OA 1HVBA 2JHEA 3NOTC 4OQIA 2ZC5B 5TGFA 1K6RA 3ULFA 4BBUA 3SOIA 4WEKA 4PM7A 4O0PA 1GSVA 4GOGA 1IYSA 4XT2B 1LSWA 2W27A 2V1BA 5HL6A 2UV0E 2VGJA 3DWKA 5FI2A 5DTSA 3WS5A 2JKRI 1SKFA 5IS1A 4NXFA 2PU4A 2J8YA 1FQGA 5FQKA 1GHIA 4WL9A 4ID4A 3DAVA 2DRWA 4KZBA 1BUEA 1EI5A 1K38A 4DMZA 1LHYA 5FAOA 1TDGA 2HDSA 4N9KA 3CG5A 4YINA 3VP0A 3GECA 3PAEA 4OQHA 3PAGA 3IXBA 5DF7A 4Q0JA 5KIZA 1DJBA 2ZQCA 3D9YA 4R3AA 4PMAA 4EESA 3T1SA 4HH3A 2O9BA 1WYCA 4E3MA 1XFQA 2QKPA 5AVEA 3IWIA 4WM9A 4O8GA 1IYPA 2V8CA 1BLHA 3TRCA 2GDNA 1ZC2A 1BSGA 2Z6DA 3CZDA 1DJAA 1NLYA 3NECA 1RP5A 1L2SA 4MLLA 3PBTA 2WZZA 1MPLA 1K54A 3VE3A 5HWVA 4KZ9A 1XKZA 2IWDA 5FI6A 3W2ZA 1STZA 3ZYTA 1BLSA 1VB6A 3Q7VA 4P87A 2QYBA 1WYBA 3MZDA 1MY8A 3SH8A 1FCMA 1OTAA 3HLFA 3S1YA 3VP4A 1K57C 1YAXA 1S66L 5DFXA 5DF9A 3HUMA 3R7WA 2I9VA 3M6BA 4HQAA 2W3EA 4S2NA 3FPWA 1TDLA 5EVIC 1J9MA 1YLTA 4PPRA 5F69A 2HZ5A 2ZQAA 5GLCA 3OPLA 3HLDA 1YT4A 4R4RA 4K0XA 4AFIA 2XK1A 4HY8A 3HUOA 3DTEA 4MNRA 2R78A 1KVMA 3T4OA 2UWXA 2Y2JA 2GX5A 5EPHA 5J3WA 4N1XA 3QP2A 1XFNA 2ZL1B 4LCLA 1N9BA 4IUHA 2PHYA 2JC7A 2WK0A 4LGWA 4R23A 1K6SA 5E2FA 3CPTB 4RYEA 4KZ8A 3VSKA 4GS9B 1P9WA 1XA1A 3UMEA 2JKFA 3AGEA 3G35A 3VV4A 4F3LA 1FILA 5EECA 2M7UA 3BEBA 3NDGA 4DXCA 2Y2NA 1K4FA 1JNUA 5CXWA 1NRJA 3KSFA 2W3HA 1GHPA 1MC0A 5DTTA 2VEAA 4MDZA 4EETB 4MN6A 3VFFA 5I94A 1I2SA 1ODVA 2Y8HA 2H10A 4JXWA 1L0DA 4FSFA 1LI0A 4KG6A 4BQMA 5TBMA 3MMHA 2WUQA 1Q2PA 4OP5A 1YLYA 5CX7A 2V2FF 3T4SA 5DFYA 1F5MA 2WKHA 3IS2A 3D72A 4PKYA 2ACGA 4NXEA 2GZAA 3IF6B 2IWCA 4CLCD 3UPPA 1FCOA 2Z6CA 1W7FA 1H8MA 1ESIA 4MBKA 4DDSA 1XXMA 3ITBA 1HD8A 4JPMA 1ALQA 2OWHA 2PRFA 5E2HA 4OH0A 3MR0A 3VOLA 3BLSA 3N4IA 1GHMA 3NDEA 1IFQA 3F1PA 3Q81A 3HCYA 5K5BA 3C30A 1D06A 2FH5A 3DW0A 3Q07A 1KGGA 4LFUA 1K54C 5A92A 1T1BA 5E43A 5F82A 4BL2A 5F83A 3F1NA 4NKPA 4S2JA 5U47A 3LR5A 3F1OB 1JTGA 4S2NC 3MQQA 2P7JA 3A3JA 1RGYA 3FZCA 2G2WA 2XH9A 5GLDA 1IYQA 2OLUA 5FI7A 1D1JA 2V1ZA 2OAP1 1NZUA 5DF8A 4NK3A 2OWJA 3E98A 2X01A 3ZVWA 5FQ9A 3MFXA 5J8XA 2B5RA 2V8FA 3V5MA 1PRQA 5AQAA 3JPUA 3Q7ZA 1BZAA 3IX4A 1OJGA 2WKEA 1S1ZA 5HDCA 3TJZC 2HF6A 3QNBA 1VM1A 3O88A 3Q1FA 1MKMA 2Y2KA 1SDNA 2PR5A 5L07A 3LCEA 1O7EA 2XRNA 2EX8A 3BJNA 4UAAA 4FH2A 3T12B 3QP1A 2OLVA 4KZ7A 3ZCZA 2OAQ1 4GD8A 4OOLA 5TR7A 2A3UA 1S6RA 3UN7A 2X71A 2VGKA 3MKFA 1VQQA 5FQIA 2DNSA 1TS6A 3PHYA 1MKIA 3KX0X 3IHBA 3OC2A 1BTLA 1FSWA 4ZJ1A 4Z9QA 5A91A 5IHVA 5EUAA 4RA7A 1LSXA 2YKHA 4X1LA 5F5YA 4WF0A 4UA9A 3IH8A 2Y2GA 3PBRA 4S2PA 1ESUA 2E8JA 2PAVP 3NOUC 5HDSA 4DN0A 1X0OA 4ME4A 3ZDJA 3P7NA 4DE2A 1F9IA 1NXYA 1W79A 5L10A 2QPNA 2ZC4B 2W3DA 1N9NA 1XJ4A 3T1QB 5M18A 4ZRRA 3HLBA 3BW6A 4ZJ3A 4U3TA 2XFSA 1T19A 4BMWA 1SHVA 3VMAA 4GB7A 3T4QA 1IKIA 2Y4AA 1WA9A 4E3IA 4Y0TA 1A0KA 3C38A 3EWKA 5AQBA 5DKLA 2G2UA 3NBLA 3BM6A 3WS0A 3L7HA 1XGIA 5EVID 1FOFA 4DRTA 1TS8A 1VHMA 2OV5A 2CC1A 5A93A 3IXHA 3C7VA 2IA2A 2J3TD 3M2KA 3EQUA 1HLUP 5DTKA 1W63M 2HV1A 5FA7A 2ZBBA 4RX2A 4IEDA 4ZAMA 4HP4A 4E3LA 4N92A 5EV0A 3UB9A 3FC7A 4S2MA 4ZBEA 3MZFA 2R9XA 4OP8A 1K56A 2PU2A 4O01A 3W8KA 5CTMA 1MXOA 2WAEA 4E6WA 3DBAA 4CQHA 4QY5A 4DE3A 4WZ5A 3E4QA 2ZQ7A 3I7JA 5L09A 1XJ2A 3QP4A 4Y2FA 4I39A 4QB8A 4EUVA 1RGZA 5FQMA 1H8YA 3TOIA 5F68A 4D60A 4I38A 1VEUB 5AQ7A 4PHTA 4RQ9A 1OJ5A 2VJWA 4Q0HA 4JBFA 4EEPA 1KDWA 3NJAA 3Q82A 2HJEA 2ZOHA 5EE8A 4BJPA 4UEYA 2WYXA 5EFWA 2O9AA 2PD8A 3C4PA 1EW0A 1CI9A 4P0MA 5L8MA 2WZXA 3RXXA 4OPZA 3G30A 2QMIA 1K0KA 5DVAA 3KYQA 3IHAA 3E0YA 3T4KA 2Y91A 3BFGA 1DRMA 2Y2HA 4EWFA 4UA6A 5HD5A 4HBTA 1P0ZA 2BG1A 4LV0A 1DP8A 2L4RA 2V20A 5D3OA 3LIAA 3IWOA 5FAQA 3PR6A 1AWIA 3LICA 3KYEA 1G6AA 3ZQ5A 5MC7A 2XQZA 1GA0A 2XA7M 4JGPA 5HWTA 1NY0A 1S1YA 3KYZA 2XDMA 1MWUA 3GR2A 1XJ6A 3OPPA 2QHKA 2H0TA 4FTXA 1KE3A 2XSSA 1MZUA 3CWFA 4LRXC 3H9WA 2ZM0A 4XT2A 4FD8A 4JF5A 2PR6A 4QU3A 3A0VA 2VV8A 3HJIA 1JWVA 4P85A 3S22A 2JCHA 2DMWA 1XPBA 3GSGA 4IJGA 4ETZA 1SZVA 3IT9A 2ZM2A 4JGOA 1P97A 1Y54A 2V1AA 1YLPA 4HP9A 1JVJA 3VSLA 4II7A 3UY6A 4Y3IA 3HL9A 1LL8A 3IQAA 5HL1A 2WKIA 4U0XA 3IX3A 3T4LA 3GQZA 2B95A 5FEGA 4M3KA 4DE1A 2EA9A 3CLOA 3H7WB 2I72A 4GDNA 5CHMA 4G3KA 2H0YA 4JF4A 5CEDA 5GHZA 2J80A 3BECA 5LBRA 4HHDA 4KENB 2W1RA 4R1GA 3MJQA 3VOYA 4ZDXA 4UQIM 3V3SA 3C2WA 3H82B 3A3EA 3AGDA 2H28A 4WZ5C 5G4ZA 4JGRA 4S2KA 3LFVA 3BWLA 3OZHA 3UB8A 2RL3A 2L0WA 1PI5A 3CUEA 3QP8A 1KVLA 1E3UA 4WELA 1AXBA 4K91A 5CGXA 2Y55A 5L2FA 2WKPA 4Y17A 2Y2MA 3EGDC 2C6WB 4OPQA 3MXSA 4HEFA 1MBLA 2VZWA 4QJGA 3ITAA 1NRFA 4NG2A 1TEMA 4WUJA 2Y79A 3A3DA 4PKYG 4BENA 2P08A 4Y0OA 4ZTKA 4MEZA 1VETB 3MKEA 2OOLA 4MN7A 2WKRA 4I3IA 4E3NA 3A0RA 3T4JA 2PDRA 1MWSA 2L1MA 3G6OA 1OTBA 1N9OA 2JKTM 3VP3A 3BQ8A 2ZL1A 4DXBA 3TW8A 4GDBA 4HH2A 2EX2A 4M4XA 3JVUA 2J7VA 3CMZA 4X53A 1U60A 2A49A 5I5LA 3LIEA 5EOOA 4EEUA 1ERMA 2XD1A 3RFBA 3LY4A 2PYPA 3CPTA 2ZQDA 1JTDA 4EU0A 2HP5A 4GS9A 1ES3A 2XD5A 4DF6A 3IX8A 2RCXA 2D02A 3GTCA 1S4SA 1ONHA 5IU1A 3U2AA 1GSWA 3UPNA 2M1CA 3MBZA 2JBFA 4B4XA 4GHIB 4GKUA 5AVFA 2WAFA 3FG8A 2PBDP 3O87A 5GLAA 3O86A 5HAPA 3HLWA 2VGLM 4YFMA 2Y2OA 2ZLYA 1LL9A 2NUPC 4KG2A 5GL9A 1BYWA 3PYPA 3ZG7B 5FEFA 3NCKA 3VOZA 3F1PB 2V0UA 4X55A 3G34A 3UE1A 3GRJA 3LEZA 1IEMA 4D2OA 4PM6A 5G18A 1OTDA 3BFCA 4MCWA 2Z2MB 1H0MA 4BBTA 4QD4A 3F1NB 4FUWA 2XA7S 1ZG4A 4Y0UA 1XP4A 3LEQA 4CLCB 2M7VA 2Q0OA 5HD3A 3LR0A 2KDKA 1PW8A 3CUEC 4HESA 5HAQA 2QJ7A 4X6TA 2XLNA 1HTZA 4X1MA 1FCNA 4BL3A 3LR3A 2GNXA 5AJGA 1IYOA 3N8LA 4OONA 3F1OA 3A0SA 4DJ2A 1L0EA 1ZKJA 4KUOA 5HW3A 4IVKA 4R70A 2WADA 2WGWA 3L9KA 2X02A 5CHUA 4U0TA 4E3JA 4ZJ2A 4UA7A 3P09A 2VV7A 5A8BA 4ARZB 4BLMA 4HIAA 3V67A 2VV6A 3UDFA 4Q8IA 4WLAA 3DTKA 1Z09A 5HWWA 5CHJA 1JWPA 3K3DA 3IXGA 3UDXA 3UMDA 3S7PA 3CI6A 2Q9NA 2EWVA 3N8SA 2W3GA 5DJUA 5FASA 4HI4A 2BASA 2P9VB 3HLGA 1JWZA 4UQIS 4FOFA 3SH9A 1L0GA 3ZG8B 1IELA 3ICYA 1M6KA 5F6AA 3BFDA 3GMWA 2A24B 1YMSA 3LGOA 1I2WA 3V39A 2W1TB 3MF0A 2ZC3B 2QWSA 4QY6A 3E4PA 5IT5A 1CK3A 4JXGA 3OBFA 4ESPA 3HLEA 1PI4A 3P98A 4CJNA 4LCMA 1TS0A 5CGSA 3NY4A 5M1AA 4H6JB 1KE0A 1BT5A 3LR4A 1V9YA 4X69A 4EV4A 4QWOA 4E3OA 4KZ3A 3M6HA 1IOUA 1OPXA 2ZMVA 3NOPC 2ZJ9A 4NETA 3A3FA 1SKOB 4FH4A 4LLOB 2EWWA 2HGVA 4LPZA 4EXOA 2R9WA 4JF6A 1PNEA 2XGNA 4X25A 3RH8B 3PBNA 3ZNYA 4GD6A 2FFYA 3ZNTA 3UE6A 4GNUA 1T18A 1CQAA 5J4EA 2FFFB 3EEAA 4GCZA 2ZC7A 4RX3A 1PWGA 3TSGA 3WRTA 1XX2A 4S2IA 3T1XA 5E2EA 4E04A 1KOUA 4UHUA 1K25A 1KGFA 4WYYA 3PTEA 4P6ZM 3D4FA 2KX6A 2HDRA 2J9PA 3T1RA 3LI9A 2HP6A 3N7WA 3QP6A 1N4OA 3ZFZA 5HX9A 5JYPA 5HPIA 5EVIB 3VFHA 3HBRA 4R38A 3HVFA 3CITA 3EOIA 4DKIA 1NYMA 4LV2A 4O7DA 2VGLS 1ONGA 1M40A 5EVEA 1K57A 1G6OA 2E8IA 4KZAA 2OSUA 3C8CA 2JKRM 4EUZA 1EWZA 4JXVA 3B3XA 1OT6A 5E2GA 1VEUA 1QMEA 1PIOA 4GLQA 2B18A 3LIBA 3MFDA 2XROA 1XJ3A 1W63Q 5FATA 3JVVA 1CEGA 1FIKA 3LUQA 3WS4A 2PD7A 3EEHA 4Y7PA 2JE5A 4KZ5A 4HJ6A 1PWCA 2G7UA 3G2ZA 1L0FA 4N1HA 5G4YA 4EERA 2O0YA 3B47A 1OMEA 3C7UA 2Z2LB 3TG9A 2JN7A 4EQIA 3IF5A 1GSXA 4WMCA 4E6XA 3NHQA 2V0WA 4R6LA 3C4OA 3G4PA 1FR6A 1OT9A 4IHQA 4EBPA 4EBNA 1DY6A
chains in the Genus database with same CATH topology
4F94A 4XUXA 4WEJA 1KE4A 3VP3A 4EBLA 2V1ZA 3BFFA 3SS5A 3OPRA 1NZUA 1EROA 5DF8A 4NK3A 4R4SA 4DXBA 4GDBA 1XA7A 2X01A 3FKWA 3NI9A 2EX2A 3ZVWA 5FQ9A 3NIAA 3E2KA 2J7VA 3CMZA 5J8XA 4X53A 1U60A 2A49A 2B5RA 1IKGA 4OKPA 3V5MA 5EOOA 5KSCA 1ERMA 5AQAA 2XF3A 3Q7ZA 1BZAA 2XD1A 3BRMA 4DDYA 3V50A 2WKEA 3LY4A 4C75A 5F1FA 3PBOA 1FR1A 2ZQDA 1JTDA 3MZEA 3QNBA 5FQJA 1HZOA 2HP5A 3AGFA 1MWTA 1VM1A 1ES3A 3QHYA 3O88A 3Q1FA 2XD5A 4DF6A 2RCXA 1GA9A 1SDNA 2Y2KA 3FV7A 3GTCA 3WRZA 5BOHA 3LCEA 2EX6A 1O7EA 1E3UD 1ONHA 3ISGA 3IXDA 2WGVA 4X56A 3UPNA 2EX8A 4XUZA 4S2LA 5GHXA 3LY3A 2ZQ9A 2XEPA 3JYIA 1ES4A 3MBZA 4UAAA 4FH2A 2JBFA 3G32A 2QZ6A 4B4XA 4GKUA 2OLVA 1CEFA 4KZ7A 1G68A 1YMXA 2WAFA 3ZCZA 3O87A 4H8RA 2Y2QA 3HREA 4GD8A 5FQQA 1S0WA 4OOLA 5GLAA 5TR7A 1SDEA 2A3UA 1S6RA 3O86A 3UN7A 2X71A 2VGKA 4B4ZA 1ERQA 5HAPA 3HLWA 3Q7VB 3MKFA 3FYZA 5EVIA 1VQQA 5FQIA 3PBSA 4OOMA 3ZG5A 2DNSA 5CEBA 4YFMA 1TVFA 1YLJA 3IWQA 4IBXA 3WWXA 4LENA 2Y2OA 2ZLYA 1LL9A 1I5QA 1O07A 4KG2A 4WMCD 1MKIA 3FWLA 3IH9A 1KDSA 3LO7A 3VP1A 5GL9A 4KQRA 3IHBA 3V3RA 2H5SA 3OC2A 1BTLA 5CTNA 3ZG7B 1MWRA 4X68A 1FSWA 1K55A 4BD0A 5HAIA 4ZJ1A 5KZHA 2C5WB 2ZD8A 4Z9QA 2HDUA 5F1GA 5A91A 1W8QA 5CGWA 5IHVA 1PZOA 3NCKA 4RA7A 5EUAA 3SS3A 3VOZA 5KMWA 3NC8A 2WGIA 3ZG0A 5A90A 3FKVA 1PWDA 1LL5A 4UA9A 3IH8A 3WS2A 4E3KA 3C5AA 4WBGA 3G34A 4X55A 3UE1A 3GRJA 4A5RA 3LEZA 2Y2GA 3PBRA 1IEMA 1HVBA 4D2OA 2EFXA 4S2PA 4OQIA 4PM6A 2ZC5B 1ESUA 5G18A 2EXBA 1DJCA 2Y59A 3BFCA 5TGFA 1FSYA 1WE4A 1K6RA 3ZDJA 3SOIA 4DE2A 4WEKA 2Z2MB 4PM7A 1NXYA 3O3VA 1W79A 4QD4A 1PZPA 2QPNA 2ZC4B 1ZG4A 4Y0UA 1XP4A 1PW1A 3W4OA 4GOGA 5FAPA 2Y2IA 1IYSA 4RVAA 5M18A 5M19A 3HLBA 4ZJ3A 3S4XA 4OPRA 1BLPA 1PW8A 4U3TA 2XFSA 2XR0A 4HESA 1W8YA 5HAQA 1PYYA 4X6TA 1SHVA 4OVDA 2VGJA 4DE0A 1ES2A 3DWKA 3VMAA 5FI2A 2XLNA 5DTSA 5HFOA 1HTZA 4GB7A 3WS5A 1FCNA 4KQOA 1SKFA 1IKIA 2Y4AA 4BL3A 4E3IA 4Y0TA 5FSRA 2ZM8A 2PU4A 5AQBA 2J8YA 1IYOA 3N8LA 2G2UA 1FQGA 5FQKA 3NBLA 3BM6A 3WS0A 4OONA 1GHIA 1RCJA 4PM5A 4KZ4A 4ID4A 1XGIA 5EVID 1L0EA 4CPKA 1FOFA 1ZKJA 5HW3A 4IVKA 4DRTA 3EQVA 2WADA 4MBFA 2OV5A 2DRWA 5CRFA 2CC1A 2WGWA 4KZBA 5A93A 3IXHA 1BUEA 3C7VA 1EI5A 1Q2QA 1K38A 3CJMA 2Y2LA 3M2KA 2X02A 3EQUA 4S2OA 1LHYA 5DTKA 5FAOA 1TDGA 2HDSA 3OCLA 4U0TA 5CHUA 4N9KA 3CG5A 4YINA 5FA7A 3VP0A 4RX2A 4ZJ2A 4IEDA 4E3JA 3PAEA 4OQHA 3PAGA 1NZOA 4UA7A 4ZAMA 3P09A 2EX9A 4GN2A 3IXBA 4BLMA 5DF7A 1DJBA 4R3JA 2ZQCA 4E3LA 4N92A 4S2MA 4ZBEA 3MZFA 2R9XA 4OP8A 1K56A 4PMAA 2PU2A 3W8KA 3UDFA 4Q8IA 3VP2A 3W4PA 1MXOA 4N9LA 2WAEA 1WYCA 5CTMA 4E3MA 4E6WA 4QY5A 1YQSA 4WZ5A 4OPYA 4DE3A 3IWIA 4WM9A 1IYPA 5CERA 3BLMA 3SH7A 2ZQ7A 5CHJA 3I7JA 1JWPA 5EOEA 3IXGA 5HARA 4QB8A 3UDXA 1BLHA 1NYYA 1RGZA 2HPBA 2GDNA 3GV9A 5FQMA 1H8YA 3TOIA 1ZC2A 1BSGA 2Q9NA 3CZDA 5AQ7A 3N8SA 1DJAA 5FASA 4HBUA 2P9VB 4MBHA 3HLGA 1JWZA 3ZGAB 1RP5A 4JBFA 1L2SA 4MLLA 1KDWA 3SH9A 1L0GA 3PBTA 3ZG8B 1IELA 3Q82A 1H8ZA 5EE8A 1M6KA 2WZZA 4BJPA 1MPLA 1K54A 3SS4A 2WYXA 3BFDA 1XKZA 2IWDA 3GMWA 4KZ9A 1YMSA 5FI6A 1BLSA 3C4PA 3Q7VA 1I2WA 4P87A 1CI9A 3V39A 1WYBA 3MZDA 2ZC3B 4P0MA 2WZXA 3RXXA 1MY8A 4QY6A 4OPZA 4R0QA 3IF6A 1CK3A 1FCMA 3HLFA 4PM8A 3S1YA 3SH8A 4JXGA 1K57C 3VP4A 3G30A 2QMIA 1H5XA 5DF9A 5DVAA 3HUMA 3HLEA 3IHAA 1PI4A 1YLWA 3M6BA 2Y91A 3P98A 1ZG6A 3BFGA 3DTMA 4S2NA 4CJNA 4LCMA 1TDLA 5EVIC 1J9MA 2Y2HA 3BYDA 4EWFA 4UA6A 1YLTA 5CGSA 3NY4A 4HBTA 2BG1A 4LV0A 3W4QA 4PPRA 5M1AA 3N6IA 2V20A 5D3OA 2ZQAA 5GLCA 1KE0A 1BT5A 3OPLA 3IWOA 3HLDA 4OOYA 4X69A 5FAQA 1YT4A 4R4RA 4EV4A 4K0XA 1G6AA 2XQZA 1KGEA 2XK1A 3HUOA 4MNRA 3DWZA 1GA0A 3ZHHA 4E3OA 4KZ3A 1CI8A 1DY6A 3M6HA 3OCNA 1KVMA 4B88A 1K55C 2UWXA 2ZJ9A 2Y2JA 4NETA 3A3FA 4FH4A 5EPHA 1NY0A 4N1XA 2XDMA 1E4DA 1MWUA 2R9WA 3GR2A 3M2JA 4JF6A 4OQGA 3HLCA 3OPPA 4LCLA 2XGNA 2H0TA 1KE3A 4JKTA 4QHCA 3QNCA 1LLBA 1N9BA 2ZM0A 3PBNA 3ZNYA 4FD8A 4JF5A 2IWBA 4GD6A 4QU3A 1Z6FA 2FFYA 4OLDA 2JC7A 2WGWB 1W5DA 3ZNTA 2WK0A 4BD1A 1JWVA 3GVBA 4GNUA 4P85A 2PBYA 4GZBA 3S22A 1NJ4A 4R23A 1K6SA 2JCHA 5E2FA 4RYEA 4L0LA 4LV1A 1XPBA 2FFFB 3GSGA 4KZ8A 3VSKA 1XA1A 3AGEA 2ZC7A 3IT9A 2XFTA 2Y2PA 3G35A 2ZM2A 1PWGA 4RX3A 3TSGA 3WRTA 1XX2A 4S2IA 5GLBA 5E2EA 1Y54A 4XXRA 5EECA 1YLPA 5EVLA 4UHUA 3G2YA 1JVJA 3VSLA 3BEBA 1K25A 1KGFA 2ZMAA 3NDGA 4WYYA 3UY6A 3PTEA 4DXCA 1E25A 4C6YA 3HL9A 3D4FA 3IQAA 5HL1A 2Y2NA 5KSHA 1K4FA 1YM1A 2EFUA 2HDRA 3BFEA 2J9PA 5CXWA 2WKIA 2P74A 4U0XA 1GHPA 2HP6A 3N7WA 4JXSA 1N4OA 5DTTA 3ZFZA 3GQZA 5HX9A 5JYPA 4R3BA 3UO9A 4M3KA 1C3BA 4FCFA 5EVIB 4DE1A 1BLCA 3VFHA 2ZC6B 3VFFA 1LI9A 5AQ9A 3HBRA 5I94A 3HVFA 1I2SA 2I72A 4GDNA 5CHMA 4OQ0A 2H0YA 2H10A 4JF4A 4JXWA 4DKIA 4K0WA 1NYMA 4LV2A 3ZVTA 4O7DA 1L0DA 5CEDA 2Q9MA 4KG5A 4FSFA 5GHZA 3WS1A 1LI0A 4PM9A 1ONGA 1M40A 3UE0A 4KG6A 3BECA 4BQMA 1K57A 2E8IA 3A3IA 4IVIA 4KENB 4KZAA 3UPOA 2WUQA 2OSUA 1Q2PA 3G31A 4OP5A 1K4EA 1XGJA 4R1GA 4WZ4A 1EWZA 1YLYA 3VOYA 4JXVA 4EUZA 3PBQA 3B3XA 2V2FF 4ZDXA 2EXAA 2WKHA 3E2LA 5E2GA 3V3SA 1YLZA 3A3EA 3IF6B 2IWCA 3AGDA 1QMEA 1PIOA 2HP9A 4WZ5C 1QMFA 3UPPA 1FCOA 2P9VA 1W7FA 3MFDA 3RXWA 4S2KA 4IBRA 3OZHA 1ESIA 4MBKA 4DDSA 1XXMA 5FATA 3ZG9B 3ITBA 5FDHA 1CEGA 2RL3A 1HD8A 3N8RA 3UNWA 1PI5A 1SCWA 1KVLA 3WS4A 1E3UA 4JPMA 2JE5A 4Y7PA 4WELA 1ALQA 4KZ6A 1AXBA 4K91A 5CGXA 5E2HA 2Y55A 3UE3A 5L2FA 4OH0A 4KQQA 3RJUA 4KZ5A 4LV3A 2Y2MA 3BLSA 3N4IA 1GHMA 1PWCA 3NDEA 2C6WB 2HDQA 3HUNA 3Q81A 3MXSA 4HEFA 4OPQA 1MBLA 3DW0A 3Q07A 1KGGA 4OLGA 3ITAA 4QJGA 3G2ZA 1K54C 1L0FA 2BLSA 4N1HA 3OPHA 1NRFA 5A92A 5E43A 5F82A 1TEMA 1OMEA 3C7UA 2Z2LB 4JLFA 1K56D 3TG9A 3MXRA 4EQIA 3A3DA 4BL2A 5F83A 5TFQA 3IF5A 3IF6C 4S2JA 4P6BA 4BENA 2ZQ8A 4WMCA 1GCEA 1ES5A 5U47A 4E6XA 4Y0OA 4ZTKA 2J9OA 5GHYA 3UDIA 4MEZA 1JTGA 3MKEA 4S2NC 3A3JA 1RGYA 3FZCA 3C4OA 3G4PA 4E3NA 2G2WA 2XH9A 5GLDA 2OLUA 1IYQA 1BULA 1FR6A 1MWSA 4C3QA 4EBPA 4EBNA 2DCFA 5FI7A 5CECA 5JYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F94 A;  4XUX A;  4WEJ A;  1KE4 A;  3VP3 A;  4EBL A;  2V1Z A;  3BFF A;  3SS5 A;  3OPR A;  1NZU A;  1ERO A;  5DF8 A;  4NK3 A;  4R4S A;  4DXB A;  4GDB A;  1XA7 A;  2X01 A;  3FKW A;  3NI9 A;  2EX2 A;  3ZVW A;  5FQ9 A;  3NIA A;  3E2K A;  2J7V A;  3CMZ A;  5J8X A;  4X53 A;  1U60 A;  2A49 A;  2B5R A;  1IKG A;  4OKP A;  3V5M A;  5EOO A;  5KSC A;  1ERM A;  5AQA A;  2XF3 A;  3Q7Z A;  1BZA A;  2XD1 A;  3BRM A;  4DDY A;  3V50 A;  2WKE A;  3LY4 A;  4C75 A;  5F1F A;  3PBO A;  1FR1 A;  2ZQD A;  1JTD A;  3MZE A;  3QNB A;  5FQJ A;  1HZO A;  2HP5 A;  3AGF A;  1MWT A;  1VM1 A;  1ES3 A;  3QHY A;  3O88 A;  3Q1F A;  2XD5 A;  4DF6 A;  2RCX A;  1GA9 A;  1SDN A;  2Y2K A;  3FV7 A;  3GTC A;  3WRZ A;  5BOH A;  3LCE A;  2EX6 A;  1O7E A;  1E3U D;  1ONH A;  3ISG A;  3IXD A;  2WGV A;  4X56 A;  3UPN A;  2EX8 A;  4XUZ A;  4S2L A;  5GHX A;  3LY3 A;  2ZQ9 A;  2XEP A;  3JYI A;  1ES4 A;  3MBZ A;  4UAA A;  4FH2 A;  2JBF A;  3G32 A;  2QZ6 A;  4B4X A;  4GKU A;  2OLV A;  1CEF A;  4KZ7 A;  1G68 A;  1YMX A;  2WAF A;  3ZCZ A;  3O87 A;  4H8R A;  2Y2Q A;  3HRE A;  4GD8 A;  5FQQ A;  1S0W A;  4OOL A;  5GLA A;  5TR7 A;  1SDE A;  2A3U A;  1S6R A;  3O86 A;  3UN7 A;  2X71 A;  2VGK A;  4B4Z A;  1ERQ A;  5HAP A;  3HLW A;  3Q7V B;  3MKF A;  3FYZ A;  5EVI A;  1VQQ A;  5FQI A;  3PBS A;  4OOM A;  3ZG5 A;  2DNS A;  5CEB A;  4YFM A;  1TVF A;  1YLJ A;  3IWQ A;  4IBX A;  3WWX A;  4LEN A;  2Y2O A;  2ZLY A;  1LL9 A;  1I5Q A;  1O07 A;  4KG2 A;  4WMC D;  1MKI A;  3FWL A;  3IH9 A;  1KDS A;  3LO7 A;  3VP1 A;  5GL9 A;  4KQR A;  3IHB A;  3V3R A;  2H5S A;  3OC2 A;  1BTL A;  5CTN A;  3ZG7 B;  1MWR A;  4X68 A;  1FSW A;  1K55 A;  4BD0 A;  5HAI A;  4ZJ1 A;  5KZH A;  2C5W B;  2ZD8 A;  4Z9Q A;  2HDU A;  5F1G A;  5A91 A;  1W8Q A;  5CGW A;  5IHV A;  1PZO A;  3NCK A;  4RA7 A;  5EUA A;  3SS3 A;  3VOZ A;  5KMW A;  3NC8 A;  2WGI A;  3ZG0 A;  5A90 A;  3FKV A;  1PWD A;  1LL5 A;  4UA9 A;  3IH8 A;  3WS2 A;  4E3K A;  3C5A A;  4WBG A;  3G34 A;  4X55 A;  3UE1 A;  3GRJ A;  4A5R A;  3LEZ A;  2Y2G A;  3PBR A;  1IEM A;  1HVB A;  4D2O A;  2EFX A;  4S2P A;  4OQI A;  4PM6 A;  2ZC5 B;  1ESU A;  5G18 A;  2EXB A;  1DJC A;  2Y59 A;  3BFC A;  5TGF A;  1FSY A;  1WE4 A;  1K6R A;  3ZDJ A;  3SOI A;  4DE2 A;  4WEK A;  2Z2M B;  4PM7 A;  1NXY A;  3O3V A;  1W79 A;  4QD4 A;  1PZP A;  2QPN A;  2ZC4 B;  1ZG4 A;  4Y0U A;  1XP4 A;  1PW1 A;  3W4O A;  4GOG A;  5FAP A;  2Y2I A;  1IYS A;  4RVA A;  5M18 A;  5M19 A;  3HLB A;  4ZJ3 A;  3S4X A;  4OPR A;  1BLP A;  1PW8 A;  4U3T A;  2XFS A;  2XR0 A;  4HES A;  1W8Y A;  5HAQ A;  1PYY A;  4X6T A;  1SHV A;  4OVD A;  2VGJ A;  4DE0 A;  1ES2 A;  3DWK A;  3VMA A;  5FI2 A;  2XLN A;  5DTS A;  5HFO A;  1HTZ A;  4GB7 A;  3WS5 A;  1FCN A;  4KQO A;  1SKF A;  1IKI A;  2Y4A A;  4BL3 A;  4E3I A;  4Y0T A;  5FSR A;  2ZM8 A;  2PU4 A;  5AQB A;  2J8Y A;  1IYO A;  3N8L A;  2G2U A;  1FQG A;  5FQK A;  3NBL A;  3BM6 A;  3WS0 A;  4OON A;  1GHI A;  1RCJ A;  4PM5 A;  4KZ4 A;  4ID4 A;  1XGI A;  5EVI D;  1L0E A;  4CPK A;  1FOF A;  1ZKJ A;  5HW3 A;  4IVK A;  4DRT A;  3EQV A;  2WAD A;  4MBF A;  2OV5 A;  2DRW A;  5CRF A;  2CC1 A;  2WGW A;  4KZB A;  5A93 A;  3IXH A;  1BUE A;  3C7V A;  1EI5 A;  1Q2Q A;  1K38 A;  3CJM A;  2Y2L A;  3M2K A;  2X02 A;  3EQU A;  4S2O A;  1LHY A;  5DTK A;  5FAO A;  1TDG A;  2HDS A;  3OCL A;  4U0T A;  5CHU A;  4N9K A;  3CG5 A;  4YIN A;  5FA7 A;  3VP0 A;  4RX2 A;  4ZJ2 A;  4IED A;  4E3J A;  3PAE A;  4OQH A;  3PAG A;  1NZO A;  4UA7 A;  4ZAM A;  3P09 A;  2EX9 A;  4GN2 A;  3IXB A;  4BLM A;  5DF7 A;  1DJB A;  4R3J A;  2ZQC A;  4E3L A;  4N92 A;  4S2M A;  4ZBE A;  3MZF A;  2R9X A;  4OP8 A;  1K56 A;  4PMA A;  2PU2 A;  3W8K A;  3UDF A;  4Q8I A;  3VP2 A;  3W4P A;  1MXO A;  4N9L A;  2WAE A;  1WYC A;  5CTM A;  4E3M A;  4E6W A;  4QY5 A;  1YQS A;  4WZ5 A;  4OPY A;  4DE3 A;  3IWI A;  4WM9 A;  1IYP A;  5CER A;  3BLM A;  3SH7 A;  2ZQ7 A;  5CHJ A;  3I7J A;  1JWP A;  5EOE A;  3IXG A;  5HAR A;  4QB8 A;  3UDX A;  1BLH A;  1NYY A;  1RGZ A;  2HPB A;  2GDN A;  3GV9 A;  5FQM A;  1H8Y A;  3TOI A;  1ZC2 A;  1BSG A;  2Q9N A;  3CZD A;  5AQ7 A;  3N8S A;  1DJA A;  5FAS A;  4HBU A;  2P9V B;  4MBH A;  3HLG A;  1JWZ A;  3ZGA B;  1RP5 A;  4JBF A;  1L2S A;  4MLL A;  1KDW A;  3SH9 A;  1L0G A;  3PBT A;  3ZG8 B;  1IEL A;  3Q82 A;  1H8Z A;  5EE8 A;  1M6K A;  2WZZ A;  4BJP A;  1MPL A;  1K54 A;  3SS4 A;  2WYX A;  3BFD A;  1XKZ A;  2IWD A;  3GMW A;  4KZ9 A;  1YMS A;  5FI6 A;  1BLS A;  3C4P A;  3Q7V A;  1I2W A;  4P87 A;  1CI9 A;  3V39 A;  1WYB A;  3MZD A;  2ZC3 B;  4P0M A;  2WZX A;  3RXX A;  1MY8 A;  4QY6 A;  4OPZ A;  4R0Q A;  3IF6 A;  1CK3 A;  1FCM A;  3HLF A;  4PM8 A;  3S1Y A;  3SH8 A;  4JXG A;  1K57 C;  3VP4 A;  3G30 A;  2QMI A;  1H5X A;  5DF9 A;  5DVA A;  3HUM A;  3HLE A;  3IHA A;  1PI4 A;  1YLW A;  3M6B A;  2Y91 A;  3P98 A;  1ZG6 A;  3BFG A;  3DTM A;  4S2N A;  4CJN A;  4LCM A;  1TDL A;  5EVI C;  1J9M A;  2Y2H A;  3BYD A;  4EWF A;  4UA6 A;  1YLT A;  5CGS A;  3NY4 A;  4HBT A;  2BG1 A;  4LV0 A;  3W4Q A;  4PPR A;  5M1A A;  3N6I A;  2V20 A;  5D3O A;  2ZQA A;  5GLC A;  1KE0 A;  1BT5 A;  3OPL A;  3IWO A;  3HLD A;  4OOY A;  4X69 A;  5FAQ A;  1YT4 A;  4R4R A;  4EV4 A;  4K0X A;  1G6A A;  2XQZ A;  1KGE A;  2XK1 A;  3HUO A;  4MNR A;  3DWZ A;  1GA0 A;  3ZHH A;  4E3O A;  4KZ3 A;  1CI8 A;  1DY6 A;  3M6H A;  3OCN A;  1KVM A;  4B88 A;  1K55 C;  2UWX A;  2ZJ9 A;  2Y2J A;  4NET A;  3A3F A;  4FH4 A;  5EPH A;  1NY0 A;  4N1X A;  2XDM A;  1E4D A;  1MWU A;  2R9W A;  3GR2 A;  3M2J A;  4JF6 A;  4OQG A;  3HLC A;  3OPP A;  4LCL A;  2XGN A;  2H0T A;  1KE3 A;  4JKT A;  4QHC A;  3QNC A;  1LLB A;  1N9B A;  2ZM0 A;  3PBN A;  3ZNY A;  4FD8 A;  4JF5 A;  2IWB A;  4GD6 A;  4QU3 A;  1Z6F A;  2FFY A;  4OLD A;  2JC7 A;  2WGW B;  1W5D A;  3ZNT A;  2WK0 A;  4BD1 A;  1JWV A;  3GVB A;  4GNU A;  4P85 A;  2PBY A;  4GZB A;  3S22 A;  1NJ4 A;  4R23 A;  1K6S A;  2JCH A;  5E2F A;  4RYE A;  4L0L A;  4LV1 A;  1XPB A;  2FFF B;  3GSG A;  4KZ8 A;  3VSK A;  1XA1 A;  3AGE A;  2ZC7 A;  3IT9 A;  2XFT A;  2Y2P A;  3G35 A;  2ZM2 A;  1PWG A;  4RX3 A;  3TSG A;  3WRT A;  1XX2 A;  4S2I A;  5GLB A;  5E2E A;  1Y54 A;  4XXR A;  5EEC A;  1YLP A;  5EVL A;  4UHU A;  3G2Y A;  1JVJ A;  3VSL A;  3BEB A;  1K25 A;  1KGF A;  2ZMA A;  3NDG A;  4WYY A;  3UY6 A;  3PTE A;  4DXC A;  1E25 A;  4C6Y A;  3HL9 A;  3D4F A;  3IQA A;  5HL1 A;  2Y2N A;  5KSH A;  1K4F A;  1YM1 A;  2EFU A;  2HDR A;  3BFE A;  2J9P A;  5CXW A;  2WKI A;  2P74 A;  4U0X A;  1GHP A;  2HP6 A;  3N7W A;  4JXS A;  1N4O A;  5DTT A;  3ZFZ A;  3GQZ A;  5HX9 A;  5JYP A;  4R3B A;  3UO9 A;  4M3K A;  1C3B A;  4FCF A;  5EVI B;  4DE1 A;  1BLC A;  3VFH A;  2ZC6 B;  3VFF A;  1LI9 A;  5AQ9 A;  3HBR A;  5I94 A;  3HVF A;  1I2S A;  2I72 A;  4GDN A;  5CHM A;  4OQ0 A;  2H0Y A;  2H10 A;  4JF4 A;  4JXW A;  4DKI A;  4K0W A;  1NYM A;  4LV2 A;  3ZVT A;  4O7D A;  1L0D A;  5CED A;  2Q9M A;  4KG5 A;  4FSF A;  5GHZ A;  3WS1 A;  1LI0 A;  4PM9 A;  1ONG A;  1M40 A;  3UE0 A;  4KG6 A;  3BEC A;  4BQM A;  1K57 A;  2E8I A;  3A3I A;  4IVI A;  4KEN B;  4KZA A;  3UPO A;  2WUQ A;  2OSU A;  1Q2P A;  3G31 A;  4OP5 A;  1K4E A;  1XGJ A;  4R1G A;  4WZ4 A;  1EWZ A;  1YLY A;  3VOY A;  4JXV A;  4EUZ A;  3PBQ A;  3B3X A;  2V2F F;  4ZDX A;  2EXA A;  2WKH A;  3E2L A;  5E2G A;  3V3S A;  1YLZ A;  3A3E A;  3IF6 B;  2IWC A;  3AGD A;  1QME A;  1PIO A;  2HP9 A;  4WZ5 C;  1QMF A;  3UPP A;  1FCO A;  2P9V A;  1W7F A;  3MFD A;  3RXW A;  4S2K A;  4IBR A;  3OZH A;  1ESI A;  4MBK A;  4DDS A;  1XXM A;  5FAT A;  3ZG9 B;  3ITB A;  5FDH A;  1CEG A;  2RL3 A;  1HD8 A;  3N8R A;  3UNW A;  1PI5 A;  1SCW A;  1KVL A;  3WS4 A;  1E3U A;  4JPM A;  2JE5 A;  4Y7P A;  4WEL A;  1ALQ A;  4KZ6 A;  1AXB A;  4K91 A;  5CGX A;  5E2H A;  2Y55 A;  3UE3 A;  5L2F A;  4OH0 A;  4KQQ A;  3RJU A;  4KZ5 A;  4LV3 A;  2Y2M A;  3BLS A;  3N4I A;  1GHM A;  1PWC A;  3NDE A;  2C6W B;  2HDQ A;  3HUN A;  3Q81 A;  3MXS A;  4HEF A;  4OPQ A;  1MBL A;  3DW0 A;  3Q07 A;  1KGG A;  4OLG A;  3ITA A;  4QJG A;  3G2Z A;  1K54 C;  1L0F A;  2BLS A;  4N1H A;  3OPH A;  1NRF A;  5A92 A;  5E43 A;  5F82 A;  1TEM A;  1OME A;  3C7U A;  2Z2L B;  4JLF A;  1K56 D;  3TG9 A;  3MXR A;  4EQI A;  3A3D A;  4BL2 A;  5F83 A;  5TFQ A;  3IF5 A;  3IF6 C;  4S2J A;  4P6B A;  4BEN A;  2ZQ8 A;  4WMC A;  1GCE A;  1ES5 A;  5U47 A;  4E6X A;  4Y0O A;  4ZTK A;  2J9O A;  5GHY A;  3UDI A;  4MEZ A;  1JTG A;  3MKE A;  4S2N C;  3A3J A;  1RGY A;  3FZC A;  3C4O A;  3G4P A;  4E3N A;  2G2W A;  2XH9 A;  5GLD A;  2OLU A;  1IYQ A;  1BUL A;  1FR6 A;  1MWS A;  4C3Q A;  4EBP A;  4EBN A;  2DCF A;  5FI7 A;  5CEC A;  5JYO A; 
#chains in the Genus database with same CATH topology
 3LID A;  3S7O A;  1KE4 A;  5EM0 A;  3BY8 A;  4WN5 A;  3SS5 A;  3E4O A;  1ERO A;  1Y28 A;  3FKW A;  3NIA A;  4OKP A;  3CAX A;  2AVX A;  4JGQ A;  2XF3 A;  3BRM A;  4DDY A;  4C75 A;  1CF0 A;  5F1F A;  1FR1 A;  2QJ5 A;  4Y13 A;  4NXB A;  1GA9 A;  1UWP X;  3FV7 A;  1NWZ A;  4QPR A;  5BOH A;  1E3U D;  3ISG A;  4X56 A;  3S7N A;  4XUZ A;  3LY3 A;  3JYI A;  1ES4 A;  3G32 A;  2J3W A;  2NUT C;  1CEF A;  1G68 A;  1YMX A;  2Y2Q A;  1S0W A;  1SDE A;  3U4L P;  1S4R A;  1ERQ A;  4KUK A;  3HJK A;  3Q7V B;  3FYZ A;  4OOM A;  3ZG5 A;  5HSQ A;  3H7W A;  1YLJ A;  3KSI A;  2BTF P;  1F98 A;  3IH9 A;  1J3W A;  3MQ0 A;  3R7W B;  1KDS A;  3LO7 A;  3VP1 A;  5HPF A;  1T1A A;  2H5S A;  1K55 A;  4BD0 A;  5HAI A;  2C5W B;  1W8Q A;  1PZO A;  4LRY C;  3NC8 A;  4GJ4 A;  3ZG0 A;  3CHW P;  5A90 A;  3H82 A;  3WS2 A;  4E3K A;  3C5A A;  4WBG A;  5TJJ A;  4A5R A;  2EFX A;  2EXB A;  1DJC A;  2Y59 A;  1FSY A;  1WE4 A;  1TS7 A;  3O3V A;  2KLI A;  3MSH A;  4I5S A;  1PZP A;  2MJ6 A;  1ACF A;  1PW1 A;  2J3T C;  4BBV A;  3W4O A;  5FAP A;  2Y2I A;  4K08 A;  4RVA A;  5M19 A;  4KQD A;  3KSH A;  3S4X A;  4OPR A;  1BLP A;  2XR0 A;  2PYR A;  4DJ3 A;  1W8Y A;  1PYY A;  4DE0 A;  4OVD A;  1ES2 A;  5HFO A;  4KQO A;  5FSR A;  2ZM8 A;  4F3L B;  4PM5 A;  1RCJ A;  4KZ4 A;  1VET A;  4CPK A;  4Z1W A;  3EQV A;  4MBF A;  4MMN A;  5CRF A;  2O9C A;  4LRZ E;  5J7E A;  1Q2Q A;  3CJM A;  2Y2L A;  3SZT A;  4S2O A;  4YOF A;  4P6Z S;  3OCL A;  3UB7 A;  3LYX A;  1NZO A;  1G5U A;  2EX9 A;  4GN2 A;  1ZTU A;  3K3C A;  3T4T A;  5FDS A;  4R3J A;  3UB6 A;  3VP2 A;  3W4P A;  4N9L A;  1YQS A;  4OPY A;  5TBM B;  5CER A;  1CJF A;  3BLM A;  3SH7 A;  4HJ4 A;  3T50 A;  4EW7 A;  3IBJ A;  5EOE A;  5HAR A;  3EGX C;  4MN5 A;  1NYY A;  2HPB A;  3GV9 A;  2INW A;  1OTI A;  3IS2 B;  1TD5 A;  3GDI A;  4HBU A;  2P04 A;  4MBH A;  3MXQ A;  3ZGA B;  3BY9 A;  4EQ1 A;  4GHI A;  2VLG A;  2JKT I;  1H8Z A;  3R4K A;  4G3V A;  1YKD A;  3SS4 A;  2VK3 A;  2W0N A;  3QP5 A;  2HJ9 C;  3S7Q A;  4R0Q A;  3IF6 A;  4PM8 A;  2LB5 A;  1H5X A;  4Q0I A;  2D01 A;  1YLW A;  1ZG6 A;  3DTM A;  1N9L A;  2FZ0 A;  5HZH A;  3BYD A;  4IUK A;  3W4Q A;  1H3Q A;  3N6I A;  3VE4 A;  2WKQ A;  3PXP A;  4OOY A;  1KGE A;  4HOI A;  3DWZ A;  3ZHH A;  1CI8 A;  3OCN A;  1P9R A;  3FPV A;  1K55 C;  4B88 A;  1D7E A;  4CLC E;  1E4D A;  4OQG A;  3M2J A;  3OLO A;  4L9E A;  3HLC A;  4CLC A;  4JKT A;  4QHC A;  3QNC A;  1LLB A;  2IWB A;  1Z6F A;  4OLD A;  2WGW B;  1W5D A;  4BD1 A;  3GVB A;  3P01 A;  2PBY A;  4GZB A;  1NJ4 A;  2PT7 A;  4L0L A;  4LV1 A;  2YKF A;  3SW1 A;  2XFT A;  2Y2P A;  4NEE D;  5GLB A;  1Y4O A;  4L9G A;  4XXR A;  5EVL A;  3G2Y A;  2ZMA A;  3OOV A;  1E25 A;  3BQA A;  4C6Y A;  3KO6 A;  5KSH A;  1YM1 A;  2EFU A;  3BFE A;  5DKK A;  1UGU A;  2P74 A;  3IBR A;  4JXS A;  4R3B A;  3UO9 A;  1C3B A;  4FCF A;  1BLC A;  4B93 A;  2ZC6 B;  1LI9 A;  5AQ9 A;  1L3L A;  4ARZ A;  4OQ0 A;  3B33 A;  2ZOI A;  3RTY A;  4K0W A;  3NUL A;  3ZVT A;  2Q9M A;  4KG5 A;  3WS1 A;  2VX8 A;  4PM9 A;  2VA0 A;  3UE0 A;  5EM1 A;  3A3I A;  4IVI A;  3UPO A;  3UB5 P;  4WZ4 A;  3G31 A;  1K4E A;  1XGJ A;  4I3J A;  3PBQ A;  4HNB A;  2GJ3 A;  2EXA A;  2ZMF A;  3E2L A;  4HJ3 A;  1YLZ A;  2HP9 A;  5FL3 A;  1QMF A;  2P9V A;  3B42 A;  3RXW A;  3O5Y A;  4IBR A;  3ZG9 B;  5FDH A;  3N8R A;  3UNW A;  1SCW A;  1PFL A;  2A24 A;  1ZHH B;  4KZ6 A;  3UE3 A;  2W1T A;  4KQQ A;  3RJU A;  4LV3 A;  2HDQ A;  3HUN A;  1DP9 A;  4OLG A;  5C5K A;  1G28 A;  2BLS A;  1LSV A;  1OTE A;  3OPH A;  4I3A A;  4JLF A;  1K56 D;  3MXR A;  2O99 A;  3LIF A;  5TFQ A;  3IF6 C;  4H6J A;  4P6B A;  2ZQ8 A;  1GCE A;  1ES5 A;  2J9O A;  5GHY A;  3UDI A;  2K31 A;  4C3Q A;  1BUL A;  4GW9 A;  2DCF A;  1SKO A;  5CEC A;  5HDD A;  5JYO A;  4ETX A;  4F94 A;  1T1C A;  4XUX A;  4WEJ A;  4YNR A;  4EBL A;  3BFF A;  4YWZ A;  3OPR A;  4PAU A;  4R4S A;  1LT0 A;  1XA7 A;  3NI9 A;  2VKS A;  1V9Z A;  1UWN X;  1TF1 A;  3E2K A;  1IKG A;  4NXG A;  2JKG A;  5KSC A;  2K2N A;  5DJT A;  1YSQ A;  3V50 A;  3PBO A;  4CLC C;  4BWI A;  3MZE A;  5FQJ A;  1NLZ A;  3MS6 A;  1HZO A;  2KOI A;  3AGF A;  1MWT A;  3QHY A;  1S67 L;  3WRZ A;  3KSG A;  2A2L A;  2EX6 A;  4Y5F A;  3IXD A;  2WGV A;  4S2L A;  5GHX A;  2ZQ9 A;  2XEP A;  2LB9 A;  2QZ6 A;  1YSP A;  3MQO A;  4H8R A;  3HRE A;  5FQQ A;  4B9O A;  4B4Z A;  2K7S A;  5EVI A;  2W3F A;  4L9F A;  3PBS A;  3TE8 A;  1DP6 A;  5CEB A;  1TVF A;  3WWX A;  3IWQ A;  4IBX A;  4LEN A;  3K2N A;  1I5Q A;  1O07 A;  4WMC D;  2V9A A;  3FWL A;  4Y15 A;  1F2K A;  4KQR A;  3V3R A;  3LI8 A;  2CMN A;  3DTI A;  5CTN A;  1MWR A;  4X68 A;  5KZH A;  1YPR A;  2B02 A;  2ZD8 A;  2HDU A;  5F1G A;  3SS3 A;  5CGW A;  5KMW A;  2WGI A;  3FKV A;  1PWD A;  1LL5 A;  4G3W A;  3D3O A;  1HVB A;  2JHE A;  3NOT C;  4OQI A;  2ZC5 B;  5TGF A;  1K6R A;  3ULF A;  4BBU A;  3SOI A;  4WEK A;  4PM7 A;  4O0P A;  1GSV A;  4GOG A;  1IYS A;  4XT2 B;  1LSW A;  2W27 A;  2V1B A;  5HL6 A;  2UV0 E;  2VGJ A;  3DWK A;  5FI2 A;  5DTS A;  3WS5 A;  2JKR I;  1SKF A;  5IS1 A;  4NXF A;  2PU4 A;  2J8Y A;  1FQG A;  5FQK A;  1GHI A;  4WL9 A;  4ID4 A;  3DAV A;  2DRW A;  4KZB A;  1BUE A;  1EI5 A;  1K38 A;  4DMZ A;  1LHY A;  5FAO A;  1TDG A;  2HDS A;  4N9K A;  3CG5 A;  4YIN A;  3VP0 A;  3GEC A;  3PAE A;  4OQH A;  3PAG A;  3IXB A;  5DF7 A;  4Q0J A;  5KIZ A;  1DJB A;  2ZQC A;  3D9Y A;  4R3A A;  4PMA A;  4EES A;  3T1S A;  4HH3 A;  2O9B A;  1WYC A;  4E3M A;  1XFQ A;  2QKP A;  5AVE A;  3IWI A;  4WM9 A;  4O8G A;  1IYP A;  2V8C A;  1BLH A;  3TRC A;  2GDN A;  1ZC2 A;  1BSG A;  2Z6D A;  3CZD A;  1DJA A;  1NLY A;  3NEC A;  1RP5 A;  1L2S A;  4MLL A;  3PBT A;  2WZZ A;  1MPL A;  1K54 A;  3VE3 A;  5HWV A;  4KZ9 A;  1XKZ A;  2IWD A;  5FI6 A;  3W2Z A;  1STZ A;  3ZYT A;  1BLS A;  1VB6 A;  3Q7V A;  4P87 A;  2QYB A;  1WYB A;  3MZD A;  1MY8 A;  3SH8 A;  1FCM A;  1OTA A;  3HLF A;  3S1Y A;  3VP4 A;  1K57 C;  1YAX A;  1S66 L;  5DFX A;  5DF9 A;  3HUM A;  3R7W A;  2I9V A;  3M6B A;  4HQA A;  2W3E A;  4S2N A;  3FPW A;  1TDL A;  5EVI C;  1J9M A;  1YLT A;  4PPR A;  5F69 A;  2HZ5 A;  2ZQA A;  5GLC A;  3OPL A;  3HLD A;  1YT4 A;  4R4R A;  4K0X A;  4AFI A;  2XK1 A;  4HY8 A;  3HUO A;  3DTE A;  4MNR A;  2R78 A;  1KVM A;  3T4O A;  2UWX A;  2Y2J A;  2GX5 A;  5EPH A;  5J3W A;  4N1X A;  3QP2 A;  1XFN A;  2ZL1 B;  4LCL A;  1N9B A;  4IUH A;  2PHY A;  2JC7 A;  2WK0 A;  4LGW A;  4R23 A;  1K6S A;  5E2F A;  3CPT B;  4RYE A;  4KZ8 A;  3VSK A;  4GS9 B;  1P9W A;  1XA1 A;  3UME A;  2JKF A;  3AGE A;  3G35 A;  3VV4 A;  4F3L A;  1FIL A;  5EEC A;  2M7U A;  3BEB A;  3NDG A;  4DXC A;  2Y2N A;  1K4F A;  1JNU A;  5CXW A;  1NRJ A;  3KSF A;  2W3H A;  1GHP A;  1MC0 A;  5DTT A;  2VEA A;  4MDZ A;  4EET B;  4MN6 A;  3VFF A;  5I94 A;  1I2S A;  1ODV A;  2Y8H A;  2H10 A;  4JXW A;  1L0D A;  4FSF A;  1LI0 A;  4KG6 A;  4BQM A;  5TBM A;  3MMH A;  2WUQ A;  1Q2P A;  4OP5 A;  1YLY A;  5CX7 A;  2V2F F;  3T4S A;  5DFY A;  1F5M A;  2WKH A;  3IS2 A;  3D72 A;  4PKY A;  2ACG A;  4NXE A;  2GZA A;  3IF6 B;  2IWC A;  4CLC D;  3UPP A;  1FCO A;  2Z6C A;  1W7F A;  1H8M A;  1ESI A;  4MBK A;  4DDS A;  1XXM A;  3ITB A;  1HD8 A;  4JPM A;  1ALQ A;  2OWH A;  2PRF A;  5E2H A;  4OH0 A;  3MR0 A;  3VOL A;  3BLS A;  3N4I A;  1GHM A;  3NDE A;  1IFQ A;  3F1P A;  3Q81 A;  3HCY A;  5K5B A;  3C30 A;  1D06 A;  2FH5 A;  3DW0 A;  3Q07 A;  1KGG A;  4LFU A;  1K54 C;  5A92 A;  1T1B A;  5E43 A;  5F82 A;  4BL2 A;  5F83 A;  3F1N A;  4NKP A;  4S2J A;  5U47 A;  3LR5 A;  3F1O B;  1JTG A;  4S2N C;  3MQQ A;  2P7J A;  3A3J A;  1RGY A;  3FZC A;  2G2W A;  2XH9 A;  5GLD A;  1IYQ A;  2OLU A;  5FI7 A;  1D1J A;  2V1Z A;  2OAP 1;  1NZU A;  5DF8 A;  4NK3 A;  2OWJ A;  3E98 A;  2X01 A;  3ZVW A;  5FQ9 A;  3MFX A;  5J8X A;  2B5R A;  2V8F A;  3V5M A;  1PRQ A;  5AQA A;  3JPU A;  3Q7Z A;  1BZA A;  3IX4 A;  1OJG A;  2WKE A;  1S1Z A;  5HDC A;  3TJZ C;  2HF6 A;  3QNB A;  1VM1 A;  3O88 A;  3Q1F A;  1MKM A;  2Y2K A;  1SDN A;  2PR5 A;  5L07 A;  3LCE A;  1O7E A;  2XRN A;  2EX8 A;  3BJN A;  4UAA A;  4FH2 A;  3T12 B;  3QP1 A;  2OLV A;  4KZ7 A;  3ZCZ A;  2OAQ 1;  4GD8 A;  4OOL A;  5TR7 A;  2A3U A;  1S6R A;  3UN7 A;  2X71 A;  2VGK A;  3MKF A;  1VQQ A;  5FQI A;  2DNS A;  1TS6 A;  3PHY A;  1MKI A;  3KX0 X;  3IHB A;  3OC2 A;  1BTL A;  1FSW A;  4ZJ1 A;  4Z9Q A;  5A91 A;  5IHV A;  5EUA A;  4RA7 A;  1LSX A;  2YKH A;  4X1L A;  5F5Y A;  4WF0 A;  4UA9 A;  3IH8 A;  2Y2G A;  3PBR A;  4S2P A;  1ESU A;  2E8J A;  2PAV P;  3NOU C;  5HDS A;  4DN0 A;  1X0O A;  4ME4 A;  3ZDJ A;  3P7N A;  4DE2 A;  1F9I A;  1NXY A;  1W79 A;  5L10 A;  2QPN A;  2ZC4 B;  2W3D A;  1N9N A;  1XJ4 A;  3T1Q B;  5M18 A;  4ZRR A;  3HLB A;  3BW6 A;  4ZJ3 A;  4U3T A;  2XFS A;  1T19 A;  4BMW A;  1SHV A;  3VMA A;  4GB7 A;  3T4Q A;  1IKI A;  2Y4A A;  1WA9 A;  4E3I A;  4Y0T A;  1A0K A;  3C38 A;  3EWK A;  5AQB A;  5DKL A;  2G2U A;  3NBL A;  3BM6 A;  3WS0 A;  3L7H A;  1XGI A;  5EVI D;  1FOF A;  4DRT A;  1TS8 A;  1VHM A;  2OV5 A;  2CC1 A;  5A93 A;  3IXH A;  3C7V A;  2IA2 A;  2J3T D;  3M2K A;  3EQU A;  1HLU P;  5DTK A;  1W63 M;  2HV1 A;  5FA7 A;  2ZBB A;  4RX2 A;  4IED A;  4ZAM A;  4HP4 A;  4E3L A;  4N92 A;  5EV0 A;  3UB9 A;  3FC7 A;  4S2M A;  4ZBE A;  3MZF A;  2R9X A;  4OP8 A;  1K56 A;  2PU2 A;  4O01 A;  3W8K A;  5CTM A;  1MXO A;  2WAE A;  4E6W A;  3DBA A;  4CQH A;  4QY5 A;  4DE3 A;  4WZ5 A;  3E4Q A;  2ZQ7 A;  3I7J A;  5L09 A;  1XJ2 A;  3QP4 A;  4Y2F A;  4I39 A;  4QB8 A;  4EUV A;  1RGZ A;  5FQM A;  1H8Y A;  3TOI A;  5F68 A;  4D60 A;  4I38 A;  1VEU B;  5AQ7 A;  4PHT A;  4RQ9 A;  1OJ5 A;  2VJW A;  4Q0H A;  4JBF A;  4EEP A;  1KDW A;  3NJA A;  3Q82 A;  2HJE A;  2ZOH A;  5EE8 A;  4BJP A;  4UEY A;  2WYX A;  5EFW A;  2O9A A;  2PD8 A;  3C4P A;  1EW0 A;  1CI9 A;  4P0M A;  5L8M A;  2WZX A;  3RXX A;  4OPZ A;  3G30 A;  2QMI A;  1K0K A;  5DVA A;  3KYQ A;  3IHA A;  3E0Y A;  3T4K A;  2Y91 A;  3BFG A;  1DRM A;  2Y2H A;  4EWF A;  4UA6 A;  5HD5 A;  4HBT A;  1P0Z A;  2BG1 A;  4LV0 A;  1DP8 A;  2L4R A;  2V20 A;  5D3O A;  3LIA A;  3IWO A;  5FAQ A;  3PR6 A;  1AWI A;  3LIC A;  3KYE A;  1G6A A;  3ZQ5 A;  5MC7 A;  2XQZ A;  1GA0 A;  2XA7 M;  4JGP A;  5HWT A;  1NY0 A;  1S1Y A;  3KYZ A;  2XDM A;  1MWU A;  3GR2 A;  1XJ6 A;  3OPP A;  2QHK A;  2H0T A;  4FTX A;  1KE3 A;  2XSS A;  1MZU A;  3CWF A;  4LRX C;  3H9W A;  2ZM0 A;  4XT2 A;  4FD8 A;  4JF5 A;  2PR6 A;  4QU3 A;  3A0V A;  2VV8 A;  3HJI A;  1JWV A;  4P85 A;  3S22 A;  2JCH A;  2DMW A;  1XPB A;  3GSG A;  4IJG A;  4ETZ A;  1SZV A;  3IT9 A;  2ZM2 A;  4JGO A;  1P97 A;  1Y54 A;  2V1A A;  1YLP A;  4HP9 A;  1JVJ A;  3VSL A;  4II7 A;  3UY6 A;  4Y3I A;  3HL9 A;  1LL8 A;  3IQA A;  5HL1 A;  2WKI A;  4U0X A;  3IX3 A;  3T4L A;  3GQZ A;  2B95 A;  5FEG A;  4M3K A;  4DE1 A;  2EA9 A;  3CLO A;  3H7W B;  2I72 A;  4GDN A;  5CHM A;  4G3K A;  2H0Y A;  4JF4 A;  5CED A;  5GHZ A;  2J80 A;  3BEC A;  5LBR A;  4HHD A;  4KEN B;  2W1R A;  4R1G A;  3MJQ A;  3VOY A;  4ZDX A;  4UQI M;  3V3S A;  3C2W A;  3H82 B;  3A3E A;  3AGD A;  2H28 A;  4WZ5 C;  5G4Z A;  4JGR A;  4S2K A;  3LFV A;  3BWL A;  3OZH A;  3UB8 A;  2RL3 A;  2L0W A;  1PI5 A;  3CUE A;  3QP8 A;  1KVL A;  1E3U A;  4WEL A;  1AXB A;  4K91 A;  5CGX A;  2Y55 A;  5L2F A;  2WKP A;  4Y17 A;  2Y2M A;  3EGD C;  2C6W B;  4OPQ A;  3MXS A;  4HEF A;  1MBL A;  2VZW A;  4QJG A;  3ITA A;  1NRF A;  4NG2 A;  1TEM A;  4WUJ A;  2Y79 A;  3A3D A;  4PKY G;  4BEN A;  2P08 A;  4Y0O A;  4ZTK A;  4MEZ A;  1VET B;  3MKE A;  2OOL A;  4MN7 A;  2WKR A;  4I3I A;  4E3N A;  3A0R A;  3T4J A;  2PDR A;  1MWS A;  2L1M A;  3G6O A;  1OTB A;  1N9O A;  2JKT M;  3VP3 A;  3BQ8 A;  2ZL1 A;  4DXB A;  3TW8 A;  4GDB A;  4HH2 A;  2EX2 A;  4M4X A;  3JVU A;  2J7V A;  3CMZ A;  4X53 A;  1U60 A;  2A49 A;  5I5L A;  3LIE A;  5EOO A;  4EEU A;  1ERM A;  2XD1 A;  3RFB A;  3LY4 A;  2PYP A;  3CPT A;  2ZQD A;  1JTD A;  4EU0 A;  2HP5 A;  4GS9 A;  1ES3 A;  2XD5 A;  4DF6 A;  3IX8 A;  2RCX A;  2D02 A;  3GTC A;  1S4S A;  1ONH A;  5IU1 A;  3U2A A;  1GSW A;  3UPN A;  2M1C A;  3MBZ A;  2JBF A;  4B4X A;  4GHI B;  4GKU A;  5AVF A;  2WAF A;  3FG8 A;  2PBD P;  3O87 A;  5GLA A;  3O86 A;  5HAP A;  3HLW A;  2VGL M;  4YFM A;  2Y2O A;  2ZLY A;  1LL9 A;  2NUP C;  4KG2 A;  5GL9 A;  1BYW A;  3PYP A;  3ZG7 B;  5FEF A;  3NCK A;  3VOZ A;  3F1P B;  2V0U A;  4X55 A;  3G34 A;  3UE1 A;  3GRJ A;  3LEZ A;  1IEM A;  4D2O A;  4PM6 A;  5G18 A;  1OTD A;  3BFC A;  4MCW A;  2Z2M B;  1H0M A;  4BBT A;  4QD4 A;  3F1N B;  4FUW A;  2XA7 S;  1ZG4 A;  4Y0U A;  1XP4 A;  3LEQ A;  4CLC B;  2M7V A;  2Q0O A;  5HD3 A;  3LR0 A;  2KDK A;  1PW8 A;  3CUE C;  4HES A;  5HAQ A;  2QJ7 A;  4X6T A;  2XLN A;  1HTZ A;  4X1M A;  1FCN A;  4BL3 A;  3LR3 A;  2GNX A;  5AJG A;  1IYO A;  3N8L A;  4OON A;  3F1O A;  3A0S A;  4DJ2 A;  1L0E A;  1ZKJ A;  4KUO A;  5HW3 A;  4IVK A;  4R70 A;  2WAD A;  2WGW A;  3L9K A;  2X02 A;  5CHU A;  4U0T A;  4E3J A;  4ZJ2 A;  4UA7 A;  3P09 A;  2VV7 A;  5A8B A;  4ARZ B;  4BLM A;  4HIA A;  3V67 A;  2VV6 A;  3UDF A;  4Q8I A;  4WLA A;  3DTK A;  1Z09 A;  5HWW A;  5CHJ A;  1JWP A;  3K3D A;  3IXG A;  3UDX A;  3UMD A;  3S7P A;  3CI6 A;  2Q9N A;  2EWV A;  3N8S A;  2W3G A;  5DJU A;  5FAS A;  4HI4 A;  2BAS A;  2P9V B;  3HLG A;  1JWZ A;  4UQI S;  4FOF A;  3SH9 A;  1L0G A;  3ZG8 B;  1IEL A;  3ICY A;  1M6K A;  5F6A A;  3BFD A;  3GMW A;  2A24 B;  1YMS A;  3LGO A;  1I2W A;  3V39 A;  2W1T B;  3MF0 A;  2ZC3 B;  2QWS A;  4QY6 A;  3E4P A;  5IT5 A;  1CK3 A;  4JXG A;  3OBF A;  4ESP A;  3HLE A;  1PI4 A;  3P98 A;  4CJN A;  4LCM A;  1TS0 A;  5CGS A;  3NY4 A;  5M1A A;  4H6J B;  1KE0 A;  1BT5 A;  3LR4 A;  1V9Y A;  4X69 A;  4EV4 A;  4QWO A;  4E3O A;  4KZ3 A;  3M6H A;  1IOU A;  1OPX A;  2ZMV A;  3NOP C;  2ZJ9 A;  4NET A;  3A3F A;  1SKO B;  4FH4 A;  4LLO B;  2EWW A;  2HGV A;  4LPZ A;  4EXO A;  2R9W A;  4JF6 A;  1PNE A;  2XGN A;  4X25 A;  3RH8 B;  3PBN A;  3ZNY A;  4GD6 A;  2FFY A;  3ZNT A;  3UE6 A;  4GNU A;  1T18 A;  1CQA A;  5J4E A;  2FFF B;  3EEA A;  4GCZ A;  2ZC7 A;  4RX3 A;  1PWG A;  3TSG A;  3WRT A;  1XX2 A;  4S2I A;  3T1X A;  5E2E A;  4E04 A;  1KOU A;  4UHU A;  1K25 A;  1KGF A;  4WYY A;  3PTE A;  4P6Z M;  3D4F A;  2KX6 A;  2HDR A;  2J9P A;  3T1R A;  3LI9 A;  2HP6 A;  3N7W A;  3QP6 A;  1N4O A;  3ZFZ A;  5HX9 A;  5JYP A;  5HPI A;  5EVI B;  3VFH A;  3HBR A;  4R38 A;  3HVF A;  3CIT A;  3EOI A;  4DKI A;  1NYM A;  4LV2 A;  4O7D A;  2VGL S;  1ONG A;  1M40 A;  5EVE A;  1K57 A;  1G6O A;  2E8I A;  4KZA A;  2OSU A;  3C8C A;  2JKR M;  4EUZ A;  1EWZ A;  4JXV A;  3B3X A;  1OT6 A;  5E2G A;  1VEU A;  1QME A;  1PIO A;  4GLQ A;  2B18 A;  3LIB A;  3MFD A;  2XRO A;  1XJ3 A;  1W63 Q;  5FAT A;  3JVV A;  1CEG A;  1FIK A;  3LUQ A;  3WS4 A;  2PD7 A;  3EEH A;  4Y7P A;  2JE5 A;  4KZ5 A;  4HJ6 A;  1PWC A;  2G7U A;  3G2Z A;  1L0F A;  4N1H A;  5G4Y A;  4EER A;  2O0Y A;  3B47 A;  1OME A;  3C7U A;  2Z2L B;  3TG9 A;  2JN7 A;  4EQI A;  3IF5 A;  1GSX A;  4WMC A;  4E6X A;  3NHQ A;  2V0W A;  4R6L A;  3C4O A;  3G4P A;  1FR6 A;  1OT9 A;  4IHQ A;  4EBP A;  4EBN A;  1DY6 A; 
#chains in the Genus database with same CATH homology
 4F94 A;  4XUX A;  4WEJ A;  1KE4 A;  3VP3 A;  4EBL A;  2V1Z A;  3BFF A;  3SS5 A;  3OPR A;  1NZU A;  1ERO A;  5DF8 A;  4NK3 A;  4R4S A;  4DXB A;  4GDB A;  1XA7 A;  2X01 A;  3FKW A;  3NI9 A;  2EX2 A;  3ZVW A;  5FQ9 A;  3NIA A;  3E2K A;  2J7V A;  3CMZ A;  5J8X A;  4X53 A;  1U60 A;  2A49 A;  2B5R A;  1IKG A;  4OKP A;  3V5M A;  5EOO A;  5KSC A;  1ERM A;  5AQA A;  2XF3 A;  3Q7Z A;  1BZA A;  2XD1 A;  3BRM A;  4DDY A;  3V50 A;  2WKE A;  3LY4 A;  4C75 A;  5F1F A;  3PBO A;  1FR1 A;  2ZQD A;  1JTD A;  3MZE A;  3QNB A;  5FQJ A;  1HZO A;  2HP5 A;  3AGF A;  1MWT A;  1VM1 A;  1ES3 A;  3QHY A;  3O88 A;  3Q1F A;  2XD5 A;  4DF6 A;  2RCX A;  1GA9 A;  1SDN A;  2Y2K A;  3FV7 A;  3GTC A;  3WRZ A;  5BOH A;  3LCE A;  2EX6 A;  1O7E A;  1E3U D;  1ONH A;  3ISG A;  3IXD A;  2WGV A;  4X56 A;  3UPN A;  2EX8 A;  4XUZ A;  4S2L A;  5GHX A;  3LY3 A;  2ZQ9 A;  2XEP A;  3JYI A;  1ES4 A;  3MBZ A;  4UAA A;  4FH2 A;  2JBF A;  3G32 A;  2QZ6 A;  4B4X A;  4GKU A;  2OLV A;  1CEF A;  4KZ7 A;  1G68 A;  1YMX A;  2WAF A;  3ZCZ A;  3O87 A;  4H8R A;  2Y2Q A;  3HRE A;  4GD8 A;  5FQQ A;  1S0W A;  4OOL A;  5GLA A;  5TR7 A;  1SDE A;  2A3U A;  1S6R A;  3O86 A;  3UN7 A;  2X71 A;  2VGK A;  4B4Z A;  1ERQ A;  5HAP A;  3HLW A;  3Q7V B;  3MKF A;  3FYZ A;  5EVI A;  1VQQ A;  5FQI A;  3PBS A;  4OOM A;  3ZG5 A;  2DNS A;  5CEB A;  4YFM A;  1TVF A;  1YLJ A;  3IWQ A;  4IBX A;  3WWX A;  4LEN A;  2Y2O A;  2ZLY A;  1LL9 A;  1I5Q A;  1O07 A;  4KG2 A;  4WMC D;  1MKI A;  3FWL A;  3IH9 A;  1KDS A;  3LO7 A;  3VP1 A;  5GL9 A;  4KQR A;  3IHB A;  3V3R A;  2H5S A;  3OC2 A;  1BTL A;  5CTN A;  3ZG7 B;  1MWR A;  4X68 A;  1FSW A;  1K55 A;  4BD0 A;  5HAI A;  4ZJ1 A;  5KZH A;  2C5W B;  2ZD8 A;  4Z9Q A;  2HDU A;  5F1G A;  5A91 A;  1W8Q A;  5CGW A;  5IHV A;  1PZO A;  3NCK A;  4RA7 A;  5EUA A;  3SS3 A;  3VOZ A;  5KMW A;  3NC8 A;  2WGI A;  3ZG0 A;  5A90 A;  3FKV A;  1PWD A;  1LL5 A;  4UA9 A;  3IH8 A;  3WS2 A;  4E3K A;  3C5A A;  4WBG A;  3G34 A;  4X55 A;  3UE1 A;  3GRJ A;  4A5R A;  3LEZ A;  2Y2G A;  3PBR A;  1IEM A;  1HVB A;  4D2O A;  2EFX A;  4S2P A;  4OQI A;  4PM6 A;  2ZC5 B;  1ESU A;  5G18 A;  2EXB A;  1DJC A;  2Y59 A;  3BFC A;  5TGF A;  1FSY A;  1WE4 A;  1K6R A;  3ZDJ A;  3SOI A;  4DE2 A;  4WEK A;  2Z2M B;  4PM7 A;  1NXY A;  3O3V A;  1W79 A;  4QD4 A;  1PZP A;  2QPN A;  2ZC4 B;  1ZG4 A;  4Y0U A;  1XP4 A;  1PW1 A;  3W4O A;  4GOG A;  5FAP A;  2Y2I A;  1IYS A;  4RVA A;  5M18 A;  5M19 A;  3HLB A;  4ZJ3 A;  3S4X A;  4OPR A;  1BLP A;  1PW8 A;  4U3T A;  2XFS A;  2XR0 A;  4HES A;  1W8Y A;  5HAQ A;  1PYY A;  4X6T A;  1SHV A;  4OVD A;  2VGJ A;  4DE0 A;  1ES2 A;  3DWK A;  3VMA A;  5FI2 A;  2XLN A;  5DTS A;  5HFO A;  1HTZ A;  4GB7 A;  3WS5 A;  1FCN A;  4KQO A;  1SKF A;  1IKI A;  2Y4A A;  4BL3 A;  4E3I A;  4Y0T A;  5FSR A;  2ZM8 A;  2PU4 A;  5AQB A;  2J8Y A;  1IYO A;  3N8L A;  2G2U A;  1FQG A;  5FQK A;  3NBL A;  3BM6 A;  3WS0 A;  4OON A;  1GHI A;  1RCJ A;  4PM5 A;  4KZ4 A;  4ID4 A;  1XGI A;  5EVI D;  1L0E A;  4CPK A;  1FOF A;  1ZKJ A;  5HW3 A;  4IVK A;  4DRT A;  3EQV A;  2WAD A;  4MBF A;  2OV5 A;  2DRW A;  5CRF A;  2CC1 A;  2WGW A;  4KZB A;  5A93 A;  3IXH A;  1BUE A;  3C7V A;  1EI5 A;  1Q2Q A;  1K38 A;  3CJM A;  2Y2L A;  3M2K A;  2X02 A;  3EQU A;  4S2O A;  1LHY A;  5DTK A;  5FAO A;  1TDG A;  2HDS A;  3OCL A;  4U0T A;  5CHU A;  4N9K A;  3CG5 A;  4YIN A;  5FA7 A;  3VP0 A;  4RX2 A;  4ZJ2 A;  4IED A;  4E3J A;  3PAE A;  4OQH A;  3PAG A;  1NZO A;  4UA7 A;  4ZAM A;  3P09 A;  2EX9 A;  4GN2 A;  3IXB A;  4BLM A;  5DF7 A;  1DJB A;  4R3J A;  2ZQC A;  4E3L A;  4N92 A;  4S2M A;  4ZBE A;  3MZF A;  2R9X A;  4OP8 A;  1K56 A;  4PMA A;  2PU2 A;  3W8K A;  3UDF A;  4Q8I A;  3VP2 A;  3W4P A;  1MXO A;  4N9L A;  2WAE A;  1WYC A;  5CTM A;  4E3M A;  4E6W A;  4QY5 A;  1YQS A;  4WZ5 A;  4OPY A;  4DE3 A;  3IWI A;  4WM9 A;  1IYP A;  5CER A;  3BLM A;  3SH7 A;  2ZQ7 A;  5CHJ A;  3I7J A;  1JWP A;  5EOE A;  3IXG A;  5HAR A;  4QB8 A;  3UDX A;  1BLH A;  1NYY A;  1RGZ A;  2HPB A;  2GDN A;  3GV9 A;  5FQM A;  1H8Y A;  3TOI A;  1ZC2 A;  1BSG A;  2Q9N A;  3CZD A;  5AQ7 A;  3N8S A;  1DJA A;  5FAS A;  4HBU A;  2P9V B;  4MBH A;  3HLG A;  1JWZ A;  3ZGA B;  1RP5 A;  4JBF A;  1L2S A;  4MLL A;  1KDW A;  3SH9 A;  1L0G A;  3PBT A;  3ZG8 B;  1IEL A;  3Q82 A;  1H8Z A;  5EE8 A;  1M6K A;  2WZZ A;  4BJP A;  1MPL A;  1K54 A;  3SS4 A;  2WYX A;  3BFD A;  1XKZ A;  2IWD A;  3GMW A;  4KZ9 A;  1YMS A;  5FI6 A;  1BLS A;  3C4P A;  3Q7V A;  1I2W A;  4P87 A;  1CI9 A;  3V39 A;  1WYB A;  3MZD A;  2ZC3 B;  4P0M A;  2WZX A;  3RXX A;  1MY8 A;  4QY6 A;  4OPZ A;  4R0Q A;  3IF6 A;  1CK3 A;  1FCM A;  3HLF A;  4PM8 A;  3S1Y A;  3SH8 A;  4JXG A;  1K57 C;  3VP4 A;  3G30 A;  2QMI A;  1H5X A;  5DF9 A;  5DVA A;  3HUM A;  3HLE A;  3IHA A;  1PI4 A;  1YLW A;  3M6B A;  2Y91 A;  3P98 A;  1ZG6 A;  3BFG A;  3DTM A;  4S2N A;  4CJN A;  4LCM A;  1TDL A;  5EVI C;  1J9M A;  2Y2H A;  3BYD A;  4EWF A;  4UA6 A;  1YLT A;  5CGS A;  3NY4 A;  4HBT A;  2BG1 A;  4LV0 A;  3W4Q A;  4PPR A;  5M1A A;  3N6I A;  2V20 A;  5D3O A;  2ZQA A;  5GLC A;  1KE0 A;  1BT5 A;  3OPL A;  3IWO A;  3HLD A;  4OOY A;  4X69 A;  5FAQ A;  1YT4 A;  4R4R A;  4EV4 A;  4K0X A;  1G6A A;  2XQZ A;  1KGE A;  2XK1 A;  3HUO A;  4MNR A;  3DWZ A;  1GA0 A;  3ZHH A;  4E3O A;  4KZ3 A;  1CI8 A;  1DY6 A;  3M6H A;  3OCN A;  1KVM A;  4B88 A;  1K55 C;  2UWX A;  2ZJ9 A;  2Y2J A;  4NET A;  3A3F A;  4FH4 A;  5EPH A;  1NY0 A;  4N1X A;  2XDM A;  1E4D A;  1MWU A;  2R9W A;  3GR2 A;  3M2J A;  4JF6 A;  4OQG A;  3HLC A;  3OPP A;  4LCL A;  2XGN A;  2H0T A;  1KE3 A;  4JKT A;  4QHC A;  3QNC A;  1LLB A;  1N9B A;  2ZM0 A;  3PBN A;  3ZNY A;  4FD8 A;  4JF5 A;  2IWB A;  4GD6 A;  4QU3 A;  1Z6F A;  2FFY A;  4OLD A;  2JC7 A;  2WGW B;  1W5D A;  3ZNT A;  2WK0 A;  4BD1 A;  1JWV A;  3GVB A;  4GNU A;  4P85 A;  2PBY A;  4GZB A;  3S22 A;  1NJ4 A;  4R23 A;  1K6S A;  2JCH A;  5E2F A;  4RYE A;  4L0L A;  4LV1 A;  1XPB A;  2FFF B;  3GSG A;  4KZ8 A;  3VSK A;  1XA1 A;  3AGE A;  2ZC7 A;  3IT9 A;  2XFT A;  2Y2P A;  3G35 A;  2ZM2 A;  1PWG A;  4RX3 A;  3TSG A;  3WRT A;  1XX2 A;  4S2I A;  5GLB A;  5E2E A;  1Y54 A;  4XXR A;  5EEC A;  1YLP A;  5EVL A;  4UHU A;  3G2Y A;  1JVJ A;  3VSL A;  3BEB A;  1K25 A;  1KGF A;  2ZMA A;  3NDG A;  4WYY A;  3UY6 A;  3PTE A;  4DXC A;  1E25 A;  4C6Y A;  3HL9 A;  3D4F A;  3IQA A;  5HL1 A;  2Y2N A;  5KSH A;  1K4F A;  1YM1 A;  2EFU A;  2HDR A;  3BFE A;  2J9P A;  5CXW A;  2WKI A;  2P74 A;  4U0X A;  1GHP A;  2HP6 A;  3N7W A;  4JXS A;  1N4O A;  5DTT A;  3ZFZ A;  3GQZ A;  5HX9 A;  5JYP A;  4R3B A;  3UO9 A;  4M3K A;  1C3B A;  4FCF A;  5EVI B;  4DE1 A;  1BLC A;  3VFH A;  2ZC6 B;  3VFF A;  1LI9 A;  5AQ9 A;  3HBR A;  5I94 A;  3HVF A;  1I2S A;  2I72 A;  4GDN A;  5CHM A;  4OQ0 A;  2H0Y A;  2H10 A;  4JF4 A;  4JXW A;  4DKI A;  4K0W A;  1NYM A;  4LV2 A;  3ZVT A;  4O7D A;  1L0D A;  5CED A;  2Q9M A;  4KG5 A;  4FSF A;  5GHZ A;  3WS1 A;  1LI0 A;  4PM9 A;  1ONG A;  1M40 A;  3UE0 A;  4KG6 A;  3BEC A;  4BQM A;  1K57 A;  2E8I A;  3A3I A;  4IVI A;  4KEN B;  4KZA A;  3UPO A;  2WUQ A;  2OSU A;  1Q2P A;  3G31 A;  4OP5 A;  1K4E A;  1XGJ A;  4R1G A;  4WZ4 A;  1EWZ A;  1YLY A;  3VOY A;  4JXV A;  4EUZ A;  3PBQ A;  3B3X A;  2V2F F;  4ZDX A;  2EXA A;  2WKH A;  3E2L A;  5E2G A;  3V3S A;  1YLZ A;  3A3E A;  3IF6 B;  2IWC A;  3AGD A;  1QME A;  1PIO A;  2HP9 A;  4WZ5 C;  1QMF A;  3UPP A;  1FCO A;  2P9V A;  1W7F A;  3MFD A;  3RXW A;  4S2K A;  4IBR A;  3OZH A;  1ESI A;  4MBK A;  4DDS A;  1XXM A;  5FAT A;  3ZG9 B;  3ITB A;  5FDH A;  1CEG A;  2RL3 A;  1HD8 A;  3N8R A;  3UNW A;  1PI5 A;  1SCW A;  1KVL A;  3WS4 A;  1E3U A;  4JPM A;  2JE5 A;  4Y7P A;  4WEL A;  1ALQ A;  4KZ6 A;  1AXB A;  4K91 A;  5CGX A;  5E2H A;  2Y55 A;  3UE3 A;  5L2F A;  4OH0 A;  4KQQ A;  3RJU A;  4KZ5 A;  4LV3 A;  2Y2M A;  3BLS A;  3N4I A;  1GHM A;  1PWC A;  3NDE A;  2C6W B;  2HDQ A;  3HUN A;  3Q81 A;  3MXS A;  4HEF A;  4OPQ A;  1MBL A;  3DW0 A;  3Q07 A;  1KGG A;  4OLG A;  3ITA A;  4QJG A;  3G2Z A;  1K54 C;  1L0F A;  2BLS A;  4N1H A;  3OPH A;  1NRF A;  5A92 A;  5E43 A;  5F82 A;  1TEM A;  1OME A;  3C7U A;  2Z2L B;  4JLF A;  1K56 D;  3TG9 A;  3MXR A;  4EQI A;  3A3D A;  4BL2 A;  5F83 A;  5TFQ A;  3IF5 A;  3IF6 C;  4S2J A;  4P6B A;  4BEN A;  2ZQ8 A;  4WMC A;  1GCE A;  1ES5 A;  5U47 A;  4E6X A;  4Y0O A;  4ZTK A;  2J9O A;  5GHY A;  3UDI A;  4MEZ A;  1JTG A;  3MKE A;  4S2N C;  3A3J A;  1RGY A;  3FZC A;  3C4O A;  3G4P A;  4E3N A;  2G2W A;  2XH9 A;  5GLD A;  2OLU A;  1IYQ A;  1BUL A;  1FR6 A;  1MWS A;  4C3Q A;  4EBP A;  4EBN A;  2DCF A;  5FI7 A;  5CEC A;  5JYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...