4X0EA

Structure of m. tuberculosis nicotinate mono nucleotide adenylyltransferase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
195
structure length
192
Chain Sequence
RLGVMGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPWQKQVSAAEHRYLMTVIATASNPRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGYELRNEHITSLLGQLKDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKCRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterial nicotinate mononucleotide adenylyltransferase: structure, mechanism, and implications for drug discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Probable nicotinate-nucleotide adenylyltransferase
total genus 51
structure length 192
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4x0eA00
3UMVA 3AG5A 1WXGA 2CV0A 2A4MA 2HGZA 2Z3VA 1WY5A 4JXXA 1O95D 2VXOA 1CT9A 1UFVA 4EG1A 4QREA 1LW7A 4XFDA 4UZEA 1IQUA 1N2EA 3GLVA 2HMAA 2DR2A 1P7PA 1QRTA 1MC1A 1N2JA 4ND7A 2O8VA 1N2HA 2A1TS 3D6UA 2J4DA 3DO8A 1F4LA 1OWPA 1G59A 1N78A 4EG7A 3IVCA 1O0CA 2IELA 1KQNA 4MQ6A 3NV7A 2QUIA 4MVYA 5DASA 3PRHA 4MWEA 3CLUC 1N2BA 4ZCQA 4WSOA 1O96A 1X8XA 1NUUA 2PZAA 1KAQA 4YP5A 2VTBB 1WXIA 4HJXA 2I1LA 2BYTA 1NI5A 1T6ZA 4MW1A 1H3EA 2PG3A 3QTBA 1Y42X 3RBAA 3ZJVA 2E18A 4EF6A 2WB2A 4F4HA 4NATA 4DDKA 1IFXA 1PG0A 2CUZA 1T9GS 4MW2A 3OTWA 4NZPA 5J5AA 1IQRA 1YUMA 2A84A 1N2IA 3KT3A 1NUQA 3COYA 5IJXA 3FI0A 2VTBA 2WSIA 3TZEA 2QJTA 4MW6A 2QUJA 1NUPA 1O96B 3CLRD 4MUJA 5TEWA 1JEDA 1N1DA 3IH5A 4NAHA 1MBZA 3FDXA 4BWVA 4DJAA 1J20A 3Q10A 3ND7A 1ILEA 3ZJUA 3CLSC 5KHAA 2PXHA 1QRUA 4ZCSA 1QU2A 4MVXA 4KR9A 3P0IA 1QNFA 1J1ZA 1NYLA 1Q11A 4MUHA 4CDNA 1JZQA 4L2IB 3DLAA 3I05A 5HUJA 1IQ0A 3OP1A 4KKVA 1WXEA 3N8HA 3HFJA 1OWLA 3QTTA 5EKDA 3SEZA 4PY2A 3A4IA 4MUFA 3IODA 1KKUA 2QUKA 3SYTA 4ZCTA 3A2KA 3PNYA 1M8FA 1I6MA 3A04A 2H2AA 4TS1A 5LLTA 3FIUA 2DLCX 1T6YA 5FO1A 1OWMA 2E89A 2R5WA 1I2DA 2V0CA 4I6GA 3SP1A 4CT0A 4PBTA 2A88A 2X0KA 3G5AA 2AKEA 1VBKA 5DK4A 3HV0A 1MB9A 2HZ7A 2QJOA 2ZUFA 4CDMA 2WQ7A 3CLUD 1TYDE 2J08A 3P0JA 1GLNA 4MWBA 1J1UA 1WQ3A 1MAUA 3FY4A 2A1UA 1WZ2A 3IOCA 2XRZA 1N2GA 1EFPB 4J75A 2WQ6A 1JIJA 2D13A 3TS1A 3K9WA 2GM3A 1OWNA 3FG9A 2IJGX 2EJCA 1TQ8A 5KCMA 1KAMA 1A8HA 1WKBA 3IMGA 1M83A 3MMXA 1JIIA 1IH8A 2Z09A 3H97A 1JZSA 3SEQA 3FOCA 4MW0A 1T9GR 4I6EA 1GN8A 2QUHA 1YULA 5LFAA 3HGMA 5DEOA 3HMQA 3IOBA 2EL7A 1XJQA 1QRSA 3RHSA 3X1JA 3ZUGA 1KH3A 2JA2A 4MULA 2TS1A 3N2YA 4KPUA 1M8PA 1Q77A 4ZT5A 3CVUA 3Q12A 3ISJA 1GPMA 3RJZA 1PFUA 2D5BA 1Q15A 3TQOA 3CA8A 3TZLA 4NAUA 1XNHA 1QJCA 2E0IA 3ND6A 4JZYA 4U7JA 4J76A 4KPUB 2X3FA 1GAXA 1EUQA 4A91A 2AZXA 4P2BA 1O0BA 4KR6A 2O5RA 1GZUA 1EJ2A 1NURA 1K4MA 4QRDA 3GUZA 1G8GA 1R6TA 4L2IA 2DETA 2X1MA 4ZT3A 4EG6A 4F3RA 4DDMA 1R6XA 1M1ZA 2JANA 2QTNA 4S1OA 4EG8A 4RPIA 1WJGA 1ZH6A 1B6TA 1I6KA 1OWOA 1N77A 4ZCPA 4NDAA 1V8FA 3N9IA 1VL2A 1IVSA 2YY5A 4G5YA 4PBSA 2ZP1A 3GMIA 3H05A 3DPIA 3CVXA 3SDBA 3CLTC 1EFPA 4JFAA 1KORA 4XFJA 2QTRA 1M8JA 2A1UB 3KT8A 4EG5A 5FNZA 1WQ4A 5IHXA 3IOEA 1U3CA 2JAXA 3LOQA 1N2OA 2H29A 4DDHA 4MUKA 1TYAE 3AG6A 1K92A 1O6BA 3TNJA 3NBKA 4UZFA 3IUEA 4CQNA 4YP7A 1X6VA 3FNRA 1O94C 4YMIA 3FETA 1TYCA 1ULHA 4DLPA 1NUTA 3H9CA 1GTRA 4EG3A 3NBAA 3HZRA 2Z08A 1SURA 4HK4A 5K0TA 1PFVA 1TEZA 1MJHA 3IVXA 1EFVA 2PFSA 3L93A 4H3SA 1VLHA 4JXZA 1QTQA 2CV1A 1RQGA 1N75A 3MLAA 1TFUA 4U63A 2DERA 3ZXIA 4MWCA 3CLRC 4FZJA 1PFYA 3G59A 1H1TA 3L92A 5K0SA 1T6XA 2YWCA 2DXIA 2E21A 1S4MA 1KH2A 3CR8A 3MLBA 2AG6A 2X1LA 1COZA 4OUDA 4MW9A 2IP1A 1MAWA 4ARIA 1KR2A 1EFVB 1OBHA 2V0GA 3Q4GA 4I6JA 1JECA 1N3LA 2QTMA 3AL0C 1H3FA 1XNJA 2D54A 1F9AA 1O5TA 4R2LA 1J21A 3PNBA 2YXNA 3MXTA 3X1KA 4OUDB 3KFLA 1KQPA 1LI5A 4ZT6A 3G6KA 4EFKA 3C8ZA 1K97A 3P0HA 2DPLA 1F7UA 5J58A 3AKZA 4K0RA 4E1AA 3ZJTA 3SZ3A 3FHJA 1KH1A 2NSYA 1V47A 1D2RA 5F23A 1KQOA 4MUNA 4Q93A 3DV2A 1MRZA 4R0NA 3CVVA 4G5FA 1DNPA 3PXUA 1JHDA 5DB4A 3UOWA 2J07A 1MOPA 2RD2A 4MW7A 4ZCRA 1IHOA 3D6VA 4MWDA 1Q19A 1J70A 4ZT7A 3U1VA 2CYAA 1YI8A 3LCJA 5J59A 3MUEA 4AS1A 1U7XA 3H99A 5LM3A 3X1MA 3CVWA 3UC5A 4DNXA 1YIAA 4MUGA 2NZ2A 3CLTD 1WXHA 1OBCA 4HPWA 3UK2A 3P52A 3VRHA 4MW4A 2OV4A 1XNGA 1R6UA 2G36A 4XSVA 3INNA 3ILVA 1K4KA 2RE8A 3LE8A 4HJRA 1KP2A 2DUMA 2YWBA 3IDFA 4QBTA 3VU8A 4MUIA 3COWA 3IMEA 2DEUA 1TYBE 5JBNA 1EXDA 2A7XA 4DE5A 1ZJWA 2CT8A 5AHWA 2PZBA 4EGAA 2A1TR 2CYBA 1O97C 3E27A 1NUSA 1G8FA 3KT6A 4KR7A 3UY4A 3VGJA 1BS2A 1JGTA 2J09A 3IUBA 5HUHA 3SZGA 4R2MA 3AFHA 1ZH0A 2CFOA 4MUEA 1U7DA 3RK1A 4JYZA 1GTSA 1O97D 4GU5A 3ZGZA 1NSYA 1QU3A 3JXEA 5BNZA 1KP3A 2CYCA 1G8HA 3TQIA 3A05A 2C5SA 4MAFA 3M5WA 1PFWA 5HG0A 1JILA 2GOYA 1EE1A 3KT0A 3K32A 1JIKA 2XRYA 4X0EA 1YIDA 4AQ7A 1VBNA 5H16A 3HL4A 4MLPA 3IVGA 3CVYA 4NX2A 3QE4A 3ELBA 2GKSA 2QJFA 5FO0A 5H7XA 2PZ8A 1VBMA 4YP6A 1YUNA 1NZJA 1U0BB 4MVWA 4OJMX 3CLSD 2PIDA 2BTEA 5KWVA 1OD6A 1ZUNA 3S3TA 1F7VA 1QQTA 2ZUEA 4YBRA 5TS2A 4EG4A 1HYBA 3IMCA 1PG2A 3BL5A 3AIIA 3RK0A 4GRIA 3RFFA 4WNYA 3H9BA 4K03A 1H3NA 4U8HA 1O94D 1EUYA 2A86A 4Q16A 2CSXA 3ZXSA 1NP7A 4ARCA 1J09A 3FH0A 1IRXA 5TEVA 3N05A 4ND6A 1M8GA 3COVA 4G6ZA 1LI7A 1WXFA 2CV2A 2J5BA 1M8KA 4ZT4A 4ZT2A 4PBRA 1I6LA 2B7LA 3FWKA 1JEEA 1FFYA 3PNVA 1JMVA 1MB2A 5TGTA 4MW5A 3ZIUA 1O95C 4MVCA 3F3MA 3ND5A 1FYDA 1U3DA 4RUKA 3COZA 2OQ2A 1WOYA
chains in the Genus database with same CATH superfamily
1OC2A 3HL0A 4ND3A 3U0VA 1PQPA 3VDNB 3JALA 1PAUA 3TFWA 3TLMA 1MQ8B 2PD4A 5F2KA 1WTAA 5FL7A 2I3AA 4AO8A 1VL0A 2OA0A 1N5OX 2PQ0A 3NWOA 4G0YA 4AFNA 1HO3A 1G8MA 2XVAA 4BJHB 5KB3A 3JD3A 2XNCA 1ZD3A 3TQFA 2HO4A 4H15A 4UZEA 3GVXA 4LSWA 2VRNA 1WSAA 3HVRA 1ISFA 3DMYA 3ASUA 2BGGA 2A1TS 2C77A 5KEIA 5IUKC 1L8LA 2OQVA 2A92A 1IEWA 4FI3C 1M2OB 2H0RA 3GLUA 4C88A 4RTOA 5KS2A 2RK4A 3YASA 1V71A 4OLAA 2FETA 2IELA 5T8KA 5SZJA 3UUGA 2H1WA 3H11B 1YJQA 1X86B 2XA9A 2XYRA 4NYJQ 2R4UA 1XQWA 2RHMA 1X8XA 4M4SA 3T7AA 3EISA 2P9TA 3WDKA 4U7HA 3GB9A 3GYBA 2IU6A 3H8SA 2DHCA 4D44A 4J0IA 3W4JA 2UU9B 4CMGA 1TK2A 1NNLA 1ZM7A 3L8MA 3GCZA 3O93A 5ARCA 1XRMA 1Y42X 2KBEA 3ZJVA 4G5SA 4ITVA 5BQPA 4DLXA 4TVBA 2X0NA 2CCGA 3QKWA 3FDZA 3L1KA 3DMHA 5EFOA 3QIAA 3RU7A 2G9ZA 4Q4LA 3UWPA 4YT8A 5L51A 2EAUA 4K86A 1JSLA 4NZPA 5HDQA 1BWSA 3QU2A 2ZAMA 4LF6B 3JQCA 1JKFA 3U49A 1HA3A 1PEAA 4EEKA 1QCZA 1WNTA 1R88A 1TQHA 3KT3A 3RUHA 3SBDA 4WCFC 3LBIA 3ZY6A 3NLLA 1SEVA 4PZAA 5LQDA 3C3XA 3D64A 4Q03A 3PTZA 4DLUA 3MMSA 5KC8A 2OMKA 4Y2VA 1V8OA 1V8ZA 4XASA 1SKYB 4XVRA 5KWSA 3FHOA 5LP6B 5BYAA 2F1HA 4QPPA 2KB0A 3SJAA 5DI9A 4WDQA 2PS0A 5T57A 4PONA 1GSAA 2FLKA 2GF2A 1TDJA 1EHCA 3FYUA 1UL1X 2ZRNA 3WV4A 3H3JA 3DWFA 3G17A 1DAKA 1EM8B 2XH8A 5HZMA 1D5WA 1QVAA 1QTIA 2WJ6A 2B7CA 2VUSA 1UK6A 4MCAA 3STUA 1PTJA 4FFLA 1WXEA 3SZUA 4PRYA 1RXWA 3HPRA 4IUDS 2RGEA 1KEEA 4JOBA 3NTVA 1IIRA 2NO1A 2E1PA 1DMSA 4BEVA 4M6WB 4EEXA 1J25A 2QV0A 1V16A 1ZXXA 2ADOA 2PEYA 1GZ4A 2QTFA 2VJCA 3A2KA 3PNYA 3QKSA 2R4TA 1V3UA 4I5DA 1V8PA 2QW0X 2WSYB 4QOJA 1K08A 1MJNA 1HE4A 2WWWA 3MHPA 3R3HA 4LCEA 3WTBA 3A70A 5AI0A 4BGEA 2I8LA 2Z58A 2Q41A 3OKCA 4QXRA 3B8EA 1SCUA 5JY6A 4OB7A 3UAWA 1JDPA 1YU6A 5HTOA 2H06A 3JQ7B 3CE6A 3QRWA 4G67A 4EB8A 3D0OA 4HVCA 5BRAA 2OHJA 2QAGA 1VBKA 2VSNA 4D4KA 2HJRA 1VE3A 3LP5A 5C1DA 4FZ5A 4RIFA 1VE6A 3QPWA 1MAUA 2A1UA 2Z1MA 2A8YA 4HTFA 3H7IA 3RS2A 4D0RA 1ZD4A 3DV0A 1OR8A 2I3DA 3LUCA 4YTEA 3TLYA 4Z51A 1DS6A 1X77A 1C9YA 3SC6A 4OB8A 1EVYA 2BGJA 3K9WA 4OGFA 4FYHA 2PRSA 5ALOA 5DN6A 1IZ7A 1YS2X 1Z8HA 3C7AA 4OQLA 1XB2A 4PZCA 5ALFA 4X8HA 4BKUA 4D02A 5HW0A 4L5YA 1P33A 3CKLA 2OVBA 2RGRA 1TD1A 2QTVB 2WIKA 2AFHE 3PNQA 4LDNA 4AG5A 1N25A 3L05A 4JYPA 2XUHA 2HHJA 2Y2UA 5JG7A 4IIHA 2R8RA 4NPCA 3RIGA 3GLFA 1CWUA 2VYVD 5BQ5A 4BNDB 2FHPA 1T4CB 2ZXFA 1XSEA 3S2FA 1NU8A 2QZPA 3EFEA 4AZSA 1RFLA 1CFJA 3CUWA 3R4CA 2EL7A 4X3OA 1XJQA 2X0EA 1XZNA 2JJ1A 2XOKD 2R751 1CZHA 2D4HA 2PX6A 2ZJ4A 1QOPB 2GM5A 3QUSA 2ZZKA 4P33A 3CUUA 4FWTA 2NSDA 2FFHA 3IUNA 2NZWA 4I5GA 2JJMA 4LBVA 4MULA 2GHRA 2PU7A 4TV9F 1G8SA 2AE1A 3FA2A 1NVEA 2CDAA 3PFCA 5CCDA 3WNZA 1VYHA 3BIOA 5CT5A 3TLXA 1G5PA 1GQOA 1JQDA 2O4CA 1I4OA 2XUQA 3AF1A 1PP4A 3EXEB 5JE8A 1VL6A 5TVGA 3RTEA 4EFDA 2EHDA 2PBLA 3GPBA 5DULA 3W3ZB 4EY6A 1E1DA 3NW9A 4IV0A 2H7YA 4EKDA 4BVJA 4TL6A 1PJAA 4DNPA 1EVLA 2AF3C 4BMDA 3EDQA 3TW4A 1DTSA 3WIOA 1YI1A 1Q0TA 2AYXA 2JJ8A 4F11A 1PDOA 3L6EA 3S27A 4NESA 1UOOA 1H2WA 5IDWA 2BGRA 2A1IA 4JI1B 2X3YA 1ZN2A 4IH4A 1OC4A 1CX9B 3K4HA 4TKVA 2VTDA 4UPEA 4KZKA 3L8ZA 2DKFA 1U2ZA 1WCXA 1WDTA 3IPXA 5GGYA 2PUEA 1EJ2A 3A3PA 3EIQA 3SSOA 2YZGA 4EUKA 3KOWA 5T3UA 2H9AA 1VGRA 2ZKIA 2BONA 4JJIA 4DG9A 1V26A 2I1VB 4JJGA 5KYWB 4TKVB 2QN8A 3Q0IA 4ZT3A 3FPHA 4M9CA 4ADSG 4DDMA 1BKYA 2CJYA 2UZAA 1OLOA 1RI3A 4JVNA 4P5PA 1L4LA 2HA7A 3H1EA 3SR3A 1OF1A 1RYDA 4RE5A 2YDXA 5LD2B 1MIOB 1AQYA 1NI4A 2WMDA 3Q3EA 4PIPA 1PL8A 3CEHA 1RM5A 1L5GB 4LC0A 4TKLA 4CCYA 1CUFA 2OCAA 1J90A 4INOA 1E3JA 2ZLBA 3CPSA 4RXTA 1O54A 4ZI2A 4QYSA 4LF4B 3VI3B 2CDBA 2NTEA 3MJFA 5CNKA 3GMIA 3ACBA 3VV3A 4AF6A 3OD5A 5CM8B 1P6UA 1CZUA 4HF7A 1U8ZA 1CULC 1NPTO 1Z6GA 3HU1A 1DG9A 4KLZA 3ZBTA 1WP9A 2I34A 3KHKA 4JHXA 2YC4C 1KC3A 2CXHA 5CJJA 3VO1A 3QHQA 4ZVPA 2OFFA 3NXSA 4QM6A 1JQBA 4KH0A 2NXCA 3AG6A 4L0CA 2GZRA 3NBKA 3OZFA 4Q19A 4YP7A 3SS9X 1FF9A 2H48A 4F5ZA 4WBNF 1ESCA 1V96A 2IITA 4HWSA 4Q9LA 5JRDS 5GQSA 3BFPA 4ZCMA 2QW1A 2XJ4A 3KYJB 2Y77A 2GCOA 3JAKB 4MI3A 2OD7A 1TEZA 1Z25A 2HA4A 4UQPA 3K6RA 4O5OA 4BNNA 3WYAA 1U9IC 1DELA 3K53A 5ENVA 3RRBA 2HCBA 4QDUA 4KRXA 2XVYA 3W5DA 2NU9B 1TAUA 4KE6A 1Y8QB 1FJGB 3EA4A 3R77A 4HNVA 3ROXA 2WKQA 3NKLA 3IAM6 2V4MA 3OQMA 2DERA 3BE4A 4EVIA 3M2TA 2L42A 3OFJA 4MWCA 3F4LA 4IF6A 4KXMA 3SEFA 2CVZA 1PFYA 1RRGA 3M49A 1K86A 4MWTA 1SUDA 3MCZA 3I83A 3P0FA 5F33A 3S0JA 3KR1A 1LQUA 4KIGA 1Z2CA 2VDUE 4PANA 2ONKA 1RRPA 1UMDA 2Z57A 4MS1B 2WHYA 3CXUA 5DI3A 3S1LA 3B1ZA 5EJ9A 1RLMA 2LD4A 3CRMA 3H5IA 2W90A 4M1KA 2AUMA 1BEZA 1IG3A 4FNAA 2JIDA 2G76A 3D6FA 2FA9A 4IFEA 3L7MA 2F17A 4AWAA 2DC1A 1DC3A 1Q12A 4EI8A 3ZEIA 3IQXA 4L8YA 4TUYF 4CVNA 1IOVA 3FKJA 2OBMA 3NETA 1ACJA 1RRVA 5CIQA 3GLFE 4LYEA 1ENYA 1X92A 2GPNA 1IMJA 2QTMA 1S02A 4EW2A 1XNJA 4FHZA 4E4TA 2C3YA 3OT1A 4RQUA 1YZUA 3QFHA 3QKSB 5I7VA 4LHXA 3FCAA 5IMSA 4UTXA 1RHKA 5A7FA 2R11A 1BKDR 4WACA 4ZQHA 3FVRA 1S7GA 4UDNA 3WIEA 1X9HA 4GD3Q 2J9FB 2DULA 4K5QA 1ODJA 1ZJZA 3OIUA 4FMCF 3OOJA 2GTHA 4EJ6A 4EHFA 4WVLA 1T5DX 1TAGA 1FUYB 3B1XA 4YJKA 1FFSA 5KREA 3P0HA 3V2UA 2G7ZA 1X0VA 4FU0A 3F6SA 5K0BA 4K0RA 3SZ3A 1M5RA 1TEHA 3C85A 4MZXA 5C3MA 4RE6A 1QRAA 1DIRA 3NTOA 3TTSA 4YR7A 3LDGA 2H16A 3S5UA 3AHGA 4UEKA 2C9CA 5B4TA 3GFPA 3OZWA 1R9JA 3KYBA 4JU9A 5AWFC 4D45A 2PUHA 4F71A 4FKBA 2AJDA 1JLLA 2VDRB 2VSOA 4HVLA 4RKEA 1PJCA 3WDSA 3KKPA 5U9CA 2MR6A 4S04A 1WIWA 2Y99A 1XWFA 3GZNB 4C2AA 4TWRA 4L22A 5FA8A 5K8TA 1J2RA 2QJWA 2ZULA 3DFUA 3HHPA 1GOTA 2YVQA 1NBAA 2YICA 4ETMA 5I4BA 4BO7A 3AHCA 4QODA 2LR0A 4EHLA 2IZ7A 1EAYA 2OBXA 1GUFA 1CQZA 2R66A 3L8CA 2PX5A 3CEAA 2V5AA 1Q19A 5LLSA 1J70A 1G5IA 1PJ4A 3PC8C 1KJIA 1Y3FE 4BX0A 3HRHA 4GBJA 4U3JB 3S6JA 4E2XA 1AJEA 2BOVA 3F1LA 5GMOA 5LM3A 3E7WA 4TV8B 2OHIA 2POQX 1XMSA 2CHQA 3DFZA 3HB5X 2EKBA 2X8BA 3WWYA 3RADC 4CZ2A 2YHIA 3FNHA 2VK4A 2M6KA 3D8SA 2P9EA 5ERXA 4IW3B 4QNRA 5I4CA 4IZHA 4ZJUA 2VYFA 2WUDA 1TZCA 2CUTA 3AVQA 3B3QA 2ZTUA 3BGIA 3NBQA 4HAXA 2WNHA 4MTLA 3WC4A 1S96A 4TV9B 2Z43A 1Q0ZA 2GK4A 1Y8ZA 1GP2A 1FA9A 3GJSA 3V6MA 4E2YA 4EGJA 2CDNA 3KB6A 4OI2A 4WADA 1E3DA 3F7MA 5IM5A 4RZ2A 1KDYA 2Z2IA 4MKHA 4PYLA 2FV8A 1RQXA 3DTYA 1R64A 3DW3X 2O2ZA 3ZZTA 1OXVA 4M1WA 2YHUA 1L4GA 2CLFB 4OFXA 1ZH8A 1RVDA 4OMUA 5TQ0B 4E12A 5CB6A 1JE1A 4L9WA 2BWJA 2A7XA 2VH2A 3K5WA 3DTVB 4NULA 1DU4A 1ONBA 2WWRA 3G2QA 3CUKA 1HH4A 3LQRA 3NEYA 3GRRA 4X84A 3IL2A 2P5TB 3P9SA 3IJRA 1NTRA 4MHSA 2ZM6B 3RGGA 4M55A 2O0MA 2IEAA 1WD5A 3O7MA 2YMMA 1ESDA 4RMIA 3WZLA 1MORA 5AVRA 1UOPA 4MMZB 4A82A 2WHRA 2Q9BA 4G26A 1RQ2A 1C0LA 2Z5GA 2BFNA 1T1GA 2ORWA 2QEQA 5BSFA 2GAAA 2XF2A 4M21A 5CR9A 1U7DA 2IHVA 2WY2D 5B7PA 2PWPA 1GTSA 2B8WA 1W4AA 2DM6A 4IX1A 2RHTA 5TNXA 1IK4A 3M4YA 2QTVA 3AILA 4B71A 3PL1A 4UXIA 4UQLA 1DTWA 3GJ0A 4M99A 3HYNA 1LS6A 3TMKA 5F3WB 4ZHQB 2ACKA 2R1UA 2IYNA 3LUBA 5KVVA 4OMFG 5ER9A 2FQYA 4MS3B 1XEWY 4RK6A 3ODPA 4TWAA 3R9XA 1CQJB 2LZ0A 2XOEA 2VPQA 4LSGA 3GH1A 1AGRA 3M5DA 2Y1FA 2FR1A 4W5OA 2GKSA 3OM1A 2HNAA 3W6UA 3TZHA 1P0PA 1USWA 2VT6A 2H4WA 1ICIA 2LWIA 5CYFA 1OSNA 3QK7A 5CX1B 2JFGA 3FB4A 4GS5A 4FB5A 5BW6B 2FPXA 2JFQA 5HCUA 3ESYA 4YACA 3WJ7A 4C05A 5HF6A 1QNLA 4J4HA 1QQTA 1Z6QA 3MMNA 3WXMA 3WYCA 4FYPA 4EG4A 4EHKA 3LY9A 4DCPA 1ZK1A 3S1SA 3RFFA 1E4YA 1NLFA 4UU1A 3S8YA 1H3NA 3FCXA 2ZVQX 4CKCB 3QKRB 1RYEA 2QTWB 2R60A 4FKZA 4XYMA 2WYOA 1G16A 3KJQA 1ZIPA 3DM5A 4RY9A 5EZ5A 1EFRA 2PUWA 4B3DA 2P6UA 2WA1A 3MOSA 2POCA 4LSMA 2ECFA 1FFXB 1M8GA 1PYGA 3HWX1 4QUGA 5FFNA 3ZVMA 3BXPA 3C3AA 4EKGA 1I6LA 1JHRA 2O7RA 3FWKA 4X6LA 4BNLA 4MVJI 1HDEA 2LIPA 1QHNA 4XJSA 2A58A 3NOXA 1JMVA 3NKFA 5HDBB 3JD2A 3KU1A 2GJAA 3RS9A 3DE6X 1FNMA 2J3LA 2ISSD 3I28A 3TNFA 1BGXT 4O3MA 4KIFA 1L7DA 3JQRA 4I0WB 1RI4A 1Z38A 2UDPA 4CV0A 5JIBA 4ZANA 4MGKR 3WB1A 2GVZC 1C3XA 1N5IA 3GBPA 3COZA 4RLHA 1U1DA 3ZQ6A 3RT9A 1ODSA 4L8LA 3AHIA 1K7YA 3HCNA 1W46A 2XGJA 1ZEMA 4HLQB 1WXGA 3DR3A 1RS0A 1ZMTA 1KFCB 4MVJE 5D1HA 5EN4A 4OI1A 1RC8A 2FK8A 1F2UB 4KIJA 3QX9A 2G7MC 1WY5A 5H82A 3F4BA 2F8MA 5JT1A 1LW7A 2CXXA 4TYMA 1KAEA 1GRNA 3N53A 1U0GA 2HHAA 1M6EX 2AQ8A 4XFDA 1XN4A 4B83A 3BD8A 4M8LA 4ZRNA 1ZSVA 3TNDA 3PGXA 4ARSA 3FPJA 1P7PA 1D7OA 1ZU5A 4L8WB 3RSCA 2QZJA 3TCXB 3LUJA 3WRYC 3R9WA 1XD8A 1PFQA 3AKYA 3EEFA 2A5GA 3FXAA 3OM9A 2C0CA 4M54A 1WDMA 3H6KA 3VNRA 4ENTA 1E0KA 4D9EA 1K5HA 2QM7A 2Q6VA 1D1QA 2AMFA 1IYZA 4MWEA 3QF4A 2GH1A 5DX0A 4RU1A 2I8CA 1B4DA 4X24A 3GV0A 4CM4B 3OESA 1R0LA 1CY7A 2GXSA 3QX8A 4QYXA 2AW5A 4YCAA 5AOAA 1NNUA 1YDGA 1EDDA 4LHSA 1A9YA 2GN0A 1V48A 4S0ZA 1UIMA 1E8NA 1NBEA 1WXIA 4WKPA 1LGYA 4OHMA 1Z0IA 3LKBA 5EIEA 5JY1A 1DC5A 1JEQA 2RONA 3OUUA 5JCOA 4EF6A 3F7OA 2LW7A 2G9NA 3VYSB 4P31A 4WASA 2VDWB 4AXXA 4HFJA 2M1XA 5JH7B 3T1TA 2RGYA 4P0PB 3PFWO 1EFCA 1Z5OA 1W34A 4DZZA 3T9AA 4EARA 2UZIR 1ZOPA 1UPFA 1FPMA 5JNTA 3SFZA 4HNQA 5GZ3A 4UC0A 1MB0A 3BGVA 1U7ZA 3VTAA 3M4XA 1KZ6A 1S89A 1RWXA 1SKBA 1R16A 3FI0A 4XEUA 2I99A 3KEGA 2NUPB 2C92A 1MC8A 1I4WA 2B7BA 4JB0A 4I7EA 4NZMA 4RGVA 5EIBC 4I1RA 5G4LA 1J9EA 2FG5A 2QPLA 3KFXA 4DCOA 3KBBA 1OZ0A 2VJYA 3ZVRA 1MO2A 3PG5A 1D4ZA 4YMVA 4B8ZA 1INLA 2DJIA 4UTVA 4GPIB 5THQA 3SNHA 1SUEA 2PT7A 4J0JA 2Z5LA 4L95C 1RYFA 4MV1A 3RS3A 4EKNB 4J7CA 2UVPB 1W4CA 1XVIA 2QG6A 3LBYA 5AVKA 3EPPA 4RABA 5CIYA 3GUVA 1X13A 3HXKA 1EINA 1ENOA 1Q11A 4M3NA 1P6QA 2L69A 4P4GA 4JIGA 2O2SA 2C84A 1U2PA 1F8XA 1QGZA 1IQ0A 2DWOA 2JHPA 4CLOB 3WLLA 3VBEA 3WLHA 3STHA 5CA1A 3WFIA 4W5HA 1OV4A 2VAXA 1JLKA 2QD5A 2ZWPA 1N0VC 2D1SA 4RD3A 2CJFA 5H9WA 4O29A 1IHXA 1NHWA 3PLAE 3N7UA 1KKUA 4FS3A 3QWAA 1Z0FA 3AT1A 4UM8B 5EWLB 1WCYA 3QVSA 4RTLA 3QE0A 2C2BA 4P22A 3LLVA 3RKRA 3UZUA 4ZCTA 5F5NA 3HCCA 4EYGA 3A3NA 2A5LA 4URUR 5B4VA 1OIWA 5LLTA 1WHSA 5JVDB 3ABRB 3K1AB 4IR7A 4Y6SA 2JLVA 1G8JA 1ZUNB 1TA0A 3O4RA 3V4RA 2W11A 4PBTA 5IEJA 1Y8CA 3OM0A 5AW2A 4BWYA 2BMWA 2ZJ5A 3O8OB 3PQ6A 1SG6A 1WUKS 5BYBA 1RYMA 1KL7A 4RD4A 1UMBA 1QBKC 4E22A 4N9QA 2RHHA 4ETWA 4EL0A 2B2XA 3CZRA 2QXTA 1J1UA 1C4WA 3G1UA 4FDVA 3MWJA 4XCVA 4RELA 2CXSA 2OBLA 1TW2A 1V7CA 1VIYA 1JV2B 5EJ5A 4LMBA 1ZO8A 1HKUA 1XEXA 5ALMA 1JQ5A 2JFWA 3OQIA 1V1JA 4DJEC 5KQRA 1RSZA 1EEHA 1A2KC 1X42A 3NONA 4ZPJA 5L7YA 5IJ9B 3DMFA 1VGVA 2WTAA 2ZRKA 4W63A 5FWDA 4EI9A 4CM8B 1IN8A 4EMUA 3GLIB 1X2BA 5DO9A 2VSFA 2I33A 5NULA 4XTRA 5ALWA 1G4AE 1M83A 3IMGA 4IY1A 4LK3A 3FCEA 5KYUB 4RTJA 1JIIA 1IM5A 4B3IA 1E9BA 1KDTA 5EHIA 4ZU3A 1H85A 1XWWA 2HCFA 1C9MA 4BVEA 5MDHA 2OZVA 5MHTA 3OJCA 3D8BA 5CUQA 3JD4A 2DKOA 4PO1A 4DQ0A 2BUBA 2UVQA 2GEJA 2Q5EA 3PHGA 4F60A 5A1JA 4RTRA 2FFQA 4OEHA 1XI2A 1N8SA 3KEOA 3LQQA 1GRVA 1U0HC 4Z0NA 3ZUGA 1MZVA 5ITVA 1XTBA 4JQOA 3ZKWA 3OCUA 4AAYA 4F8JA 1R6AA 2V7QA 2ZYHA 3KZNA 2LDBA 2PXCA 2JA2A 3GDOA 4RIIA 3C4VA 5EJMA 3ZE9A 2JLWA 3K9CA 2JGMA 2YOGA 3F97A 3GT3A 4R6WA 4B80A 1YE8A 1Q77A 1R5NA 4NQRA 1B6SA 4HXFB 4YRKA 5FOXA 1MX5A 2HA6A 3QKUA 4L8GA 4KQ2A 2D5BA 5DNVA 3RJZA 4Z0PA 5FAKA 2I6UA 1YVPA 3PUWA 3HDJA 4W8GA 2I4RA 1KIMA 1MNQA 1ZA2A 2JB9A 2OVFA 2Z8ZA 2GBIA 3DKIA 2HIMA 4F86A 5EXTA 4K6FA 4BFXA 1U1IA 5LPNA 3FROA 4ZD6A 4EJ0A 2CV0A 4GKJB 5EMHA 1WCWA 3WJ2A 2AEFA 4J7XA 4EF5A 5AW1A 4BN4A 3UXHA 4U7DA 3IS3A 2O0LA 1UJCA 4E07A 2O5RA 1D1SA 1MXFA 2E85A 2F00A 3WWZA 3OZIA 1YR7A 1QYCA 5BV0A 5FOVA 1I2CA 1RAGA 2BBTA 2JD2A 1NVMB 1VCMA 3GUZA 5J3JA 1QRDA 3EJ6A 3HN7A 5TJ9A 1X3LA 1Z5UA 3KSRA 1JKJB 1TF5A 5CG2A 2X1MA 5FWNA 3M33A 4HS4A 1SKQA 4DKJA 1WBBA 4LPKA 1PYOA 4BFYA 2G0NA 2QE7D 4S1OA 4LF8B 3FB1A 1G0OA 1EHIA 1LPPA 4AQDA 2CUNA 2WV9A 1FQKA 2ZSEA 4F1KA 5BNIA 2OESA 1OWOA 1KPIA 2DTDA 3GARA 6PFKA 1T3ZA 2CLDX 2CNWD 2JIZA 2X42A 4J91A 4IP0A 4R1MA 3STTA 2F43A 5EVJA 5ELMA 3DMNA 4RLFA 2C4VA 3N2LA 4JK3A 2EP8A 4PAGA 3GRPA 4TN1A 4XIYA 4PCLA 1RXVA 4QGFA 2PA3A 3DCNA 3B7PA 2JFHA 4BNMA 3DFMA 4WTOA 5IT0A 1Y7HA 4OSEA 4P58A 4FIZA 4Q3LA 5FPQA 5DHQA 4LXGA 2JH9A 5HBRA 4JI2B 2AFRA 3QHPA 4POAA 4EZIA 3DUWA 1GAJA 3CKKA 2OYRA 2IVZA 5IZCA 3B1JA 3FNRA 2XB6A 4NU5A 3V42A 3B2EA 3PICA 1NXQA 5IKMA 2X19A 3ITNA 1MA3A 5I8ZA 4KR3A 2O19A 4AI6A 2ZR7A 2P40A 4JB2A 3TZKA 1XTUA 2OV2A 3ORQA 4QTZA 3VFDA 1UKEA 3INYA 1E0AA 3OEHA 5E7IA 4M7OA 3BJRA 3FTFA 2PQMA 4QICA 4ZEWA 3DOUA 2ZUVA 3RVNA 3UQYS 5B5SA 4RV5A 4CMKA 5A71A 1M72A 2A9PA 2BJVA 2FFAA 3Q7TA 4DMFA 3RAFC 3LIPA 1UC8A 1JHYA 1F1BA 3V1UA 2R6AA 4W5WA 5CA1F 4G8CA 1M2EA 3AUXA 1V7PC 1JQEA 1X8LA 4MR9A 1M2FA 1KQGA 3H42B 5K3CA 3SDSA 1G9TA 2IYFA 1QQ7A 1OYYA 1RI1A 4H7FA 1IN7A 4HRVA 4Y7CA 3W5IA 5AW8A 2KHZA 2BIFA 3GLSA 1YFZA 4L4UA 4EATA 1O9GA 5U4XA 5HJ7A 1BJRE 2C58A 2H9YA 1KMMA 3IUPA 2AHOA 1RJEA 3RH0A 3G7SA 3KQNA 3LCUA 4HGZA 1KJWA 1KVSA 2ZIAA 3I4CA 1COZA 3PFIA 3WP1B 5BOSA 1Q50A 4RDIA 3SMVA 2XTMA 3KKOA 4Q24A 4B6PA 1S2OA 1O03A 3DYIA 3UWOA 2V0GA 3HNPA 1J24A 2IV7A 3JSXA 4G0XA 3C5HA 4PF1A 3Q8WA 1TE2A 4C6TB 3H2HA 3NYIA 3H3FA 5BV1A 4UATA 1A4RA 1VPWA 3LLMA 5SYAA 1RWNA 2Z0MA 1RKBA 2RHCA 3X1KA 1NJ6A 521PA 1LI5A 5HZKA 3TSOA 5M29A 2D00A 3KQMA 1GPH1 4R2HA 3AJRA 1JALA 4NFLA 4PYNA 5E4TA 1J4AA 4CL0A 1N7HA 1UQUA 3K9GA 1D6JA 3ZWXA 2PS9A 3PGVA 4RGBA 1W29A 3A7EA 3LPNA 3EBOA 4OBWA 3LRPA 3PPYA 4V2IA 5ICCA 4WLVA 2EX1A 2NZXA 1E94E 1HDZA 1JQ3A 4MKXA 5DMXA 4YP9A 4DJJA 3U4QB 1PZGA 4L5CA 3QZUA 4QLBA 4BMVA 3FHJA 2UUBB 3ZCTA 3FF4A 1Y37A 1Y6GA 1KH1A 3CF4G 4ZZ2A 2MIIA 4PYJA 4K6MA 1T0HB 3ENQA 2AOTA 1Y33E 5JAZA 1M6VB 1Q0PA 4YJHA 2KE5A 4D6XA 5AM5A 3L9XA 2EKLA 3IV6A 4NSNA 4BDSA 4S1NA 4DSAA 1NBWB 1S1MA 2JFUA 2H4HA 5IMBA 1NMXA 5I3CA 3F5DA 4JR2A 2WHPB 2OCGA 1WO8A 3PV0A 1SUPA 1C2YA 4IGKA 1YKSA 3D6VA 5LVAA 4NL4H 5DCWA 4L27A 5T4EA 3WLTA 1DCMA 2CYAA 5I9NA 1YI8A 1GV0A 4DY4A 2FHSA 3VM6A 1AO0A 3GRFA 4KOAA 1U7XA 1UXGA 1E2DA 2FFRA 3HZOA 3RRYA 4DJTA 1BDJA 1DAMA 1I8TA 3X1MA 1IG0A 2Q3EA 2HF8A 2NU7A 3RV3A 3HCDA 4QJ3A 1E2GA 2OENG 3VKGA 1TT7A 3CLTD 5C18A 1JSCA 3IKJA 1AKMA 1FQWA 1VZ2A 2OZLA 2XGMA 3CBQA 3LY8A 2BRUC 4ZVSA 3UK6A 4B79A 5HCIA 3WB9A 421PA 3E4CA 2ZBPA 3GR6A 1NBIA 2FSHA 4HEA6 5H4GA 4K46A 1EZ1A 4KV9A 2ZRIA 2I9KA 2L17A 2WFLA 4XX1A 4CMIB 2NP6A 1EIWA 1DKRA 1V3VA 4QECA 1KI3A 4Y7DA 2VS1A 3UXEA 4DV4B 1FU7A 1YKFA 2COEA 3IBGA 5F12A 3DT6A 1GVNB 1OX4A 3TG2A 3H18A 1X7WA 1CETA 1ZOOA 3L1IA 5G1PA 4V38A 4W9NA 3ADDA 4GUDA 4FCVA 3M34A 4G07A 2JS7A 3TEMA 2YS6A 4JQCA 1HK7A 1L5ZA 5EJFA 5C53B 2AFIA 2IHUA 2RKOA 3BE6A 2PJZA 3X2EA 2L18A 4EPYA 1JYFA 4D99A 5JJ5A 1DBSA 5TF0A 3GRCA 2PIAA 2E4UA 3I52A 4LWPA 4EMSA 1FLAA 4B2PA 1MEEA 1N3BA 1TKCA 2CEKA 4HNGA 4IIVA 4V0NA 4BQQA 3QSYA 4NEGA 2CVHA 1H2AS 1ZPDA 4JOQA 2C7RA 3PRKE 1U9CA 3RTBA 3PZBA 3SHVA 4F5DA 5IXYA 3CPJB 3RK1A 5JNVA 4LVOA 3VO9A 1U0TA 1G2OA 1FDRA 1Q1QA 4KXVA 4Y2PA 1QQBA 1I7NA 1ZMRA 2I8AA 5D3MB 3L7LA 4GXTA 3AM3A 2WIFA 1JIQA 4DLTA 4ETNA 3FFTA 4KSYA 4MUXA 5ADHA 2GO1A 2K7FA 4TTTS 1I33A 1XELA 1P5ZB 3FIJA 2AFVA 3K32A 2AG8A 3DE4X 2ZATA 1KOLA 2FWBA 4EGSA 3MUNA 1HXHA 3IQFA 1FBTA 5BWNA 5AICA 3A9VA 3I2KA 4PZPA 1U28A 4ESOA 1OBOA 4HGNA 2BH2A 3THXB 2CFTA 4ATNA 2NT4A 3TLEA 3LM8A 3G68A 3P19A 4P9NA 2P9YA 2QSUA 1FC0A 1NF3A 4R83A 3ZWCA 3LX8A 3R5XA 2WU3A 4KNYA 4U7WA 1QFZA 2JFOA 5P21A 1DO0A 3KOOA 3FDJA 4CETA 2BTEA 3BF7A 1R4MA 4B3CA 1R0XA 4ML3A 1W5AA 1KOGA 4EPVA 4CDRA 3GEGA 1Z2AA 3BDVA 4GWKA 5K6TA 4UHDA 4JX9A 5EPEA 1XF9A 4R1SA 1DCKA 1LRKA 1T1SA 1TX4B 1EXWA 2YZ7A 3FNFA 4NH0A 4ROSA 4Z8YA 5ALHA 1CQPA 5EJ4A 4U8HA 2O8EA 1LKZA 2YNMD 3BB4A 4Z0TA 4PWZA 4HRYA 4YUWA 3AUYA 4YREA 3H2BA 2UXBB 1RPTA 1T6BY 2H3HA 2O23A 1OB2A 5K3FB 3AVUA 4ZJYA 3E5NA 2QYSA 4KSCA 4YRJA 1EWRA 1UDWA 2IEYA 2KPOA 1DXHA 3DBLA 3GDFA 3WYNA 4J6FA 3SC3A 1W5SA 2WICA 5D1NA 4AJKA 2GZHA 3NNNA 4WKOA 1Y3HA 1FYXA 1L1RA 5A62A 3AJEA 5FUXA 3ZKAA 2RBEA 1YCGA 4WOPA 1RQLA 2B2CA 1K6MA 4GKKB 1NZFA 1ZL2A 1E18A 2XE8A 4TZ6A 4D46A 1LEHA 4IFBA 1NLYA 2V5UA 3OPXA 3DKPA 3VPGA 4DNFA 4IIJF 1XP8A 3H0CA 5CFPA 1U9JA 4XUCA 2R65A 4Z9YA 2A33A 2X8JB 5AW5A 1LLQA 1RYHA 3TNLA 5CG1A 1IK6A 2UAGA 3FPFA 3ZQ4A 1NLZA 4FKMA 1GPDG 1T8TA 4RUKA 3SVTA 1CF9A 2B0CA 4L76A 1WB6A 4LNUB 5C46F 1A5ZA 4N8EA 5KNCH 1U65A 2QD3A 2W2LD 4X95A 3TR0A 3UMVA 3H3XA 4B31A 2A4MA 5LA6F 5IVPA 1WVGA 3CUVA 3IESA 2YFHA 2J4CA 4AP6A 4IDOA 4F2GA 2VXOA 5C4MA 1O89A 2E2WA 2PU5A 2GJKA 3SX2A 3VX4A 2O52A 1JFTA 4CXMA 5EP1A 1I3MA 4K7JA 4CCSA 4LZJA 4RJLA 1EGVB 3TECE 1IXZA 4M1ZA 5FBHA 4HDNA 5KTKA 5DBHX 4AKTA 4EA9A 5BO5A 2CNWA 2WJWA 4ZI5A 2IZZA 1SUBA 2YRFA 1WZCA 4C76A 2P75A 4C7JA 4CLHA 1PL7A 2A6PA 4CL8A 4O2AA 2ECQA 2XNDD 3BTUA 1O0CA 1UXJA 1J8QA 3DLPX 2BBSA 4Y3UA 2B99A 3IB3A 3HDTA 2GAFA 3PFNA 3IA2A 5BV2P 2VF5X 4MHTA 1L9KA 3UJNA 3VAZA 3LC1O 2P77A 3FPSA 4TT3A 3OQOA 3VDXA 2EJWA 4L78A 1U0RA 2QRZA 4WL0A 4YP5A 2VTBB 1L3CA 1PGPA 4RC9A 3TMYA 5ADUS 3CR7A 2CNLA 4EEZA 4HJXA 1WD7A 2ETXA 1VIDA 2Z2KA 2OMEA 5DM60 5IWCA 1JR3D 2E9SA 2GEDA 2I2WA 3TE7A 2IYVA 4AK9A 2IYXA 4JU8A 3IP5A 4Y1RA 5K0ZA 3B2QA 1RQNA 4GX0A 4QU0A 3GCXA 1F5NA 4XM2A 3UXMA 1JU3A 1YH3A 1RHMA 2QLNA 1DO8A 5ADVA 2H63A 4X8OA 2RAFA 4IDCA 1L8QA 1YUMA 2A84A 3FVVA 2J0EA 2KW5A 1BCSA 4QTUB 1OX6A 3EG9A 4I1VA 2C8JA 3MMPA 2PVSA 1PJBA 2P4SA 4RQTA 5I7AA 1A5BB 3G2HA 3HB1A 2I2XB 2F55A 1W35A 4IXMA 3U31A 4FIDA 2LV8A 2DJ5A 1WMBA 2R79A 2PQ6A 3WGTA 4KUEA 2MYUA 2HA5A 4ID3A 4Y9UA 4BASA 4IL5A 2ZVDA 4NAHA 1E1CA 4K87A 4GQIA 1HZZC 3FLEA 4P2GA 4YAFA 3RSGA 5JATA 2QM0A 3ND7A 3QGMA 4QUBA 4LIPD 3ZJUA 2FZWA 3H1FA 5HXAA 5SY4A 2G08A 4YHHB 2DGDA 4O4HF 5PNTA 1NXXA 4TN5A 2DLNA 3TBKA 3TGLA 1M75A 2HJ9A 1NUAA 4Y2RA 4D97A 1UPCA 1DADA 1P1IA 5AKJA 4A1FA 1CHDA 4ZYYA 1I3LA 1V9LA 1WHTA 2NTNA 3FMIA 1CNEA 2VRBA 3OE7A 3K8ZA 3L6OO 2ZSUA 3CH7A 5LOVB 4L3VA 4H16A 2JVJA 1NAHA 3OUZA 4WCFB 5FKJA 1RKVA 2P6PA 3E5MA 2BKLA 3MEQA 2JHGA 4CG0A 1D09A 5EWJB 4AL4A 3IODA 5FI1B 5ILQA 1O7JA 1R8YA 4U1RA 7AT1A 5FYDA 2WPNA 1JKMA 2F4NA 4DEXA 3EQ2A 3B6IA 3PNMA 2D74A 1Q3TA 2DP4E 4RZSA 1W85B 5EP3A 4B8YA 1K8XB 4MPJA 4R1NA 1LPMA 2O6HA 3DAFA 3NHYA 3RHZA 2R00A 1DBVO 1DMRA 1PUJA 4QBGB 1NFQA 3LWDA 1AK1A 2LCIA 1VE9A 3NVDA 4NZZA 3UH1A 2NUTA 1KZYC 2HYDA 1HYHA 1C4OA 3KSMA 3NWEA 5KSZA 4NBRA 1UJBA 4Q7KA 5E9JA 2PUGA 2NTVA 3GEPA 4PQGA 1KJNA 2OLKA 5JQGF 3KD3A 4KREA 3D02A 1A9ZA 2QN1A 2ZXEA 3FUVA 3SLGA 4PG4A 2ZAOA 3ZE6A 1U3TA 2JFBA 4NKRA 4Y1EA 1ECGA 3LFUA 1DKOA 2QXUA 4RS3A 4XLZA 4YCJA 4HWPA 4OHZA 2UYOA 2ODNA 1KAMA 3NANA 2WJ3A 3KZVA 3T94A 1A72A 1FBNA 1WDKA 4FT4A 1A69A 4UFNA 3U39A 5I9IA 4S12A 2WTUA 2YVKA 2IHNA 3RODA 4TXHA 4BB0A 2OGSA 4R3NA 1J23A 3FOCA 2JAQA 4MIEA 2W6JD 2Y6VA 1PK8A 4OM8A 1A1VA 3A36A 4HQ6A 3O8NA 1OCEA 1EX7A 3KQLA 4QJBA 4V02A 4OHKA 3ANTA 1A9SA 1ECJA 2XMDA 2YNMA 3HYTA 5L4SA 1IOLA 1CEQA 1BS1A 2VF7A 3R7FA 1KH3A 3EGIA 3KZOA 2FF5A 5CT6A 5FADA 1BHO1 3P5SA 3PHBE 4TKUA 3TQRA 4NMMA 2F90A 2INGX 3KKZA 3WGHA 2PX2A 3IJEB 2BEVA 2P62A 3DKVA 1KC1A 1JEQB 1M5UA 3DWGA 3AU8A 3G89A 4HEA1 2CKDA 3GP5A 4QQFA 3PHJA 3TKAA 2UYGA 1J1IA 3CGGA 2LBPA 2P9BA 3KEMA 1P2SA 2BF7A 2O7NA 2V7EA 2ZUCA 3CLKA 4K9RA 4RACA 2AEJA 4E5SA 4GKBA 1DIOB 2PO5A 1VRWA 3AVVA 4TWBA 2XUPA 3IQGX 2AWNA 4E94A 4MP6A 4EW3A 4BFWA 3JQFA 2DWUA 2E6UX 5TF4A 4MB2A 1DARA 3EGCA 5AK4A 2BMFA 5F1KA 5BRJA 1F8UA 1TU3A 2I3ZA 4B5KA 4RJ2A 1GNRA 4WOBA 5JBIA 1QZZA 4ND8B 1UC5B 3OECA 1FVFA 3AXSA 5J2TF 4FW8A 1EESA 2NACA 4L4RA 4LV8B 1P39A 3AMVA 3SQLA 4K2HA 1GZUA 3TXXA 3W8RA 3U37A 3UJ8A 2PK3A 3EULA 2QZ4A 3VZRA 3QM1A 1KYXA 1AF4A 1BDBA 4DLRA 1YS6A 4N41A 1NE7A 2GBLC 1T1EA 2Z8YM 4O2BA 2ZS7A 2CB0A 1NVBA 3IQZA 2DFDA 2SKDA 3NDPA 4NDZA 4C30A 4ZEVA 2LCFA 2PLFA 2C5AA 1F0KA 2RC5A 3ZH9B 2IOYA 5AHKA 2COKA 5C52B 1BD3A 2P65A 1KJ8A 3RUDA 3ULKA 1HL7A 1IDN1 2EP5A 4BLWA 5L4LA 3AQIA 2FQQA 1EFHA 3QYFA 1PUIA 4IWYA 3VPCA 3VTFA 2EL9A 1GPKA 5C81A 4DT1A 3HVKA 3KP1A 3R6DA 4GZ6A 4FZVA 4Q3CA 2ZR0A 5TS3A 1VCOA 3QMPA 2LXNA 1REQB 4MVJP 3V4ZA 5KTYA 2H5EA 4J4TA 4P54A 1TA4A 3OZGA 1QAQA 3JYQA 1X1EA 2NZUG 1JMYA 3JQ9C 1JU4A 4YJGB 4DMKA 3C6ZA 2G72A 3U1BA 2WNSA 4DCVA 1BWPA 1QHEA 1ISPA 3DJYA 3LT2A 1XRQA 4EG5A 1WUJS 5HZHA 3IOEA 4C6HA 2Q1TA 2FUG6 1SCDA 3F3YA 4GX5A 4AIIA 1MX1A 2GCPA 3JV7A 5F7JA 3ROFA 3A37A 4U7FA 3BG5A 3EFOA 3TNJA 1QMPA 1T3HA 1QBGA 3C16C 5PGMA 5IUNC 4PX3A 4CMCA 1VRVA 2FPOA 3HNOA 3HP7A 1VFPA 3KTAB 5I4KA 2PCLA 1JFFB 4PICA 3HSYA 1D03A 3HUDA 2Z6AA 2Z5VA 3D3KA 3GNQA 3M7IA 3B3AA 1GL6A 4JDUA 2NNWB 3GY0A 4Q1VA 2PFSA 3O4IA 2MHCA 2JL1A 4NBWA 3JRXA 4IICA 1R0YA 2JFXA 3TLAA 4MRMB 2VHTA 2IUTA 4EJFA 1WKCA 4HZUA 4GHWA 2WVAA 1MG0A 3O4FA 5E4YA 2WJHA 5AT1A 4OHWA 3EF0A 1UEJA 4PZZA 1WV1A 4N9WA 1T6XA 4Z4EA 3M1LA 4ZODA 1E2QA 1JHAA 1RP1A 1XGKA 4PFKA 3U7IA 3CR8A 4UTPA 2PAAA 3O4HA 3JYNA 1MVNA 3BQ9A 4FC7A 4R7TA 3HU2A 5BXYA 4MQBA 2QV7A 1DBWA 3AUAA 1A8SA 2ZBGA 3DMPA 1ORDA 5T7BA 3OLVA 1EDBA 1XMOB 3C43A 1SXJC 4X7BA 1RM4A 1YJXA 2O8EB 3QLJA 1JECA 3W8DA 1VI2A 1JXOA 3QVOA 2C2GA 3RD5A 4YJFB 5L7TA 1Y6FA 3G8YA 3AHJA 4E5KA 1O5TA 3VZBA 3SGLA 4CG1A 2CXPA 4IFIA 5EGNA 3R3VA 2WUGA 4XPIB 3SK0A 4RTSA 5ALTA 2PL9A 3HFGA 2QTBA 4TM8A 1GFWA 1IZZA 3EIFA 4GF5A 3DE1X 5CA0F 4BV3A 1PBTA 2IP4A 3QENA 2IYOA 3A31A 2QRHA 3JATB 2GCEA 4FEGA 1FLNA 4REOA 1T10A 3D0KA 3JU3A 2ES4A 2EGUA 2ANCA 2IF2A 2NO6A 5TPZA 3V9AA 2AK2A 3C5EA 3SR4A 3ZJ4A 4GGMX 5IT4A 3F5FA 1GARA 5JCOC 3W5JA 5D3MA 4G97A 2GZ3A 2PGJA 4KQGA 5DYTA 3S7TA 2X15A 1UBCA 3OAAA 1L1FA 4TLBA 4AJNA 4KQFA 3TX6A 3MAJA 1WLYA 2J59A 1Y3CE 1R50A 2C4KA 1I0ZA 3PFHA 4IZ6A 3BHMA 4F72A 5KPDA 5GIOE 3R74A 2W6CX 3WLSA 3DL4A 4E6PA 4Y1GA 3GP8A 2VUIB 3UOWA 2IBTA 1W87A 2J07A 2RD2A 1VQ1A 2OV3A 5WRFA 3PLNA 2Q29A 3SX0A 2RCNA 4E0BA 2ZGVA 4F7DA 3FGZA 2AH5A 1RZRA 4G8DA 5EJAA 1F2TA 2ST1A 3DE5X 1V4VA 3I8SA 3U1VA 1T9CA 3O1HB 3LCJA 4JNCA 1MKYA 4TM7A 1HDIA 5LBIA 3KWLA 4NYIQ 3L0SA 1I14A 3D4NA 4EWLA 4F2DA 2V65A 4BJ1A 1C1DA 3TI7A 4DXAA 1IC6A 2Q2NA 1VPEA 3PUIA 2PNJA 3DPUA 1GU0A 3AM5A 3I9JA 1MQAA 3DE3X 4H7DA 3B7GA 1XAIA 3AGQA 1U3WA 3C7KA 4JGIA 3LLUA 5D7BA 2HU2A 5KCZA 1WNFA 4A5SA 3REOA 4D3YA 1QVRA 2GCNA 3INNA 4UTRA 3TAUA 2R62A 3I2HA 1ML3A 4CLRA 2R7KA 1QUEA 4K05A 4DR7B 1QF6A 1E2IA 1FJ2A 2QP9X 4K9QA 4MWSA 1QIDA 2GA9A 2VIIA 2D1QA 4OYHA 3VU8A 4KQEA 2F8TA 4TMVA 1XQ9A 2J41A 2IWHA 3ILXA 2QD1A 4LX0A 2FPKA 2DPYA 3ECAA 4Z86A 4L6IA 1ITZA 1OKKD 3V1MA 2WHXA 2C8KA 3MD0A 2O0JA 1XCBA 1KVQA 4RA6B 4UEJA 3ZU5A 4AJEA 4O59O 1W4LA 3AH8A 1LDMA 3CF2A 1UKAA 5BSUA 3WGMA 1I9GA 4BJ3A 2ACWA 3CSDA 3NP7A 4NS1A 4TTJA 4A9AA 2P78A 2B20A 1A88A 3PC7A 4A2WA 3MILA 3U2QA 4AJ4A 1DOZA 1ABBA 2XUAA 2VAWA 3EGXA 4Z2AA 1GPUA 1PFKA 3ONNA 4O08A 4BNJA 3OBBA 2FE4A 4EDHA 4H0FA 2J09A 2HTEA 2JLCA 1ZDMA 5F4BA 5K8LA 2ZYAA 1SXPA 2GXAA 4RF5A 1RAHA 4RZUA 4D9MA 4P84A 1G2QA 1O97D 1RPZA 2OYCA 4ZO4A 4FB4A 3V6LA 3NIDB 1M2JA 2VWQA 4AIRA 3A05A 3VR4A 5C8VA 2PN1A 2YMQA 1TEXA 2D7CA 3SAJA 1P2GA 2VP5A 3HRKA 4Q1EA 5DISB 2GX6A 2Z8YA 3BAFA 4PO8A 1V1RA 1OH5A 4LJ6A 4TT3D 5LXTA 2C97A 4GVLA 3TRFA 3PIDA 2HJHA 3MHTA 3S7ZA 2IY8A 1UM9A 2QJFA 3V8PA 3L1VA 2WM9B 3AEKB 5G0TA 1TU0A 2XXAB 3ENKA 4B4OA 1M1YA 1KPGA 1O6CA 3EWAA 4D8UA 1IXKA 4MRMA 4R01A 2JFVA 4UTOA 2OC9A 2F9FA 2ECPA 3MWYW 5F52A 2CMFA 1UBGA 3MS2A 3PE3A 4YBRA 1M33A 1GL7A 1HYBA 1ES9A 1RC1A 1ECPA 2FPUA 4K1XA 1N2XA 3ASYA 3PT9A 4Z9XA 1EUYA 1O94D 4BUZA 2FN3A 2ZYUX 3SVLA 3B6KA 3HJFA 4HUJA 3KD2A 3BN3A 3NR2A 2WYVA 1IRXA 4LUCA 1I1QB 1XTJA 3IB6A 3O26A 3H2GA 3SBOA 4BZZA 2CZCA 1RLIA 4W5QA 1UZMA 1FTWA 3COVA 2VQSA 3LF2A 1CP3A 4R9UC 4I1PA 3IPLA 2YC2C 4QWWA 1TF7A 3HPQA 4XAQA 3ZDYB 1WMEA 2DF8A 4E2WA 2Z9CA 3ZDBA 1IMOA 4NABA 4YNBA 5EWMB 3ZHCA 4D9JA 1MB2A 5LZ8A 1QP4A 4XDYA 3WL4A 1XRLA 2HFKA 3LZCA 4X1KB 2H52A 3HGQA 4B8WA 4BE7B 4DZRA 1YS9A 2Q0HA 3LSTA 3LMKA 1WZIA 3GLGE 1CUCA 1IY8A 2DFNA 2OGUA 4RJJA 2D0PB 3ME5A 4J9VA 5J63A 4EHAA 4ZHQF 4QOGA 5CLIA 3NBUA 5FNVA 1L7AA 2FSFA 2MINB 1G1AA 1HEYA 3BD9A 3IT2A 1SGWA 4I14A 4R69A 2Z3VA 1N33B 6GPBA 4DV3B 3EZGA 1XHLA 4IF4A 4RULA 1E0DA 2PKEA 1DG1G 2BFAA 1VE5A 4F04A 2OCLA 3AOGA 3Q7RA 4UHBA 1BFUA 2P11A 1DIBA 1SHTX 2AOWA 1IB0A 4RNCA 1XCGB 2A67A 4MPRA 1EP2B 4KLCA 2BMAA 5CVJA 5E1MA 1LSUA 1E2JA 4IG4A 5CD1A 4ONEA 1G59A 1HC7A 3ETCA 1HSOA 1QX3A 2HMVA 2I0FA 4I8DA 5BVGA 1YACA 2FLVA 1L7MA 4G56A 3QVGA 1UT8A 4LC1A 2GS9A 3HFSA 4DWVA 4BB5A 4HWGA 4DBLE 3MSCA 4UUOA 2I4LA 3EXFB 4RK1A 1YDMA 3L7IA 4H7JA 4FMPA 2Z9DA 3PGMA 3EAQA 2UYQA 1NW4A 2BY4A 2EBWA 3FPKA 4LRXA 5K0CA 2PV7A 2HIHA 3I42A 3NS7A 2G1KA 1QDLB 3QTBA 4PCAA 1KE1A 4DZTA 4XWKA 5LU9A 2XADA 3QPVA 2QU8A 2ZRDA 3D6MA 4M60A 2DFPA 1R0WA 2AT1A 3N39C 4K6OA 3NBZC 4QGBA 3USCS 5KOHA 2F62A 1E7WA 2HF2A 1BVYF 4LJ7A 5I7OA 4GM1A 3QBVA 4W6ZA 3LXRA 4IS3A 3RS5A 3IBYA 3W78A 3OMXA 4B7XA 4PLHA 2QX8A 4O02B 3TW8B 4WK2B 4O5AA 1Z37A 2J0UB 4LA4A 2DY0A 3HDGA 3TEFA 1OZHA 3HFRA 2K7ZA 3QHAA 1NGSA 2J5RA 3GLFB 3CC8A 1EB9A 2MWMA 1O6FA 2C00A 2PGIA 1XAGA 4QYTA 5E3IA 4BRWA 4F5WA 4F2WA 1XMQB 1YL7A 2KI5A 3L40A 5BN5B 3D7MA 4LHWA 3VUFA 3QXCA 5DIFA 1CUXA 3BM5A 3BC1A 4YEDA 4DREA 3CLSC 1BE1A 1HG1A 3MZ0A 5KHAA 2I76A 5ECGC 3EB9A 3DNPA 3Q8MA 1D9XA 2ZYVX 2GBLA 5FLYA 1S4QA 1T29A 2FH5B 4UDYX 5HJ2A 3RYIA 3FMPB 2XYGA 5EJ7A 1G7SA 1ZM9A 3A6HA 1CUEA 1GA4A 5TVKA 3IIEA 1XJWA 4MYUA 4Q9KA 3WDLA 5HUJA 1QDUA 3OP1A 4KKVA 2Y1EA 4F6CA 4Z0HO 2BSXA 2QMOA 3N8HA 3TM4A 3IP8A 5EQJB 4LK2A 1XK6A 1DC6A 2ZG6A 3OT4A 4ZOCA 3WGKA 4BVLA 1QRSA 1JR6A 2IKQA 3SSAA 5LJIA 2IE0A 4E88A 1SHUX 2XAAA 2RJOA 4OD0A 1UZUA 2BJWA 2QUKA 4QGGA 4UBIA 3SYTA 5HZGA 4UNPA 3UO8B 5AR1A 4W82A 1ZRMA 1VCHA 4BN5A 4EMTA 1XCLA 2UUPA 4LYAA 3TD9A 4N6GA 1DCTA 3S2GA 4FMCB 2IYEA 2J6BA 2WZQA 3WLKX 4YMGA 1QH1A 4YCMA 4D0SA 1FS5A 3PXXA 1WXWA 2IT1A 4WV3A 1HLPA 3FOFC 3E9EA 2PZLA 1IXYA 1V6SA 2GUWA 3LBFA 4QZVA 4NRDA 4JDPA 1KVUA 4GL2A 4CCWA 4QT4A 2XWSA 4YRLA 3TUZC 3I2IA 4DANA 1B6GA 1RWBA 4G81A 5ER6A 1V3QE 5K8IA 2BFBB 1Z8FA 3S2ZA 3PQDA 1S8OA 4G5OA 3BOSA 4JLKA 4BO2A 1CE8B 3GCGA 1BTOA 4W1RA 2NQTA 1Q7EA 5CYGA 2J9YB 4OHRA 1P5JA 3K4PA 4HY3A 3V8BA 1GSHA 3HWWA 3JR7A 2VQ6A 4NMHA 4U2DA 1K0FA 1OHHA 5DNAA 3QA3E 3ZGNA 3ZDQA 1E20A 3LDHA 5ES4B 4YUAA 4NZOA 5BQ3A 2HWKA 2VHWA 4HWOA 1G5QA 3IRVA 2X14A 1WTCA 1HURA 3O03A 3KJZA 4TT8A 2OHFA 2JJ1D 3DZIA 4UHJA 1AV6A 4IVQA 1JFSA 4DB2A 1VG8A 3FFAA 4LRQA 1Q74A 4X20B 4UAUA 1JB1A 1V2HE 4MW0A 4B73A 1CEYA 4MRVA 4IKOA 1C4KA 3E03A 3OCVA 3SC2A 3OU2A 3P97A 1QYRA 1VG0B 2P27A 3HEBA 4KN5A 1I7DA 1UBUS 1YHNA 5LFAA 1DKMA 5DEOA 1NXVA 1YBFA 2VYVA 1R0KA 4M0LA 4X41A 5DGHA 4O4JA 4JVSB 4O2BB 4C21A 2I1WA 2YV4A 5FTWA 5KAMA 4QE3A 4Q1AA 1E77A 4O4LF 5AFSA 4FGSA 3T8YA 4A0HA 2P1DA 5ICGA 3ZN2A 3HBNA 5FPYA 3KOZA 4CMEC 1TB4A 2BEUA 2QE7A 3A1CA 3CSUA 5FYQA 2ETVA 5JLJA 4NR0A 1CQJA 1HF3A 1K7SN 2QDXA 3ZNPA 1C80A 1O2DA 2HRQA 4HTAA 4OOFA 2ZJBA 4RANA 1Y4UA 1QQ6A 3U4IA 4RW0A 3IA7A 3T0FA 3CVUA 1YS4A 1H1LB 2XA2A 4AMUA 3HSSA 3MJHA 1GPMA 1G42A 4OQFA 5KNDD 5CXSA 1ZGCA 2R4QA 5CJ2A 4EVSA 1AC5A 4LV5B 4NJMA 2F8SA 1P72A 3SX4A 2V7GA 1Z4OA 4IGAA 4LNAA 4RWZA 4ZJPA 4LFBB 2Y27A 1Z2NX 3W9BA 1U8FO 3HKEB 2XPCA 5JPDA 5FPKA 1KWKA 4G9GA 4HHEA 3H1BA 1USIA 4F2HA 3MJ4A 2ZRJA 4NH4A 4CV3A 1SD5A 3R7WA 4BKQA 4ASUD 2YOHA 1EUQA 3FRHA 2ISCA 2IW3A 1ZICA 1AKNA 4HDRB 3W77A 3F46A 1YA8A 3EE6A 5CGQB 1WBJB 1BWRA 2ZRMA 1C3JA 4LX8A 2DHEA 2XUFA 3A9TA 3IV9A 1JDBB 2FWRA 3AX6A 4JLMA 4LBYA 3UW1A 5BPFA 5AI5A 4EG6A 4KFTA 1Q0LA 1ZSNA 4GM4A 2V3WA 1NRXA 3HY3A 4HYYA 3TLJA 4PG8A 3DVAB 3CF6R 2XCTB 1MO5A 4YQFA 4JX8A 1M0TA 5GONA 3TXAA 2EWMA 2HPZA 2JIOA 3F74A 4CHGA 2LNDA 5HRAA 2RGCA 1YZVA 4OH7A 4WN9B 1WQ1R 2FVXA 2MTBA 1U9ZA 5SYNA 3TRDA 1DEKA 2IXDA 4F4IA 4LISA 4WW0A 2R6DA 2IEDA 4R1TA 2ZWMA 2GK6A 3TD2A 3WADA 3DPIA 1CJKC 3LHDA 5JD3A 3TD6A 4BFTA 2OQRA 4JQYA 3RYFB 3O6VA 4Y2SA 2G4LA 2I6QA 4ARVA 2F3SA 3A4NA 1IN5A 2ARKA 1CJVC 1GGNA 5JFGA 3MGKA 4HWTA 4WECA 1Y8RB 4KACA 1RDFA 1SG0A 1G8AA 3AJDA 1NDHA 1JG4A 3I0MA 4KGVA 3A6EA 4NOLA 1GXSB 1DBQA 3N8DA 5BNTA 4LCJA 2OK8A 4NZNA 4YRDA 2C7GA 4E3WA 4F8EA 1D2NA 2XYVA 4EG3A 3BHJA 4HK4A 4U2BA 4URXR 4MQ5A 5K0TA 4X20A 3AVPA 3LDAA 5F3RA 1Z5GA 4B0OA 1ULSA 2A14A 1NA5A 2PT6A 2YOFA 3BIJA 3PCXA 5FD8A 5LMUB 1JNYA 5C7IO 3D7NA 4U9IS 3EPRA 3W3AA 5H1YA 4X1KA 3MLAA 2RK3A 1SD2A 2P8SA 1YMUA 1D4OA 5B2ZA 3OEWA 1GFZA 2CLOB 3ZW8A 2OGZA 3SZLA 3VH1A 4HPXB 4XTCS 1H6BA 1RWOA 4MICA 1J0AA 2PD3A 1QG0A 4IILA 5AM1A 2YWCA 2N3ZA 2Y0DA 4AO7A 1S4MA 4J0CA 1X9IA 2O48X 3HB9A 4FBMA 2RH8A 1FFDA 1LWOA 2O2JA 3MLBA 3ER8A 4DEYA 4HVTA 5A03A 2DHQA 1AF7A 1B2LA 2FWIA 4Q01A 3NVKI 5GV8A 1J49A 1T2VA 2P9ZA 1E6CA 3NIBA 4JL6A 5FTLA 3ES9A 3ZCVA 1P3JA 2AXEA 2VA9A 1YK0A 4N5DA 5EUCA 2H7CA 1GV1A 1L4BA 4L4ZA 3V48A 3WWOA 4KHPB 4C4YA 3WYEA 1XMXA 1XKQA 1IWBB 2O5EA 2OG2A 4LE0A 1IM2A 4K28A 2FLWA 1V0JA 4TWJA 4RADA 4MP3A 5BMVA 2ZK7A 5CFMA 1XEAA 2VSYA 5ECDA 4P3KA 2BR4A 4U9HS 3DFKA 4WRRA 4CG3A 2O2IA 3WRXC 2OV6A 3KJEA 3WX0A 1J2EA 3DHVA 5BWOA 5FPPA 1EQ2A 3RREA 2FZEA 1JT2A 3D8RA 4RX1A 5B36A 1ORRA 2D5AA 3ZOZA 3MRVA 1P81A 1Q0HA 2YV1A 3HJAA 5C35A 3I8OA 1V1RB 3T4UA 2P9CA 1COWA 1Y4SA 2PLWA 3IVAA 1ORHA 4N47A 5EQTA 5BT8A 1J5EB 3U60B 2IHKA 2W2QA 3PCRB 4R9RA 2GNAA 2A9RA 1J0CA 2YH2A 4E5VA 3CS3A 2QT9A 4ENPA 4WOCA 1PX2A 3K1JA 3ZW9A 3GQBB 3CVVA 3U7HB 1T26A 1AX9A 1NV9A 2NO9A 2ORIA 2Q2VA 2OHVA 3O3CA 3OJXA 4JODA 3PGKA 4HWKA 5ALGA 3RLFA 3RT1A 3ZK7A 2BGWA 5C31A 3GHYA 1VPDA 2Q5QA 3NI2A 4AYXA 3KXDA 1U98A 1MB4A 3BXXA 3VGPA 1Q17A 1M1UA 3OFKA 3RBZA 1NMYA 1RI5A 4RMGA 4S2UA 1K7EB 2Z9BA 3THXA 1Z4KA 3A4MA 3PENA 4LCBA 3LX4A 2DFKB 2IC5A 2O1SA 4HFNA 3SXJA 3NFRA 4KMRA 4X94A 3COJA 2NZ2A 3GPLA 4GOMD 5ISMA 3RWOA 3DO6A 1JXAA 4QYIB 3U61B 3UMCA 5CDFE 1XEWX 5IH3A 2AC7A 6NULA 2FX5A 3TZBA 5LYJF 1IZ8A 3M9WA 4X65B 1LX6A 5JJCA 1CEXA 1DKNA 3EXFA 4J8PA 4BNHA 4ZPXA 1PFGA 4XSVA 4AC9A 1TUEA 4XH9B 4YI5A 3IAEA 1X7ZB 1ZRSA 2JJ2D 4JC5A 1JYSA 2BPOA 3QE2A 2E4XA 3SQOA 2AD1A 1KBOA 2P4QA 4KMOA 3V00A 3NWPA 4MV3A 4ZA2A 1SC6A 4WY5A 4G25A 4ISCA 4DHEA 3ZVNA 3AF0A 3ECSA 2WWIA 3FSGD 4YRQA 4YV0A 5AUOB 3C97A 3UG7A 2FGJA 1RBZA 5AHWA 1NJGA 3BCRA 1ZGHA 2CLHB 5BQFA 1FFBA 1ZVVA 1Z73A 3FX2A 3H5LA 4Z1OA 2PM8A 1NT2A 2AW3A 1D2GA 1OPRA 2D1RA 1Y6RA 5DEIA 4UE3S 3NVAA 3TB4A 3TCNA 3NT4A 2B4TO 1RAAA 1GCGA 1LD3A 1BS2A 1F17A 2R8OA 3ET4A 5JSKA 1A76A 1YE5A 4U9UA 1A4IA 1PS0A 3WNBA 5LB2A 4QPZA 4R2MA 3SZGA 4XWAA 3INGA 4V1CI 1P4RA 4F7WA 1DJOA 4JYZA 3IDSA 4JOCA 2GKOA 1UBTS 1RKXA 1GG5A 1QVVA 3GFBA 4LGCA 5D2CA 4ER7A 5ALPA 5EESA 3DDSA 4IJVA 1HLFA 2GPYA 2CUKA 4XOUA 4EDFA 1TQ4A 4RD1A 3PWTA 4G8JA 3OPYB 1HEUA 1CUHA 1YVEI 2Y1KA 4G5RA 3RC2A 1LF0A 3CURA 4QUKA 3LBNA 4L02A 2WE7A 1AD2A 4RIEA 3BTSA 5KSPA 2DUUA 3IVGA 3FM9A 3NKVA 4TTQA 3OEHD 3OKFA 3Q3CA 1RJDA 1RT9A 3L6DA 1AKVA 4H4EA 2EZ4A 3B3JA 3B20A 2V0NA 4LQLA 5FL3A 3TIIA 5JOQA 2YNMC 3M4NA 2PUVA 2W2XA 1PQYA 1T3TA 1NZJA 1SOMA 5H5JA 2B1RA 1QV7A 4M1OA 3RC3A 3MFYA 3CLSD 4I5FA 5ALZA 3ZCRA 2PUTA 2BHTA 1NY5A 1PGJA 3A6JA 1LBSA 3VR2D 1OD6A 1UK7A 4F46A 1ZCAA 3T61A 4AM8A 2C2HA 5ICEA 2ZUEA 2DHDA 1P19A 2O7SA 1CQIA 3T1QA 5KO2A 5AVTA 1E62A 4Q34A 4LOHA 1R0RE 2W43A 3LLSA 3ADBA 1W1WA 1CRLA 1RWPA 3BB1A 2CSXA 4KYIB 4M8KA 1W4RA 2I2FA 3K15A 1FMJA 1N6LA 2RBGA 5C8DA 2XRFA 4Q4AB 3RRFA 1DDOA 4JBWA 3UIEA 5HMMA 4LY0A 4FSHA 4DBZA 5I8PA 5KSOA 2XXAA 2VP4A 3UHPA 3CRZA 4UXHA 3CIFA 4TS9A 4AW9A 2NZVG 2XMRA 4XYBA 1M76A 2P7IA 3B12A 3FZGA 4M76B 2PZMA 3BB3A 5A5GA 1OIVA 1AG9A 1JR2A 1TD9A 3I9NA 5TGTA 3Q9NA 1CRWG 2C1XA 2QNRA 3BPSA 2CNDA 3ZNOA 4RCVA 4DCMA 2E4ZA 1YXMA 5BMVF 3LY7A 1R5JA 2EJVA 1L5MA 2YWHA 4CMIA 2W4MA 3KZKA 1MT3A 1L5KA 1NR5A 1NZDA 4HLNA 2VL7A 4M88A 4V0KA 1JVNA 3U3JA 1KDPA 3I6IA 3AFGA 3ICCA 2VC2B 4WXPA 1RIIA 3ZIDA 3AVOA 5JSZB 5JALA 1XXLA 1UBNA 3PJGA 1IZ0A 5EYPB 3WK8A 4YCSA 1YFKA 3JZFA 1UFVA 4HZGA 4PTYA 5GOZA 5IBQA 4EG1A 2X86A 4AWBA 1F8GA 1O5IA 1VCNA 3OU6A 4DLZA 5IABA 1NBME 1UXHA 3GRKA 4BFZA 1MOZA 4J0DA 1ONPA 1SVIA 4LYJA 2ERCA 4BOYA 2RG7A 4NCBA 4KIUA 1FDUA 2QSZA 5AW6A 2EFHB 3PUHA 1MC1A 2EOAA 4Q9JA 1AS3A 1TKBA 4HH1A 4M8IA 4JVMA 4MI9A 2PJRA 2B21A 3T7SA 1IJFA 3PZRA 4TXMA 4KR0A 4B6JA 3MXOA 5BN4A 3VR6D 3G0HA 4RF2A 2ANBA 4C6SA 2IYPA 3ZD9A 3ZHOA 4N12A 2FMUA 1MU0A 4NENA 1C7QA 2QX7A 1AQNA 1SIWA 5FPHA 4L51A 5G0VA 5DU2A 4BO8A 2YW2A 1NUUA 4DR2B 1GGVA 2RI1A 3LF1A 4OHPA 3CO0S 5DXJA 1CIJA 1SVWA 5EFZA 3RI3A 1KSJA 4MKFA 1SK9A 2FP4A 4PLFA 3TQQA 4C04A 3LA8A 3U7QB 2Y9MB 2WYHA 1A1SA 1AN0A 1EBUA 2B5OA 2P69A 3LWNA 4AJIA 1MGOA 3O1IC 4PSDA 4F4HA 2LRHA 4I50B 3KOUA 3OZSA 3TJZA 2YN4A 1SB9A 3W4IA 2J3MA 2CBGA 1H4QA 5BR4A 3MC1A 5EERA 3W9UA 3MINB 4J2TA 4NCNA 2ZVJA 4FSXA 4E03A 4B84A 1YA6A 1NUQA 2QYTA 4RCYA 1FFEA 5D3KA 4UFPA 1GLGA 5JH7F 4ARUA 3E5HA 4RGQA 2H2FA 1JHPA 3CLRD 4MUJA 2PJUA 1B00A 5FUYA 5BUSA 5HF9A 3R7SA 2DYKA 3HUEA 1ODCA 2P2ZA 3KJFA 4DJAA 4EYOA 5C4GB 1J56A 5HR5A 5JDCA 2OBBA 3U3RA 4QQRA 1SUAA 2WYIA 3ZLUA 4KO2S 5HVNA 2X5XA 1SNYA 1SXJA 4IWXA 1M2OA 4TTRA 5J23A 1ORTA 1L0BA 1XEXB 1W52X 4H77A 4PZDA 5KTSA 3I53A 1DX4A 4QFMA 4ZMSA 5GAJA 5BW5A 1QGUB 1UWKA 1Z3IX 1IN4A 1X74A 1GUYA 4RPJA 3A8TA 1AMNA 1Z4NA 2VEOA 3H2KA 4NEHB 2PFKA 4JIMA 4IOKA 4X1YB 3IDQA 1DFGA 1SELA 3QTTA 5CH8A 2NZYA 2L0XA 4XPIA 4YJ2F 1G6KA 2PX3A 3A3KA 3A1WA 2NU8A 3AHFA 1U0FA 3R7WB 1QHGA 3DBLB 4JKOA 1M8FA 4ALJA 4EY5A 5CA0B 3U7JA 4V2UA 2XMBA 2EQ5A 2XUZA 4RM3A 3PKZA 4QJIA 1VKRA 3O3MB 4R3UC 4R51A 1FQJA 5DP1A 3SP1A 2OG1A 1UP6A 1I2DA 4CE6A 5JWHA 4ER5A 2QX4A 4BQFA 3W06A 5EWLA 3GEMA 4JZKA 4DMGA 4C6RA 2PRZA 1FXWA 3TKLA 2X0KA 4RHTA 2OZKA 2Z1DA 3C70A 2CXTA 3CHYA 4Q4JB 3TW6A 1A7AA 5C5EA 5JNWA 3UV7A 1A97A 1II8B 5K6AC 2YKGA 4PPGA 5DW0A 3UJCA 4S05A 1FFGA 2PH3A 4IX9A 1OZGA 4JT4A 1ZITA 1QFYA 2OAGA 4OJYA 5JSHA 4FHCA 1YA4A 3FY4A 1SC4A 3AUSA 4RFLA 1LQ2A 2OCBA 3I6ZA 3SF0A 2LIVA 3A6KA 3I34X 5A04A 2WD9A 2W6MA 4J75A 2VDOB 3I9OA 4TMZA 1T4MA 3W3AH 2ZITA 3VOSA 3FG9A 1K6EA 3MTAA 1M3SA 1YNSA 2Q21A 3OIYA 1WKBA 3FW1A 3GT4A 3TIVA 1DJMA 5D3ZA 3NORA 4HYEA 2PEZA 1UUFA 4ISBA 5L3ZA 4AJ9A 1E63A 1K06A 1NYQA 2GB4A 1HQKA 1KI8A 1NN5A 3FMVA 1K2WA 1WVIA 2M2IA 3GZJA 5LOVF 3K09A 2ZIGA 4U0JA 3H1PA 2CWWA 4YDHB 2YZMA 2IP2A 4YP1A 1J7KA 4KQIA 1VL8A 3LECA 1GUZA 4IEFB 2NLOA 5H3HA 3M1IA 3MRSA 4DWOA 4GQBA 2EX4A 2VPTA 1KY5A 1YR8A 4LBWA 1JKJA 5K2OA 1KKMA 3DDOA 3V8NA 2JGJA 2AEMA 4ICIA 5B1SA 3NOOA 3OX3A 3VISA 1P18A 4MYHA 1Q14A 3H9GA 4AXBA 2DH5A 2TYSB 2OAP1 2PV0A 3PXEA 4PHHA 2RGNA 5LA6A 3KUUA 1A9TA 1PJ8A 4ZIRA 2DTXA 3WIBA 1SXQA 4FNMA 4EHNA 3J80A 1QOQB 5JCZA 1EWTA 4MAMA 1NKVA 3NATA 3N2YA 4KPUA 4LMAA 4OSPA 3C8MA 2Q4RA 3V2GA 4EW1A 5HQ3A 5C8YB 3RS4A 1J06A 1REQA 2V5VA 3EH2A 3GZ4A 2A9VA 2ZQYA 4Y6PA 3OE5A 5HM8A 1HUQA 4KIWA 1I2AA 2OHXA 5I8WA 3GJ4A 2K4MA 4EY8A 3A25A 3ND6A 5BWMA 3HCAA 4CJXA 4I36A 3JTMA 3A1SA 1LW6E 2CZQA 3TG8A 4LDPA 4A91A 4US1R 1AO3A 4EPXA 5CVTA 5AVUA 1Z3CA 2BF4A 4EJSC 3E1GA 1XPRA 2VKTA 4BKPA 5CMLA 2Q5OA 4RDHA 3TXYA 2A5DA 3LWBA 5AKGA 1G8GA 3TH5A 3GMTA 3IUMA 3M9LA 3UK1A 4C4SA 2HA2A 2C9OA 4NICA 2WBLC 1GQSA 3WLPA 1JRLA 3OZAA 2JC3A 2DSNA 3A4VA 4GXQA 4MIKA 5FTKA 2ZIZA 4JI8B 3EYAA 1IZ9A 4E14A 4RZHA 5D51S 2V9PA 3BTOA 1WJGA 4OHXA 1TTHA 3HU3A 2B6HA 4K6GA 5E6UA 1Z9BA 2ZJFA 2IUYA 2DWCA 1G20B 1EFKA 1R8QA 4FEAA 3ZZ1A 4RTQA 1WY7A 4AMGA 2O5CA 1YQGA 3DL2A 4H9GA 3OX2A 4UXJA 3M5CA 3QUTA 9LDTA 2I78A 4I3FA 3O9MA 4ZVRA 5HKLA 1KSHA 3AR3A 2BRUA 2Y8EA 5LR6A 1R3UA 3G82C 4JQSA 2IH4A 1ZBQA 5A05A 2IA5A 1ISIA 4AZ0B 4BMOB 4H2DA 3BWMA 1EXNA 6LDHA 4IO0A 1DRKA 4RENA 4D8VA 4DRXB 1QYXA 2HIGA 4LTNA 3CINA 1TJ4A 1P7YA 1AS2A 3T3EA 1Q1ZA 3AKCA 5I5GA 1W9HA 4RL6A 5DRYA 1UDXA 3BDIA 3DNFA 3LI2A 4JP2A 5DOVA 1EVEA 2J3KA 5E9QA 2AXPA 5TMDA 4Z9AA 1NX6A 3UATA 2F3PA 5KQMA 3D4PA 3U6KA 1N7IA 4DLPA 3H9CA 3OHMA 5KC9A 4P36A 2C4TA 3VJRA 3NWBA 2PKRA 2RGUA 5LBUA 3U0BA 3BK2A 2Z08A 3HZRA 1CJSA 2B25A 3TVTA 1RMYA 2FXIA 3Q41A 2HK9A 4MV5A 1DAHA 5A06A 1UWVA 1KI7A 2PUAA 2FZCA 2G1UA 3L93A 1UPTA 3MGGA 3V1KA 4JBIA 4M9XA 4HX2A 5FEUA 3K8YA 1QO0A 4IH9A 3O8CA 3D3EA 1SEPA 2HFJA 4ASUA 8ADHA 1TFUA 4L8VA 3ZXIA 2IPXA 2YV5A 4Q02A 4FZJA 3EUFA 1GSIA 1ZU4A 3QFTA 4ZOLF 1BJKA 2GF0A 4A8JB 1E6EA 3UKDA 4AVYA 4H18A 2W8BA 3R0JA 4PCUA 3HY6A 1WZEA 4XD7A 2XE6A 1XRJA 1Z26A 3L8GA 1KH2A 4QQNA 4CLOA 1P7WA 2GA8A 3LO5A 4LOJA 2H18A 4Q4JA 3WNCA 3UB4A 4C0QC 1N7GA 3ZHYA 4TLLB 4YT5A 3EA0A 1H65A 2PKWA 4XDHA 1PTKA 4ZVUA 4BNXA 4ZZIA 4AN0A 1J0BA 3C41J 3PQ4A 5JXWA 1SXIA 5K3EA 3FF1A 4PR3A 4P4LA 4K0KB 4B45A 3V32A 3EXHC 1OPXA 1UF9A 3WOHA 4ZYVA 3C7DB 3GJYA 1BD4A 2DFTA 2CW5A 3OOEA 1A9XB 1UJNA 3WXBA 3V5NA 3H2ZA 2XOKA 1NRJB 2OEPA 2Z2XA 4TOIA 2FK7A 3WVNA 3ZD8A 2VK1A 1J21A 1JHUA 1OREA 1WU7A 4NV1A 3O0DA 4L0MA 2ODPA 3ZWBA 2UUAB 3IVMA 2WINI 4FZ3A 3IIMA 4GPBA 4JL5A 3HM2A 5EIXA 1HFEL 1MHPA 4R71A 2JCBA 3PFFA 4JBNA 4PNPA 5KMGB 3BZBA 3M6IA 1GRRA 4E13A 2FWNA 4EUEA 4CTMA 6YASA 2V4ZA 3JQEA 3L0CA 2JHCA 4YRFA 2CLMB 4B3RB 4TLCA 3O4VA 2VDVE 5DGCA 1DL5A 3QKRA 4AURA 1P7VA 3RWBA 3TPZA 1HRDA 1RIFA 5GOTA 1SQ5A 2BFPA 2BKVA 2FSUA 3K9HA 4IXTA 5BRNA 2X4GA 5A5EA 4JA0A 4CUZA 1AQUA 2C94A 3FGPA