4X0EA

Structure of m. tuberculosis nicotinate mono nucleotide adenylyltransferase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
195
structure length
192
Chain Sequence
RLGVMGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPWQKQVSAAEHRYLMTVIATASNPRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGYELRNEHITSLLGQLKDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKCRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mycobacterial nicotinate mononucleotide adenylyltransferase: structure, mechanism, and implications for drug discovery.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Probable nicotinate-nucleotide adenylyltransferase
total genus 51
structure length 192
sequence length 195
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4x0eA00
1QJCA 1T6ZA 3G5AA 3AKZA 2QTMA 1B6TA 1QU2A 1NUQA 5K0SA 1I6MA 1RQGA 3VGJA 2PFSA 4MW4A 3KT3A 3I05A 1COZA 3FIUA 1QRUA 1QRTA 3CLRD 1G59A 3MMXA 1MBZA 3CVXA 2CV0A 4ZCRA 4G6ZA 3SEQA 4CDNA 3AFHA 4Q93A 3CLSC 1EXDA 1WXGA 3N8HA 2A7XA 4OJMX 1WXFA 2PIDA 2D54A 3TZLA 2RD2A 4AQ7A 4CQNA 4XFDA 4XSVA 5FO1A 4MVCA 3CR8A 2PG3A 2WSIA 4EG1A 3PXUA 3N9IA 5IJXA 1J21A 1EFVA 1O94D 1R6TA 4NZPA 4MUIA 2E89A 1O95C 4PBTA 4KPUA 2A88A 1OD6A 4EG5A 1IHOA 1PG2A 3MLBA 2H2AA 4QRDA 1XNGA 1KH1A 3IUEA 3P0JA 4JZYA 1NP7A 4JFAA 1IH8A 3ZJUA 3SP1A 4MW0A 3NV7A 3CLSD 2EL7A 4I6EA 1KH3A 1O96A 3S3TA 1JMVA 3G6KA 2QJOA 5H16A 3FDXA 1BS2A 1NSYA 3IDFA 3U1VA 4H3SA 2Z09A 4MUKA 5HUJA 2WB2A 1N1DA 1MB2A 1P7PA 1R6XA 3N2YA 1JEEA 1J09A 5EKDA 3KT6A 5TEVA 2BTEA 1QQTA 2PZ8A 1T9GS 1GLNA 3H05A 5AHWA 3A05A 2DEUA 3HFJA 5K0TA 2YWCA 2YY5A 4MW5A 1XJQA 4DE5A 4EG8A 1MJHA 1WKBA 3LE8A 3H99A 1H3NA 4EG4A 3KFLA 5KHAA 3RHSA 3INNA 2IJGX 3VRHA 2B7LA 1H3EA 4K03A 4A91A 2E21A 1ZUNA 4MVYA 3IMCA 4MUJA 3ND5A 1N75A 4TS1A 3KT8A 2X3FA 1HYBA 4I6GA 3DLAA 5JBNA 1N2OA 2QJFA 3COYA 3COWA 3AG6A 2NZ2A 4MW9A 5J5AA 2HMAA 1J20A 3CA8A 2CYAA 1VBKA 1Q19A 3CVUA 3SYTA 1X6VA 3PNVA 1V8FA 4MVXA 2ZUFA 1WZ2A 2D13A 1WXHA 1YIDA 4ZT2A 1V47A 4JXZA 5KCMA 1ZH0A 3ND6A 3A4IA 4FZJA 1O0BA 1CT9A 4DJAA 1MRZA 1GPMA 4MVWA 4J76A 1EUQA 2CV2A 1TYAE 1TYBE 4PBSA 4MUHA 2Z3VA 1K4KA 1XNHA 3C8ZA 1IQUA 4RPIA 4NATA 1IQRA 1M1ZA 3FETA 4YP5A 3DPIA 1JHDA 1N2BA 4GRIA 4U63A 3MLAA 3SEZA 4ARCA 1U3CA 2CYBA 3QTBA 1YIAA 3P0HA 1JZSA 1FYDA 4XFJA 4U8HA 5LM3A 1K4MA 3LOQA 1JEDA 1MOPA 3Q12A 1O97D 2H29A 3ZXSA 3FI0A 1N2GA 5J59A 2EJCA 2O8VA 4YP7A 1I2DA 2CT8A 2GM3A 4KR7A 2DERA 4X0EA 3D6VA 3CLUD 3HL4A 4UZFA 1LI5A 4MW7A 1KR2A 2PZBA 3IOEA 2QUKA 1KORA 3IVGA 5HG0A 4MWDA 2J08A 3X1KA 3JXEA 1QU3A 2CYCA 1JILA 2OQ2A 3MXTA 1QRSA 2CUZA 2J07A 1GTRA 3CLTC 1G8FA 1KH2A 1MC1A 1JGTA 5BNZA 1M8JA 3A04A 2X1MA 1GZUA 2AG6A 1T6XA 4OUDB 4ZT7A 3RFFA 3SZGA 4EG6A 1MAUA 2C5SA 4ZT6A 3UOWA 1U0BB 2IELA 1N77A 1DNPA 3E27A 1LI7A 3OP1A 2AKEA 1TYDE 3RJZA 3M5WA 1WQ4A 1NUTA 2X0KA 3HV0A 1VL2A 1R6UA 3SDBA 3RK0A 3FNRA 3L92A 3UY4A 2QTNA 1M8PA 3AG5A 1LW7A 5H7XA 1F9AA 1H3FA 3SZ3A 4DDHA 1WQ3A 1YUMA 3N05A 1NYLA 2PZAA 2HZ7A 3ZIUA 1NUSA 1F7UA 3PNBA 1SURA 1FFYA 4MWCA 1N3LA 1VBMA 4YP6A 1TYCA 1JIJA 4NAUA 3UMVA 4CDMA 1M8GA 1ZH6A 4E1AA 4MUNA 3AIIA 4EFKA 1J1UA 2E0IA 1T9GR 4NAHA 2GOYA 3FG9A 3CVVA 5TGTA 2DR2A 1JIIA 4ZCPA 3TZEA 3H9CA 1IFXA 3P0IA 4MUGA 4NDAA 1VLHA 4DDKA 5F23A 1GTSA 4KR9A 1O0CA 1EJ2A 1G8HA 3D6UA 1JECA 4OUDA 2VTBB 2DPLA 3FY4A 3COVA 3TS1A 1TEZA 3TQIA 1IQ0A 3K32A 1O97C 3IOBA 3KT0A 3PNYA 5LLTA 1D2RA 4MULA 3P52A 2YXNA 1U7XA 1O94C 1TQ8A 2ZP1A 4MLPA 1EE1A 1KKUA 3BL5A 1WY5A 1QNFA 5LFAA 2A1TR 2QTRA 1KAQA 2J4DA 2XRZA 3CVYA 4G5YA 3F3MA 5TEWA 1TFUA 1PFUA 4R0NA 1IVSA 4UZEA 4MW6A 1EUYA 1EFPB 4WNYA 1K92A 2Z08A 1U7DA 1KAMA 3PRHA 2G36A 4PY2A 3Q10A 4P2BA 1YULA 2R5WA 2HGZA 1F7VA 4AS1A 3RBAA 4ARIA 3NBKA 3IMGA 4EF6A 4S1OA 1OBHA 1M8KA 2QUIA 1PFWA 4G5FA 2A1UA 1UFVA 4HPWA 1ZJWA 3TQOA 1N2HA 4MUFA 1F4LA 2QUJA 1M8FA 1N78A 3FWKA 4QREA 2JA2A 3IODA 3X1JA 2A84A 2QJTA 1WXEA 3FHJA 3LCJA 3OTWA 3Q4GA 1NURA 1KP3A 2O5RA 1NI5A 3CVWA 1KP2A 4U7JA 2I1LA 1NZJA 1K97A 1JZQA 3QE4A 4ZT4A 2DLCX 1ILEA 1OWNA 4DLPA 1J1ZA 1N2EA 2XRYA 4KR6A 1I6KA 5DEOA 5KWVA 2X1LA 3VU8A 4MUEA 4F4HA 4JXXA 4R2MA 1YUNA 3ZGZA 3HZRA 1I6LA 1ULHA 2CV1A 3X1MA 1WOYA 5DB4A 4ZT3A 5DK4A 1OWMA 1O6BA 1U3DA 2DUMA 1MAWA 4MW1A 4ZCSA 4KPUB 1M83A 1OBCA 4DNXA 1T6YA 3K9WA 4JYZA 3GUZA 3DV2A 1X8XA 1NUPA 2A86A 1WJGA 1O95D 1O96B 4EG7A 1A8HA 3ZJTA 4L2IB 1O5TA 4Q16A 4EGAA 4EG3A 4MAFA 4J75A 3GLVA 1VBNA 3HGMA 2V0CA 4HJXA 1Y42X 3UC5A 1NUUA 4MWBA 2A4MA 5FO0A 4BWVA 4ZCTA 4L2IA 3IOCA 1N2JA 4GU5A 2DETA 2BYTA 4DDMA 1WXIA 3ISJA 1GN8A 2AZXA 1EFVB 2YWBA 4NX2A 3ZUGA 1GAXA 1OWOA 1S4MA 2OV4A 3CLTD 2J09A 2RE8A 2VXOA 4F3RA 2CSXA 4I6JA 1KQNA 3A2KA 2QUHA 1EFPA 5DASA 4CT0A 2V0GA 1IRXA 4R2LA 3NBAA 3ND7A 4KKVA 1OWPA 4RUKA 1Q11A 1PFVA 1YI8A 3ZJVA 3CLRC 3HMQA 4HJRA 3H97A 2PXHA 3H9BA 4ZCQA 1J70A 3ZXIA 1XNJA 2E18A 4ZT5A 1Q15A 2VTBA 3ELBA 1H1TA 3QTTA 3CLUC 2WQ6A 2A1UB 2ZUEA 1N2IA 1Q77A 2WQ7A 3MUEA 3FOCA 5J58A 3IMEA 1PFYA 3L93A 3ILVA 4K0RA 4HK4A 3COZA 4MQ6A 1G8GA 4MW2A 4PBRA 3UK2A 2GKSA 1KQOA 3RK1A 2JANA 4YBRA 3AL0C 3G59A 3DO8A 1PG0A 1KQPA 3TNJA 1QTQA 1MB9A 5TS2A 3FH0A 3GMIA 4QBTA 1OWLA 4ND6A 4WSOA 5HUHA 2D5BA 1JIKA 2J5BA 2DXIA 2CFOA 2IP1A 3IH5A 3IVCA 2A1TS 2NSYA 4ND7A 4MWEA 5IHXA 2JAXA 2TS1A 3IUBA 4YMIA 3IVXA 5FNZA
chains in the Genus database with same CATH superfamily
3LDUA 5F4ZA 3WBFA 1ONNA 2UVQA 3PPVA 4RQBA 1GT91 4LISA 3JR3A 4X64B 3GZJA 1YIOA 3ZGYA 3ER9A 1DOHA 4QFMA 4YJ3F 5IVIA 4ZJYA 1F2VA 1ZOOA 1XTZA 2FPIA 2R47A 4MP3A 4JR0A 4XFKA 2MSLA 1K6JA 3UFXA 1QRTA 1O3YA 2R6DA 1LPMA 3VYUB 1M2WA 5B2ZA 1VOTA 4OJQA 1HNWB 2AVDA 1J24A 1P77A 4N8SA 3P1JA 4FCWA 3KIPA 1A7KA 3IQHX 3BGOS 1SOWA 2JJYA 4G6ZA 2EEPA 4KFUA 2R4UA 3S1LA 3BMQA 3NI2A 3GDFA 2HO4A 3FNGA 3X2SA 4CDNA 3U4QA 1SOUA 2JFVA 3CLSC 3E35A 3K9CA 4TOIA 5LYJB 1WB5A 4UAJA 2F67A 1P3Y1 2HPHA 2JLAA 4W7IA 1EK2A 1MDFA 1RYZA 2FE1A 3O3OB 2I55A 1XMIA 3ZQKA 4AQ7A 2QU7A 2ZRQA 4FOPA 4G0WA 1T8UA 2GFIA 3R3HA 2YYYA 3WKDA 5CFZA 2J8ZA 1K7CA 1I33A 3E15A 5G4LA 2XSZD 4F92B 1BROA 4UDOA 3Q9LA 3RC8A 1PEAA 2ZT7A 3PB3A 1LTKA 4XPZA 4I4TB 3S7TA 5LDDC 4ESOA 4WADA 5CB4B 5IZCC 4NXMB 4KVGA 2WYUA 1L3BA 4C2UA 1FLVA 2M6LA 2A88A 4BO8A 3WLTA 5LWHA 1ZD8A 4QTTB 3MJRA 5A9SA 1N7GA 5BR1A 3ICPA 2E4VA 4G8CA 1NBHA 4QRDA 2ISQA 2GM4A 1PJ2A 1JDBB 1MF7A 3TZ6A 3NV7A 3NXKA 5A7FA 1E1RD 2ERYA 3RQIA 4DZTA 5J2TA 3BGDA 5JXWA 1ZONA 4C08A 4BXOA 4QSHA 3LIIA 1OLXB 2REOA 4BVAA 5KNBA 2Q3BA 4KO2S 5FXMA 3H18A 3DE3X 2GZ2A 2EERA 2HBRA 3H4IA 5F78A 1VPEA 2ANBA 3AIMA 1ETUA 3RC2A 4E6PA 1ZM3A 5A4KA 3ITEA 3KWJA 4FXPA 4JLPA 3T12A 4YUZA 2JL1A 2PRIA 2Q3FA 3NHFA 5TT0A 1IJBA 2C7RA 1UM9B 2ZYAA 1UBGA 3O2NA 4PRZA 4XDZA 3WIBA 4WXMA 4F4UA 5A3RA 5C1DA 1V45E 4RESA 1XZDA 2NTNA 5AVXA 3UEOA 2VJMA 3SFZA 3N6VA 4OXRA 1JLRA 3AKCA 5HS6A 2IPMA 4M1MA 5E1DA 3QPVA 2CMFA 4L6IA 2VIIA 2C8JA 4ZQGA 4JC4A 1BFUA 1QE3A 2ZREA 5E0KB 5IW8A 1H3EA 1XRPA 4ZN6A 1AQYA 3TOCA 5ALVA 2HJVA 4ZIRA 3TG8A 4R81A 1JQEA 2JFQA 2AMJA 4B73A 3HVUA 3HJCA 3MIIA 4EB0A 3C45A 4F6RB 2QJFA 4W7SA 5AHKA 3HBNA 1Z0KA 1DPFA 5FEUA 3EA5A 2OZLA 2XNDA 3ZW7A 3NT5A 1HM5A 3GA7A 3VR4H 1M2FA 1RYHA 3ENWA 2A57A 3D4NA 3LVFO 1C3OB 2IUSA 2A9RA 2BFCB 2MHCA 1KJIA 2VDLB 4A2CA 1RKUA 1D1TA 1Z0AA 3OPYB 3WIEA 5KNDD 3V8EA 2ZYSA 3TG2A 1JTEA 3W1EA 3BZBA 8ATCA 4LFAB 1V8FA 3I2GA 4L4SA 3DOOA 1PDWA 4MVXA 5B55A 2QD1A 2X76A 2WOJA 3G17A 2A2ZA 3INTA 3IQIX 1DBPA 3A4IA 2UVPB 4OFZA 1W94A 1Y3DE 2H0AA 4C6SA 4Z2YA 1PR9A 3A0RB 1JE0A 3Q15C 5ARDA 3WK5A 3DTVB 5BMVB 3MYRA 4JB8A 4CTOA 4DANA 2CE2X 3QLVC 4RVFA 3CUTA 4CGZA 4LZLA 3KOMA 4Q24A 5FWYA 3DNMA 3OX2A 4EYGA 3OP4A 4KUEA 4D8YA 3GEHA 1L4EA 3VMMA 3ZHSA 1BWSA 4ES6A 5I51A 5M3BA 1ITZA 2WAAA 4XTRA 4ZZ1A 4WESA 1SPBS 1MHTA 5EFZA 1Y9DA 4L76A 4TQGA 4FQ7A 1ISHA 3KETA 3ME5A 4OI2A 4C7MA 2BRUA 5CDFA 5AK6A 2ISCA 2ISSD 1IPHA 2GEJA 4POAA 3FI0A 4GOLD 4TYMA 3LRXA 4PHHA 4PLZA 1NY5A 3O73A 3L05A 4RFLA 5ARBA 1FDSA 5CCXA 1E3WA 4HLNA 3W4JA 3EVFA 1VFNA 3JD4A 2IIPA 2PZBA 2GH1A 1DWPA 4IV0A 2QLJA 3DVQX 1CZHA 1BVHA 4GBJA 2HEGA 4U9UA 5DN6D 4CQMB 4RDHA 3N6RA 2JHFA 1Y3CE 4L1KA 1LX6A 2ZAMA 3HRHA 2H2FA 1BVUA 2FK8A 4IJKA 2FZ4A 1A2QA 4NPHA 4MGYR 4D3DA 1KEKA 4EY8A 4TYQA 4PFSA 1Z75A 4R3WA 5I3CA 4PYJA 3L07A 3MPUA 2OXCA 4M87A 1QHGA 1Y6JA 3AGPA 3CUYA 5K0LA 1CEQA 2HQSA 2EKLA 4NZMA 1EGVB 5CFNA 5A9RA 1MT3A 1SVKA 2C42A 3WNDA 1P7ZA 2G67A 2I4IA 2X41A 2FEMA 3IP9A 4US0R 2ERCA 2AEFA 2Q5EA 4JENA 4FFLA 2VLIA 1DMSA 1OF1A 2IYFA 3OO1A 4QVIA 3HR7A 2EJWA 3RYIA 5E3JA 3K0FA 2JDIA 3IA2A 1AC5A 3HXLA 3G8AA 3LAWA 5DWDA 4AROA 3E27A 2AK2A 2R7NA 4JBXA 2ZJ4A 1V1RB 2CXOA 2I0FA 4H59A 3RK4A 3GCXA 3MGCA 1LPSA 2HNAA 4Q7QA 5B37A 1IIBA 5K6AC 1GRQA 3PPWA 4PSDA 5TVGA 3TF5A 1UDXA 4Z9AA 4YRLA 1VL0A 1V1JA 1RPAA 1G60A 2QT0A 1D09A 3N58A 2UDPA 1FPQA 1OKKA 3C3XA 3PUWA 3HVKA 4FNOA 2FPUA 1ADBA 3EXHA 3PNLA 3UHOA 4KQEA 2JZCA 1XKXA 2NPIA 2QJRA 2WTEA 3KJIA 2WJ3A 1NZFA 3BH7A 3M6AA 1BWQA 4MQLA 3TB4A 2H4JA 3BRQA 1FTQA 3EVNA 3FKJA 4JUFA 1O95A 2F8LA 2YIMA 4X95A 1WQ3A 5GQSA 1RYNA 2VXYA 5B7NA 3GLFA 4GMGA 5LMUB 3AIKA 4I5DA 1MR3F 2Z6VA 3H1GA 3EGWA 3L6BA 1C8LA 2QTTA 3CJQA 1G8JA 3QY0A 3NHLA 1JIJA 3GFPA 4WNIA 1KY5A 2FW1A 5IC5A 4NSNA 1MO5A 1V9CA 4OYHA 3DUFB 1KEEA 2W2OA 2WV9A 4EATA 1JAYA 5K3OA 1BDIA 2P3QA 3D7RA 3H2SA 2GVNA 3D5TA 5AUQA 4I5EA 1PZNA 4U2KA 2DWOA 4PHGA 3RTCA 5FNVA 2OHFA 5EWJB 2H9YA 5BR7A 4L4XA 4FFPA 3V1LA 3FZGA 2ZUTA 4BJ5A 4BX8A 1HDIA 3O4FA 1WU8A 3GNLA 1ZEJA 5DBOA 3NH6A 2OLKA 1GPDG 4JLVA 1NJ8A 4I1PA 2CKMA 2CSUA 4FMCF 2QTVB 1RWMA 3EH1A 3AF6A 1XWWA 3EVDA 5HM6A 2IYRA 2H85A 1TKRA 2X0FA 4B7ZA 5TDHA 5JE8A 1GITA 2XTMA 2WIKA 1VJRA 1YQEA 1ZINA 3PHIA 2BW0A 2OHIA 2WK1A 2JVIA 1N8SA 3K5HA 1VJTA 4GLLA 4HZIA 4NCKA 2E6UX 4LZJA 3WYDA 1QF7A 4GL4A 1KKUA 1CUSA 1KEUA 1U11A 2AL7A 3ZY6A 5CA0A 1E9DA 3HP7A 2Q7XA 4R8MA 1Q0ZA 1WVIA 1ZIDA 1JJFA 4ICIA 4CW7A 2XJ4A 5K8LA 3VC2A 3IP1A 1T0IA 3UVEA 4HVCA 3O47A 5BVHB 1NJGA 2RGUA 3W9YA 5IX8A 1C3VA 1V11A 1AK2A 3ADKA 3IAUA 4JXKA 1P0MA 4K9PA 4YT2A 2XCTB 1PR0A 5KUTA 1X1TA 1L4YA 1RKXA 2GM9A 4U9HS 3GAFA 4LXYA 4A27A 2ZJ6A 3DP7A 2PCJA 3IT1A 2R5WA 3IVRA 1FMTA 2OHVA 3GOHA 5G53C 2R7MA 1IG0A 4WA8A 4AS1A 2UVPA 3EX7C 1SIBE 3U3KA 2WJWA 3IBYA 4OJKA 5DDIP 4M0KA 3KB8A 3QUCA 2VSYA 3QXCA 5ITSA 2Q3JA 4DR5B 3PQEA 1P4AA 3MS4A 1G0OA 1BYIA 1U65A 4MRMA 1WP4A 2XRFA 1QH1A 1BHJA 1I10A 2Z3ZA 3W0LB 3A1TA 3TQOA 4X7RA 3KUXA 1S5PA 3E2MA 2GTHA 4F60A 2XHEA 4V3CA 1NPTO 3D8UA 4HQ6A 4U7PB 1MENA 1P0PA 1IZ0A 2HREA 2YZNA 2VNIA 3GLTA 3DB2A 4O4LA 1XRNA 4BCDA 5AM2A 3EA0A 3P45A 2B5WA 6CHYA 1RWXA 2IOFA 1TEXA 4XWYA 1N9ZA 2JCSA 2RK4A 1OFUX 3QRWA 4V0NA 3AHDA 1G42A 2ZJ8A 3KXKA 3LFUA 4JCCA 4W1QA 2F6RA 1SBYA 3ZWYA 1NXQA 5EJ6A 4N7JA 3RV4A 3U4IA 4K26A 4ZI3A 4CMEC 4IPTA 4QGHA 3W5DA 2CJPA 2QVGA 1Y3FE 2ID7A 3P26A 5H0IA 2PGNA 2ON6A 2F3TA 3ORFA 1DKLA 2Q0XA 2X2FA 1OZAA 3CZRA 2C3PA 3UH0A 1R5JA 4YWJA 3VDXA 2AG0A 1Y5IA 2Z58A 1K5GA 4PYRA 1P7YA 3GA5A 3SNKA 5EUQB 3PQ7A 5CCDA 2P41A 3M9WA 3KX2A 4FSDA 4E5YA 5GV8A 2A9KA 4M7WA 2B9VA 1NNUA 3QH4A 3TZHA 3SKXA 2NUPA 1WSWA 3FWYA 4JVSB 5EHIA 4ID3A 3GRZA 1B2LA 3PC3A 2DBRA 5JMTA 1UPTA 1O4WA 2EQAA 2QRZA 1YRYE 2I03A 4HZUA 4KPUB 4EB6A 3GFRA 3EXEB 2FRVA 3QBEA 1CZKA 4OIMA 1ZGGA 1CYDA 3O9ZA 4FONA 1UFKA 2R00C 3VHXA 1UKBA 4CTMA 3RTGA 3TLXA 3A9TA 5E6UA 1OFUA 4H1HA 3A11A 4WA7A 4QOHA 4ZEXA 3GZNB 3K9BA 4PVDA 4B3FX 2A86A 3SYMA 1F4PA 3C24A 4ZEMA 1S8AA 2IBTA 2JJMA 4L2IB 1QS0B 4M88A 3HN6A 5FTNA 1G3UA 4AQYB 1BXRA 4UASA 4D3XA 4QYIB 4GPBA 3MPOA 4QRIA 4CMIA 2W4IA 5ALMA 5AW8A 4E33A 2B61A 2C2GA 1TFRA 1MAVA 2Q4TA 3JAKB 4CKCB 3RWOA 2GHRA 4IVRA 3NJRA 4QSMA 3HGMA 3KOOA 4WUTA 3U6KA 4D9HA 4Z4EA 4BU1A 4J4BA 3H1EA 9LDTA 4Q1CA 1XL0A 1GAJA 2JJ2A 3ITDA 4JT8A 5I47A 3EG9B 1Z7GA 1WF3A 2IZZA 4V02A 1M2JA 4AWXA 1HLGA 3CBGA 3PRYA 1OHHD 4C6RA 4D92A 3PS9A 2HJWA 2XKKA 4D82A 1OWOA 4GYKA 2O8EB 5KNCD 3DOEA 4YB8A 5LQRA 1RPTA 3DAPA 4MJ3A 3ZWCA 2PQ0A 1OAAA 2PWPA 4OD0A 1N5RA 1SUSA 4IQ4A 4JP3A 1EFPA 1NXXA 2WZDA 4UZSA 1BHQ1 1EX1A 1KJJA 2Z8YM 5AW2A 5BSHA 4RUKA 3BWYA 2NO9A 3FCEA 3RT9A 3N2KA 4NV3A 3USCS 4KR0A 5BW4A 4AUEA 3D4OA 4ZAZA 1HL7A 1Z6XA 1Y48E 4UTOA 4NF2A 4CTJA 4DR3B 1DFIA 1DUSA 2ONCA 3T7EA 1JX6A 4B8YA 2JFXA 5EXPA 3VJRA 4A8JC 1AUQA 1FFDA 2CBXA 4GLOA 1A50B 4O4HF 3F0TA 2OD2A 2ZU6A 1J0XO 3HLKA 4C14A 4D7AA 2WHPB 1SXJD 2FW8A 4N8DA 3I28A 3USES 5MHTA 2AI2A 1A5SB 1UM9A 1AIPA 1I4WA 3FNFA 5EWMA 5TVKA 3TJMA 1G7CA 3QVUA 3WRVA 2B37A 3OJCA 4HK4A 2J32A 1YZVA 4RY0A 3LWDA 3JQEA 3R77A 2PWAA 5D85A 5CPFA 3ULKA 4FNAA 4N49A 3TAUA 5EE9A 1SKBA 3AVXA 1ZM7A 2HA6A 3JPWA 1INLA 4QDZA 3VAZA 2OCLA 2WJPA 3HJTA 5K3FA 3BXOA 1A7AA 1YRWA 2V8OA 3AWIA 4M9CA 5LCXA 4Q3KA 3TQCA 3I0ZA 4BFLA 1SG6A 2GCGA 3T4PA 4MDYA 4OQLA 2SBTA 1OWLA 3ZY2A 2YVQA 3DFUA 2C2YA 2RAVA 1ECLA 3BC1A 3JZAA 4IOMA 2GGSA 1PYDA 3OE7D 3TBKA 3M89A 5FOVA 3OUUA 4MWSA 2AA3A 1OIVA 4MV7A 1THTA 5AVWA 2IC5A 4BNIA 3HRIA 1GGJA 3QHPA 3ZVNA 1QQAA 3IA7A 2IVZA 4J94A 1LNSA 3MNFA 1LSOA 3UGJA 2EFGA 1ZGCA 1T6ZA 4DLXA 1ZJZA 2BEUA 3OFVA 1B6TA 3N07A 1VRWA 2FKNA 3PKZA 1ZLXA 1M1XB 1T4GA 4H7FA 4KQ9A 4B4DA 3I5XA 3ITNA 3DMTC 4UU0A 3FR7A 4D56A 5G41A 3RTBA 1FFXB 3WI7A 4ZV9A 1CY7A 1OJ7A 1YB1A 2XMQA 2QL9A 3H7AA 1RM4A 4G1EB 3ZYCA 3ABRB 4B43A 5KX5F 1QC5A 3G85A 2P5YA 2PT6A 1H9BA 2NU8B 2CLFB 3N3AC 3K0AB 2SNIE 5K3AA 3VPFA 4MRAA 5FWNA 2FDRA 4V38A 2QVLA 3LLMA 4S0XA 1J2EA 1RLUA 2MINB 2X6QA 4ZQHA 3VUEA 1KMIY 4QBKA 3U81A 4AYWA 1QCDA 4W9NC 5EYPA 1WW2A 3QPDA 2VT6A 3SJCA 5LOVB 1WS6A 3KQKA 5IT5A 3VKUA 2ZJOA 1B8OA 2O23A 3FPKA 5ERYA 3DMGA 4X65B 2D2XA 1GTZA 2CHFA 4P98A 2DG2A 5J43A 1D6SA 3AY0A 3I4CA 2ZB2A 5EIHA 1Z08A 5IJAA 4US1R 4JB3A 3ROPA 4E32A 2C9DA 3ESAA 4TKVB 3UJ8A 1G38A 1EQ2A 3CRQA 3R5SA 1Y1PA 1SA0B 1TVEA 3SF8A 4P6VF 4ARBA 1FEZA 1YL7A 4HDMB 2C77A 4NP6A 2G0TA 4DS3A 2H2DA 4O6VA 3TSZA 4DV2B 5LD2B 2HRCA 3VSAA 4KITB 1NDHA 1U1DA 3WZLA 1DRUA 5B4UA 5E4JA 4M86A 2H4HA 1L8QA 1GYRA 2JCVA 3Q6MA 4JJ4A 1EWQA 2CXRA 2QAGA 2QPOA 1HDZA 2HMUA 2YRXA 4DN6A 4QTYA 3SXUB 4ABTA 1CJUC 4MA5A 2VP4A 4PC7A 2Q45A 4PQFA 1JQAA 3JQGB 4TLLB 6Q21A 5KU7A 2Q4EA 5A9SB 5HF6A 2G9QA 3I42A 3ADBA 2YV1A 1O77A 4RY2A 1N7IA 4DCJA 2PR2A 4U6NA 3CH6A 2AYXA 3U3DA 5BMVA 2CHGA 5KYYB 2WB2A 2ZI7A 2PJRA 5CXXA 1FSZA 1YS9A 1AO3A 3FJ1A 2I6TA 4PCVA 4OHZA 1WBBA 5FD8A 3IPAA 5AK5A 4BNNA 3DAYA 2F00A 3GNTA 1W36C 4LBZA 5GVRA 1C7FA 2ZSIA 3I9V6 3FRHA 4M1YA 1W6UA 1T9HA 2RONA 1T9DA 3L0OA 5KTTA 2I5PO 3LYUA 1JXMA 4PG4A 1W44A 3HFJA 4O5AA 3ISTA 2JFWA 4EYSA 1JU9A 5FH9A 5THKA 1UIRA 2YHIA 1KJ9A 3JQFC 3OIWA 4Y6RA 1PK7A 2PL9A 3V8BA 5GGXA 5ALKA 1MJHA 3CC8A 1BEZA 4LV5B 4OVKA 5GMOA 3IIEA 1RT9A 3I76A 4GIBA 1A04A 2JKZA 3EF1A 2HHAA 4HNGA 3TD2A 3ES9A 4MMXB 1P2GA 4W5WA 1YJ5A 4L9WA 2PUWA 2WF8A 3O91A 3WGYA 2VJAA 2BY4A 3OZSA 2G1PA 4BLSA 3SSOA 1EXWA 1I2AA 4YRZA 3DZGA 4QGAA 3OEHA 2GPYA 3T1OA 3V1UA 3VU1A 1EK0A 2OVBA 2PVSA 2YJ4A 4M0MA 1KEZA 1E1QD 2VDPB 1R8YA 3SR0A 3UXYA 3AP2A 5J5AA 2XQVA 3N28A 5HR5A 5JAZA 3BE8A 4PGHA 3UG7A 3AOEC 3LT5A 2EX1A 3H4TA 5A2GA 1CBUA 2CJYA 1JA1A 1H69A 3IV6A 2O0KA 3U31A 3L8EA 3GCZA 3DMHA 4QDOA 1NIJA 1ORWA 4NNOA 5FL3A 3ZZ1A 5J4LA 1YHYA 1IHUA 1TC2A 1E9VA 1BHSA 3OE7A 4DQXA 5JAIA 5EC8A 4J76A 5H80A 1P6UA 1P8AA 2Y76A 3BCHA 2O1XA 3WFJA 2HMWA 4IQ0A 1EVIA 3IHTA 4LJ7A 1K4KA 7MDHA 2V6FA 4RPIA 3BGVA 3ORQA 3AESA 1VL6A 1C8VB 2QVBA 1UXKA 2I99A 3CF4A 3WHIA 2WABA 4KCGA 2XUFA 1V8ZA 2N9UA 4LK3A 3VC1A 3EXIB 4JQSA 5HCNA 3SWWA 3QTBA 3AVQA 3CW2A 1Q12A 3RS2A 2LGJA 1D03A 1ZFNA 1JEDA 3C70A 2ZULA 4CM9A 2XLCA 1S2IA 3EGXA 3K1ZA 4IIJA 1XDDA 5AVJA 1DKPA 2JAOA 2PSSA 2BHRA 3IERA 5DW0A 1CYEA 2VZLA 4E2YA 4F46A 3DPSA 2EJCA 2B4QA 2D5LA 2OLJA 1HQDA 2YJ6A 4X0EA 2HIGA 4I1IA 4JBWA 4NRDA 3DHNA 5JW6A 2C5FA 3ABOB 2AN5A 3L8ZA 1JKMA 3OF3A 2BM1A 2YHAA 2LDXA 4BPBA 4B4OA 1AN9A 3IKLA 3UQZA 5CDUA 1YB4A 4ME6A 3GRVA 3HFGA 4HTFA 5MN6A 1XIVA 3QELB 4CT4B 5C9ZA 2JAHA 1UJNA 5JSFA 3ZVKA 5F98A 3TJZA 3BM5A 1E9CA 3I04A 2PUHA 1YMQA 4M9XA 1JPNA 2A58A 4RD0A 1YZKA 1MORA 4L7VA 1U8YA 4KX5A 1CPYA 3KR2A 3AF5A 2V5VA 2CUZA 4P4NA 4E31A 2I9KA 4FFVA 1QCZA 1HEYA 1B8NA 4M0LA 4FD3A 3VSEA 4OP3A 5IAAA 4QU8A 1RXEA 2K7FA 3GVCA 3UXEA 4LJRA 2O2IA 2HOQA 3A28A 3M6UA 3NPAA 3EE6A 4BYGA 1US8A 3QF4B 1X7ZA 2X8AA 1AQUA 4JODA 3J7AC 1TVMA 4JVLA 1MAUA 4S1PA 5JZMA 3WL3A 3TAHA 1ZI6A 1L1EA 2C9OA 4WQMA 1JG4A 5B3KA 3L8HA 5SYAA 2GCPA 5KPDA 1I7NA 3TL2A 4JC5A 2RHTA 2YW2A 5TGDA 2BF7A 4G1UC 2XR1A 4K9MA 4FR2A 3RFTA 2RK3A 4OU4A 2EX4A 4DV5B 4Y18A 1THZA 1T9AA 2NU7A 1OREA 3AUFA 5DBEX 3ZXUB 1TYZA 3G2JA 3LPNA 3L1UA 5DWVA 2I34A 2IYTA 1BH2A 3DJYA 3IPXA 1KJ8A 4LJLA 3FCUB 1E3QA 5CM2Z 4XDYA 3I2KA 3NDPA 2WKWA 1X7XB 2Z9DA 5KQSA 2PGXA 2R86A 2JLVA 5KNDH 3GLFE 1UFQA 1X1BA 1Q57A 3WS7A 2QRNA 2I3AA 5CDHA 4ENVA 2OUKA 5F9FA 3H2JA 3N59A 4CF3A 4EB6B 3EFHA 3R5TA 4URZR 2X2PA 1QDEA 5DN9A 4MUNA 2B4KA 3C15C 3MEQA 1L6RA 1VZ3A 2J0UB 5E1OA 4EJ2A 2Y0DA 1IXZA 4CCAA 3K0BA 4OHKA 3G2MA 4DVGA 3AZOA 2Y9PB 1NLMA 4XR4A 4AZVA 1ONBA 3ETEA 4PZZA 3D3QA 5K3SA 5LSAA 1JIIA 2FPOA 1NMXA 3PEFA 2H11A 4U2EA 6GPBA 2QLMA 2VG8A 1F5NA 4G5XA 1DPGA 1GTSA 1FFWA 3CM0A 3ETJA 1NW5A 2CVOA 2NSHA 1A2OA 4QUEA 4QYIA 1NKTA 2C5AA 4AZTA 4B7AA 4DLYA 5D3ZA 4F9FA 2B35A 3TS1A 3FPFA 1XRLA 4LXGA 4IY1A 4FFSA 1WMEA 3IOBA 4F11A 3KZNA 1H2FA 2B0JA 3PNYA 4ID9A 4MULA 4ZVMA 3LBFA 1A9XA 2YY7A 3GQBA 1HE2A 1QGAA 2BZ0A 2JGIA 1RLIA 3RKSA 5KTRA 1GL7A 4RVUA 1GT6A 1O94C 1A9ZA 2BGLA 4ZZ3A 4B3XA 3ENNA 1AKTA 2QR2A 2XT6A 4F96A 1AVTA 1E66A 5CK5A 3DE4X 4DA0A 3R44A 1I7PA 2J4DA 4QJ4A 1L1FA 4ARZB 3D8RA 4D8VA 3L6OO 1R0KA 1QDLB 2Q0HA 3L7IA 1CXZA 3PNKA 2WP8J 1MB0A 4ZVKA 4BMYA 2IYLD 4B6SA 4ZGBA 1R6DA 2NU9A 4PV7A 1UPFA 2ASEA 3DT8A 2QHXA 2G36A 2Q8QA 2CZCA 1NSTA 2MOKA 4LDJA 2NUPB 4WY5A 4YJHA 3SS7X 3E58A 3SDZA 3B20A 3QFHA 2GRJA 3QVKA 1JHPA 3VBCA 5IKXA 2HLDD 4YASA 4YRKA 2PSEA 4R5MA 3THWB 1FUUA 2B3DA 4E1VA 4MGIR 4O0MA 2DVMA 1V11B 2JCXA 2ZKIA 4P7GA 3LVBA 2Q6TA 1VKHA 3ZWQA 3WGNA 4Q02A 1QH8B 2O3SA 4ZOAA 3EGOA 3ZPXA 4BO3A 3K05A 3MBOA 2REXB 1L4KA 3I04M 4CI0B 2WWYA 4Z5XA 1U7HA 2AI1A 5CPBA 4MUXA 4O4IB 4JVOA 1VG9B 5CIYA 4J16C 3W6OA 3O1JC 1J8YF 4RGYA 5EJMA 2IF2A 1MC4A 2RHGB 3O2QB 2Y67A 2O5RA 3N3BC 1HDGO 3U9TA 1N2SA 4KYVA 2PHZA 4YROA 4U7JA 2DM6A 3W6UA 3EUAA 1GFZA 4RMJA 3NGLA 4ZT4A 3P9ZA 3IRUA 1NQXA 3K8QA 1BVRA 4Y2TA 2NGRA 2ZJZA 1Y1LA 2YVUA 1OWNA 3AT1A 4S2UA 1N0IA 2GI4A 4UM9D 3ZTYA 3R9XB 1TE2A 5CTAA 5A7HA 4JUIA 5EQTA 3TAXA 4KK4A 2QRHA 4ZU6X 4BRSA 5EI5A 3CRMA 3C6QA 3MWJA 3OOWA 3CX3A 4Y6QA 4B2YA 4C22A 2R751 3HABA 3N86A 5DEOA 3WRYC 4DLKA 1IC6A 1IY0A 3JQPA 3E23A 1P72A 4U0KA 3L4BA 5AJXA 2RHRA 1ULHA 2JFYA 3RC1A 2CLIB 1NY6A 2FLWA 4YRIA 3DLTA 4G1MB 4DIBA 2OHHA 1HR0B 3WWZA 3RU3A 1BGWA 3X1XA 4ASUD 2BHSA 1QK4A 3A1EA 3NM4A 4Z4QA 1RWPA 1BQ4A 2P2NA 2VHZA 4UU8A 1T0HB 2JEZA 3K31A 2YOFA 4RO0A 1NI4B 3R1IA 2VQDA 1KZ4A 2VDMB 4GZ3A 4XIGS 3WO1A 2ETXA 3OC6A 1C7IA 4GKVA 4JYPA 5FBLB 1SC3A 4R6XA 3X1YA 1IOZA 3HA3A 2HLPA 1T6YA 3D8NA 4BY9E 3L1JA 4PC2A 3R0QA 4MRMB 4KN8A 4PPNA 1T26A 5AUPB 3EWAA 1OBOA 1AK1A 1O2DA 1JEJA 3P9IA 5T8KA 4BVKA 4C5AA 4Q39A 3C6ZA 2A0XA 3HPQA 1F2UB 2OCAA 2VAMA 4YMWA 4NYMR 3X43A 4M21A 2GXAA 3A36A 2HQRA 1QHFA 2IV2X 4Y7CA 4E1BA 2WSYB 2Q0SA 2ZYDA 1LY1A 3V2GA 3WLKX 2EFEB 2V0CA 4BDTA 3O1LA 4EEZA 4TT3A 1NUUA 5JSQA 5FYQA 2KX7A 2W0SA 4L2IA 1BA3A 4L08A 3E0QA 1S7CA 2QYTA 4QUHA 3VSBA 3R3JA 1JB9A 4W5HA 4BQIA 2O2CA 2YCBA 4MI6A 2B2NA 1I4OA 4D0GA 3CZPA 4HYYA 4JNCA 1YB2A 3ZQUA 3FDZB 5A71A 3UMGA 1SBIA 8OHMA 4P53A 1CUDA 3JYQA 4BV8A 1KWGA 4LNUB 2IOFK 3MD9A 3A32A 1HV8A 4FILA 3LXRA 2QZJA 4ISCA 5JJLA 1EU1A 1XPJA 5EIOA 2GN4A 2X8LA 2AOUA 3GLKA 4W9MC 4OQXA 1WDWB 3C8DA 5TARA 3K0SA 5U9CA 1N8TA 1ZBQA 4KH1A 2PXHA 2JH9A 3H9BA 4R7ZA 3VR5H 3BWDD 2EVWX 2VYNA 3BMNB 3GK3A 4FZVA 2ZPAA 2VWGA 4H35A 3WGLA 2FN4A 1GUAA 5K9ZA 5JAMA 3PQ6A 1KSFX 4RAQA 3KB1A 2MCFA 4PHCA 2O6HA 3VXKA 4L5JA 3PLNA 2YOHA 3B85A 5KBYA 1Y89A 5HQTA 3OC0A 4NJOA 1LQUA 4LYYA 2UZ0A 4NENA 1WOMA 4J6EA 5JZSA 4FB4A 1KNQA 1OUMA 4H3KB 3IFSA 3CRZA 3N7TA 5K0EA 4RHUA 2Q46A 2RGWA 1QWSA 3SJZA 1EFAA 2AXEA 1GGKA 4GC5A 1QB8A 4R2WA 3ZHUA 1QSGA 1PZFA 3JVDA 3QE3A 4HDQB 3ERCA 3GUCA 2IYEA 1IUNA 4I3GA 1BJTA 3I6MA 3OCCA 2MMGA 1X8LA 2CHQA 4YXWD 3RVQA 4G36A 4OHBA 1DCMA 4IICA 4OYRA 5A3VA 3TLYA 2BMFA 2HFKA 1BKDR 4OQEA 5TPZA 4CVNA 3HYNA 4R9UC 3PTLA 4F56A 3MHTA 1P9RA 3PJEA 2Q6OA 5DYYA 5AUNB 5EQJB 5H5JA 3EGXB 3EWNA 4OQ4A 4YCMA 3O8OA 2BFFA 3A6EA 1Q5PA 2BDEA 4QAJA 1HE5A 1V3TA 1BO6A 3WV5A 1OU4A 5B36A 3QV2A 4DIDA 2D2IA 3IVXA 3O9MA 2JIBA 2WSBA 3RAEC 4W5JA 1VB5A 1EWKA 1Z56C 2NXEA 3C98A 1OH6A 4E46A 1UBUS 1WUJS 4FHGA 1G8SA 5BYKA 4AY2A 2ID9A 3NTQA 1R7RA 1SUAA 4LZOA 5DBIA 5DTJA 5BSVA 1TJNA 4RJIA 2JGRA 2I6XA 1GSIA 1LK0A 2VO1A 4MW4A 3VGJA 4CLEA 5F3WB 4UW9A 3BMQB 1GILA 5DCWA 2ZM6B 4BE9A 2ODTX 4R1NA 3WHLA 3H9EO 1ZD3A 2IIBA 3PFCA 4BP3A 4EVRA 3OQOA 3HC7A 3NYQA 3OX3A 5T7BA 1W34A 1ZMOA 3WHPA 2OLEA 4A2WA 1HTTA 1FJ2A 4Q7MB 4QBIA 1XQWA 2JHPA 1W1IA 5LR6A 4FOSA 1LQ2A 1GCGA 1S2NA 2WUGA 1HK7A 4RHEA 1V8DA 4F4FA 1CF9A 1I0LA 2ZIEA 1E2QA 2BJWA 2C1EA 2LV8A 3CUEF 3ZV6A 1D7AA 2BHNA 2ORWA 1ZG3A 4UEJA 4DMUB 2VJMB 1VA4A 2ACWA 1X2BA 1YE5A 2VPYA 1PYOA 2O8CB 1O03A 4HLQB 4WFKA 2PIDA 2D54A 2DTXA 4FI3C 4DQLA 1OYOA 4C4XA 2C2HA 2PH7A 2OGSA 4PZ9A 5LYYA 4GPZA 3EH2A 4HCJA 3Q7TA 5BV2P 1DC5A 2J3EA 1DG9A 2HY7A 2D3WA 3F71A 4K9NA 3NOQA 4CG0A 1J8DA 1AV6A 1VYTA 4QICA 1GJRA 1G1AA 5GAJA 4F6RA 2QY6A 3EZNA 1V95A 2HIMA 3PGLA 2YUIA 3U39A 2VJLA 3FM9A 2J9RA 4N3NA 5BN5B 1GU7A 1LK7A 4I4CA 2DFTA 4H15A 4JYCA 3NWBA 5FLYA 1YF3A 1T36A 2H2AA 4D9GA 1CR0A 2XE4A 2OWEA 5JI3E 6YASA 2P6PA 4DB2A 2XB4A 1SXJC 1X0VA 1DJLA 1G20B 3B5IA 1PEDA 3G8CA 4INPA 4R68A 4UD6A 4D26A 1EQUA 5LZ4A 2PYIA 1NU8A 2RGNA 4PZCA 4RKYA 5IN5A 1LRJA 2Z09A 1TT5A 3F2IA 1NAHA 3LH5A 1VL8A 4MUKA 5U4XA 1X86B 3DDNA 1R18A 3DMFA 2C5GA 3U40A 4CN9A 1ESMA 1IDN1 3TZQA 2IY8A 1M0SA 2CNWD 1RABA 1G7SA 3L0DA 3QU4A 1E9EA 1RJDA 4FJ2A 4KVZA 4LQLA 4CQJA 4Z1OA 5JCXA 2FFQA 5AHWA 4ALKA 4TYNA 2QSUA 3B1WA 1P3JA 2H1IA 5CFQA 1GUZA 1VKRA 1L7QA 5B1HA 1XTTA 4TN5A 4AP5A 4RV4A 3RRZA 1O6CA 3FRIA 3CSDA 3PBKA 1OU0A 2H59A 3TE7A 4TTAA 3FGOA 3IRVA 3LPDA 2AVNA 3LHSA 3SVLA 3KFLA 2QMYA 1W47A 2W6OA 2HJRA 4K6OA 3TIGA 2EG9A 4AZ3B 3ED1A 4RLFA 2B7LA 2Q6LA 1THGA 2BFNA 1KEPA 4MUJA 4S2EA 5EXTA 3STUA 2JJ2D 2I76A 4M0FA 3FCXA 3V1TC 4DSZA 1L7EA 3L6RA 3PJFA 1NV9A 1U2PA 2BEJA 2PX0A 4HXGA 5I9MA 2XV1A 2Y92A 5AW5A 2H1FA 1L0BA 1QHXA 2HK9A 1LB1B 4FIZA 4JBIA 4JR2A 5K3DA 3LTEA 1WXWA 2F2TA 2JGJA 3S8EA 1XD2B 2P68A 3C5VA 4X00A 3CA8A 4X5OA 4EHJA 4BFXA 2CYAA 3OCUA 4WJLA 3MK31 4KI7A 4Y9DA 3S55A 2V97A 2JG3A 1HE4A 1P44A 3OURA 3V8PA 3SXUA 2KLBA 4C0KA 1IE3A 3W9UA 4B6FA 4ZJZA 4JEMA 4IDAA 2BVNA 4WV3A 2ONYA 1UK7A 2H1HA 1UOPA 4EY4A 3NGMA 2GVZC 3I8OA 3DBIA 1NI3A 1CR6A 1I3KA 1GPMA 4ZOLB 4BGDA 3LZCA 4CNQA 2AJTA 2BMWA 4WESB 2FR8A 2O3QA 4GI7A 2XMCA 1SQ5A 2WM9B 4IBOA 4IL5A 4N1AA 4OGKA 3Q3CA 2X6TA 1RQXA 4OBEA 2R6R1 4DWVA 2BGRA 5DNYB 3G1WA 2P7HA 3BQ9A 4MO2A 3TR0A 4F04A 3D5QA 4Z1MD 3R6TA 2QVYX 5EN4A 1RQRA 3LX6A 3M1YA 4V0KA 1ODIA 1IOLA 1TUBB 2PRYA 2W8BB 2P3LA 1FSGA 1MXFA 2WJ4A 3Q2KA 1FMFA 3QJ5A 5BN1A 2O7VA 1UEJA 3N2EA 2P7IA 4NZZA 5DXAA 3IEUA 5H59A 5AKIA 1U02A 4XFJA 2O54A 3AJAA 3VH2A 1OTYA 1OT5A 4QUGA 1FRZA 1QG2A 3KJNA 5ECDA 5BP7A 3I30X 1EM8A 2IZ7A 1O97D 2F3RA 3OM8A 4LYJA 2QEQA 2J3QA 1RIIA 4NV0A 2IUTA 1IUKA 1T0UA 4NG4A 4CLRA 2H4ZA 2Q3HA 5D2CA 1TF5A 1UJCA 2DERA 2L18A 4ZHQB 4M99A 3ENQA 3W2HA 1UANA 5HOEA 2Z98A 4BNHA 5CXSA 4EL0A 1Y80A 3BXFA 3NP9A 3TDNA 3UYLA 1IHPA 2R2AA 3DAGA 5KQLA 3B1ZA 3EHEA 4X54A 2JJQA 2XD4A 1XCOA 4UUPA 2G06A 3G0GA 3AVOA 2ARKA 2BM9A 1EZZA 5HVNA 4NLLA 5DX0A 1U2SA 4MINA 1QRDA 1RZVA 1ZVJA 1P60A 2EJTA 2CYCA 4IRMA 4GS5A 3JPYA 4BFYA 1PUIA 3CRVA 3PIDA 4QYXA 4U3JA 4OHYA 2FDXA 2GN0A 1KBQA 1TZBA 1GTRA 1ECBA 3SKVA 1D5CA 3WIDA 4KFSA 1AMNA 4V03A 3E1KA 3SQWA 1MC1A 2VYVD 4PLHA 4QASA 1GDTA 2I4OA 2YJNA 4RK4A 4WZBB 3VHQA 4RMGA 3ZWDA 2XWPA 2YV3A 5ESWA 1E7RA 2ES4A 1ML4A 4DIUA 2FW6A 4IV8A 3WLPA 1WNFA 3O74A 5DGHA 4OB6A 5GZ3A 4KKXB 2R6HA 4IZHA 4N82A 3VOAA 1I2CA 5J5VA 2HTFA 1C1YA 3MJSA 1C5KA 3HI6A 1W5SA 4IUBS 5ESDA 6LDHA 5I48A 3LZDA 2O2GA 4EBFA 3TK1A 1ICEA 3TX6A 5IK2D 4NECA 1XYGA 3KHKA 5KNBD 4XGRA 1NC1A 2DFNA 1V8OA 1HY3A 4WBSA 3E8SA 2P35A 3HYTA 3MG9A 1FX1A 4DZRA 1WX1A 2J9XB 2NAFA 5J1SB 3W2TA 5DYGA 2BZ1A 2X40A 2UUOA 3HKCA 4FKZA 1YBMA 4GNKA 1A8QA 4HRAA 4DA8A 3TKYA 4YCLA 2UZ3A 5B64A 1PT7A 4MI9A 5BNWA 1P2FA 1PAUA 1T1GA 2F9FA 2JBWA 3ETGA 3G8DA 3T7CA 5KYNA 1Q20A 4B3MB 5CLLA 1MJGM 3W05A 4DDHA 121PA 3PQ5A 3MXOA 1PGPA 3B48A 3R7BA 1YS7A 4TLCA 3TTWA 1N3LA 4EFMA 3ROZA 4HD8A 5KJ1A 3L8FA 3KG2A 1Q83A 1TU0A 4RBNA 5CGQB 4TVSA 2BTQB 1TOAA 3ANTA 1L5NA 3A9SA 3SIRA 3PKIA 3UH1A 2PJDA 4RXMA 5AI5A 1UBCA 3KQQA 4QPNA 1SVLA 2FGJA 4G4IA 4LF9B 2VJKA 3IEPA 5TQ0A 3RVNA 1H8EA 1QOPB 4G67A 3MJFA 1AUOA 3P32A 3S44A 5ALQA 4UBKA 4ZFNA 1SXPA 1QYVA 1B8UA 1DO0A 2JIRA 2WYIA 1SKMA 4AMGA 2VTBB 4TRMA 4CEHA 3DBLB 2O07A 1HT3A 2CCJA 5EMHA 3EEBA 1ISRA 4HRYA 4G5OA 4IO0A 4L3OA 3LX5A 4S0ZA 5TE9A 3JAMA 1EGAA 1V96A 2IEAA 1GDDA 3TZKA 3LO8A 3NS7A 3AINA 1J6UA 1Z2AA 1KDRA 4NPCA 1T0JB 5KYVA 3PC7A 4CCYB 5C7IO 3D6JA 2HRQA 1EVLA 4HS4A 3N5CA 4C6TB 2XVYA 4MLPA 3EARA 1Y1QA 4TM8A 3EGIA 2PSFA 5EFOA 1RI1A 1XD9A 3D2BA 3B7PA 2GZRA 2W71A 1X2EA 2NU6B 3M3PA 1YXMA 4EO9A 1TKCA 2C2MA 4MK4A 1ENOA 4TWRA 5TEWA 3PU6A 3WGZA 2VHYA 1WVMA 2JZOA 4HP8A 4MW6A 3CN9A 3VPBA 2FPLA 4MV8A 1YL5A 3UHPA 5CW1A 3OFSA 1G8MA 5AW0A 3MOGA 4IDPA 3AI1A 5C0OE 4HAXA 1V16B 3F6EX 3KR9A 4NK5A 1ZMXA 3I4LA 1UPBA 2P8SA 4G0QA 3IQXA 3K09C 4CF5A 2C2KA 1WZNA 2H5LA 1YRAA 2HUPA 2WMDA 2XKAA 4GW3A 1KI6B 2OBXA 4YDRA 5JQGF 2PM8A 1GFIA 1SRRA 3IPLA 2HHHB 3VH1A 1KPGA 2B21A 1RWKA 2VPIA 2VYQA 4RVNA 1V8BA 3QY9A 2EW1A 2Y0PA 3DWGA 2P5TB 3K73O 4H1TA 2VH1A 1PNRA 1N6LA 4UD2A 3T0GA 2JW5A 5JNUA 1RPJA 1MAAA 4B81A 2XQJA 1UOQA 1E6WA 3FFXA 1BXRB 2PKCA 4GC9A 5CHEA 4EKYA 1I7DA 4MMZB 3VAAA 5MN4A 1Q3KA 1TTHA 1RU3A 1HOTA 1K6MA 2A84A 5B53A 4D3ZA 5HW0A 1UIMA 4QUKA 3GB9A 1IG3A 4PPYA 4KPYA 1JI3A 2B98A 1J5PA 1GPUA 1PK8A 1TIBA 2HBQA 4XVRA 3WG9A 4K9SA 3WBJA 3N0RA 7YASA 2XMPA 2YZMA 3B52X 1RXVA 4J7CA 1Y37A 2ACVA 1DQNA 1LF0A 2WMYA 2ZVQX 4W99A 2AOTA 4DQVA 3IO3A 5DOZA 2LNDA 2PBRA 4YRNA 4BKQA 3M1IA 1Q1QA 1T0BA 2VAWA 8GPBA 1HBJA 1QP8A 3FNIA 2QLTA 3LI2A 4FOOA 3T5GA 1FFBA 5EE3A 3AF4A 3I0MA 3GMSA 1XEXA 1E1RA 1DKOA 1PZXA 1Z13A 4E5PA 2H1VA 3EIQA 5KQRA 5ESRA 3F46A 5TMDA 3OTOB 3UATA 3GFOA 5BW5A 4W5NA 5FOWA 3ZNQA 3H65A 1OBFO 2ZQYA 3UCEA 2OBYA 5CH3A 3B2QA 4CTKA 3T9CA 5BUQA 1WDKA 3H83A 3V48A 2QBYA 2PWYA 3T3HA 1ZR4A 8AT1A 2XZLA 3DXYA 4GSLA 2QW1A 3DF9A 5LQSA 5F12A 1YZFA 2FETA 3PD1A 4JLJA 4FWBA 2FHPA 2RI0A 1O7JA 3LOUA 3QWHA 4NFSA 2OMKA 1R8SA 2IXGA 3G5UA 3O84A 4OXYA 4DJJA 1IEVA 2DUJA 1QR6A 1NI4A 1TJPB 1Z06A 4LK2A 5DKFA 4WVFA 1PD1A 4B6QA 4C4SA 1YRBA 5A62A 3PFBA 3ZE7A 1VRCA 3AJ9A 3CZQA 4J29A 4D8WA 4EGAA 1J25A 5CVEA 1P9LA 3WK9A 4C1NA 2EKBA 2ODAA 2Z4SA 4KPFC 1KI9A 2I4LA 1Y42X 2CNBA 3DH0A 3FB1A 3HADA 2RGXA 4Q1AA 3UC5A 4K46A 4GVXA 2OZEA 1CJSA 3AUYA 2G9RA 3HJHA 4KUHA 3IOCA 4PC1A 2QTCA 4GYYA 4Q21A 2OQIA 4LKOA 2W2KB 1USIA 3I6YA 2WVGA 3DG9A 4PU0A 4X45A 1F8GA 2AZXA 4EGQA 4EO4A 3K4HA 3QOWA 4LVCA 3UB2A 4BMNA 3MRVA 1D2HA 1Y8RB 2GLTA 1OGJA 3WDMA 1U7OA 1YBHA 1KIFA 2R8YA 1CJBA 3O1HB 4EA6A 5JZBA 5HS4A 1DT3A 1I1QB 3FZQA 5A4AA 4DARA 1QGED 1RPZA 2G9VA 3TW4A 1SBZA 1K7XB 3LSYA 4IOJA 3ZC3A 5CYPA 1YI8A 1P6QA 1LLDA 2OR3A 4HB2A 3KL2A 3PEYA 4YQYA 4GPD1 4O4HA 3JVEA 1LCIA 4E5NA 3V8VA 2NZJA 3RIGA 4ZCQA 1W96A 3EIFA 5BV0A 1B42A 1HI9A 2V6MA 3DOHA 2WE7A 5JC8A 1URPA 3ZQ4A 3FUXA 3AL2A 2O59A 4FYYA 2OHOA 4NABA 3M81A 2FAXA 2WQ6A 1J8VA 3NIGB 4WOPA 4YNBA 5JH7B 1S2OA 1T5SA 4B48A 3QLTA 1B6SA 5FCDA 3GDWA 1ECJA 3KLBA 4EKDA 4LEIA 5J4YA 1TRHA 4IHQA 1ZIOA 3BKXA 1HX7A 4NJEA 4RCZA 3SY8A 4MKHA 1PDOA 5FR1A 5KZMB 4FN4A 4BAGA 3P2OA 4PRKA 3BXGA 4DT1A 2CLKB 1CZUA 3RI3A 5LNK6 4FHDA 1IHDA 5LKAA 3L01A 3P4XA 2NNLD 3HBLA 3HM2A 2AX4A 1PWYE 3RFVA 3R7WB 4JV5B 2R6GA 4WZAA 3O95A 4BASA 4QQNA 2OCXA 3MHPA 3E3AA 5DSZA 3DO8A 4Q4JA 3TNJA 1KY3A 2Y93A 5K2OA 1MRSA 2Q07A 2YYZA 3GMIA 3VNUA 1SM4A 3FDZA 1CEXA 3RW9A 4EI8A 4M1OA 4F2HA 3IAM1 5U1PA 2HM7A 1GA1A 2ZJAA 3RBZA 3DOUA 1GFWA 3H16A 3IQEA 2IP1A 3IH5A 2CDAA 3Q9UA 3MIZA 4HDKA 1KS9A 3THXB 3N2ZB 2RC5A 3HEMA 4UDYX 1ZXBA 2G72A 3SZUA 4A9AA 1U28C 1RACA 4YMIA 3L84A 4BUZA 1E1CA 5FI5A 5GWXA 1YCFA 4WOKA 5CVDA 1UAGA 5LZ8A 3BSWA 3OOSA 4UC0A 1E92A 4BBPA 4DR6B 2CVFA 3KPVA 2PQ6A 3UAOA 1TA4A 1RQGA 5I01A 1IMJA 1Z82A 3GNQA 1E96A 1CKEA 1PV2A 1W73A 3KT3A 4HBGA 5KVCA 2A14A 1BGVA 1NXSA 3UW1A 3CEPB 1FNDA 5IM5A 1H94A 1KE1A 4RCYA 1KY2A 3ZNNA 5L6MB 4EUNA 3MMZA 5DYTA 1H8HA 3H84A 2WFZA 2WIFA 2M6RA 5IUNC 1LUAA 1ZICA 4RPLA 1OZGA 3QYAA 1Y7LA 2XTZA 3F6CA 4LMBA 1JFSA 1VG0B 4CLXA 1OVMA 2NUAB 2YNMD 4DREA 3VVLA 4Q93A 1PHPA 1RYEA 1C1XB 5D87A 3SD7A 5I9SA 3GNSA 1GYQA 2JGDB 3N8HA 4WL0A 3AW9A 2OCYC 1GAEO 1SG0A 1QGYA 2I1WA 1PZHA 2G88A 1UC4B 4QM6A 5DBFA 4A16A 4EI7A 3EOAI 2EFCB 3ACBA 3NJ4A 5B58C 2JBHA 1X1RA 2W7TA 5AVQA 2AQKA 2G63A 2FXIA 3RJMA 3T6KA 3VZRA 2KBEA 4CM4A 4HLUA 3U16A 4RZUA 2CL7X 4MYTA 4INOA 1J23A 3I61A 3D4LA 1JHAA 1O95C 1TCUA 3PWTA 1JAIA 4KZPA 4D4GA 4Q4CA 3UJBA 5CVJA 1EUQA 2VT3A 3RARA 1GGHA 5IKOA 1Z0SA 1GNPA 4PG6A 4FEEA 1ZWLA 1IVYA 1GTG1 1HL3A 3EY4A 1AGYA 1P9NA 1N9GA 1Q1GA 1QBGA 3NONA 3QUTA 4MVJM 4XZ3A 5LXTF 1AXRA 1T6BY 2W6NA 1DKNA 1Y9AA 3MWKA 4LC9A 2AUTA 2BFDA 4GM0A 2HJHA 5HYVA 2YFYA 3PKJA 2BGKA 3AF2A 4QXPA 4ASUA 4AZWA 2HA0A 1WLYA 2EFYA 4AM8A 3VTFA 1CUBA 2FUCA 3OLXA 1OZHA 4JD5A 4JKOA 4XPIA 4LHEA 4H3SA 1NR5A 3DNPA 2ODWA 4LZZA 3CIFA 1Z5ZA 3DZIA 5IT9A 2CK3D 2JA1A 5JUWA 1DG1G 1CQXA 3B1XA 3FPSA 4RTSA 3NFRA 1GAWA 1AG9A 4ZZIA 4BZQA 4G0NA 3W06A 2D1SA 3F67A 2QWXA 3PHJA 3SXPA 4A8TA 2JFZA 3V34A 4Z7NB 4ZJUA 3IR7A 4IS2A 2J87A 1X14A 5T6MA 1S3IA 1CRLA 1V48A 3EG9A 3RHTA 1FQKA 3A05A 4EY3A 3ZLBA 1TO1E 1ZSYA 2WNSA 3RDPA 1B23P 2ZT8A 1ADJA 2X7XA 1MV5A 3T4UA 3IE1A 5FA6A 2GRAA 1W25A 3QU7A 4H6WA 4XQ9A 3EZ9A 3EDOA 5COBA 1XJQA 5DXJA 4B8ZA 2G4CA 2GJAA 3DBVO 5JJKA 4N40A 2FP4A 3C39A 4TQAA 3INNA 5G4KA 4YWHA 4OHXA 4JI0B 3KS9A 4MZDA 2OFFA 1GPKA 1E2MA 1WZCA 4GAEA 3O8NA 1GV1A 2ZUVA 2YTZA 1U8AA 2R6ZA 4KBFA 4URVR 4ENTA 5KWSA 1II8B 3LBNA 2ZRNA 2WB4A 3SIWA 3GHYA 3VZQA 3G2PA 4QRHA 1XA4A 2WKSA 3AMVA 5DCLA 1Y33E 2I6FA 2FPGA 4IDDA 1KEEB 3F4BA 3JYOA 1L1RA 4XAQA 1P33A 1HEUA 5BNTA 5ALPA 5C7OO 1GSAA 4OA8A 4X3PA 4OI1A 2BGGA 3Q6IA 2Z56A 3FNEA 3MILA 7ADHA 4EZEA 3H8SA 1WXQA 4D44A 1Z6YA 2AR9A 1FU7A 4KJXA 1VCOA 2HK7A 1V47A 4OGLA 5LWQA 5JPIA 4WE3A 4F85A 1LDGA 4NH4A 4BNTA 2FW9A 1O0BA 1CHDA 1MRZA 4DLNA 2XITA 4LC0A 3QVJA 1QTNA 3MSXA 4RS3A 5DHTA 4CKBA 5C5DA 4GM4A 1SJ9A 3LF1A 3O4VA 4N39A 1VHDA 4G5QA 2C29D 2CE7A 4BNGA 2VTDA 3B7GA 2AMLA 5ALXA 2GPTA 2YWEA 1VLLA 3QBVA 4R0MA 4JL8A 3LUKA 1BDBA 3P2KA 4WZAE 1H9CA 4E0BA 1NBME 4GYWA 3V2IA 4XWWA 3B5JA 1TJ5A 1O57A 4GOMD 1A9PA 1HMPA 2ODBA 2Q8PA 2Y6VA 4BAUA 3GFBA 1ZH4A 4HQKA 1E5VA 1YIAA 4K6KA 4NU8X 4FNMA 5IBRA 3KUKA 1EVJA 3IKJA 1MOPA 5H83A 2O57A 3CX7A 3EIUA 1ODJA 2PMWB 4KBGA 3V55A 3ZDXB 2H29A 4B46A 4EGJA 4MR9A 5A3JA 5CDYA 4MOWA 1QG0A 3KZXA 3JWJA 4R8KA 3GJ7A 5BSKA 1ZXLA 2QI9F 4YXWA 1I2DA 4WBNA 3KPJA 4KR7A 4ZAFA 3QFCA 1FMLA 1ELOA 2FZCA 5JJIA 4GZ6A 4IUCS 1GR0A 4S3MA 1SU8A 1EHIA 1KMMA 4IEEA 4Y1RB 3V4PB 1P5HA 3MGKA 1FF9A 1SA0A 3EGCA 1LI5A 4EQZA 3UMSA 1KR2A 2AGVA 4LE1A 3HKEB 2HSJA 2WJGA 2R6CA 5AKHA 3X44A 3EEOA 1MABB 3AJ8A 3L5KA 3M4JA 4JLBA 4Z3DA 3TUJC 3IVGA 5HG0A 5KYKA 4YAJA 1NWCA 1P73A 5FQOA 2HF2A 3F5QA 3IEIA 2GUGA 2FHSA 3W2IA 1XF9A 3O82A 4KXQA 3R8FA 4GKJB 2KSQA 2VATA 1HDXA 3LHKA 2B1GA 2G17A 2XRMA 4QGSA 2B0CA 5K09A 1VMAA 4XYEA 4JCOA 2ZTMA 4RY8A 2ZJ0A 2QN9A 2AN3A 4IS3A 3OJXA 4NMHA 2LIVA 3NMUF 1YJCA 3A7DA 4FZ5A 4G9EA 2Z6QA 3QX3A 3VX3A 1GTVA 1NN1A 3K2EA 3LMKA 4WCFC 1NTOA 4UULA 3K5IA 3ZD9A 4BB5A 4S04A 3CNOA 4MAAA 3FDFA 4LV8B 3N70A 3OG9A 5JASA 2GCNA 3BQMB 2FZVA 2ECPA 5GIPE 3AFNA 3MM4A 5IUKC 4N5NA 2EWWA 1BWRA 1GEEA 1P1JA 2EGUA 3BH0A 5GZ1A 5T4EA 4M60A 4DMLA 2CUTA 2HGSA 1YBVA 3TOSA 4D0RA 2ZANA 721PA 2XUQA 2W22A 2YZ2A 5KNCA 1K2VN 2PKQO 1K8ZB 2O2DA 1MGPA 2CLSA 3EEYA 4IKPA 1FE8A 3E9MA 2NU6A 4AJKA 1Z3IX 3GUYA 4TTRA 4R2JA 2P2SA 4HR7A 2WU4A 4F2WA 4H7EA 4KO8A 2PLAA 3RK0A 5J3JA 2XKJE 3GIDA 1GKYA 2FG7C 2AN4A 1SWWA 1PK9A 4EPVA 3TQRA 1RHRA 2XBUA 1PJQA 3HE3A 5FYDA 5L3QB 1XEXB 2VDQB 1SK9A 3TE6A 3ZBPA 2V6IA 2IHJA 4P3NA 3LP6A 2N3ZA 1L4BA 4L0DA 3HSSA 4N0QA 1J2YA 1GGMA 4LGVA 5BQ5A 2NO5A 2ADMA 1NWHA 2CHUA 1KI6A 3OLZA 5EERA 3ZHRA 2WPDA 1XZCA 2VCEA 1AZTA 3HCAA 3ADPA 1HORA 3BE6A 4J8PA 4ON9A 3Q3EA 4QDJA 1P2DA 4BO5A 4DMGA 1BN6A 1LDYA 2WJIA 4I4LA 1ST3A 2YC2C 3IO5A 1OYVA 2BMAA 3LUHA 4NBUA 3RWMB 2QKYA 1VQ1A 1H6BA 1AX9A 2ZKLA 1VLHA 1P4GA 1R4AA 1JLHA 2VDVE 1CZNA 4BKPA 4UATA 2BTQA 1KY4A 4B09A 2X22A 2B30A 3CHYA 4CV0A 9MHTA 1AH2A 2ZSFA 4I1YA 1I94B 1N2XA 4E15A 1I3LA 5AW1A 2JS7A 1L7VC 2ZIFA 3FGZA 3ND8A 5G0WA 2FP4B 3GFFA 1VHWA 3KT0A 1XK7A 4GSKA 4LYFA 4N4AA 1LRLA 2ZYTX 4EY7A 3LLCA 4AXBA 4DLWA 2EBWA 1RS0A 2OBLA 4LMRA 3WSTA 1QG4A 1Z6QA 1PV1A 4H1UA 1ZSVA 1ZMBA 1K6IA 3O38A 5FOUA 2J5XA 3UV3A 3TYXA 3E9RA 1IN6A 3PJDA 4KTTE 5HF8A 1N4AA 2C4VA 1XKTA 3A3PA 5KOHB 4LHYA 3Q3GE 1YDGA 5HIKA 2I71A 1Y4AE 2QTRA 2QTZA 4OSOA 1PGNA 4CKYA 4MPJA 3GJ4A 5I5GA 2WP0A 3USZA 4EPTA 3PSHA 3WJAA 2C59A 2YMPA 1Z73A 3WGGA 1XMXA 3IPRA 3NANA 1BMQA 1R0ZA 3EQ7A 1ZHHA 4ECAA 5FI3A 1VE3A 2Z5VA 3HCBA 3P9NA 4BDSA 1KZYC 1U3VA 3H5NA 4YREA 3TUIC 1N9KA 1YULA 3UYKA 4JN6B 3AEYA 1EMDA 4TKLA 2D0PB 4HO1X 4XVUA 3PFWO 2DQ4A 3H1FA 4LMPA 3IMGA 4UE3S 3QBDA 2LRHA 3DCJA 1EP3B 2P6UA 2P0YA 2PKYX 5JNWA 3HVHA 4JBLA 2IPNA 1Q0UA 1F0NA 1N6IA 2C96A 3QEOA 5K01A 5FWXA 3U6BA 2V03A 1SU7A 4ED9A 4MR7A 5CNIA 1M2VB 4PX5A 4XB6B 1D5WA 3BULA 2B20A 3HO6A 3HH8A 3WAGA 2DP4E 2JJ1A 2RHWA 3C48A 2BISA 1G6HA 2X4GA 1KNXA 1SZJG 4K3UA 4KE7A 4L4YA 1E6LA 1QO0D 2QUJA 2G40A 1IXSB 3DQZA 4MR8A 5KB3A 1VE1A 1Q2UA 2GUWA 3DEHA 1PQWA 4JQZA 2FVXA 1NKSA 3EMKA 4HB4A 3HG7A 2BOVA 1TLTA 1BD4A 2AJLI 4LECA 1NZJA 2FSGA 3T34A 1P0IA 1MQSA 1P0QA 1IL0A 3KJXA 1HE8B 3MT7A 2XUGA 4J1SA 4DPLA 4AG5A 1VSBA 2I9PA 1G63A 3IV9A 3FLAA 4AUKA 1SCUB 2QMHA 2WTXA 5G1NA 1K3FA 2IT1A 1BQEA 3O8DA 4I7EA 3VA7A 3V6LA 2CNDA 2FX5A 2G09A 3LYAA 3GP5A 3JRNA 3TTTA 1Y8CA 1YAHA 7AT1A 1W1UA 1WCIA 4Q18A 2E9SA 3KFVA 4YJDA 3H2KA 2QRGA 3Q3IA 3E0XA 3UK7A 4F21A 1EIZA 1LKZA 1T24A 1WOYA 1T15A 1H23A 2VTVA 2ZUUA 1MO2A 3L7CA 3QV1A 1DQRA 1L1QA 3K71B 2B92A 3T9FA 4MHTA 1EUZA 3IUNA 1E4EA 4G07A 4WK4B 4YFVA 1AZLA 1VMKA 1QPGA 1UC8A 1I13A 3FTPA 3MTDA 4P0QB 4KRXA 1Q17A 4S1NA 1FW6A 1X7ZB 3SG0A 2P2DA 4IKEA 1LJUA 1RBMA 4P82A 1G2PA 2QAGB 2PS3A 1QC5B 2J85A 3OF5A 1QORA 4JOCA 1NRIA 1LBEA 3R5JA 2G08A 3ADDA 1LDMA 3SHOA 3GIWA 2O4CA 4ZC8A 2YIVX 4F8YA 5CGZA 2G71A 4MGHA 1UP7A 3DONA 1BE6A 1U1IA 2IH2A 3FKSD 4FWIB 3JQQA 3WWEA 4I4IA 1UDCA 2GILA 2P4QA 3BIXA 4H0NA 3RVJA 5L51A 3THRA 3RTDA 4D57A 2OCPA 3L0PA 4WK2B 3M1LA 2FF7A 3ZK8A 4UUQA 4CMAA 3VNAA 4WEQA 5A6SB 4FYVA 4RPCA 3NEPX 1DRWA 3UCXA 3ZBTA 2IUYA 3CKKA 4E70A 2WD7B 4WKOA 3CGWA 4W9RA 2C88A 1LSSA 3GLHE 5JCJA 4U6QA 4MRNA 4YJ3A 2F3QA 5AUOB 3W5JA 4LGYA 1KQGA 2AV6A 2J09A 2OC4A 1PYGA 2QPLA 4UOZA 2VNAA 5CLHA 3BICA 2JPDA 5BOSA 1C0EA 5F1PA 1MH9A 3K5PA 4KAJA 2PD3A 4H4CA 3KQHA 2P9JA 3EK2A 2C04A 4DEVA 3A2KA 2JFPA 1A5ZA 4YAWA 5LQDA 5DASA 2IYSA 2CVHA 2A67A 2GZ1A 2HF8A 3NBAA 4PC6A 4ZKEA 1GU1A 3E3LA 1NSFA 2FGKA 1RQNA 1NLZA 2R60A 3FBWA 3ON5A 1KQFA 3QFRA 1B74A 5FHRA 1Q7CA 2JI8A 4MS4B 1D2CA 3L43A 1W48A 4H0CA 2IE8A 3IHWA 1FTGA 5K6RA 1YA8A 3U7QB 3ODGA 4JJAA 5IM4A 1GNLA 2G9ZA 1MV8A 2J4FA 1FUEA 2Q21A 2VZ9A 4UUNA 1JFLA 3UJPA 1VE7A 1ZL2A 1SZPA 2OC9A 5EJIA 3IVAA 2AFRA 4K5QA 3IAS1 4Y1GA 1XD8A 3VR1A 4QEDA 2VF4X 3ONFA 2EJBA 4FZRA 2PX4A 3PQCA 1VDMA 3F6BX 3T7DA 2E4YA 2QYSA 3HCNA 3PXEA 3VAYA 3KTFA 1VGVA 3VMFA 1Z0JA 2ZWPA 3EDQA 3OE4A 4MI1A 2ONZA 5K51A 4YIHA 1SHTX 3FBGA 5I8ZA 4FGSA 1TM4E 3LECA 2JRCA 1WHSA 4D4HA 4H60A 1BA2A 4HDRB 4UTNA 1GTL1 3DSRA 3WB1A 5EQFA 4UCQA 3EUEA 4LDAA 2HA2A 5C32A 1QTQA 4ZGGA 1KZ7B 5HRCA 2LVBA 1P7CA 1AF7A 1D4OA 4IVNA 2DQYA 3G1TA 1DRJA 3R0XA 2Z2ZA 4MJXA 1YBFA 4YRRA 4JLAA 2CLOB 3I5MA 1SXIA 4NMLA 3V80A 4E5VA 5HUHA 2Q29A 1WABA 2WTAA 1E8NA 4DUPA 1PG5A 1I2MA 3FCOA 5ALEA 3WLFA 4KWEA 4E2FA 3ZEAA 4ETMA 1Y1TA 1W6RA 1W52X 2R7KA 5F1OA 2MU1A 5IJ0A 3AB7A 3KAPA 3SEAA 1RRPA 2BE7A 3MC1A 3JVVA 3WL7A 4YMGA 1E69A 1FFCA 2BI7A 3IQGX 1PFGA 4FP9A 5A03A 3OM0A 3GZTB 4J0GA 5BY2A 1WMBA 5HOQA 3DKIA 5KO2A 5M34A 1P45A 4EAAA 3VI3B 1V26A 2H2WA 1DEKA 5IU6A 3THXA 3PL1A 4TTTS 3OLVA 3HZZA 4Y0NA 3I3SR 3MUOA 4LI0A 1QRUA 1YJBA 1EGMB 3OIFA 2QOEA 3EFOB 3RT7A 2GBFA 2ZS8A 2JCGA 5AP9A 2V4UA 1I0ZA 5CRIA 1YQTA 1IPEA 2WF5A 1GQYA 3ETDA 5EWLB 1YS4A 4ZVOA 4ENUA 2XA1A 1FQOA 2YW9A 1NF3A 3KJGA 5E7MA 4CMCA 2AEJA 4JBGA 3D02A 3DBRA 3EVTA 3H2IA 5JHGB 3W5AA 3RF6A 5BW8A 1V5WA 3L0BA 4TVKA 4WXYB 2H8GA 3QNUA 4PONA 3IUMA 1PLKA 1SUBA 4E5DA 1G5FA 1GCIA 2A7XA 3QYFA 4HXFB 4IIEA 1ESEA 1WXFA 4QNRA 2FZKA 2RD2A 3FB4A 3ZZUA 1W30A 1JLMA 3NCHA 4LVUA 1O8CA 1V9SA 5BN5A 3PVCA 4FKMA 4I4NA 1Z9BA 1ZU4A 3BMOA 1R8JA 1KKLA 1TTPB 2DF8A 1TKAA 2G8LA 2IXDA 2Y05A 3BD6A 3FMIA 3IJPA 3PXUA 1PJ8A 3SC6A 1JFTA 2I8LA 3P20A 4TVOA 1AQLA 2N42A 4JB2A 5JSZB 3NT4A 1ENPA 4DPKA 2DUNA 1G20A 1R12A 4MPTA 1GCAA 1X1SA 2VRNA 3ICVA 3DZBA 1ZN9A 2JLWA 2F64A 3P8ZA 1YFZA 3AB8A 4L5CA 1JSXA 1SXGA 2LE0A 4QHSA 1YFKA 4BQQA 2I2CA 1NNSA 4XLLA 3MVEA 5DRTA 3TLBA 1FC0A 1IH8A 3SP1A 1FFEA 1KWKA 5HGXA 3MSCA 2C3MA 3U4DA 2HU2A 5DGCA 5JG7A 4YT4A 2YFHA 4RSGA 4KAXA 2VHXA 1QH0A 2IU3A 3D3EA 4YGYA 4DUGA 1GRCA 1RWOA 3S1AB 2QRLA 3IDFA 5BO5A 4RLHA 3UOAB 2CMHA 4JASB 2PH3A 4ONEA 5CW2A 2ET6A 3RUDA 2Z57A 2GZHA 3DDUA 3ZZNA 3CQ9A 2HAEA 2A5JA 3BXHA 1R6AA 5JVDB 5AD1A 1EDBA 2BTEA 3T5PA 2WY2D 3OPNA 3QLUA 4N3GA 3QBTA 1FDRA 2FTKE 2HI0A 2VDUE 3RUFA 2OZPA 1UFOA 2B6NA 2ZWOA 1XRMA 1JDJA 3LBIA 3FMFA 4IIUA 4LXHA 4UFNA 4DJDC 2YY5A 5JQGA 4TTJA 4J0QA 4B83A 3WWOA 2R79A 4N0PA 4N7RA 3H99A 3JQBA 2IDZA 2IOHA 4PQYA 3W8EA 1H2EA 2H3HA 3QVXA 4UTRA 2E21A 1UEIA 3IMCA 4G8JA 3EVBA 4KWTA 3V5NA 1VKZA 2G83A 1CCWA 3EAFA 5B1IA 3R9WA 4KHZA 3KXPA 4KREA 1E3TA 1XHLA 3IQFA 4IDGA 2XQIA 1U0LA 2CHVA 3O1IC 4LXXA 3NWJA 1N5KA 4Z86A 2V0NA 5I7UA 1KO4A 3L8CA 5AOAA 1GQOA 3SR4A 3GCDA 3QVTA 4PZUA 2BCJQ 4XVHA 1Y82A 5LBUA 4AXXA 4YMUA 2QRKA 3VR4A 3EFBA 2C4UA 3V4ZA 2Z9BA 5TSDA 4OLFA 3TL3A 2PZKA 2I6QA 5EMNA 1KPIA 4N03A 1DEXA 1UJBA 4FMDB 4JFRA 3V4LA 4V1CA 5K0CA 1DELA 5FNVB 1C8BA 3ZWWA 4E4YA 4KMSA 3IDZA 1WXHA 3EDMA 1W87A 4MQEA 4MTCA 4ZXPA 5BWMA 5IJZA 3K92A 2LCFA 3V2HA 1CY1A 4OOEA 5E6RA 1RBYA 4OOFA 2KW5A 4AN0A 3S28A 3U60B 4RIEA 4OG2A 3A4TA 1C3OA 2VQSA 3UAWA 2QTVA 4D8XA 2Z3VA 1JLKA 3ZX5A 3BTOA 3CJTA 3ZNPA 4COKA 5GJCA 1B3RA 3QUQA 2YY6A 3FNHA 1WB4A 5DHFA 3SAJA 5D6NA 3UHAA 5IDWA 4WY2A 2UZ4A 3NC4A 4KUGA 4DCPA 1RRGA 3AHEA 2RIPA 1QUFA 3QYJA 4C7KA 1U3CA 2PX6A 1WZEA 3LY9A 1ZPDA 2RHCA 2Q3LA 5ADUS 1PL8A 3VSCA 2EJVA 1CETA 4B3TB 2Z9CA 4OXNA 1KGDA 3DTVD 4J3FA 4X6LA 2QV7A 4IHJF 1NC3A 4GEGA 2QTFA 1YOBA 3EXHB 1M33A 2WBLC 4D4JA 4WLUA 5EOVA 1KSGA 4CM3A 1I51A 1H2ZA 4DCCA 4FDTA 3CLUD 4CE6A 1FSPA 1YR8A 1J06A 3I5AA 3O31A 4K87A 3ZE0B 4FVTA 4AY4A 2V59A 1JHRA 4I4TA 3GLUA 5HIMA 3EZ6A 5CX4A 2EDCA 2YC4C 4L8GA 5IZ4A 4PGMA 3ZDBA 1KORA 2WG1A 1XDGA 5JNLA 1K0UA 2ZRLA 3EUWA 3B78A 3TLJA 1E94E 2OZKA 3BGIA 1WCV1 4CEJA 1U8UA 4WBNB 2PWBA 2WU3A 5C5IA 5LQMA 1G98A 1NM5A 2PQ2A 3OPYA 4LIPD 3ZJYA 3SX4A 2O2ZA 2VHCA 1XTUA 4Y1RA 3VV3A 4BJ1A 4L16A 4WDRA 4X8HA 4C88A 1PZGA 2FKAA 3CLTC 4CFZA 1U6JA 4GYJA 2WTMA 3TNYA 3FHTA 4NVRA 3R3XA 3IMKA 3R3ZA 4J0IA 5A4DA 1JGTA 4GUAA 1XPRA 1USKA 1JDNA 1II0A 4D45A 5D3KA 1N1EA 4LZAA 1GGEA 4N6GA 2QZ9A 2DPMA 4IRXA 3C3MA 1BS1A 1WU7A 1JHVA 1E4OA 4ZT7A 5CDTA 1BMDA 4IHJB 2P3SA 4WGGA 3HLTA 4L22A 1RAFA 5K4HA 2HNKA 2ZBRA 1NNLA 2AWOA 4MVJG 5IANA 4WNAA 3A3YA 4E5UA 1VYHA 4WTOA 4PG7A 1LJ8A 1VKJA 3DKVA 2C8KA 4YV2A 1BH6A 3WJ2A 1F2UA 3DKKA 3WLJA 2PZJA 3MQ2A 3EODA 5JD3A 1NUTA 2PGIA 4IIYA 2Q9CA 3MERA 4U5QA 4C6TA 2KHZA 3MWDA 5H1YA 1G20E 1VKNA 2BTOA 2YMLA 5TMBA 2DWUA 3UWKA 3K9GA 1RXSA 2CNWA 3DS8A 2FOIA 2R8XA 1H66A 4TROA 3L92A 621PA 1IJKA 1XX6A 4B0OA 5JEEA 2PAAA 3PCXA 1DAFA 1NVDA 2NWQA 3HDQA 3SYLA 4RACA 2NVBA 4TWAA 3F96A 2DY1A 2ZBFA 5DLQC 4EYKA 1VCMA 4RU1A 1Z6PA 3FPLA 5HMMA 2H31A 1H4VB 4CEIB 4BVBA 3T3EA 4BEJA 5JT1A 4C1BA 4E07A 3IBFA 3L7DA 5DT2A 3PD0A 1RZRA 4NCHA 4MICA 3AY7A 3TLEA 1G0NA 4Q37A 3I5UA 1UUFA 3D8HA 5TNXA 4R01A 1YC2A 2JLCA 2E0IA 2W2VA 1SIOA 3K1TA 1X7XA 2OORA 4HATA 1XWFA 1NW9B 3QQ5A 3ANNA 1CRWG 2GCOA 3NASA 3ZHZA 1F12A 1IWOA 1WCXA 3M6LA 3I9V1 1VYUA 3IUSA 1GQFA 4KGVA 3FCCA 3PXAA 2JIZA 3DYIA 3RC3A 1FY2A 4JLMA 1RQPA 1CC1S 4LNHA 3TINA 4JI5B 4D6YA 2FSIA 1BEEA 1RLOA 4KR9A 1O0CA 1JVBA 3GUHA 1J42A 1EJ2A 2J0UA 2CF6A 4KK3A 2P2ZA 1GPLA 1EBBA 3Q7IA 4OUKX 4RKQA 1X7YB 2FB9A 4V3BA 5FPPA 2P65A 1MCZA 4IYJA 5SZKB 4GPAA 1YS6A 3AYXB 3B51X 4RA6B 1QGDA 3EN0A 4B32A 4Y2SA 2MDTA 2BRUC 1U5CA 5LQAA 2WD8A 3PQ3A 4ZPXA 2PGLA 3MTEA 4Q05A 1S2DA 4YUWA 4Z9XA 4E30A 2O2EA 1LLQA 5HPYB 3U2QA 5EZYA 4CG3A 3ZKWA 2BHTA 3B1VA 4MI3A 4IJ5A 5AJUA 3GLSA 3PFHA 1FVFA 5A4FS 3WWCA 5LFAA 3QKRB 1V16A 2QRVB 3EPHA 4TV9A 4ND2A 1PF7E 3K70C 3WP0A 4LMAA 1FNNA 1YB6A 3SBXA 4D3YA 2QMQA 1EH5A 4C78A 1MZPA 1E0SA 2H48A 5B1SA 1UKZA 1VL1A 1ZJ5A 4WNYA 3K53A 3IE2A 4GKAA 1QV7A 4K6FA 2YUTA 5EXXA 4UCWA 1C4XA 2ZJ3A 4QHYA 4QDUA 1SCBA 1M1NB 3LCRA 4A8JB 2HQ1A 1JDPA 4YMHA 3B53X 5CFMA 2FWJA 1M34E 4BRWA 1AGXA 1Z4LA 2O0LA 4OGFA 4WLNA 4MS3B 5THQA 1F7VA 1PJ3A 3RBAA 3U7QA 1AUVA 3K2QA 4ZOLA 4EF6A 5CBPA 4FT2A 4S1OA 5GM2A 4ZD6A 2C9ZA 3Q3HA 3QW4B 3TPZA 2WAXA 5JYCA 1PFWA 3RAJA 4LF5B 4I8XA 5HK9A 3ZIDA 1NXWA 3P4YA 4UMDA 4WGFA 3MGAA 3LIPA 4W8GA 4N3AA 4OXXA 4OBBA 4W5TA 4X61A 1YSCA 4X6UA 4CKWB 1DADA 3MD0A 3GVIA 3OMLA 3ICCA 1F4LA 2Q2QA 1Q84A 2FW0A 2DB3A 1E6CA 1GARA 4G8DA 1G9XA 2NV0A 3PQDA