4X0WU

The crystal structure of mupain-1-17 in complex with murinised human upa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinctive binding modes and inhibitory mechanisms of two peptidic inhibitors of urokinase-type plasminogen activator with isomeric P1 residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords mupain-1-17
total genus 55
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x0wU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x0wU01
3ZV9A 1L4DA 1NESE 1PPBH 2Z3CA 1AKSB 3OYPA 3HGNA 3UNQA 1EX3A 2R3YA 1IQLA 2OXSA 4DIIH 1UTKA 4KP0A 2WYJA 4I8LA 3UNRA 1V3XA 2GDDA 4A7IB 4OS4A 1HAGE 3P95A 1XXFA 2BZAA 5A8XA 1D4PB 3LGWA 4B75A 2XRCA 4YT7H 2ZFPH 3SUDA 1NRRH 3ZYEA 1PYTD 2UWLA 4WH6A 2ZU1A 4ESTE 4LZ4B 3GY4A 2PTCE 1C5NH 4A1TA 2ZHDA 1K1MA 4CBOA 1SSXA 4AFUA 2EI7A 3ATWA 1DDJA 4AGKA 4BXWA 1GG6C 2ZPQA 3K65B 1WTHD 1HYLA 4ABDA 1WOFA 1HAZB 7GCHF 1O2GH 7ESTE 2PUXB 1GHVH 3A7WA 2VVVA 1A0LA 1Y59T 1VJ9U 1UTQA 1W10U 4JK6A 1QB6A 1C1OA 2XCFA 1DXPA 7KMEH 3CP7A 1EZQA 4UDWH 1BTWA 4NIWA 4JZIA 1O2YA 4OS7A 4YOGA 1DOJA 2ZKSA 2FESH 1Y3YA 4IN2A 4GSOA 1EPTB 2ZNKH 4IC6A 2ZF0H 3ZVBA 4UEHH 3GYMA 4MPUA 1THRH 1A46H 2J94A 1A1RA 1FZZA 1A5HA 2HVXA 1PQ5A 1C4U2 3EA8A 3RUOA 4MG3A 4CHAC 1EPTC 5A0CA 3O8DA 5ETXA 1K9OE 2Z3DA 2BY9X 1V2PT 4K1EA 4AB8A 1AZZA 5AVDA 1ZOMA 1FN6A 4LZ1H 1C5MD 1HJAC 4TPIZ 2ZFTA 1O3DA 3VFEA 3SUEA 4CR5A 2SGPE 2FI5E 1L0ZA 4XBBA 1W0YH 2ZHFH 1NPMA 1UK3A 1VCPA 3NCLA 2OC1A 1PPZA 3EAJA 3MO3A 1D6RA 3CS7A 3ATIA 1UVPA 3BSQA 3TK6A 1IOEA 3BTME 5K7RA 4ABIA 4BNRA 1S0RA 1F92A 3DFLA 4AX9H 1C1VH 3I77A 2VIVA 1ZHPA 1WYKA 1O33A 1QY6A 1H4WA 1GVZA 4ZXYH 4CRCA 2FLBH 1O5AB 2R0KA 3M7TA 5HGGA 1TYNA 3T62A 5JBAS 1H9HE 3URCA 3FVFB 4Z6AH 3UPEA 3SJIA 1ELGA 3SU6A 1QL9A 1BMAA 3SHAH 1C1RA 1GBAA 1YPGH 4OS1A 3MTYA 5FCKA 3GCTG 2I6QA 3A7ZA 2FX6A 2CHAB 1GJDB 1QHRB 4LK4A 5LH8A 2D1JA 3RXDA 3V7TA 2P3TB 3A86A 1T4UH 3V3MA 2WV5A 1C9PA 1K28D 3RXKA 3F68H 3H5CB 5GCHG 1S84A 2ANMH 2B0FA 3B23B 4GCHG 4DIHH 1LVMA 1CA0B 4O97A 1GI3A 2BLVA 2KAIB 4ABHA 1DSUA 1Z71A 3ZZAA 1BTXA 1L4ZA 1B5GH 3PMHB 1O2ZA 1AZ8A 1YPLH 4AFSA 2FO9A 5EQSA 1A3BH 2P3FH 1CA0C 4ZKRU 4Y7BA 1KY9A 4GAWA 3OY6U 1KTSB 3DFJA 1IQJA 1RGQA 3A89A 4NGAH 1LPGB 3GOVB 3B8JA 2P93A 3M7UA 1AFQB 4B2AA 2TGTA 1HAHH 3ATKA 2ZCKP 5DGJA 4AB9A 2R9PA 4U30A 6CHAB 2ALPA 2FM2A 2ZWLH 1HRTH 1V2NT 1HJ8A 2GDEH 3A88A 3GY6A 1NFYA 2F83A 1AFQC 1LQEA 4AZ2B 4DGJA 5LGOA 1GHAF 2HWLB 1SGPE 4J1YA 1DUAA 3VB4A 1ARCA 1UK2A 1O2VA 1SGFG 5L30H 4DY7B 3AW0A 1BB0B 1BTYA 1BRUP 1AUTC 2FXRA 2Y5HA 3L33A 1T31A 1TQ7B 3QK1A 1SBWA 5EPYA 1Y8TA 3LDXH 3BTDE 3D23A 4GHTA 2ZDVH 3SORA 1G37A 3UREA 1EJNA 1MU8B 1DWBH 1W2KH 1TMUH 1Y5AT 1UTJA 1G9IE 2FX4A 2Q6GA 2A7JA 4A1VA 1KTTB 2Q6FA 1LPZB 1P8VC 2FS8A 3NXPA 1A0HB 5TJXA 3MHWU 1CT2E 2GGVB 4Y76A 3Q3YA 2D8WA 3AVZA 1UJ1A 4M7GA 3M36A 5HXFA 1TBQH 1K1PA 4Y11E 1HBTH 1DWDH 3UY9A 2ZGHA 1P2QA 2XW9A 3SU5A 1LKBA 2VWOA 1GHBF 2BHGA 4FVDA 2A45B 2C3SA 1GI9B 4WH8A 4X1RU 1CE5A 1DY8A 2ZCLP 1TNLA 4WF8A 4NIXA 3MU0A 2GZ8A 3D65E 1DM4B 1NY22 4I8KA 1QA7A 2FOBA 4BTIB 4UONA 1ZMJA 2UWOA 3FP8E 4A6LA 4D76A 4X6OA 2HLCA 3KHVA 1ZZZA 1SLVB 1EP6A 3RXLA 1LHFH 2PKSC 1U6QA 2ZECA 5EU8A 4B2CA 3ZVCA 4CRFA 1O38A 3O8BA 1BTUA 3L3TA 1S83A 2VNTA 2Y81A 4DW2U 1OWDA 1TBRH 2BTCE 1YLDA 3FAOA 2FOMB 3VB7A 1BJVA 3VXFH 4ABFA 1CQQA 1PQ7A 2P8OC 1NU7B 1SGFA 1AI8H 1FNIA 3NPSA 1P05A 3ZZCA 1K22H 1BCUH 2A5AA 1ACBE 5K0HA 4KTUA 3E0NB 2P94A 1GBDA 1EOJA 4X0WU 1P3CA 2THFB 1N6XA 1GGDC 4I32A 4K2YA 1XKBC 5AHGH 3EDXB 4Y10E 9LPRA 2GZ7A 4F49A 2W3KA 1T8MA 2BM2A 1TRNA 1O2TA 3LIWA 2TGPZ 4H6SB 1F0SA 1XUIA 2P3UB 4YOIA 2OC7A 3RC4A 1EZSC 1G36A 2ZDNA 2GVFA 3SQEE 1KDQB 5DP8A 1CBWB 2D26C 2RA0A 4NSVA 5DP9A 1EJMA 1PPEE 2JETC 1BOQA 1QJ7B 4NCYA 3GDUA 2WYGA 1H9IE 1O36A 3NWUA 1DLEA 1AN1E 1TX6A 4X1NU 4OGXA 1GHAG 2Z9LA 3LOXA 4JMYA 4IW4E 4Y8YA 2Z7FE 1O0DH 1C2KA 3S9BA 1YPHC 3U1IB 4TPYA 5DG6A 1NTPA 3M5MA 4AORA 1ZJDA 3SJOA 3UNSA 1O2SA 3P8OA 1DWEH 8GCHF 4RN6A 1L1JA 4BXSA 2FOEA 1A61H 1YGCH 1QGFA 1GJ4H 2PWXA 3URDA 4XOJA 1GBMA 4I8GA 1MTWA 2C8XB 4IMZA 1TLDA 1A5GH 3SNEA 1BJUA 4IBLH 2Z6BD 2A4QA 4VGCC 2JH5D 3ODDA 4JYTA 4BAKB 2PGQB 1XX9A 4CH2B 1OP2A 4MDSA 2PHBA 3FZDA 2Q6DA 1BIOA 9ESTA 2OUAA 1GCDA 3BTKE 4H6TA 2HRVA 3IG6B 1PPHE 1Z6JH 5DKMA 1GHWH 1GJCB 1TPAE 2R2WU 3KCGH 1G3DA 2ZFSA 1NFWA 2V3HH 1SGCA 3SUFA 3M5OA 5LPFA 5E0JA 4CR9A 2QAAA 1RD3B 3MH6A 4NWKA 1QURH 1AGJA 1YLCA 2B5TB 3RC5A 1K1JA 1SVPA 2A2QH 2PR3A 2OTVA 2NU0E 1VZQH 4OGYA 1KDQA 2J34A 3QZQA 1S5SA 2BOHB 4D9QA 1GL1A 4O9VA 1QJ6B 3S9CA 1DVAH 4FVBA 4TWYA 1Z1IA 2F9VA 2BY6X 1Q2WA 1BRCE 3PV4A 3SI3H 3F6UH 4INKA 3TH4H 1NRPH 2G8TA 2VJ1A 4AG2A 1OXGA 2F9NA 4NFEA 3GY3A 1ZPBA 2AMPA 4MQAA 2BD4A 2ZO3H 1C9TA 2GD4B 4ABAA 1K1IA 1W8BH 8KME2 1P10A 3I29A 3AAVA 5A2MH 1KLIH 4XBDA 4AG1A 1V2JT 4Y6DA 1AO5A 1J9CH 1NU9A 2GKVE 2CHAC 1AE8H 4LXBH 3RXCA 1O5BB 5TCAA 5EXNA 2F9BH 2CN0H 1EXFA 2A5IA 5F8TA 1Y3VA 2XBWA 1CHGA 1LTOA 2Z94A 5E0GA 4D9RA 4FUCA 4JYVH 2FODA 2H9HA 1TRMA 3BEIB 3SHCH 2HALA 1LVBA 4FU9A 1TA6A 4KELA 1ELDE 1V2MT 2A5KA 3B9FH 4O3UA 3E91A 5FCRA 5EOKA 2TBSA 1BTPA 3ZZ4A 2AGIX 3QTVH 1MTSA 2QC2A 3RXQA 1V2UT 2BDYA 4INLA 5B6OA 1TBZH 1WUNH 1QB9A 2ASUB 2H6MA 3E16B 1SPJA 3MYWA 2XXLA 1GJ7B 3UWJH 1O2UA 1JMOH 3VB3A 4ZXXH 1Y3UA 1OWIA 1AWHB 1OYQA 1GCTB 1GMCG 4YLUA 1YCPH 5C67A 1SHHB 1MQ6A 2BD2A 2TGAA 5JB8S 1C1WH 3LGIA 3Q3XA 3VGCB 3E3TA 4HTCH 4TY7A 4WXIA 4TYDA 1RJXB 4NA7A 1D3TB 1O5GH 4NZLA 1UVUH 1BMLA 4R0IA 4TWWA 3KQBA 1ZMLA 1PPCE 2JKHA 3M5NA 3OSYA 2G4UA 3MNSA 1OWEA 3K6ZA 3SGBE 3E0PB 3A8DA 4THNH 3EA9A 3UQOA 4WWYA 1D3PB 1EPTA 1E37B 2Y5FA 1SQOA 1YYY1 5EQRA 4HGCA 2QA9E 3UWIA 4WJG2 1ZTKA 3RMOH 3M7QA 5AF9H 1TX7A 4NA8A 1MU6B 2IOTA 4FUIA 4TY6A 4D7GA 1TNHA 1GL0E 3RDZA 1KXBA 1P01A 3SUGA 3VPKA 5GJ4B 2WPKS 3T28A 1P2IA 3A8AA 5FAHA 1BZXE 5DK1A 3TIUA 1AQ7A 3KN2A 2H5DA 3ATLA 1Y5BT 2KAIA 4WY3A 1IQEA 5EQQA 4NA9H 2VIPA 3TJUA 2ZPRA 1SL3A 2GV7A 3IWMA 4B76A 4FUGA 1W3CA 2K1QA 6ESTA 2FMJA 3Q3KA 1SI5H 5F8XA 5L2ZH 2ZU2A 4X8UH 2O8WA 1FIZA 1ZTJA 3F1SB 1T8OA 4XBCA 2Y82A 1LMWB 1SGIB 1ZLRA 2BB4A 3SU2A 2G51A 5JB9S 1FQ3A 2BDGA 5HM2A 4JZEH 5C3NA 5CMXH 1SOZA 3P70B 1BUIA 1HFDA 1JIRA 1HIAA 3KIDU 3R3GB 1Z8GA 4UFDH 2P8OB 1H8IH 1B7XB 4GUXA 2QXJA 1EASA 1T8NA 3A7XA 3RXIA 1P03A 3TU7H 3QUMP 5EGMA 1IQMA 3U9AH 2OINA 1ZRKA 3RM2H 3DD2H 3ENSB 1ESTA 4SGBE 4INHA 1A0JA 5JPMH 1PQ8A 2BXTH 2J95A 2Y80A 5JYIA 1EZUC 2ZEBA 3QGNB 3RC6A 2BDIA 5DP4A 3SQHE 4AN7A 2Z3EA 3RXVA 3MU5A 2ESTE 2B8OH 1HNEE 4CRDA 1C4Y2 2PV9B 1AHTH 1CGIE 3P17H 4Q7XA 2A1DB 1VJAU 4X1PU 2BQ6B 4GLYA 4YOJA 2HPPH 2J9NA 1TFXA 1UCYK 1MKWK 2UUYA 3GDSA 1GDNA 1D3DB 2BLWA 4X8SH 4WXVA 1HAVB 2ZHQH 3GCOA 1P11E 1FY4A 3JZ2B 4B74A 3PTNA 4ISLA 1IQKA 3VB5A 1W13U 1FN8A 3MU1A 2O9QA 1O5CB 2G52A 1E34B 4GVUA 5A09A 5I46H 2W3IA 1PJPA 1RTFB 1QNJA 2OBOA 1EUFA 1BTHH 1ZYOA 5HYOA 2ANWA 2OQUA 1ESBA 2TPIZ 1UTPA 1PQAA 2NU4E 1SLUB 3K2UA 5ESBA 2ZGXH 4UE7H 2JH6D 4X6MA 1P06A 4IC5A 1C2FA 1W14U 1V2TT 2BX4A 1MZAA 1C2HA 1GI2A 1KXDA 3Q77A 1THPB 3EGKH 3KL6A 2YNAA 1ANEA 3RU4D 1H8DH 1RTKA 2EEKA 1KXAA 1FPHH 5CHAB 3ZZ8A 1ELEE 2YNBA 1YCPK 1SGNE 1SQTA 1IQNA 2Y7XA 2W7SA 1ELCA 1OP0A 2UWPA 2ZU4A 1FIWA 4XE4A 1XUFA 1QBOA 2VGCC 4I7YH 5T6FA 1NRQH 3A87A 1AD8H 4UFFH 5DP6A 1L1GA 2A32A 2AYWA 1FV9A 1GBHA 3SNDA 3C27B 3GYLB 1CHOG 4JK5A 1TOCB 2VIQA 2G55A 4Q2KA 2BY5X 3BTEE 4X1SU 3PTBA 2A2XH 3TGKE 1VGCC 1BT7A 2AMDA 3GY2A 1AVGH 3A81A 3BG4C 3NZIA 1HPGA 1F0UA 1AIXH 2OQ5A 1CSOE 4H42U 1V2QT 2W5EA 2NU1E 1F5KU 4A5TS 1FY8E 2HPQH 4KTSA 1BBRE 1BITA 3TNTA 3ZVEA 3RMNH 1V2LT 3PLPA 5J4QA 1SOTA 3SV6A 1C2IA 3SW2B 2GCHG 3MNXA 5EG4A 4YLQH 2HNTF 4X2WA 3VB6A 1O3EA 2O8MA 3ZVFA 5E2PA 4K60A 1QIXB 2ZDKA 1TALA 3CENA 3PB1E 1B0FA 2GT7A 3PM3A 5E0HA 2Z9GA 3PLBA 1HJ9A 1YC0A 2Z9IA 3MH7A 1P2KA 1S81A 6GCHF 1GBFA 3T2NA 3SV7A 1MKXH 1O3LA 1EJAA 1EP5A 1TGBA 2BDAA 2NU2E 1V2RT 2Y6TA 4MLFB 1XVOA 4X6NA 1VR1H 3SGAE 1NROH 1TA2A 1GMHG 5DP7A 1O34A 4E7NA 1G3CA 4AYVB 1WSSH 3RM0H 4XDEA 4FU8A 1G2LA 4DJZB 5F6MA 2EI8A 2J4IA 1KXFA 3S7HB 1MH0A 2C90B 1QTFA 1HAPH 2VIWA 3ODFA 1EOLA 2BD5A 4ZUHA 1MTVA 1OYTH 3LU9B 1O2MA 1K1OA 1W0ZU 5JBTA 5L6NH 1YPJH 2WPIS 1VITG 2ODPA 1THSH 1A5IA 5HMAA 1ZMNA 1G32B 2ZTYA 1UMAH 1A7SA 1F5RA 4DCDA 1OP8A 1GHYH 2GCTC 4ZKNU 1YPMH 2BX3A 1NRNH 2XWBI 4DOQA 1JIMA 2H9EH 4OS2A 1P02A 4NSYA 3SN8A 2WPJS 1SMFE 4ISIH 1C4V2 1Z8JB 3SBKA 2GCTB 8GCHG 2BD8A 1HB0B 2FIRH 3A83A 2V35A 1G30B 1ZGIA 2AGGX 3O8RA 1WCZA 3WY8A 2F91A 3K9XB 2OC0A 4NWLA 3IITA 1WU1A 3TK5A 3KQCA 1IHTH 1BRAA 4BAOB 5L2YH 1C5VA 4CBNA 3EQ0H 1HAVA 1QQ4A 1GHXH 2B7DH 4FUJA 4K3JA 4X2YA 1XUHA 1O2KA 1MBMA 6CHAC 3UOPA 1NFXA 1UVTH 3FP7E 3LC5A 1HLTH 4YZUA 2AH4X 1T32A 1HAOH 1FLEE 1O37A 3HPTB 4Y0YE 2PW8H 2EI6A 5FX5A 4NIVA 1P12E 1RXPA 3A7VA 4ISNA 4MNVA 4Y7AA 4MPVA 1CO7E 4ABGA 1XUKA 3FZZA 2FOGA 4ZROA 2R2MB 1VITH 4Q7ZA 1M9UA 3PLKA 2GMTC 3SV8A 1K21H 1QRWA 1J15A 3MOCA 3UOUA 1HAXB 4YM9A 1O30A 1ELVA 1A2CH 1V2WT 2BMGB 1ETTH 3BTHE 2VH6A 1QFKH 1GI5A 3KQDA 3ZVGA 1QL8A 1W7XH 2ZDMA 2ZFRH 3SNBA 1H1BA 2P59A 3CS0A 2BD9A 1ARBA 1J14A 3TVJB 3MFJA 1CVWH 1ID5H 1SGEE 2O8LA 3UR9A 2ZU5A 5C1YA 4I33A 2CGAA 1K1LA 1WBGB 1IQIA 4Y8ZA 1P0SH 5FPYA 6LPRA 1UCYE 2G5VA 1FY3A 1V6DA 1TOMH 2BVSH 3PMJA 3V12A 1BDAA 1TB6H 2C93B 2GX4A 4K8BA 1TGTA 1XUGA 1C2EA 2FTMA 2H5CA 1LVYA 2WPMS 2XTTB 3RXFA 1GMDG 3BTGE 1AVWA 1NM6A 2H2ZA 2ZGJA 5FPTA 3ZZ3A 7LPRA 2AIPA 1SLWB 1AE5A 1T8LA 2ZFQH 3QDZB 2C8WB 3VEQB 1ZHMA 3QZRA 2A7HA 2STAE 5IYTA 1V2KT 3F9FA 2A7CA 1NO9H 3KQEA 4K1SA 4BAMB 2M5TA 1C1NA 3RXGA 1C5TA 1EB2A 1D6WA 3SU0A 2CF9H 1C1PA 1NFUA 1IQGA 1TPOA 2ZTZA 3M3SA 1AB9B 2FOHA 4ZMAH 3TLOA 4NZQA 2PLXA 4ZKOU 1Q31A 1UHBB 1QQUA 5EODA 1HXEH 1LO6A 1O2IA 5A8ZA 3U8TH 4I8JA 4B1TA 4H4FA 3LT3A 3A7TA 3M3VA 4DG4A 1W11U 1C5SA 2VVCA 1MMJN 2G00A 2ANYA 3RMMH 2HNTE 1XUJA 1W12U 1C2MA 1ZTLA 4Z0KA 3HGPA 1K2I1 2BQWB 2BZ6H 3UTUH 1IQFA 1DUEA 2ZZUH 4KTCA 4NG9H 2FLRH 3RP2A 2VWMA 2ZC9H 1NC6A 2BQ7B 3LGYA 2C8YB 2A31A 3H7OA 1MBQA 3BTTE 2RA3A 5F03A 1BRBE 2GTBA 2VIDA 1BBRK 1B0EA 1UVSH 1JOUB 1EAXA 4FUDA 2V6NA 1ANCA 1LVOA 1S0QA 1GMDF 2HGTH 1C5ZB 4RKJB 2OLGA 3HATH 3PMAB 4HI3A 1O2QA 5C1XA 3A7YA 1YKTA 1BTZA 1QA0A 1LPKB 5FBEA 1AU8A 1O2LA 2ZI2H 1BHXF 2QY0B 1TGSZ 4LOYH 1IHSH 3EA7A 4MNWA 1OKXA 5FBIA 1NS3A 1C2GA 1KLJH 5FPSA 3RXJA 1ANBA 1UTOA 1LHCH 3AASA 3R0FA 1GBBA 2GP9B 5T3HA 8LPRA 1ETRH 4WVPE 4ISHH 4AOQA 3U1JB 2TGDA 1DITH 4MPWA 3ZYDA 1C5UA 1F0RA 1EAIA 1O3HA 2QN5T 1BBRH 3MH5A 4Y0ZE 1AMHA 3TJVA 4JZFH 1FJSA 1YCPM 8ESTE 4FUHA 3P92A 3QWCH 3MU4A 1CHOF 2ZGBH 4UFGH 5PTPA 1GI7B 3L6PA 1IQHA 1GI4A 1Q3XA 2SGDE 1LHGH 1D9IA 1DT2A 1TGCA 2QGRA 3PO1B 4BAQB 2PTNA 5E8EH 3OTJE 2BXUH 2Y5GA 4HFPB 4Y71A 1TABE 2IPHA 1GBEA 1RS0A 1TRYA 2TRMA 1UTMA 4IGDA 5DO4H 3BG8A 5GIBA 1TNGA 2VH0A 1DS2E 3HKIB 5AFYH 3RMLH 2ZP0H 4J2YB 2QIQA 3HK6B 1S82A 7GCHG 1O3CA 1XXDA 3SV2H 4I8HA 2GMTB 1OOKB 2ZU3A 4KKDA 3TH2H 1UCYH 1C1SA 1YF4A 1VITF 5A0BA 1GJ9B 1AKSA 4GCHF 1JXPA 1ELFA 1N8OB 1GHZA 3ZZBA 3GISB 1GJAB 1RFNA 2QCYA 1HIAB 3ESTA 2AERH 2RCEA 1AUJA 1RTLA 4CRGA 5J4SA 1GMCF 2A4OA 1O2HA 1TPPA 1HV7A 1O2JA 3N7OA 3PWBA 4XFQA 1O3OA 3E6PH 1C5QA 3M37A 3SGQE 3VXEH 4QT8C 1N1LA 1UVOA 3STIA 2VIOA 2J92A 3QN7A 3K6YA 1MCTA 3RXBA 2FS9A 3ELAH 2CXVA 1YPEH 3BEUA 2Z9KA 1GI0A 1NZQH 1OWJA 1KXEA 2Z9JA 3P8FA 3SZNA 1C1UH 5C5OA 1O3GA 5HM9A 2Y7ZA 1GHBG 3GICB 4ZHAA 3BIVH 1P2OA 4ZHMU 3DUXH 1BMNH 1MTNB 3SU3A 3Q00A 5BPEA 1GBIA 5ESTE 4O03A 1SB1H 5DP5A 1GBKA 2ILNA 3GY8A 5FX6A 1WQVH 1DY9A 3H7TA 5G4BA 3T26A 1ORFA 1QRZA 3JZ1B 1SGRE 3UFAA 3DT0H 3C1KA 2BOKA 3PMBB 5LPEA 2F9PA 1ZGVA 1C1MA 1C2JA 1GJ8B 1MAYA 3P8NA 1TMTH 1MZDA 1P57B 2CJIA 5F8ZA 3U98H 3ZV8A 2YOLA 2ZFFH 3ZZ6A 2BVRH 4ZHLU 1XKAC 5JDUB 1AFEH 4ABJA 2FPZA 1S85A 2V3OH 3NK8A 1GDQA 1E0FD 3DA9B 2A4GA 3F9HA 5C1UA 1HUTH 1Z8RA 2G81E 2J38A 1JRSA 1O3PB 3RU4E 1CBWC 1YP9A 5C20A 1GWAA 2CMYA 3ATMA 4OS6A 1AB9C 2GCHF 2GT8A 2UUKB 3SI4H 3S69A 5TCCA 1GJ5H 1O2NA 1NRSH 1DICA 1HCGA 1Z8IB 1DSTA 1O2RA 5A0AE 1TQ0B 2Q1JA 3A85A 2OCVB 1MCVA 1SFQB 3RXRA 3TK9A 4U01A 1CT4E 1F0TA 3SJ8A 2FP7B 1PYTC 3UUZA 2BYAX 1O2PA 2FI4E 1L2EA 5C5NA 3QGJA 1DX5M 1TWXB 4JZ1A 2C4FH 2P95A 3T25A 2FZZA 3U69H 3RXAA 3E8LA 1WQSA 1T7CA 1P9SA 2AEIH 4UD9H 3SU1A 1KSNA 1GCTC 1UK4A 1ELAA 1KLTA 1LDTT 2XBVA 3PO1C 2EA3A 1DE7H 1G2MA 1JWTA 3RXTA 4IS5A 1TNKA 2XWAA 4K69A 1SG8B 5EPNA 3TNSA 1SFIA 4BTUB 1QBVH 1ESAA 1MKWH 1FXYA 2BY8X 2O8TA 1MD8A 2AIQA 1O5FH 3ZZ7A 2H9TH 3U8OH 1YM0A 3RXEA 1SQAA 1RRKA 2OD3B 3BN9A 4A1XA 3LH1A 3PWCA 4BTTB 1CGJE 4A92A 1DXWA 3M3TA 1C1QA 1GBCA 4ASHA 1G3BA 2FTLE 3F9GA 4FUFA 1WAYB 2LPRA 2VU8E 3M35A 1VGCB 1N8OC 1Z1JA 4E7RG 1LQDB 3W95A 3MNCA 2ZGCA 4MNXA 5LPRA 1O35A 2V0BA 4BANB 1HDTH 2SFAA 1DLKB 2I6SA 2XCNA 3GCTF 1OSSA 1WV7H 2VB0A 1HGTH 3E1XB 1C5XB 4SGAE 2SGFE 1DPOA 1O2WA 2SNWA 1UO6A 2ODYB 5SGAE 2PKAB 4WMEA 3BTFE 1OWKA 4ISOA 2AFQB 4K8YA 2WINI 3MU8A 3LH3A 3S7KB 1ANDA 1GJBB 2XC0A 3OY5U 3KEEA 1SR5C 4WMDA 1O3MA 3MNBA 3S0NA 4F4OC 4CRBA 3GCHC 5I25A 2FYRA 2IJOB 4JCNA 1ZSLA 3MWIU 4NIYA 1ZHRA 2ZHEH 1RIWB 2BDBA 1BQYA 4YO9A 3SJKA 2ULLA 2P16A 1C5PA 4IN1A 1TAWA 3QLPH 1N6YA 3VGCC 3QTOH 5GWZA 1L1NA 3AW1A 1V2VT 4ZH8A 2NU3E 1HAIH 1JRTA 2STBE 3OX7U 1GG6B 3KNXA 2PSXA 1ZJKA 2B9LA 4VGCB 1EAUA 3RLYH 2FWWA 1Y3WA 2O8UA 3T5FH 2F9UA 1EKBB 2SNVA 2WUCA 1V2ST 1DWCH 2JH0D 1A3EH 2RDLA 3E90B 3ZZDA 2FYQA 1E38B 3A8CA 3TITA 3BTWE 2FOFA 3MI4A 1WTGH 1O3KA 5EW2H 3BEFB 1GVLA 2LNCA 3D62A 1TNJA 1FONA 2VWNA 1D3QB 1BA8B 2QXIA 2BVXH 1O3BA 1HXFH 1GMHF 2XC4A 2ZIQH 2QF0A 1ZSJA 1FAKH 3QX5H 1TPSA 4U2WA 3V13A 3T27A 5GDSH 3RXUA 2W26A 1FMGA 1QCPA 1FY1A 1TE0A 4CHAB 4B73A 4IMQA 2FEQH 3GY7A 1O5DH 1GVKB 2ZHWH 1XMNB 1EB1H 2BDCA 2RG3A 2XBXA 3S9AA 5C2ZA 2BLOA 4FUEA 1Z6EA 2ZG0H 4JYUH 1Z7KA 3UR6A 4HZHA 1OS8A 4Y8XA 1ZPCA 2ZQ1A 1GI6A 2GZ9A 1W7GH 4X8VH 1KIGH 1ZSKA 2BY7X 1O3NA 3P8GA 1QL7A 3OU0A 1O3AA 2PFEA 2WV4A 2BDHA 2SGEE 1O5EH 1EQ9A 4I31A 2AMQA 4AFQA 3MO9A 1TGNA 1S6FA 2ALVA 3NKKA 3G01A 3UIRA 2D2DA 5EXMA 4YTAA 2BLQA 1O3IA 4D8NA 1ZR0A 1O31A 2ZDLA 1AVXA 4K1TA 1E36B 2OP9A 2AS9A 3P6ZB 4MVNA 5DP3A 1TMBH 3TJNA 1O3FA 1OX1A 5GPIB 1C5WB 2SGQE 4Y79A 1O32A 1ZPZA 1MQ5A 4AGJA 3LONA 2OBQA 1GPZA 3DHKH 2VVUA 1FI8A 1MKXK 1ZRBA 1P9UA 1JBUH 1LKAA 4OS5A 2CV3A 3TGIE 3A80A 3RXOA 2ZCHP 4CRAA 2WPHS 1V2OT 2QF3A 4FU7A 4U32A 3ZVDA 1GDUA 1C2DA 4NFFA 1IAUA 2DE9A 4UFEH 1O3JA 4X6PA 1QRXA 3I78A 4CH8B 4Q80A 1E35B 5CHAC 4ZKSU 5GXPA 1P2MA 3BF6H 2W7UA 4K5ZA 1QJ1B 1NT1A 1J17T 5DPAA 1LHDH 2C8ZB 1ABIH 4JZDH 5T6DA 3F9EA 1O2XA 2VGCB 3LGTA 4FUBA 5AFZH 4DVAU 3A8BA 1EAWA 2PGBB 2XNIA 1LHEH 1GGDB 1XM1A 1Y5UT 3BV9B 1SGQE 4FXGH 4R8TB 3ZZ5A 4XSKU 2GV6A 4MNYA 2ZA5A 4AYYB 1SC8U 5ABWA 3Q76A 3PYHA 2R3UA 1VCQA 3SV9A 2ZPSA 1QB1A 3HK3B 3LKWA 3U8RH 4X8TH 1TONA 4B71A 3M61U 2SGAA 1MTNC 3SNAA 1TX8A 3TPIZ 4X2XA 5GCHF 2EC9H 1SGDE 3HKJB 1SLXB 2XC5A 2J2UA 3AAUA 1GBTA 1K1NA 1PPFE 1P04A 2VINA 3D49H 4PROA 2NWNA 2XBYA 3TJOA 3GY5A 2A4RA 1INCA 4E05H 3LPRA 2ODQA 3A82A 1EZXC 3RXMA 3NUMA 1FPCH 2UUJB 3TGJE 1A4WH 4X1QU 2AGEX 3RLWH 1HAYB 4O3TA 1DFPA 1GI1A 4MPXA 3FANA 3KF2A 1UTLM 1KXCA 4B2BA 1CGHA 3RXPA 1MD7A 3M5LA 3GDVA 1GBLA 3LGVA 1RIWC 4D7FA 4GHQA 1O39A 1AWFH 2R0LA 2G4TA 2XYAA 1ETSH 1C5OH 1G3EA 1F7ZA 5A8YA 1YPHE 2QXGA 1Y3XA 1MAXA 3UQVA 5DJ7A 2HOBA 3RU4T 1EATA 1P3EA 1VCWA 2VWLA 3LGUA 2BD3A 1HJAB 4KGAA 3ZVAA 3MMGA 3MO6A 1NN6A 1J16A 4WMFA 1T4VH 1UTNA 3SOSA 4Q7YA 1XVMA 1OWHA 1QR3E 2HNTC 6GCHG 1F5LA 4DT7B 1PPGE 1CA8B 2FDAA 1TIOA 3BTQE 3BIUH 1KYNA 2CF8H 3FFGA 2WUBA 3T29A 4X2VA 3KGPA 2ANKH 2F3CE 1DANH 1FY5A 3BG4B 2ZQ2A 1UHBA 3STJA 1FAXA 3SU4A 2IN2A 1ELBA 3EE0B 4AFZA 2UUFB 3SNCA 1YPKH 1TNIA 3ITIA 1C2LA 3W94A 2ZDAH 2PSYA 3LJOA 1QBNA 2PKAA 3MH4A 5JBCS 1F2SE 1X7AC 5E2OA 4BOHA 1CT0E 2QXHA 1C5YB 4RKOB 5IDKA 1PFXC 1O2OA 2FOCA 4CREA 1AY6H 1ABJH 3FP6E 2WPLS 2G5NA 2PUQH 3A84A 1GI8B 2ZTXA 2PKSB 4YESB 5BRRE 2BD7A 1FUJA 1FDPA 1LCYA 1H9LB 2QV1A 1P2JA 4BAHB 3QO6A 5EW1H 1ELTA 4YT6H 5H4IB 3LC3A 5EXLA 3RXHA 4E06H 3RXSA 1BMMH 2FI3E 1C5LH 2F9OA 1P09A 1C1TA 2DE8A 2FOAA 2QYIA 2DUCA 3LJJA 3TH3H 1CU1A 1BHXB 1J8AA 1MTUA 2OC8A 5CE1A 1P2NA 1OPHB 4ABBA 5FXLA 3O8CA 4ZAEA 3PROA 1GJ6A 4GPGA 3SJ9A 3GCNA 3EYDA 2TIOA 3ZZ9A 1YBWA 3V0XA 1C5RA 1MUEB 5JBBS 4DURA 4MTBA 1SGYE 1S6HA 5T6GA 2A0QB 3SO3A 3GCHB 4RSPA 2H1UA 2JETB 5FHTA 4ABEA 1SGTA 1GBJA 1SHYA
chains in the Genus database with same CATH superfamily
3ZV9A 1L4DA 1NESE 1PPBH 2Z3CA 1AKSB 3OYPA 3HGNA 3UNQA 1EX3A 2R3YA 1IQLA 2OXSA 5C0TA 4DIIH 1UTKA 3OTPA 4KP0A 2WYJA 4I8LA 3UNRA 1V3XA 2GDDA 4A7IB 4OS4A 1HAGE 3P95A 1XXFA 2WHXA 2BZAA 5A8XA 1D4PB 5T1VA 3LGWA 4B75A 2XRCA 4YT7H 2ZFPH 3SUDA 1NRRH 3ZYEA 1PYTD 2UWLA 4WH6A 2ZU1A 4ESTE 4LZ4B 3GY4A 2PTCE 1C5NH 4A1TA 2ZHDA 1K1MA 4CBOA 1SSXA 4AFUA 2EI7A 3ATWA 2EQNA 1DDJA 4AGKA 4BXWA 1GG6C 2ZPQA 3K65B 1WTHD 1HYLA 4ABDA 1WOFA 1HAZB 7GCHF 1O2GH 7ESTE 2PUXB 1YLNA 1GHVH 3A7WA 2VVVA 1A0LA 1Y59T 1VJ9U 1UTQA 1W10U 4JK6A 1QB6A 1C1OA 2XCFA 1DXPA 7KMEH 3CP7A 1EZQA 4UDWH 1BTWA 4NIWA 4JZIA 1O2YA 4OS7A 4YOGA 1DOJA 2ZKSA 2FESH 1Y3YA 4IN2A 4GSOA 1EPTB 2ZNKH 4IC6A 2ZF0H 3ZVBA 4UEHH 3NRLA 3GYMA 4MPUA 1THRH 1A46H 2J94A 2W6JD 1A1RA 1FZZA 1A5HA 2HVXA 4XD7D 1PQ5A 1C4U2 3EA8A 3RUOA 4MG3A 4CHAC 1EPTC 5A0CA 2J5UA 3O8DA 2L74A 5ETXA 1K9OE 3U28C 2Z3DA 2BY9X 1V2PT 4K1EA 4AB8A 1AZZA 5AVDA 1ZOMA 1FN6A 4LZ1H 1C5MD 4RT0A 1HJAC 4TPIZ 2ZFTA 1O3DA 3VFEA 3SUEA 4CR5A 2SGPE 2FI5E 1L0ZA 4XBBA 1W0YH 2ZHFH 1NPMA 1UK3A 1VCPA 3NCLA 2OC1A 1PPZA 3EAJA 3MO3A 1D6RA 3CS7A 3ATIA 1UVPA 3BSQA 3TK6A 1IOEA 1COWD 3BTME 5K7RA 4ABIA 4BNRA 1S0RA 1F92A 3DFLA 3OEED 4AX9H 1C1VH 3I77A 2VIVA 1ZHPA 1WYKA 1O33A 1QY6A 1H4WA 1GVZA 4ZXYH 4CRCA 2FLBH 1O5AB 2R0KA 3M7TA 5HGGA 1TYNA 3T62A 5JBAS 1H9HE 3URCA 3FVFB 4Z6AH 3UPEA 3SJIA 1ELGA 3SU6A 1QL9A 1BMAA 3SHAH 1C1RA 1GBAA 1YPGH 4OS1A 3H09A 3MTYA 5FCKA 3GCTG 2I6QA 3A7ZA 2FX6A 3KQ5A 2CHAB 5FL7D 1GJDB 1QHRB 4LK4A 5LH8A 2D1JA 3RXDA 3F2FA 3V7TA 2P3TB 3A86A 1T4UH 3V3MA 2WV5A 1C9PA 1K28D 3RXKA 3F68H 3H5CB 5GCHG 1S84A 2ANMH 2B0FA 3B23B 4GCHG 4DIHH 1LVMA 1CA0B 4O97A 1GI3A 2BLVA 2KAIB 4ABHA 1DSUA 1Z71A 3ZZAA 1BTXA 1L4ZA 1B5GH 3PMHB 1O2ZA 1AZ8A 1YPLH 4AFSA 2FO9A 5EQSA 1A3BH 2P3FH 1CA0C 4ZKRU 4Y7BA 1KY9A 4GAWA 3OY6U 1KTSB 3DFJA 1IQJA 1RGQA 3A89A 4NGAH 1LPGB 3GOVB 3B8JA 2P93A 3M7UA 1AFQB 4B2AA 2TGTA 1HAHH 3ATKA 2ZCKP 5DGJA 4AB9A 2R9PA 4U30A 6CHAB 2ALPA 2FM2A 2ZWLH 1HRTH 1V2NT 1HJ8A 2GDEH 3A88A 3GY6A 1NFYA 2F83A 1AFQC 1LQEA 4AZ2B 4DGJA 5LGOA 1GHAF 2HWLB 1SGPE 4J1YA 1DUAA 3VB4A 1ARCA 1UK2A 1O2VA 1SGFG 5L30H 4DY7B 3AW0A 1BB0B 1BTYA 1BRUP 1AUTC 2FXRA 2Y5HA 3L33A 1T31A 1TQ7B 3QK1A 1SBWA 5EPYA 1Y8TA 3LDXH 3BTDE 3D23A 4GHTA 2ZDVH 3SORA 1G37A 3UREA 1EJNA 1MU8B 1DWBH 1W2KH 1TMUH 1Y5AT 1UTJA 1G9IE 2FX4A 2Q6GA 2A7JA 4A1VA 1KTTB 2Q6FA 1LPZB 1P8VC 2FS8A 3NXPA 1A0HB 5TJXA 3MHWU 1CT2E 2GGVB 4Y76A 3Q3YA 2D8WA 3AVZA 1UJ1A 4M7GA 3M36A 5HXFA 1TBQH 1K1PA 4Y11E 1HBTH 1DWDH 3UY9A 2ZGHA 1P2QA 2XW9A 3SU5A 1LKBA 2VWOA 1GHBF 4F48B 2BHGA 4FVDA 2A45B 2C3SA 1GI9B 4WH8A 4X1RU 1CE5A 1DY8A 2ZCLP 1TNLA 4WF8A 4NIXA 3MU0A 2GZ8A 3FN8A 3D65E 1DM4B 1NY22 4I8KA 1UW7A 1QA7A 2FOBA 4BTIB 4UONA 1ZMJA 2GJGA 2UWOA 3FP8E 4A6LA 1S6LA 4D76A 4X6OA 2HLCA 3KHVA 1ZZZA 1SLVB 1EP6A 3RXLA 1LHFH 2PKSC 1U6QA 2ZECA 5EU8A 4B2CA 3ZVCA 4CRFA 1O38A 3O8BA 1BTUA 3L3TA 1S83A 2VNTA 2Y81A 3N7EA 4DW2U 1OWDA 1TBRH 2BTCE 1YLDA 3FAOA 2FOMB 3VB7A 1BJVA 3VXFH 4ABFA 1CQQA 1PQ7A 2P8OC 1NU7B 1SGFA 1AI8H 1FNIA 3NPSA 1P05A 3ZZCA 1K22H 1BCUH 2A5AA 1ACBE 5K0HA 4KTUA 3E0NB 2P94A 1GBDA 1EOJA 4X0WU 1P3CA 2THFB 1N6XA 1GGDC 4I32A 4K2YA 1XKBC 5AHGH 3EDXB 4Y10E 9LPRA 2GZ7A 4F49A 2W3KA 1T8MA 2BM2A 1TRNA 1O2TA 3LIWA 2TGPZ 4H6SB 1F0SA 1XUIA 2P3UB 4YOIA 2OC7A 3RC4A 1EZSC 1G36A 2ZDNA 2GVFA 3SQEE 1KDQB 5DP8A 1CBWB 2D26C 2RA0A 4NSVA 5DP9A 1EJMA 2CK3D 1PPEE 4FOUC 4ACBA 2JETC 1BOQA 1QJ7B 1NBME 4NCYA 3GDUA 2WYGA 1H9IE 1O36A 3NWUA 1DLEA 1AN1E 1TX6A 4X1NU 4OGXA 1GHAG 2Z9LA 3LOXA 4JMYA 3MQKC 4IW4E 4Y8YA 2Z7FE 1O0DH 2IPQX 1C2KA 3S9BA 1YPHC 3U1IB 4TPYA 5DG6A 1NTPA 3M5MA 4M9FA 4AORA 1ZJDA 3SJOA 2IJD1 1H8HD 3UNSA 1O2SA 3P8OA 1DWEH 8GCHF 4RN6A 1BMFD 1L1JA 4BXSA 2FOEA 1A61H 1YGCH 1QGFA 1GJ4H 2K8IA 2PWXA 3URDA 4XOJA 1GBMA 4I8GA 1MTWA 2C8XB 4IMZA 5HIYA 1TLDA 1A5GH 3SNEA 1BJUA 4IBLH 5KECA 2Z6BD 2A4QA 2HVYB 4VGCC 2JH5D 3ODDA 4JYTA 4BAKB 2PGQB 1XX9A 4CH2B 1OP2A 1W0KD 4MDSA 2PHBA 3FZDA 2Q6DA 2L6OA 1BIOA 9ESTA 2OUAA 1GCDA 3BTKE 4H6TA 2HRVA 3IG6B 1PPHE 1Z6JH 5DKMA 1GHWH 1GJCB 1TPAE 2R2WU 3KCGH 1G3DA 2ZFSA 1NFWA 1SGCA 2V3HH 3SUFA 2J98A 5EIYA 3M5OA 5LPFA 5E0JA 4CR9A 2QAAA 1RD3B 3MH6A 4NWKA 1QURH 1AGJA 1YLCA 2B5TB 3RC5A 1K1JA 1SVPA 2A2QH 2PR3A 2OTVA 2NU0E 1VZQH 4OGYA 4B6EA 1KDQA 2J34A 3QZQA 1S5SA 2BOHB 5DN6D 4D9QA 1GL1A 4O9VA 1QJ6B 3S9CA 1DVAH 4FVBA 4TWYA 3PRDA 5EJLA 1Z1IA 4XRNA 2F9VA 2BY6X 1Q2WA 1BRCE 3PV4A 3SI3H 3F6UH 4INKA 2RDEA 3TH4H 1NRPH 2G8TA 5GNDA 2VJ1A 4B6FA 4AG2A 1OXGA 2F9NA 4NFEA 3GY3A 1ZPBA 2AMPA 4MQAA 2BD4A 2ZO3H 1C9TA 2GD4B 4ABAA 1K1IA 1W8BH 8KME2 1P10A 3I29A 3AAVA 5A2MH 1KLIH 4XBDA 4AG1A 1V2JT 4Y6DA 1AO5A 1J9CH 1NU9A 2GKVE 3AK5A 2CHAC 1AE8H 4LXBH 3RXCA 1O5BB 1E79D 5TCAA 5EXNA 2F9BH 2CN0H 1EXFA 2A5IA 5F8TA 1Y3VA 2XBWA 1CHGA 1LTOA 2Z94A 5E0GA 4D9RA 4FUCA 4JYVH 2FODA 2H9HA 1TRMA 1H8ED 3BEIB 3SHCH 2HALA 1LVBA 4FU9A 1TA6A 4KELA 1ELDE 1V2MT 2A5KA 3B9FH 4O3UA 3E91A 5FCRA 5EOKA 2TBSA 1BTPA 3ZZ4A 2J97A 2AGIX 3QTVH 1MTSA 2QC2A 3RXQA 1V2UT 2BDYA 4INLA 5B6OA 1TBZH 1WUNH 1QB9A 1FX0B 2ASUB 2H6MA 3E16B 1SPJA 3MYWA 2XXLA 1GJ7B 3UWJH 1O2UA 1JMOH 3VB3A 4ZXXH 1Y3UA 1OWIA 1AWHB 1OYQA 1GCTB 1GMCG 4YLUA 1YCPH 5C67A 1SHHB 1MQ6A 2BD2A 2TGAA 5JB8S 1C1WH 3LGIA 3Q3XA 3VGCB 3E3TA 4HTCH 4TY7A 4WXIA 4TYDA 1RJXB 4NA7A 1D3TB 3EE7A 1O5GH 4NZLA 1UVUH 1BMLA 4R0IA 4TWWA 3KQBA 5C94A 1ZMLA 1PPCE 2JKHA 3M5NA 3OSYA 2G4UA 3MNSA 1OWEA 3K6ZA 3SGBE 3E0PB 3A8DA 2F43B 4THNH 3EA9A 3UQOA 4WWYA 1D3PB 1EPTA 1E37B 2J98B 2Y5FA 1SQOA 1YYY1 4Q4LA 5EQRA 4HGCA 2QA9E 3UWIA 4WJG2 1ZTKA 3RMOH 3M7QA 5AF9H 1TX7A 4NA8A 1MU6B 2IOTA 4FUIA 4TY6A 4D7GA 1TNHA 1GL0E 3RDZA 1KXBA 1P01A 3SUGA 3VPKA 5GJ4B 2WPKS 3T28A 1P2IA 2XOKD 3A8AA 5FAHA 3OEHD 1BZXE 5DK1A 3TIUA 1AQ7A 3KN2A 2H5DA 3ATLA 1Y5BT 2KAIA 4WY3A 1IQEA 5EQQA 4NA9H 2VIPA 3TJUA 2ZPRA 1SL3A 2GV7A 3IWMA 4B76A 4FUGA 1W3CA 2WSSD 4P00A 2K1QA 6ESTA 2FMJA 2QF5A 3Q3KA 1SI5H 5F8XA 5L2ZH 2ZU2A 4X8UH 2KR7A 1FIZA 1ZTJA 2O8WA 3F1SB 1T8OA 4XBCA 2Y82A 1LMWB 1SGIB 1ZLRA 2BB4A 3SU2A 2G51A 5JB9S 1FQ3A 2BDGA 5HM2A 4JZEH 5C3NA 5CMXH 1SOZA 1KMHB 3P70B 1BUIA 1HFDA 1JIRA 1HIAA 3KIDU 3R3GB 5EJZA 1Z8GA 4UFDH 1E1RD 2P8OB 1H8IH 1B7XB 4GUXA 2QXJA 1EASA 1T8NA 4ZCNA 3A7XA 3RXIA 1P03A 3OAAD 3TU7H 3QUMP 2KM0A 1IQMA 5EGMA 4TSFD 3U9AH 2OINA 1ZRKA 3RM2H 3DD2H 3ENSB 1ESTA 4SGBE 4INHA 1A0JA 5JPMH 1PQ8A 2BXTH 2J95A 3OE7D 2Y80A 5JYIA 1EZUC 3UAIC 2ZEBA 3QGNB 3RC6A 2BDIA 5DP4A 3SQHE 4AN7A 2Z3EA 3RXVA 3MU5A 4Z1MD 2ESTE 2B8OH 1HNEE 4CRDA 1C4Y2 2PV9B 1AHTH 1CGIE 3P17H 4Q7XA 2A1DB 1VJAU 4X1PU 2BQ6B 4GLYA 4YOJA 2HPPH 2J9NA 1TFXA 1UCYK 1MKWK 2UUYA 3GDSA 1GDNA 1D3DB 2BLWA 4X8SH 4WXVA 1HAVB 2ZHQH 3F0PA 3GCOA 1P11E 1FY4A 3JZ2B 4B74A 2LELA 3PTNA 4ISLA 1IQKA 3VB5A 1W13U 1FN8A 3MU1A 2O9QA 1O5CB 2G52A 1E34B 4GVUA 5A09A 5I46H 2JJ2D 2W3IA 1PJPA 1RTFB 1QNJA 2OBOA 1EUFA 1BTHH 1ZYOA 5HYOA 2ANWA 2OQUA 4RT1A 1ESBA 2TPIZ 1UTPA 1PQAA 2NU4E 1SLUB 3K2UA 5ESBA 2ZGXH 4UE7H 2JH6D 4X6MA 1P06A 4IC5A 1C2FA 1W14U 1V2TT 2BX4A 1MZAA 3FKSD 1C2HA 1GI2A 1KXDA 3Q77A 1THPB 3EGKH 3KL6A 2YNAA 1ANEA 3RU4D 1H8DH 1RTKA 2EEKA 1KXAA 1FPHH 5CHAB 3ZZ8A 1ELEE 2YNBA 1YCPK 1SGNE 1SQTA 1IQNA 2Y7XA 2W7SA 3DSOA 1ELCA 1OP0A 2UWPA 2ZU4A 1FIWA 4XE4A 1XUFA 1QBOA 2VGCC 4I7YH 5T6FA 1NRQH 3A87A 1AD8H 2JJ1D 4UFFH 5DP6A 4TT3D 1L1GA 2A32A 2AYWA 1FV9A 1GBHA 3SNDA 3C27B 3GYLB 1CHOG 3OFND 4JK5A 2RFKC 1TOCB 2VIQA 2G55A 4Q2KA 2BY5X 3BTEE 4X1SU 3PTBA 2A2XH 3TGKE 1VGCC 2YMSC 1BT7A 2AMDA 3GY2A 1AVGH 3A81A 3BG4C 3NZIA 3F3BA 1HPGA 1F0UA 1AIXH 2OQ5A 1CSOE 4H42U 3PV2A 1V2QT 2W5EA 2NU1E 2YMSB 1F5KU 4A5TS 1FY8E 2HPQH 4KTSA 1BBRE 1BITA 3TNTA 3ZVEA 3RMNH 1V2LT 3PLPA 5J4QA 1SOTA 3SV6A 1C2IA 3SW2B 2GCHG 4P02A 3DSPA 3MNXA 5EG4A 4YLQH 2HNTF 4FETA 4X2WA 3VB6A 1O3EA 2O8MA 3ZVFA 5E2PA 4K60A 1QIXB 2ZDKA 1TALA 3CENA 3PB1E 1B0FA 2GT7A 3PM3A 5E0HA 2Z9GA 3PLBA 1HJ9A 1YC0A 2Z9IA 3MH7A 1P2KA 1S81A 6GCHF 1GBFA 3T2NA 3SV7A 1MKXH 1O3LA 1EJAA 1EP5A 1TGBA 2BDAA 2NU2E 1V2RT 2Y6TA 4MLFB 1XVOA 2QE7D 4X6NA 1VR1H 3SGAE 1NROH 1TA2A 1GMHG 5DP7A 1O34A 4E7NA 1G3CA 4AYVB 1WSSH 3RM0H 4XDEA 4FU8A 1G2LA 4DJZB 5F6MA 2EI8A 2J4IA 1KXFA 3S7HB 1MH0A 2C90B 1QTFA 1HAPH 2VIWA 1OHHD 3ODFA 1EOLA 2BD5A 4ZUHA 1MTVA 1OYTH 3LU9B 1O2MA 1K1OA 4YXWD 1W0ZU 5JBTA 3VG8A 1YPJH 2WPIS 5L6NH 1VITG 2ODPA 1THSH 1A5IA 5HMAA 1K0HA 1ZMNA 1G32B 2ZTYA 1UMAH 1A7SA 1F5RA 4DCDA 1OP8A 2KFWA 1GHYH 2GCTC 4ZKNU 2KCOA 1YPMH 2BX3A 1NRNH 2XWBI 4DOQA 1JIMA 3FOAA 2XNDD 2H9EH 4OS2A 1P02A 4NSYA 3SN8A 2WPJS 2V7QD 1SMFE 4ISIH 1C4V2 1Z8JB 3SBKA 2GCTB 8GCHG 2BD8A 3PV5A 1HB0B 2FIRH 3A83A 2V35A 1G30B 1ZGIA 3DSGA 2AGGX 3O8RA 1WCZA 3WY8A 2F91A 3K9XB 2OC0A 4NWLA 3IITA 1WU1A 3TK5A 3KQCA 1IHTH 1BRAA 4BAOB 5L2YH 1C5VA 4CBNA 3EQ0H 1HAVA 1QQ4A 1GHXH 2B7DH 4FUJA 1E1QD 4K3JA 4X2YA 1XUHA 1O2KA 1MBMA 6CHAC 3UOPA 1NFXA 1UVTH 3FP7E 3LC5A 1HLTH 4YZUA 2AH4X 1T32A 1HAOH 1FLEE 1O37A 3HPTB 4Y0YE 2PW8H 2EI6A 5FX5A 4NIVA 1P12E 1RXPA 3A7VA 4ISNA 4MNVA 4Y7AA 4MPVA 1CO7E 4ABGA 1XUKA 3FZZA 2FOGA 4ZROA 2F4LA 2R2MB 1VITH 2K0QA 4Q7ZA 1M9UA 3PLKA 2GMTC 3SV8A 1K21H 1QRWA 1J15A 3MOCA 3UOUA 1HAXB 4YM9A 1O30A 1ELVA 1A2CH 1V2WT 2BMGB 1ETTH 3BTHE 2VH6A 1QFKH 1GI5A 3KQDA 3ZVGA 1QL8A 1W7XH 2ZDMA 2ZFRH 3SNBA 1H1BA 2P59A 3CS0A 2BD9A 1ARBA 1J14A 3FO8D 3TVJB 5CDFE 3MFJA 1CVWH 1ID5H 1SGEE 2O8LA 3PRBA 2ZU5A 5C1YA 3UR9A 4I33A 2CGAA 1QZ8A 2PP6A 1K1LA 1WBGB 1IQIA 4Y8ZA 1P0SH 5FPYA 6LPRA 1UCYE 2G5VA 1FY3A 1V6DA 1TOMH 2BVSH 3PMJA 4AC9A 3V12A 1BDAA 1TB6H 2C93B 2GX4A 4K8BA 1TGTA 1XUGA 1WDIA 1C2EA 2FTMA 2H5CA 2M2AA 1LVYA 2WPMS 2XTTB 3RXFA 3SYJA 1MABB 1GMDG 3BTGE 1AVWA 1NM6A 2H2ZA 2ZGJA 5FPTA 3W1EA 3ZZ3A 7LPRA 2AIPA 1SLWB 1AE5A 2V3MA 1T8LA 3WWFA 2ZFQH 5DSFA 3QDZB 2C8WB 3VEQB 1ZHMA 3QZRA 2A7HA 2STAE 5IYTA 1V2KT 3F9FA 2A7CA 1NO9H 3KQEA 4K1SA 4BAMB 2M5TA 1C1NA 3RXGA 1C5TA 1EB2A 1D6WA 3SU0A 2CF9H 5C0UA 1C1PA 1NFUA 1IQGA 1TPOA 2ZTZA 3M3SA 1AB9B 2FOHA 4ZMAH 3TLOA 4NZQA 2PLXA 4ZKOU 1Q31A 1UHBB 3F2HA 1QQUA 5EODA 1HXEH 1LO6A 1O2IA 5A8ZA 3U8TH 4I8JA 4B1TA 4H4FA 3LT3A 3A7TA 3M3VA 4DG4A 1W11U 1C5SA 2VVCA 1MMJN 2G00A 2ANYA 3RMMH 2HNTE 1XUJA 1W12U 1C2MA 1ZTLA 4Z0KA 3HGPA 3DCLA 1K2I1 2BQWB 2BZ6H 3UTUH 1IQFA 1DUEA 2ZZUH 4KTCA 4NG9H 2FLRH 3RP2A 2VWMA 2ZC9H 3F2GA 1NC6A 2BQ7B 3LGYA 2C8YB 2A31A 3H7OA 1MBQA 3BTTE 2RA3A 4RI0A 5F03A 1BRBE 2GTBA 2VIDA 1BBRK 1B0EA 1UVSH 5EJ1A 1JOUB 1EAXA 4FUDA 2V6NA 1ANCA 1LVOA 1S0QA 1GMDF 2HGTH 1C5ZB 4RKJB 2OLGA 3HATH 3PMAB 4HI3A 1O2QA 5C1XA 3A7YA 1YKTA 1BTZA 2KCPA 1QA0A 1LPKB 5FBEA 1AU8A 1O2LA 2ZI2H 1BHXF 5KGOA 2QY0B 1TGSZ 4LOYH 1IHSH 3EA7A 4MNWA 1OKXA 1YY3A 5FBIA 1NS3A 1C2GA 1KLJH 5FPSA 3RXJA 1ANBA 1UTOA 1LHCH 2QF4A 3AASA 3R0FA 1GBBA 5HKKD 2GP9B 5T3HA 8LPRA 1ETRH 4WVPE 4ISHH 4AOQA 3U1JB 2TGDA 1DITH 4MPWA 3ZYDA 1C5UA 1F0RA 1EAIA 1O3HA 2QN5T 1BBRH 3MH5A 4Y0ZE 1AMHA 3TJVA 4JZFH 1FJSA 1YCPM 8ESTE 4FUHA 3P92A 3QWCH 3MU4A 1CHOF 2ZGBH 4UFGH 5PTPA 1GI7B 3L6PA 1IQHA 1GI4A 1Q3XA 2SGDE 1LHGH 1D9IA 1DT2A 1TGCA 2QGRA 3PO1B 4BAQB 2PTNA 5E8EH 2HLDD 3OTJE 2BXUH 2Y5GA 2YMSD 4HFPB 4Y71A 1TABE 2IPHA 1GBEA 1RS0A 1TRYA 2TRMA 1UTMA 4IGDA 5DO4H 3BG8A 5GIBA 1TNGA 2VH0A 1DS2E 3HKIB 5AFYH 3RMLH 2ZP0H 4J2YB 2QIQA 3HK6B 1S82A 7GCHG 1SQRA 1O3CA 1XXDA 3SV2H 4I8HA 2GMTB 1OOKB 2ZU3A 4KKDA 3TH2H 1UCYH 1C1SA 1YF4A 1VITF 5A0BA 1GJ9B 1AKSA 4GCHF 1JXPA 1ELFA 1N8OB 1GHZA 3ZZBA 3GISB 1GJAB 1RFNA 2QCYA 1HIAB 3ESTA 2AERH 2RCEA 1AUJA 1RTLA 2KCAA 4CRGA 5J4SA 1GMCF 2A4OA 1O2HA 1TPPA 1HV7A 4Q63A 1O2JA 3N7OA 3PWBA 4XFQA 1O3OA 3E6PH 1C5QA 3M37A 3SGQE 3VXEH 4QT8C 1N1LA 1UVOA 3STIA 2VIOA 2J92A 3QN7A 3K6YA 1MCTA 3RXBA 2FS9A 3ELAH 2CXVA 1YPEH 3BEUA 2Z9KA 1GI0A 1NZQH 1OWJA 1KXEA 2Z9JA 3P8FA 3SZNA 1C1UH 5C5OA 1O3GA 5HM9A 2Y7ZA 1GHBG 3GICB 4ZHAA 3BIVH 1P2OA 4ZHMU 3DUXH 1BMNH 1MTNB 2VBCA 3SU3A 3Q00A 5BPEA 1GBIA 5ESTE 4O03A 1SB1H 5DP5A 1GBKA 2ILNA 3GY8A 5FX6A 1WQVH 1DY9A 3H7TA 5G4BA 3T26A 1ORFA 1QRZA 2WV9A 3JZ1B 1SGRE 3UFAA 3DT0H 3C1KA 5IK2D 2BOKA 3PMBB 5LPEA 2F9PA 1ZGVA 1C1MA 1C2JA 1GJ8B 1MAYA 3P8NA 4F55A 1TMTH 1MZDA 1P57B 2CJIA 5F8ZA 3U98H 3UB0A 3ZV8A 2YOLA 2ZFFH 3ZZ6A 2BVRH 4ZHLU 1XKAC 5JDUB 1AFEH 4ABJA 2FPZA 1S85A 2V3OH 3NK8A 1GDQA 1E0FD 3DA9B 2A4GA 3F9HA 5C1UA 1HUTH 1Z8RA 2G81E 2J38A 1JRSA 1O3PB 3RU4E 1CBWC 1YP9A 5C20A 1GWAA 2CMYA 3ATMA 4OS6A 1AB9C 2GCHF 2GT8A 2UUKB 3SI4H 3S69A 5TCCA 1GJ5H 1O2NA 1NRSH 1DICA 1HCGA 1Z8IB 1DSTA 1O2RA 5A0AE 1TQ0B 1W0JD 2Q1JA 3A85A 2OCVB 1MCVA 1SFQB 3RXRA 3TK9A 4U01A 1CT4E 1F0TA 3SJ8A 2FP7B 1PYTC 3UUZA 2BYAX 1O2PA 2FI4E 1L2EA 5C5NA 3KYGA 3WWBA 3QGJA 3CNRA 1DX5M 1TWXB 4JZ1A 2C4FH 2P95A 3T25A 2FZZA 3U69H 3RXAA 3E8LA 1WQSA 1T7CA 1P9SA 2AEIH 3WW7A 4UD9H 3SU1A 1KSNA 1GCTC 1UK4A 1ELAA 1KLTA 1LDTT 2XBVA 3PO1C 2EA3A 1DE7H 1G2MA 2WZQA 1JWTA 3RXTA 4IS5A 1TNKA 2XWAA 4K69A 1SG8B 5EPNA 3TNSA 1SFIA 4BTUB 1QBVH 1ESAA 1MKWH 1FXYA 2BY8X 2O8TA 1MD8A 2AIQA 1O5FH 3ZZ7A 2H9TH 3U8OH 1YM0A 3RXEA 1SQAA 1RRKA 2OD3B 3BN9A 4A1XA 3LH1A 3PWCA 4BTTB 1CGJE 4A92A 1DXWA 3M3TA 1C1QA 1GBCA 4ASHA 1G3BA 2FTLE 2WPDD 3F9GA 4FUFA 1WAYB 2LPRA 2VU8E 3M35A 1VGCB 1N8OC 1Z1JA 4E7RG 1LQDB 3W95A 3MNCA 2ZGCA 4MNXA 5LPRA 1O35A 2V0BA 1NBMD 4BANB 4OM9A 1HDTH 2SFAA 1DLKB 2I6SA 2XCNA 3GCTF 2JIZD 1OSSA 1WV7H 2VB0A 1HGTH 3E1XB 1C5XB 4SGAE 2SGFE 5CHBA 1DPOA 1O2WA 2SNWA 1UO6A 2ODYB 5SGAE 2PKAB 4WMEA 3BTFE 1OWKA 4ISOA 2AFQB 4K8YA 2WINI 3MU8A 3LH3A 3S7KB 1ANDA 1GJBB 2XC0A 3OY5U 3KEEA 1SR5C 4WMDA 1O3MA 3MNBA 3S0NA 4F4OC 4CRBA 3GCHC 5I25A 2FYRA 2IJOB 4JCNA 1ZSLA 3MWIU 4NIYA 1ZHRA 2ZHEH 1RIWB 2BDBA 1BQYA 4YO9A 3SJKA 2ULLA 4ASUD 2P16A 1C5PA 4IN1A 1TAWA 3QLPH 1N6YA 3VGCC 3QTOH 5GWZA 1L1NA 3AW1A 1V2VT 4ZH8A 2NU3E 1HAIH 1JRTA 2STBE 3OX7U 1GG6B 3KNXA 2PSXA 1ZJKA 2B9LA 4VGCB 1EAUA 3RLYH 2FWWA 1Y3WA 2O8UA 3T5FH 2F9UA 1EKBB 2SNVA 2WUCA 1V2ST 1DWCH 2JH0D 1A3EH 2RDLA 3E90B 3ZZDA 2FYQA 1E38B 3A8CA 3TITA 3BTWE 2FOFA 3MI4A 5HIZA 1WTGH 1O3KA 5EW2H 3BEFB 1GVLA 2LNCA 3D62A 1TNJA 1FONA 2VWNA 1D3QB 1BA8B 2QXIA 2BVXH 1O3BA 1HXFH 1GMHF 2XC4A 2ZIQH 2QF0A 1ZSJA 1FAKH 3QX5H 1TPSA 4U2WA 3V13A 3T27A 5GDSH 3RXUA 2AHME 2W26A 1FMGA 1QCPA 1FY1A 1TE0A 4CHAB 4B73A 4IMQA 2FEQH 3GY7A 1O5DH 1GVKB 2ZHWH 1XMNB 1EB1H 2BDCA 2RG3A 2XBXA 3S9AA 5C2ZA 2BLOA 2OK5A 4FUEA 1Z6EA 2ZG0H 4JYUH 1Z7KA 3UR6A 4HZHA 1OS8A 2EY4C 4Y8XA 1ZPCA 2ZQ1A 1GI6A 2GZ9A 1W7GH 4X8VH 1KIGH 1ZSKA 2BY7X 1O3NA 3P8GA 1QL7A 3OU0A 1O3AA 2PFEA 2WV4A 2BDHA 2SGEE 1O5EH 1EQ9A 4I31A 2AMQA 4AFQA 3MO9A 1TGNA 1S6FA 2ALVA 3NKKA 3F0OA 3G01A 3UIRA 2D2DA 5EXMA 4YTAA 2BLQA 1O3IA 4I86A 4D8NA 1ZR0A 1O31A 2ZDLA 1AVXA 4K1TA 1E36B 2OP9A 2AS9A 3P6ZB 4MVNA 5DP3A 1TMBH 1SKYE 1O3FA 3TJNA 1OX1A 5GPIB 1C5WB 2SGQE 4Y79A 1O32A 1YWUA 1ZPZA 1MQ5A 4AGJA 3LONA 2OBQA 1GPZA 3DHKH 5C17A 2VVUA 1FI8A 1MKXK 1ZRBA 1P9UA 1JBUH 1LKAA 4OS5A 2CV3A 3TGIE 3A80A 3RXOA 2ZCHP 4CRAA 2WPHS 1V2OT 2QF3A 4FU7A 4U32A 3ZVDA 1GDUA 1C2DA 4NFFA 1IAUA 2DE9A 4UFEH 5F53A 1O3JA 3N7DA 1QRXA 3I78A 4X6PA 4CH8B 4Q80A 1E35B 5CHAC 4ZKSU 5GXPA 1P2MA 3BF6H 2W7UA 4K5ZA 1QJ1B 1NT1A 1J17T 5DPAA 1LHDH 2C8ZB 1ABIH 4JZDH 5T6DA 3F9EA 2KX4A 1O2XA 2VGCB 3LGTA 1VKYA 4FUBA 5AFZH 4DVAU 3A8BA 1EAWA 4HG6A 2PGBB 2XNIA 1LHEH 1GGDB 1XM1A 1Y5UT 3BV9B 1SGQE 4FXGH 4R8TB 3ZZ5A 4XSKU 2GV6A 4MNYA 2ZA5A 4AYYB 1SC8U 5ABWA 3Q76A 3KYFA 3PYHA 2R3UA 1VCQA 3SV9A 2ZPSA 1QB1A 3HK3B 3LKWA 3U8RH 4X8TH 2W6ID 1TONA 4B71A 3M61U 2SGAA 1MTNC 3SNAA 1TX8A 3TPIZ 4X2XA 5GCHF 2EC9H 1SGDE 3HKJB 1SLXB 2XC5A 2J2UA 3AAUA 1GBTA 1K1NA 1PPFE 1P04A 2VINA 3D49H 4PROA 2NWNA 2XBYA 3TJOA 3GY5A 2A4RA 1INCA 4E05H 3LPRA 2ODQA 3A82A 4ACAA 1EZXC 3RXMA 3NUMA 1FPCH 2UUJB 3TGJE 1A4WH 4X1QU 2AGEX 3RLWH 2KCYA 1HAYB 4O3TA 1DFPA 1GI1A 2JDID 4MPXA 3FANA 3KF2A 1UTLM 1KXCA 4B2BA 1CGHA 3RXPA 1MD7A 3M5LA 3GDVA 1GBLA 3LGVA 1RIWC 4D7FA 4GHQA 1O39A 1AWFH 2R0LA 2G4TA 2XYAA 1ETSH 1C5OH 1G3EA 1F7ZA 5A8YA 1YPHE 2QXGA 1Y3XA 1MAXA 3UQVA 5DJ7A 2HOBA 3RU4T 1EATA 1P3EA 1VCWA 2VWLA 3LGUA 2BD3A 1HJAB 4KGAA 3ZVAA 3MMGA 3MO6A 1NN6A 1J16A 4WMFA 1EFRD 1T4VH 1UTNA 3SOSA 4Q7YA 1XVMA 1OWHA 3GS9A 1QR3E 2HNTC 1WXRA 6GCHG 1F5LA 4DT7B 1PPGE 4DT4A 1CA8B 2FDAA 1TIOA 3BTQE 3BIUH 1KYNA 2CF8H 3FFGA 2WUBA 3SZEA 3T29A 4X2VA 3KGPA 2ANKH 2F3CE 1DANH 1FY5A 3BG4B 2ZQ2A 1UHBA 3STJA 1FAXA 3SU4A 2IN2A 1ELBA 3EE0B 4AFZA 2UUFB 3SNCA 1YPKH 1TNIA 3ITIA 1C2LA 3W94A 2ZDAH 2PSYA 3LJOA 1QBNA 2PKAA 3MH4A 5JBCS 1F2SE 1X7AC 5E2OA 4BOHA 1CT0E 2QXHA 1C5YB 4RKOB 3ZIAD 1PFXC 5IDKA 1O2OA 2FOCA 4CREA 1AY6H 1ABJH 3FP6E 2WPLS 2G5NA 2PUQH 3A84A 1GI8B 2ZTXA 2PKSB 4YESB 5BRRE 2BD7A 1FUJA 1FDPA 1LCYA 1H9LB 2QV1A 1P2JA 4BAHB 3N99A 3QO6A 5EW1H 1ELTA 4YT6H 5H4IB 3LC3A 5EXLA 3RXHA 4E06H 3RXSA 1BMMH 2FI3E 1C5LH 2F9OA 1P09A 1C1TA 2DE8A 2FOAA 2QYIA 2DUCA 3LJJA 3TH3H 1CU1A 1BHXB 1J8AA 1MTUA 5KEDA 2OC8A 2KZ4A 5CE1A 1P2NA 1OPHB 4ABBA 5B6LA 2LP6A 5FXLA 3O8CA 4ZAEA 3PROA 1GJ6A 4GPGA 3SJ9A 3GCNA 3EYDA 2TIOA 3ZZ9A 1YBWA 3V0XA 1C5RA 1MUEB 5JBBS 4DURA 4MTBA 1SGYE 1S6HA 5T6GA 2A0QB 3SO3A 3GCHB 4RSPA 2H1UA 2JETB 5FHTA 4ABEA 1SGTA 1GBJA 1SHYA
chains in the Genus database with same CATH topology
3ZV9A 1L4DA 1NESE 1PPBH 2Z3CA 1AKSB 3OYPA 3HGNA 3UNQA 1EX3A 2R3YA 1IQLA 2OXSA 4DIIH 1UTKA 4KP0A 2WYJA 4I8LA 3UNRA 1V3XA 2GDDA 4A7IB 4OS4A 1HAGE 3P95A 1XXFA 2BZAA 5A8XA 1D4PB 3LGWA 4B75A 2XRCA 4YT7H 2ZFPH 3SUDA 1NRRH 3ZYEA 1PYTD 2UWLA 4WH6A 2ZU1A 4ESTE 4LZ4B 3GY4A 2PTCE 1C5NH 4A1TA 2ZHDA 1K1MA 4CBOA 1SSXA 4AFUA 2EI7A 3ATWA 1DDJA 4AGKA 4BXWA 1GG6C 2ZPQA 3K65B 1WTHD 1HYLA 4ABDA 1WOFA 1HAZB 7GCHF 1O2GH 7ESTE 2PUXB 1GHVH 3A7WA 2VVVA 1A0LA 1Y59T 1VJ9U 1UTQA 1W10U 4JK6A 1QB6A 1C1OA 2XCFA 1DXPA 7KMEH 3CP7A 1EZQA 4UDWH 1BTWA 4NIWA 4JZIA 1O2YA 4OS7A 4YOGA 1DOJA 2ZKSA 2FESH 1Y3YA 4IN2A 4GSOA 1EPTB 2ZNKH 4IC6A 2ZF0H 3ZVBA 4UEHH 3GYMA 4MPUA 1THRH 1A46H 2J94A 1A1RA 1FZZA 1A5HA 2HVXA 1PQ5A 1C4U2 3EA8A 3RUOA 4MG3A 4CHAC 1EPTC 5A0CA 3O8DA 5ETXA 1K9OE 2Z3DA 2BY9X 1V2PT 4K1EA 4AB8A 1AZZA 5AVDA 1ZOMA 1FN6A 4LZ1H 1C5MD 1HJAC 4TPIZ 2ZFTA 1O3DA 3VFEA 3SUEA 4CR5A 2SGPE 2FI5E 1L0ZA 4XBBA 1W0YH 2ZHFH 1NPMA 1UK3A 1VCPA 3NCLA 2OC1A 1PPZA 3EAJA 3MO3A 1D6RA 3CS7A 3ATIA 1UVPA 3BSQA 3TK6A 1IOEA 3BTME 5K7RA 4ABIA 4BNRA 1S0RA 1F92A 3DFLA 4AX9H 1C1VH 3I77A 2VIVA 1ZHPA 1WYKA 1O33A 1QY6A 1H4WA 1GVZA 4ZXYH 4CRCA 2FLBH 1O5AB 2R0KA 3M7TA 5HGGA 1TYNA 3T62A 5JBAS 1H9HE 3URCA 3FVFB 4Z6AH 3UPEA 3SJIA 1ELGA 3SU6A 1QL9A 1BMAA 3SHAH 1C1RA 1GBAA 1YPGH 4OS1A 3MTYA 5FCKA 3GCTG 2I6QA 3A7ZA 2FX6A 2CHAB 1GJDB 1QHRB 4LK4A 5LH8A 2D1JA 3RXDA 3V7TA 2P3TB 3A86A 1T4UH 3V3MA 2WV5A 1C9PA 1K28D 3RXKA 3F68H 3H5CB 5GCHG 1S84A 2ANMH 2B0FA 3B23B 4GCHG 4DIHH 1LVMA 1CA0B 4O97A 1GI3A 2BLVA 2KAIB 4ABHA 1DSUA 1Z71A 3ZZAA 1BTXA 1L4ZA 1B5GH 3PMHB 1O2ZA 1AZ8A 1YPLH 4AFSA 2FO9A 5EQSA 1A3BH 2P3FH 1CA0C 4ZKRU 4Y7BA 1KY9A 4GAWA 3OY6U 1KTSB 3DFJA 1IQJA 1RGQA 3A89A 4NGAH 1LPGB 3GOVB 3B8JA 2P93A 3M7UA 1AFQB 4B2AA 2TGTA 1HAHH 3ATKA 2ZCKP 5DGJA 4AB9A 2R9PA 4U30A 6CHAB 2ALPA 2FM2A 2ZWLH 1HRTH 1V2NT 1HJ8A 2GDEH 3A88A 3GY6A 1NFYA 2F83A 1AFQC 1LQEA 4AZ2B 4DGJA 5LGOA 1GHAF 2HWLB 1SGPE 4J1YA 1DUAA 3VB4A 1ARCA 1UK2A 1O2VA 1SGFG 5L30H 4DY7B 3AW0A 1BB0B 1BTYA 1BRUP 1AUTC 2FXRA 2Y5HA 3L33A 1T31A 1TQ7B 3QK1A 1SBWA 5EPYA 1Y8TA 3LDXH 3BTDE 3D23A 4GHTA 2ZDVH 3SORA 1G37A 3UREA 1EJNA 1MU8B 1DWBH 1W2KH 1TMUH 1Y5AT 1UTJA 1G9IE 2FX4A 2Q6GA 2A7JA 4A1VA 1KTTB 2Q6FA 1LPZB 1P8VC 2FS8A 3NXPA 1A0HB 5TJXA 3MHWU 1CT2E 2GGVB 4Y76A 3Q3YA 2D8WA 3AVZA 1UJ1A 4M7GA 3M36A 5HXFA 1TBQH 1K1PA 4Y11E 1HBTH 1DWDH 3UY9A 2ZGHA 1P2QA 2XW9A 3SU5A 1LKBA 2VWOA 1GHBF 2BHGA 4FVDA 2A45B 2C3SA 1GI9B 4WH8A 4X1RU 1CE5A 1DY8A 2ZCLP 1TNLA 4WF8A 4NIXA 3MU0A 2GZ8A 3D65E 1DM4B 1NY22 4I8KA 1QA7A 2FOBA 4BTIB 4UONA 1ZMJA 2UWOA 3FP8E 4A6LA 4D76A 4X6OA 2HLCA 3KHVA 1ZZZA 1SLVB 1EP6A 3RXLA 1LHFH 2PKSC 1U6QA 2ZECA 5EU8A 4B2CA 3ZVCA 4CRFA 1O38A 3O8BA 1BTUA 3L3TA 1S83A 2VNTA 2Y81A 4DW2U 1OWDA 1TBRH 2BTCE 1YLDA 3FAOA 2FOMB 3VB7A 1BJVA 3VXFH 4ABFA 1CQQA 1PQ7A 2P8OC 1NU7B 1SGFA 1AI8H 1FNIA 3NPSA 1P05A 3ZZCA 1K22H 1BCUH 2A5AA 1ACBE 5K0HA 4KTUA 3E0NB 2P94A 1GBDA 1EOJA 4X0WU 1P3CA 2THFB 1N6XA 1GGDC 4I32A 4K2YA 1XKBC 5AHGH 3EDXB 4Y10E 9LPRA 2GZ7A 4F49A 2W3KA 1T8MA 2BM2A 1TRNA 1O2TA 3LIWA 2TGPZ 4H6SB 1F0SA 1XUIA 2P3UB 4YOIA 2OC7A 3RC4A 1EZSC 1G36A 2ZDNA 2GVFA 3SQEE 1KDQB 5DP8A 1CBWB 2D26C 2RA0A 4NSVA 5DP9A 1EJMA 1PPEE 2JETC 1BOQA 1QJ7B 4NCYA 3GDUA 2WYGA 1H9IE 1O36A 3NWUA 1DLEA 1AN1E 1TX6A 4X1NU 4OGXA 1GHAG 2Z9LA 3LOXA 4JMYA 4IW4E 4Y8YA 2Z7FE 1O0DH 1C2KA 3S9BA 1YPHC 3U1IB 4TPYA 5DG6A 1NTPA 3M5MA 4AORA 1ZJDA 3SJOA 3UNSA 1O2SA 3P8OA 1DWEH 8GCHF 4RN6A 1L1JA 4BXSA 2FOEA 1A61H 1YGCH 1QGFA 1GJ4H 2PWXA 3URDA 4XOJA 1GBMA 4I8GA 1MTWA 2C8XB 4IMZA 1TLDA 1A5GH 3SNEA 1BJUA 4IBLH 2Z6BD 2A4QA 4VGCC 2JH5D 3ODDA 4JYTA 4BAKB 2PGQB 1XX9A 4CH2B 1OP2A 4MDSA 2PHBA 3FZDA 2Q6DA 1BIOA 9ESTA 2OUAA 1GCDA 3BTKE 4H6TA 2HRVA 3IG6B 1PPHE 1Z6JH 5DKMA 1GHWH 1GJCB 1TPAE 2R2WU 3KCGH 1G3DA 2ZFSA 1NFWA 2V3HH 1SGCA 3SUFA 3M5OA 5LPFA 5E0JA 4CR9A 2QAAA 1RD3B 3MH6A 4NWKA 1QURH 1AGJA 1YLCA 2B5TB 3RC5A 1K1JA 1SVPA 2A2QH 2PR3A 2OTVA 2NU0E 1VZQH 4OGYA 1KDQA 2J34A 3QZQA 1S5SA 2BOHB 4D9QA 1GL1A 4O9VA 1QJ6B 3S9CA 1DVAH 4FVBA 4TWYA 1Z1IA 2F9VA 2BY6X 1Q2WA 1BRCE 3PV4A 3SI3H 3F6UH 4INKA 3TH4H 1NRPH 2G8TA 2VJ1A 4AG2A 1OXGA 2F9NA 4NFEA 3GY3A 1ZPBA 2AMPA 4MQAA 2BD4A 2ZO3H 1C9TA 2GD4B 4ABAA 1K1IA 1W8BH 8KME2 1P10A 3I29A 3AAVA 5A2MH 1KLIH 4XBDA 4AG1A 1V2JT 4Y6DA 1AO5A 1J9CH 1NU9A 2GKVE 2CHAC 1AE8H 4LXBH 3RXCA 1O5BB 5TCAA 5EXNA 2F9BH 2CN0H 1EXFA 2A5IA 5F8TA 1Y3VA 2XBWA 1CHGA 1LTOA 2Z94A 5E0GA 4D9RA 4FUCA 4JYVH 2FODA 2H9HA 1TRMA 3BEIB 3SHCH 2HALA 1LVBA 4FU9A 1TA6A 4KELA 1ELDE 1V2MT 2A5KA 3B9FH 4O3UA 3E91A 5FCRA 5EOKA 2TBSA 1BTPA 3ZZ4A 2AGIX 3QTVH 1MTSA 2QC2A 3RXQA 1V2UT 2BDYA 4INLA 5B6OA 1TBZH 1WUNH 1QB9A 2ASUB 2H6MA 3E16B 1SPJA 3MYWA 2XXLA 1GJ7B 3UWJH 1O2UA 1JMOH 3VB3A 4ZXXH 1Y3UA 1OWIA 1AWHB 1OYQA 1GCTB 1GMCG 4YLUA 1YCPH 5C67A 1SHHB 1MQ6A 2BD2A 2TGAA 5JB8S 1C1WH 3LGIA 3Q3XA 3VGCB 3E3TA 4HTCH 4TY7A 4WXIA 4TYDA 1RJXB 4NA7A 1D3TB 1O5GH 4NZLA 1UVUH 1BMLA 4R0IA 4TWWA 3KQBA 1ZMLA 1PPCE 2JKHA 3M5NA 3OSYA 2G4UA 3MNSA 1OWEA 3K6ZA 3SGBE 3E0PB 3A8DA 4THNH 3EA9A 3UQOA 4WWYA 1D3PB 1EPTA 1E37B 2Y5FA 1SQOA 1YYY1 5EQRA 4HGCA 2QA9E 3UWIA 4WJG2 1ZTKA 3RMOH 3M7QA 5AF9H 1TX7A 4NA8A 1MU6B 2IOTA 4FUIA 4TY6A 4D7GA 1TNHA 1GL0E 3RDZA 1KXBA 1P01A 3SUGA 3VPKA 5GJ4B 2WPKS 3T28A 1P2IA 3A8AA 5FAHA 1BZXE 5DK1A 3TIUA 1AQ7A 3KN2A 2H5DA 3ATLA 1Y5BT 2KAIA 4WY3A 1IQEA 5EQQA 4NA9H 2VIPA 3TJUA 2ZPRA 1SL3A 2GV7A 3IWMA 4B76A 4FUGA 1W3CA 2K1QA 6ESTA 2FMJA 3Q3KA 1SI5H 5F8XA 5L2ZH 2ZU2A 4X8UH 2O8WA 1FIZA 1ZTJA 3F1SB 1T8OA 4XBCA 2Y82A 1LMWB 1SGIB 1ZLRA 2BB4A 3SU2A 2G51A 5JB9S 1FQ3A 2BDGA 5HM2A 4JZEH 5C3NA 5CMXH 1SOZA 3P70B 1BUIA 1HFDA 1JIRA 1HIAA 3KIDU 3R3GB 1Z8GA 4UFDH 2P8OB 1H8IH 1B7XB 4GUXA 2QXJA 1EASA 1T8NA 3A7XA 3RXIA 1P03A 3TU7H 3QUMP 5EGMA 1IQMA 3U9AH 2OINA 1ZRKA 3RM2H 3DD2H 3ENSB 1ESTA 4SGBE 4INHA 1A0JA 5JPMH 1PQ8A 2BXTH 2J95A 2Y80A 5JYIA 1EZUC 2ZEBA 3QGNB 3RC6A 2BDIA 5DP4A 3SQHE 4AN7A 2Z3EA 3RXVA 3MU5A 2ESTE 2B8OH 1HNEE 4CRDA 1C4Y2 2PV9B 1AHTH 1CGIE 3P17H 4Q7XA 2A1DB 1VJAU 4X1PU 2BQ6B 4GLYA 4YOJA 2HPPH 2J9NA 1TFXA 1UCYK 1MKWK 2UUYA 3GDSA 1GDNA 1D3DB 2BLWA 4X8SH 4WXVA 1HAVB 2ZHQH 3GCOA 1P11E 1FY4A 3JZ2B 4B74A 3PTNA 4ISLA 1IQKA 3VB5A 1W13U 1FN8A 3MU1A 2O9QA 1O5CB 2G52A 1E34B 4GVUA 5A09A 5I46H 2W3IA 1PJPA 1RTFB 1QNJA 2OBOA 1EUFA 1BTHH 1ZYOA 5HYOA 2ANWA 2OQUA 1ESBA 2TPIZ 1UTPA 1PQAA 2NU4E 1SLUB 3K2UA 5ESBA 2ZGXH 4UE7H 2JH6D 4X6MA 1P06A 4IC5A 1C2FA 1W14U 1V2TT 2BX4A 1MZAA 1C2HA 1GI2A 1KXDA 3Q77A 1THPB 3EGKH 3KL6A 2YNAA 1ANEA 3RU4D 1H8DH 1RTKA 2EEKA 1KXAA 1FPHH 5CHAB 3ZZ8A 1ELEE 2YNBA 1YCPK 1SGNE 1SQTA 1IQNA 2Y7XA 2W7SA 1ELCA 1OP0A 2UWPA 2ZU4A 1FIWA 4XE4A 1XUFA 1QBOA 2VGCC 4I7YH 5T6FA 1NRQH 3A87A 1AD8H 4UFFH 5DP6A 1L1GA 2A32A 2AYWA 1FV9A 1GBHA 3SNDA 3C27B 3GYLB 1CHOG 4JK5A 1TOCB 2VIQA 2G55A 4Q2KA 2BY5X 3BTEE 4X1SU 3PTBA 2A2XH 3TGKE 1VGCC 1BT7A 2AMDA 3GY2A 1AVGH 3A81A 3BG4C 3NZIA 1HPGA 1F0UA 1AIXH 2OQ5A 1CSOE 4H42U 1V2QT 2W5EA 2NU1E 1F5KU 4A5TS 1FY8E 2HPQH 4KTSA 1BBRE 1BITA 3TNTA 3ZVEA 3RMNH 1V2LT 3PLPA 5J4QA 1SOTA 3SV6A 1C2IA 3SW2B 2GCHG 3MNXA 5EG4A 4YLQH 2HNTF 4X2WA 3VB6A 1O3EA 2O8MA 3ZVFA 5E2PA 4K60A 1QIXB 2ZDKA 1TALA 3CENA 3PB1E 1B0FA 2GT7A 3PM3A 5E0HA 2Z9GA 3PLBA 1HJ9A 1YC0A 2Z9IA 3MH7A 1P2KA 1S81A 6GCHF 1GBFA 3T2NA 3SV7A 1MKXH 1O3LA 1EJAA 1EP5A 1TGBA 2BDAA 2NU2E 1V2RT 2Y6TA 4MLFB 1XVOA 4X6NA 1VR1H 3SGAE 1NROH 1TA2A 1GMHG 5DP7A 1O34A 4E7NA 1G3CA 4AYVB 1WSSH 3RM0H 4XDEA 4FU8A 1G2LA 4DJZB 5F6MA 2EI8A 2J4IA 1KXFA 3S7HB 1MH0A 2C90B 1QTFA 1HAPH 2VIWA 3ODFA 1EOLA 2BD5A 4ZUHA 1MTVA 1OYTH 3LU9B 1O2MA 1K1OA 1W0ZU 5JBTA 5L6NH 1YPJH 2WPIS 1VITG 2ODPA 1THSH 1A5IA 5HMAA 1ZMNA 1G32B 2ZTYA 1UMAH 1A7SA 1F5RA 4DCDA 1OP8A 1GHYH 2GCTC 4ZKNU 1YPMH 2BX3A 1NRNH 2XWBI 4DOQA 1JIMA 2H9EH 4OS2A 1P02A 4NSYA 3SN8A 2WPJS 1SMFE 4ISIH 1C4V2 1Z8JB 3SBKA 2GCTB 8GCHG 2BD8A 1HB0B 2FIRH 3A83A 2V35A 1G30B 1ZGIA 2AGGX 3O8RA 1WCZA 3WY8A 2F91A 3K9XB 2OC0A 4NWLA 3IITA 1WU1A 3TK5A 3KQCA 1IHTH 1BRAA 4BAOB 5L2YH 1C5VA 4CBNA 3EQ0H 1HAVA