4X0WU

The crystal structure of mupain-1-17 in complex with murinised human upa
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mupain-1-17
publication title Distinctive binding modes and inhibitory mechanisms of two peptidic inhibitors of urokinase-type plasminogen activator with isomeric P1 residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
total genus 55
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x0wU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x0wU01
2O8UA 4AGKA 5DP6A 1BIOA 1GDQA 5EPNA 2OC1A 1CT2E 2HGTH 1J8AA 1E38B 3EYDA 1BQYA 1BTWA 1ZYOA 1IQLA 1WQSA 2B5TB 4WH6A 1XXFA 3ZZ4A 1IQEA 3O8RA 2GP9B 2VWLA 3KGPA 1BBRE 1HIAA 2ZFTA 5EQSA 1C5YB 4ZHLU 1EP6A 1H9IE 1ANDA 1SPJA 3R0FA 3S9CA 2J34A 3CENA 1LVOA 2QAAA 2Z7FE 1C1RA 2A1DB 5DP3A 1F2SE 2VWMA 2W7UA 1VCWA 3HK6B 3GCNA 1EP5A 5CHAC 3OY6U 1T4UH 1P04A 5AF9H 3G01A 4U01A 2OUAA 2P3TB 3F1SB 1ZPZA 5DP4A 1D6WA 2WPMS 5JBTA 3SGBE 2V0BA 1LTOA 2Q6GA 4A92A 7KMEH 3BTFE 1SFIA 3A86A 4NGAH 3Q77A 1JOUB 3ZYDA 1FAKH 4YO9A 2GCTB 4ASHA 3MNSA 1L0ZA 2QXIA 4X6MA 4BXWA 3QN7A 1JWTA 2F91A 2V3OH 3E16B 3PROA 2PSYA 2PV9B 4O9VA 1AFQC 1D3TB 3SV2H 1GJBB 2A4QA 3SU6A 1A0HB 1C2HA 3SV7A 1D6RA 2DUCA 1XUFA 1TOMH 3PLBA 3CS7A 1AY6H 3MHWU 4GCHG 3H7OA 1O32A 2BOKA 3SHCH 1BHXF 1O2SA 1Y3VA 4CHAC 1A1RA 2BX4A 2EEKA 1D4PB 1SG8B 4MDSA 1OPHB 1O2IA 1P11E 5ABWA 1K2I1 4KTUA 2WV5A 3E0NB 1KIGH 3A88A 1YP9A 3QO6A 3SUEA 1HAXB 3QWCH 1ZGIA 1N6XA 2BVXH 2FM2A 4K8BA 1RIWC 3HKIB 2XBXA 3UNSA 1RJXB 3KHVA 3MH5A 3UFAA 1VCPA 1MQ5A 4O3UA 3A7TA 4OS1A 1CA8B 2GZ7A 3FANA 2JKHA 1S83A 2Y7ZA 5GPIB 3M7TA 1ZHRA 1BA8B 1BUIA 3LGYA 5AVDA 3ZVEA 4LXBH 3PLPA 2C8YB 2FYRA 1GCTC 1ESTA 1GMCG 2ZFPH 3K2UA 3BV9B 2A4GA 2ZNKH 4GVUA 4YT7H 1ELEE 2FWWA 1GBLA 2QXHA 4FUCA 2PLXA 1T4VH 2BDBA 3FP6E 1J17T 5DP8A 2O8MA 3VB4A 3RXGA 2AMPA 1ELBA 1MD8A 3MTYA 3U8TH 4B2AA 1HAYB 4JYUH 2J9NA 1OS8A 4D7FA 5H4IB 4YZUA 1DWDH 2Z9IA 2B9LA 1GHBF 3URDA 2YNAA 1NS3A 2PKSB 5A09A 4WXVA 1W14U 2ZIQH 2Z3DA 3E90B 2ILNA 1KXFA 2KAIB 1C5NH 1FNIA 1OP8A 3B8JA 3EA7A 3PMBB 1GBKA 3RXUA 1L1NA 4CREA 3PV4A 1C5TA 2FXRA 2XC5A 3SQHE 4D76A 1YLCA 1Y5BT 4ESTE 1OSSA 3SUDA 1ZGVA 5BPEA 4J2YB 1EATA 1P3EA 2GT7A 3M3SA 4WMDA 1TNLA 1C5VA 1UCYK 1FXYA 1QQ4A 5EW1H 1L1GA 2Z9JA 3ZVAA 1XUJA 1SC8U 4NIXA 5A2MH 3L6PA 2VVVA 1P2IA 1PFXC 2CXVA 5FPYA 4WJG2 2RCEA 2Z9GA 2ZCKP 5J4SA 3HPTB 1P10A 3RXJA 3E1XB 1ELTA 4I8GA 3SI3H 2BDHA 1M9UA 4GSOA 3M5NA 2WPIS 3A89A 1JIRA 1O3IA 4YESB 1ZSLA 2RDLA 4FVDA 4DOQA 2ZGHA 2ALPA 3TU7H 2G81E 2ZGCA 4R0IA 1EOLA 3M61U 5JBCS 1FY1A 4X8TH 1LPKB 1O3KA 3M35A 4NSVA 1J15A 2BXTH 1OKXA 6CHAB 5HM9A 2FESH 1SGYE 4B76A 1O3NA 3O8CA 4XSKU 3LC3A 4ZROA 1FPHH 3HGNA 3F9EA 2FOHA 4WWYA 1ETRH 1BB0B 4ZH8A 5GXPA 2ZDAH 3BTDE 5HM2A 5LPRA 5K7RA 3UNQA 1LKBA 2ZFFH 1DPOA 1TGNA 2J2UA 1SGEE 2BVSH 3ENSB 4J1YA 4M7GA 2THFB 4FU7A 1MKWH 2GDDA 1UK4A 2OP9A 4X2WA 3S69A 4CH2B 3FP8E 2ZGBH 1GWAA 5BRRE 1MBMA 3P8FA 1GCDA 2BLQA 2GMTB 2FX4A 3UTUH 3SI4H 5T6DA 5LGOA 3MO9A 3L3TA 4TY6A 1S0QA 3NWUA 4X1PU 1LCYA 3ZZ7A 2PTCE 3UUZA 1CO7E 1CT4E 1V2ST 1FJSA 1CGIE 3NPSA 1XMNB 2HNTE 5F8TA 3GICB 1CBWB 1DDJA 3ITIA 1EAXA 1YCPH 2ZI2H 1GL1A 1VGCC 2XWAA 3EE0B 3PTBA 2A5IA 2SNVA 1LHFH 2UUJB 4FUHA 3GY6A 1SQTA 2ZF0H 1JRSA 1MTNB 4AG1A 3RU4T 1XVMA 1DSTA 2BTCE 4BAKB 1O5CB 3OU0A 5FAHA 4HGCA 4E05H 1PPCE 4DG4A 3Q3KA 4X6PA 1ZTLA 1LPZB 1Z6JH 2HWLB 3ZVDA 2FX6A 2Y80A 1O35A 2ZFQH 4MLFB 2EC9H 2WYGA 1F5KU 3LU9B 1THRH 2A4RA 2GV6A 1QL9A 1GMHF 3SU2A 1KTTB 1QRWA 3AVZA 1AWHB 3SQEE 4CRCA 1O5BB 2D26C 2NWNA 2BLOA 2QY0B 3RM0H 2PKAA 2GZ9A 4FVBA 3LGWA 4Q2KA 1C1OA 4Y71A 1SLVB 3LGUA 3T28A 1MCVA 1GDNA 1TRYA 1EZSC 1O3MA 4HI3A 1O2GH 1QIXB 2FI5E 2Z9KA 1P2QA 1IQJA 3EA9A 2BD3A 5SGAE 1BTPA 2WPHS 5C2ZA 1OX1A 4NFFA 2VIVA 2FMJA 1Y3UA 1OP0A 5EPYA 1AB9C 2BY8X 5EGMA 2AGIX 1ACBE 3RXKA 1A5IA 4BAOB 1ABIH 1P2JA 4OS6A 1GBHA 5EQRA 5EXLA 1E36B 1SLXB 1ANCA 2Y7XA 4IC5A 1FDPA 3VB5A 4YM9A 2ASUB 1YF4A 1BBRK 1O2RA 1Y3XA 1DLEA 4UONA 4JYTA 3NXPA 2TBSA 2VH0A 2BD8A 1NU7B 2GCHG 3URCA 1K1IA 3LH1A 1O2XA 3M3VA 5JBAS 3BEFB 1SGFG 1SGRE 1HAZB 1O34A 1HUTH 3LC5A 2OTVA 3EDXB 2QF3A 3RXQA 1SFQB 2R9PA 4NWLA 3QTVH 5GWZA 1Q2WA 2OXSA 4XBBA 2P8OB 1YGCH 4FUFA 5B6OA 1T8LA 1UVPA 2A2QH 2GVFA 2O8WA 3QZQA 2ZC9H 1AU8A 2UWLA 5JDUB 1PPEE 1QJ6B 1NRNH 1SQAA 3GY3A 2SGDE 1Z8JB 2NU0E 2ZU5A 1AWFH 2SGAA 3BTGE 1SGQE 1O2OA 2G4TA 1H9LB 3SJKA 1CU1A 4BTIB 2F3CE 1VITH 1NPMA 2XNIA 3NK8A 4ISOA 2TIOA 3VGCB 4OGXA 1TPPA 3A7VA 1EAIA 1HJ8A 4Q7XA 2AH4X 1GGDB 1ZJKA 3ZVCA 4TWYA 1RFNA 1O3FA 4D8NA 3ZYEA 4BTTB 1TIOA 4UFFH 1SGFA 1V2OT 2FODA 2HLCA 1MTUA 3N7OA 1Q31A 5GCHF 1TPAE 1Z7KA 1F5RA 5ESTE 1BJVA 2ANKH 4NIVA 1AHTH 3T25A 2ZQ2A 1MU8B 3BTKE 4MPVA 4Y10E 2BD9A 3KQCA 3TNSA 1TONA 2ESTE 1O3AA 4F4OC 2A45B 1GVZA 5FPSA 1GHZA 2BHGA 1LPGB 1C5PA 4AB8A 1FIWA 1YPHC 1BRAA 4ZKOU 2TGDA 3EAJA 1GBEA 4JZIA 3VXEH 1S6FA 5I46H 1FLEE 1AVXA 1YCPM 1U6QA 5JB8S 5JBBS 3Q3XA 4XDEA 1DITH 5A8ZA 1T8MA 3RXEA 1Y3WA 1WV7H 4K1SA 1Q3XA 4Z0KA 3ZVFA 1YPGH 3M7QA 4ZKNU 1MAYA 2PW8H 4GCHF 4OS2A 1CT0E 4NA8A 5AFYH 4ABBA 2Q6DA 2WPJS 2PGBB 2KAIA 3E91A 8ESTE 1L2EA 1TRNA 2ZDMA 1ANBA 1C1WH 1TLDA 1C2DA 3BTHE 6GCHG 4GHQA 2XBYA 1ETSH 4F49A 2R0LA 2W3IA 1P2NA 2AYWA 1ID5H 4KTSA 2Z6BD 8KME2 4ABJA 1YPLH 5E0HA 1GJ4H 1PQ5A 2FTMA 7ESTE 1S82A 3ELAH 4MNVA 1AMHA 4JZDH 1LO6A 2Q6FA 2QN5T 3UWJH 1IQMA 5JYIA 1C1TA 4WF8A 1NU9A 1PQ7A 3I78A 1N6YA 3A84A 4FUIA 1FN8A 2XRCA 5ETXA 1WUNH 4Y0ZE 1EB1H 4Y6DA 2UUKB 1ZTJA 1BRUP 1GMCF 3STIA 2ZDVH 4A1VA 3RXMA 5DG6A 2QGRA 1LMWB 2GCTC 3F9FA 3T27A 1MTSA 4H6TA 1AE8H 1QRZA 2PKAB 2AIQA 4E7NA 5AFZH 3BTEE 1FIZA 3BG4B 1C1PA 1EPTA 3VB3A 1OWKA 2ZTZA 2ZDKA 3KL6A 3P92A 2VJ1A 1GJ7B 8GCHG 1C4Y2 2IJOB 1F0UA 2JETC 3VEQB 4JZ1A 1AI8H 1Z8IB 2LPRA 2QIQA 1HLTH 3JZ1B 4U2WA 3FVFB 4Y8XA 2VNTA 4X1SU 3MU1A 2HPPH 4CH8B 2SGEE 1J14A 2VH6A 1K1MA 2HRVA 3SW2B 4NG9H 1BRBE 4KELA 1NESE 3SU1A 1LHGH 1TMBH 4K3JA 4DJZB 3ZZDA 4B2BA 1SOZA 3T29A 1TYNA 1K1PA 5L2ZH 4I8KA 2A2XH 5C1UA 1GJCB 1BTUA 1TQ7B 4FUEA 1DUEA 3A85A 2QCYA 1O2LA 1W13U 1G36A 4X8VH 1W0YH 2F9PA 2BDIA 2WINI 3LT3A 1XVOA 7GCHG 1QJ7B 1GI1A 2AS9A 2TPIZ 5HGGA 2ZFRH 2ZU2A 1TMUH 1EQ9A 4WVPE 1MBQA 1G3EA 2ZU4A 2C8WB 1RTKA 3MO3A 3F9GA 3MMGA 2H5CA 1OOKB 2FPZA 4VGCB 2P94A 4AFZA 3SHAH 4ZXXH 4MPWA 5FXLA 1MZAA 5L6NH 3MU4A 4FXGH 1GHYH 1NRRH 2DE8A 1QURH 2GGVB 4NA7A 2EI8A 3VXFH 4X1NU 3TK5A 3SO3A 4BANB 5CE1A 1T31A 1TNGA 1YPEH 1V2VT 4PROA 4AB9A 2XC4A 3KF2A 3RLYH 1VITF 1RS0A 3SU4A 3RC5A 1V2RT 1DT2A 1OWHA 1UVUH 3UOPA 2UUYA 4TPYA 2NU3E 2WPLS 3BN9A 2BM2A 2VGCB 5EQQA 1LQDB 2FOGA 1PPHE 1UCYH 4K1TA 2A5AA 2NU1E 2XCNA 5A8XA 3P8OA 1RGQA 1A61H 1QB6A 2A4OA 5ESBA 1O2MA 3SNBA 1EZQA 3GY2A 2SFAA 5PTPA 2EI6A 2J38A 1NTPA 2CN0H 3PMAB 5A8YA 1P8VC 2FO9A 1T8NA 3M5LA 3PM3A 1C2FA 1SOTA 4X6OA 5C5NA 5LPFA 1HGTH 3W95A 1TGCA 2UUFB 3JZ2B 1C2GA 2Z94A 3AW0A 3FP7E 4A5TS 2FP7B 1GMDG 3DFLA 4SGBE 2Y82A 1DY9A 2H2ZA 5A0AE 4RKOB 1SGPE 1Y8TA 3SJ8A 2ZPRA 1G30B 2J94A 2D1JA 4Q80A 4I8HA 1ZMJA 2A0QB 3GDVA 4O03A 4KKDA 3TH2H 1NO9H 3NZIA 2H1UA 1C4V2 1TRMA 1BCUH 1ZRKA 4DY7B 2VWOA 3BG8A 3SU3A 1AUJA 1ESAA 3D49H 1O3LA 5CHAB 2HPQH 1NT1A 2OBQA 1O2KA 3MO6A 3F68H 1H8IH 1S85A 4ZXYH 5G4BA 1KY9A 4AFSA 1V2WT 3RXCA 3LONA 1UTMA 4ZKRU 4ISLA 3KN2A 2OBOA 4RKJB 1B5GH 2FDAA 1C2IA 4HFPB 1CHOG 3A87A 3IITA 1BRCE 2STAE 2NU4E 1HDTH 1MTWA 5A0BA 2F9VA 2I6QA 2ANYA 1X7AC 1AFQB 1YC0A 2FI4E 1P12E 1B0EA 1EZXC 4AORA 2WUCA 3MH4A 2FI3E 1MH0A 1G3DA 4GPGA 3RXTA 3U1JB 1SLWB 1AKSB 1P2KA 1UTKA 3PMJA 2BZ6H 1F0TA 3Q76A 2RA0A 1TBZH 4IMZA 5C67A 2SGPE 2Y6TA 1QY6A 1QBOA 1FN6A 4CHAB 1KYNA 1AE5A 2B7DH 3LJOA 4BXSA 3TGKE 1O5EH 2Z3CA 2CHAC 3V12A 2QYIA 4JZFH 3SJ9A 1AUTC 4MVNA 1OWIA 4BAMB 1CBWC 1QB1A 1W10U 1O2NA 2RG3A 2EA3A 4IW4E 2XTTB 3K6ZA 2BD5A 3PO1B 2A5KA 3RMMH 1OWDA 1P2OA 3TJNA 4DIIH 1UO6A 3O8DA 1NN6A 3ZVBA 1V2NT 4OS5A 1K28D 3RXDA 3BTQE 1O37A 1MTNC 3TGJE 1XUHA 1KSNA 3NCLA 1C2LA 4Y0YE 3SNCA 1V2TT 1EPTB 3TH3H 1ZJDA 1B0FA 1ZZZA 5JB9S 3GOVB 2AFQB 1NROH 2VB0A 4XBDA 5CMXH 2NU2E 2RA3A 3TNTA 1EUFA 1UVOA 1DE7H 1GCTB 1GI7B 1K1JA 1EJNA 2ZQ1A 1YPHE 1HAIH 2GCHF 1EZUC 5L30H 3O8BA 4FUJA 1TFXA 2FOCA 2TGAA 1HRTH 1Y5UT 3QTOH 3C1KA 1TOCB 1A7SA 1UTOA 1FY5A 2H6MA 3AW1A 1Z8GA 2ZCHP 3PB1E 1TNIA 1THSH 1O5DH 3V3MA 4GLYA 1ELGA 2QF0A 1IHTH 4JMYA 2BDYA 1GI4A 4NSYA 1DICA 1TBRH 1W3CA 1NZQH 2FOMB 1RTFB 1W11U 1SVPA 3E8LA 1O36A 5J4QA 1NFUA 2PFEA 1FAXA 3KQEA 3RU4D 1NM6A 3A83A 1KTSB 1A2CH 3B9FH 4AYYB 1BBRH 1O3CA 1BTXA 1SQOA 4K60A 4D7GA 1SGCA 1S84A 3GCHB 2G00A 3GCTF 4X1RU 5EG4A 1VJ9U 1W12U 1MZDA 2F83A 2LNCA 3PWCA 3ODDA 4Q7YA 2W3KA 1C5WB 3TK6A 1P3CA 2ZPQA 1O2ZA 3RC4A 5EW2H 3V13A 1AO5A 2OINA 2H9EH 1HAPH 1C5RA 1GG6C 2BD4A 1GHAF 2P95A 1PJPA 2ZHFH 3HK3B 1JBUH 2P59A 3UIRA 4RN6A 1Y3YA 3OSYA 3LGTA 2ODYB 1TPOA 2VIPA 1QFKH 3TJUA 3GY8A 1CQQA 1G37A 1UTQA 1QL7A 1A5GH 3MI4A 1OYQA 2QC2A 1GPZA 1RXPA 1HB0B 1LKAA 2FS9A 1VZQH 4R8TB 5HMAA 1JXPA 4X1QU 1IQHA 1Y5AT 1N8OC 3HGPA 1OWEA 3I29A 3E0PB 2J4IA 1EOJA 2BY9X 3P95A 3UPEA 2G8TA 2HALA 5DP9A 1TWXB 3D62A 4XE4A 3LIWA 4BOHA 2G4UA 3EGKH 3GISB 4NIYA 4HZHA 1NY22 1LHCH 5JPMH 1EJAA 2ZZUH 3FZZA 3VGCC 3MFJA 4ABGA 1TQ0B 5DP7A 1C5LH 3VFEA 2ZU3A 4DIHH 1WU1A 1GGDC 1GI3A 1GVKB 5EODA 1DWEH 4B75A 3PTNA 1P0SH 1O3HA 2GX4A 1C5ZB 4ZMAH 4FUGA 1DSUA 3UNRA 3SU5A 2YNBA 1A46H 1S6HA 4H6SB 1PQAA 1VGCB 4UFDH 2ZA5A 1G2MA 4X8SH 1WCZA 5F8XA 2FZZA 1O2VA 3RP2A 4X2VA 1NRPH 1WSSH 1TAWA 5E2OA 1SLUB 1MD7A 3QGNB 1DWBH 1ZMNA 1FQ3A 1CA0B 2VVCA 5C1YA 1T8OA 1IQGA 1A3EH 1DVAH 1G2LA 3KIDU 1SSXA 2C90B 1UK3A 3LGVA 2BMGB 2CJIA 1O2HA 1ZTKA 2FS8A 1C1SA 3S7KB 1SHYA 2DE9A 3MOCA 5EU8A 3BSQA 1V6DA 3QK1A 3R3GB 1UVSH 1O3OA 2ZGJA 1O30A 3TLOA 4NZQA 3GCOA 2JH0D 3TITA 3SJIA 2FEQH 2GZ8A 5DJ7A 1QTFA 1LHEH 3SV6A 2O9QA 1C1QA 3A82A 2Y5GA 2GV7A 1QGFA 4UD9H 1SGNE 1TB6H 1E0FD 1Z71A 3WY8A 1GJ6A 3SNEA 1VJAU 1ZSKA 1FZZA 1W2KH 1TBQH 1JMOH 3RM2H 3P70B 1UTJA 4K2YA 1HXEH 1TX8A 1HJ9A 1HJAB 2YOLA 1GI5A 3E3TA 1K21H 3VPKA 4IN2A 3GY7A 1THPB 2ZDLA 1A0LA 2ZTXA 2BD7A 2FTLE 2R2WU 3GY5A 1V2JT 1BJUA 3LGIA 1OYTH 1ESBA 1RD3B 2Y5FA 4ZAEA 1XXDA 4I8JA 1AD8H 2GKVE 3W94A 3SOSA 2M5TA 3I77A 4Y76A 4UDWH 5GIBA 1XM1A 1YYY1 1KLIH 1O3JA 1VR1H 2P3FH 1FY8E 1OP2A 3RXOA 4I33A 1O2JA 1YPKH 3BIVH 3HATH 3SN8A 4Y8YA 2C8ZB 4A6LA 1L4ZA 4INKA 1C1NA 1BOQA 3ATLA 2ZPSA 1GMHG 3TVJB 3TJOA 1QCPA 1O5AB 4ABIA 3QLPH 3H5CB 3F6UH 3A8CA 3K6YA 4UE7H 3ZZCA 3BIUH 4DT7B 1T32A 5AHGH 1P9SA 1H1BA 5E2PA 2J95A 1H4WA 2JH6D 1TABE 3DFJA 4AFQA 1S0RA 2PWXA 1HXFH 1AKSA 1ZRBA 2C4FH 2ODQA 3DT0H 4CBOA 5IDKA 5DK1A 1EAUA 1YBWA 1MKXK 2ZU1A 1DXWA 2BY5X 1GDUA 2FOFA 1YLDA 5E0JA 1KDQB 2D8WA 3KQBA 1QB9A 1GHXH 3S9AA 1V2PT 3FZDA 1FI8A 4INLA 1GI9B 1L4DA 1QNJA 5LH8A 2G55A 1KXAA 4WY3A 9ESTA 3ZZ8A 3A7ZA 2F9NA 1D3QB 4VGCC 4ZKSU 1AGJA 1GHWH 4AN7A 5DPAA 4WMEA 1F5LA 2QXJA 2B8OH 1G3BA 4MNXA 4YOGA 3U1IB 1BMLA 4IGDA 1FPCH 3B23B 1MUEB 1G3CA 1EAWA 1Z8RA 1O3GA 1QA0A 3QDZB 1PPZA 1AFEH 1WYKA 4RSPA 1P9UA 1V3XA 2V35A 1UJ1A 2PSXA 3T5FH 1WTHD 1A3BH 2OQ5A 1K22H 4WXIA 2OC7A 3SU0A 1AZ8A 1NFYA 3GDUA 3RXLA 4YTAA 4CRFA 1C4U2 4A1XA 1O2WA 1INCA 3A7WA 4MPUA 2GTBA 2CMYA 5K0HA 4X6NA 4ZHMU 2ZHDA 1SMFE 1MCTA 3UWIA 1UVTH 1QJ1B 3SJOA 1F7ZA 3S0NA 1WQVH 2BQWB 2XYAA 4XOJA 2ZTYA 1P02A 3MNCA 1SL3A 5F6MA 3KCGH 1EB2A 1GJ5H 1WTGH 4IBLH 1T7CA 1MMJN 3K9XB 5FHTA 1C5XB 1EASA 2IPHA 2PHBA 2FOAA 2PR3A 2VWNA 4Y7BA 2VIQA 5GCHG 4JK6A 5EXMA 4K8YA 1O31A 4K1EA 3UREA 1BTHH 4UEHH 5FCRA 1SBWA 2WYJA 1MQ6A 5C5OA 3T2NA 1QBNA 3ZZ3A 3RXSA 2Z3EA 2BXUH 4FU8A 1EKBB 4Y79A 3DA9B 4DGJA 1TGTA 1O0DH 2VINA 1GJAB 4OS4A 2ANWA 1B7XB 1UHBA 2BQ6B 3SZNA 4H42U 2PKSC 1BMAA 1O2YA 3SGAE 1ORFA 5FBEA 2VU8E 3QZRA 1QR3E 2AIPA 2BLWA 4ZUHA 1P57B 2GT8A 3DHKH 1IQNA 4ISHH 4A7IB 1C9PA 1C2JA 2JETB 3M7UA 2ANMH 3LPRA 1IOEA 3ATMA 2BDAA 2XXLA 2BLVA 3GY4A 3P8NA 2FLBH 1UK2A 4AGJA 5F03A 3RXIA 1CVWH 3TGIE 3L33A 2FYQA 3P6ZB 3PMHB 2SNWA 4CRAA 6ESTA 1LHDH 3E6PH 3ZZ6A 2XCFA 5EXNA 3BTWE 3D65E 1J9CH 3ZVGA 1P01A 1K1OA 3MU0A 3ZV9A 1AQ7A 1DOJA 3OYPA 2AGEX 1C5SA 2UWOA 1FMGA 1E35B 3PO1C 3C27B 1XKBC 1TE0A 3ATWA 1ABJH 1XUIA 1YKTA 4TWWA 2TGPZ 2BQ7B 3M5MA 1C5MD 1AN1E 1IQIA 3AAUA 3A8BA 2A7CA 4JYVH 5A0CA 4FUBA 4BNRA 1DY8A 5TCAA 9LPRA 1EPTC 3RXVA 3MU8A 4BTUB 6CHAC 3A7YA 1PPGE 1P2MA 2ZFSA 4HTCH 1O2TA 2ZCLP 1H9HE 5C3NA 5T6FA 1P09A 2R0KA 1ELDE 2VVUA 1HAHH 3ZZBA 1EX3A 3MH6A 1NRSH 1TA6A 3VB6A 4JZEH 1Z1IA 2V3HH 1XUKA 1DUAA 3ZZ9A 1IHSH 2ZDNA 1DS2E 1P05A 1TGBA 3LOXA 4AZ2B 2W7SA 4B71A 5LPEA 2HNTF 2F9BH 4AYVB 1ELFA 3SBKA 2ZEBA 1K1NA 2GMTC 3MNBA 4Y11E 4NFEA 5TJXA 2TRMA 4GUXA 1D9IA 1QHRB 3RC6A 4YT6H 4YLUA 1O3DA 2WPKS 2ZP0H 2O8TA 3MWIU 3BEUA 1TA2A 2PTNA 3KNXA 1ZR0A 4B74A 2QV1A 3H7TA 1WOFA 4U30A 2BYAX 4MNWA 1C5QA 1HCGA 2I6SA 3UR9A 4CR5A 1CGHA 1LVMA 1O5GH 1ANEA 2IN2A 4TY7A 3GCHC 2Q1JA 1V2QT 1HAVB 1RIWB 2G5NA 4DCDA 1FUJA 4XBCA 2F9UA 2ZG0H 3KQDA 3SNAA 4ABFA 1H8DH 4E7RG 2GD4B 2H9HA 3QUMP 4DW2U 1SHHB 1KXDA 1C1UH 3BTME 3UQOA 3A81A 4YOIA 1V2UT 2ODPA 5T6GA 3A8DA 4Y7AA 4LOYH 4AOQA 3PWBA 1ZSJA 2VIWA 4FU9A 3NKKA 4UFGH 2CGAA 4ABEA 3ESTA 1GBMA 2ULLA 3D23A 5GJ4B 3ATKA 4TPIZ 3RUOA 2AERH 3SV8A 1UTLM 2HOBA 4AG2A 4KP0A 1LVBA 1SB1H 1V2KT 2R3YA 3T26A 3CS0A 4I7YH 3TIUA 1GJ8B 1ZPCA 4AFUA 4AX9H 2Z9LA 4ABDA 1NC6A 1VITG 3QGJA 1TGSZ 3OX7U 3S9BA 1F0RA 3PLKA 2G51A 1Y59T 1SGIB 1NRQH 5F8ZA 2P3UB 1E37B 1F92A 3Q3YA 1IAUA 3RDZA 1HIAB 4YOJA 5DKMA 1BZXE 5FCKA 2FOBA 4X0WU 3U98H 3P17H 1QBVH 2ZKSA 1W7XH 4E06H 1C1VH 3BTTE 2PGQB 2STBE 1HBTH 2PUQH 1GBIA 2D2DA 1XX9A 1C2EA 2OD3B 4YLQH 2CF9H 3PYHA 1BMMH 1O38A 2K1QA 2BB4A 3CP7A 1HFDA 2CHAB 5HXFA 1S81A 2XBWA 1AZZA 1BTYA 1C2MA 2A7JA 1RTLA 1KDQA 3MNXA 4CRBA 1FV9A 3A7XA 2A7HA 1NFWA 4X2XA 3TPIZ 1F0SA 3KEEA 2PUXB 4FUDA 4H4FA 5IYTA 1GJDB 3TK9A 1UHBB 2BDGA 3A8AA 4NWKA 1YM0A 1DWCH 3MH7A 3IG6B 4MTBA 1O5FH 1CA0C 3EA8A 1C1MA 2OLGA 1BMNH 4WMFA 5L2YH 2JH5D 4SGAE 1GI0A 3Q00A 1O2PA 2F9OA 2P8OC 1PYTC 1GBBA 3ZZ5A 2XW9A 1A4WH 1OXGA 1QL8A 3ODFA 4GHTA 2H9TH 4ISIH 5HYOA 1W0ZU 2VIOA 1GHBG 2QXGA 1V2LT 2WUBA 3U8OH 1TX6A 1PQ8A 4ISNA 3AASA 2W5EA 4O3TA 1ARBA 3UY9A 1D3PB 4ABHA 1C2KA 1N1LA 2C8XB 2OQUA 6LPRA 3DUXH 1C9TA 1GHVH 1UTNA 1XUGA 3LH3A 4IN1A 4K5ZA 4MNYA 5DO4H 5T3HA 4GAWA 4LK4A 4CR9A 4B2CA 3RXRA 1UMAH 1GL0E 6GCHF 5I25A 3GYMA 4BAQB 1ZPBA 1QQUA 1YPMH 1ELCA 4LZ4B 1HNEE 1XKAC 4I8LA 1GBJA 5DGJA 3ZV8A 1FONA 1HJAC 4IS5A 1KLTA 2AMQA 1MKWK 1KLJH 1O3BA 4B73A 3MYWA 5C1XA 4WH8A 1S5SA 4NA9H 1GBCA 3RLWH 1ELVA 1MTVA 3STJA 1ZHPA 2OC8A 1O3EA 1AIXH 4MQAA 2CF8H 1TNJA 2CV3A 1O2UA 2UWPA 3U69H 1C5UA 2VIDA 3U8RH 3LJJA 1GBAA 3GDSA 3ATIA 1QRXA 2ZECA 3SUFA 1GG6B 5E0GA 1IQFA 1WBGB 4IMQA 1YCPK 1PYTD 3VB7A 3RMLH 1KXEA 4X8UH 1SGTA 2FIRH 1CSOE 2O8LA 1Z6EA 4I31A 1G9IE 1EJMA 4KGAA 1UCYE 2OCVB 4A1TA 1ZLRA 4D9QA 1P03A 5FX6A 8GCHF 1A0JA 1TNHA 2EI7A 1HV7A 1HAOH 2Y5HA 1TMTH 1MKXH 1DXPA 1GBFA 1TPSA 5GDSH 3SGQE 1V2MT 2C93B 2IOTA 1N8OB 4OGYA 4OS7A 3RMNH 2A31A 1KXBA 2XC0A 4Q7ZA 4JCNA 5FPTA 1C5OH 4IC6A 8LPRA 4K69A 3M3TA 2BY7X 3OTJE 4U32A 4INHA 5EOKA 4Y8ZA 1W8BH 4NIWA 1GJ9B 4DURA 3V0XA 2AEIH 2J92A 5E8EH 1OWJA 1W7GH 2GDEH 7GCHF 3M5OA 2HVXA 1AB9B 2Y81A 1GI8B 3GCTG 2G5VA 2TGTA 1AVGH 3ZZAA 3QX5H 1DFPA 3SV9A 7LPRA 1JRTA 4LZ1H 4KTCA 3LKWA 3FFGA 3IWMA 3UR6A 1YPJH 1MAXA 1K9OE 5DP5A 1DX5M 2BZAA 1ZHMA 2ZHQH 1GHAG 3NUMA 2BVRH 3RXPA 4Z6AH 2B0FA 1PPBH 2BD2A 3DD2H 4I32A 4MPXA 3HKJB 3V7TA 5FX5A 3BG4C 2BY6X 1P06A 4TYDA 1IQKA 2FLRH 2BDCA 3AAVA 4BAHB 1J16A 2WV4A 5FBIA 4JK5A 1E34B 1FY3A 3F9HA 1QA7A 2XBVA 4X2YA 3UOUA 1DM4B 1DLKB 1ZOMA 1DANH 2ZHWH 3RXFA 3SNDA 2BOHB 1GBTA 2V6NA 1ZMLA 3TJVA 1FY4A 1NFXA 1BT7A 4MG3A 3S7HB 2P16A 5C20A 3UQVA 2SGFE 1ETTH 4CRGA 1RRKA 3FAOA 3RU4E 1A5HA 1HPGA 1GI6A 3RXBA 2AGGX 1GBDA 1GMDF 1CGJE 1TALA 4CBNA 4XFQA 3M37A 3LDXH 3GYLB 1SI5H 1HYLA 2C3SA 1L1JA 1O39A 2W26A 4DVAU 3RMOH 3SUGA 1LQEA 1SGDE 2FOEA 3M36A 2A32A 1O33A 1D3DB 1PPFE 1MU6B 2ZO3H 2HNTC 3P8GA 3OY5U 1KXCA 1CE5A 1JIMA 2SGQE 1LDTT 2ZHEH 1CHGA 1UTPA 1HAVA 2QA9E 2P93A 4B1TA 4THNH 3K65B 2ALVA 1BHXB 1SR5C 1GI2A 2OC0A 1BDAA 1O3PB 4D9RA 1WAYB 3T62A 1AVWA 2H5DA 4NCYA 4ZHAA 2AMDA 2R2MB 1TX7A 3RXHA 2ZGXH 1K1LA 1HAGE 2ZWLH 2R3UA 1EXFA 3A80A 1CHOF 3U9AH 1TNKA 4CRDA 1BITA 1G32B 3TH4H 1Z1JA 4NZLA 2VGCC 1O2QA 3EQ0H 2XWBI 2G52A 1BTZA 1LVYA 4ABAA 1ARCA 1GVLA 3RXAA 3BEIB 3SORA 3MU5A 1VCQA 5TCCA 4UFEH 2BX3A 3BF6H 1ELAA 4O97A 4QT8C
chains in the Genus database with same CATH superfamily
2O8UA 4RI0A 4AGKA 5DP6A 1BIOA 1GDQA 2XOKD 5EPNA 2OC1A 1CT2E 2HGTH 1J8AA 1E38B 3EYDA 1BQYA 1BTWA 1ZYOA 1IQLA 1WQSA 2B5TB 4WH6A 1XXFA 3ZZ4A 1EFRD 1MABB 1IQEA 3O8RA 3ZIAD 2GP9B 2VWLA 3KGPA 1BBRE 1HIAA 2ZFTA 5EQSA 1C5YB 4ZHLU 1EP6A 1H9IE 1ANDA 1SPJA 3R0FA 3S9CA 2J34A 3CENA 1LVOA 2QAAA 2Z7FE 1C1RA 2A1DB 5DP3A 1F2SE 4YXWD 2VWMA 2W7UA 1VCWA 3HK6B 3GCNA 1EP5A 5CHAC 3OY6U 1T4UH 1P04A 5AF9H 3G01A 4U01A 2OUAA 2P3TB 3F1SB 1ZPZA 5DP4A 1D6WA 2WPMS 5JBTA 3SGBE 2V0BA 5KEDA 1LTOA 2Q6GA 4A92A 7KMEH 3BTFE 1SFIA 3A86A 4NGAH 3Q77A 1JOUB 3ZYDA 1FAKH 4YO9A 1UW7A 2GCTB 4ASHA 3MNSA 1L0ZA 2QXIA 4X6MA 4BXWA 3QN7A 1JWTA 2F91A 2V3OH 3E16B 3PROA 2PSYA 2PV9B 4O9VA 1AFQC 1D3TB 3SV2H 1GJBB 2A4QA 3SU6A 1A0HB 1C2HA 3SV7A 1D6RA 2DUCA 1XUFA 1TOMH 3PLBA 3CS7A 4ACAA 1AY6H 3MHWU 4GCHG 3H7OA 1O32A 2BOKA 3SHCH 1BHXF 1O2SA 1Y3VA 4CHAC 1A1RA 2BX4A 2EEKA 1D4PB 1SG8B 4MDSA 5IK2D 1OPHB 1O2IA 1P11E 5ABWA 1K2I1 4KTUA 2WV5A 3E0NB 1KIGH 3A88A 1YP9A 3QO6A 3SUEA 1HAXB 3QWCH 1ZGIA 1N6XA 2BVXH 2FM2A 4K8BA 1RIWC 3HKIB 2XBXA 3UNSA 1RJXB 3KHVA 3MH5A 3UFAA 3WW7A 1VCPA 1MQ5A 1E1RD 4O3UA 3A7TA 4OS1A 1CA8B 2GZ7A 3FANA 2JKHA 1S83A 2Y7ZA 5GPIB 3FN8A 3M7TA 1ZHRA 1BA8B 1BUIA 3LGYA 5AVDA 3ZVEA 4LXBH 3PLPA 2C8YB 2FYRA 1GCTC 1ESTA 1GMCG 2ZFPH 3K2UA 3BV9B 2A4GA 2ZNKH 4GVUA 4YT7H 1ELEE 2FWWA 1GBLA 2QXHA 4FUCA 2PLXA 1T4VH 3F0OA 2BDBA 3FP6E 1J17T 5DP8A 2O8MA 3VB4A 3RXGA 2AMPA 1ELBA 1MD8A 3MTYA 3U8TH 4B2AA 1HAYB 4JYUH 2J9NA 1OS8A 4D7FA 5H4IB 4YZUA 1DWDH 2Z9IA 2B9LA 1GHBF 3URDA 2YNAA 1NS3A 2PKSB 5A09A 4WXVA 1W14U 2ZIQH 2Z3DA 3E90B 2ILNA 1KXFA 2KAIB 1C5NH 1FNIA 1OP8A 3B8JA 3EA7A 3PMBB 1GBKA 3RXUA 1L1NA 4CREA 3PV4A 1C5TA 2FXRA 2XC5A 3SQHE 1OHHD 4D76A 1YLCA 1Y5BT 4ESTE 1OSSA 3SUDA 1ZGVA 5BPEA 4J2YB 1EATA 1P3EA 2GT7A 3M3SA 4WMDA 1TNLA 1C5VA 1UCYK 3OEED 1FXYA 1QQ4A 5EW1H 1L1GA 2Z9JA 3ZVAA 1XUJA 1SC8U 4NIXA 5A2MH 3L6PA 2VVVA 1P2IA 1PFXC 2CXVA 5FPYA 4WJG2 2RCEA 2Z9GA 2ZCKP 5C94A 3HPTB 5J4SA 1P10A 3RXJA 3E1XB 1ELTA 4I8GA 3SI3H 2BDHA 1M9UA 4GSOA 3M5NA 2WPIS 3A89A 1JIRA 1O3IA 4YESB 1ZSLA 2RDLA 2KX4A 4FVDA 4DOQA 5EIYA 2ZGHA 2ALPA 3TU7H 2G81E 2ZGCA 4R0IA 1EOLA 3M61U 5JBCS 1FY1A 4X8TH 1LPKB 1O3KA 2J97A 3M35A 4NSVA 1J15A 2BXTH 1OKXA 6CHAB 4B6FA 5HM9A 2FESH 1SGYE 4B76A 4OM9A 1O3NA 3O8CA 4XSKU 3LC3A 1COWD 4ZROA 1FPHH 3U28C 3HGNA 3F9EA 2FOHA 4WWYA 1ETRH 1BB0B 4ZH8A 5GXPA 2ZDAH 2WHXA 3BTDE 5HM2A 4DT4A 5LPRA 3N7EA 5K7RA 3UNQA 1LKBA 2ZFFH 1DPOA 1TGNA 2J2UA 1SGEE 2BVSH 3ENSB 4J1YA 4M7GA 2THFB 4FU7A 1MKWH 2GDDA 1UK4A 2OP9A 4X2WA 4XD7D 3S69A 3FP8E 4CH2B 2ZGBH 1GWAA 5BRRE 1MBMA 2JJ2D 3P8FA 1GCDA 3OAAD 2BLQA 2GMTB 2FX4A 3UTUH 3SI4H 5T6DA 5LGOA 3MO9A 3L3TA 4TY6A 1S0QA 3NWUA 4X1PU 1LCYA 3ZZ7A 2PTCE 3UUZA 1CO7E 1CT4E 1V2ST 1FJSA 1CGIE 3NPSA 1XMNB 2HNTE 5F8TA 3GICB 4Z1MD 1CBWB 1DDJA 3ITIA 1EAXA 1YCPH 2ZI2H 1GL1A 1VGCC 2XWAA 3EE0B 3PTBA 2A5IA 2SNVA 1LHFH 2UUJB 5EJLA 4FUHA 3GY6A 1SQTA 2ZF0H 3KYFA 2GJGA 1JRSA 1MTNB 4AG1A 3RU4T 1XVMA 1DSTA 2BTCE 4BAKB 1O5CB 4TSFD 3W1EA 3OU0A 5FAHA 4HGCA 4E05H 1PPCE 4DG4A 3Q3KA 4X6PA 1ZTLA 1LPZB 4M9FA 1Z6JH 4RT0A 2HWLB 4F55A 3ZVDA 2FX6A 2Y80A 1O35A 2ZFQH 4MLFB 2EC9H 2WYGA 1F5KU 1VKYA 3LU9B 1THRH 2A4RA 2GV6A 1QL9A 1GMHF 3SU2A 1KTTB 1QRWA 3AVZA 1AWHB 3SQEE 3UAIC 1O5BB 4CRCA 2D26C 2NWNA 2BLOA 2QY0B 3RM0H 2JIZD 2PKAA 2GZ9A 4FVBA 3LGWA 4Q2KA 1C1OA 4Y71A 1SLVB 3LGUA 3T28A 1MCVA 1GDNA 1TRYA 1EZSC 1O3MA 4HI3A 1O2GH 1QIXB 2FI5E 2Z9KA 1P2QA 1IQJA 3EA9A 2BD3A 5SGAE 1BTPA 2WPHS 5C2ZA 1OX1A 4NFFA 2VIVA 2FMJA 1Y3UA 1OP0A 5EPYA 1AB9C 2BY8X 5EGMA 2AGIX 1ACBE 3RXKA 1A5IA 4BAOB 1ABIH 1P2JA 4OS6A 1GBHA 4F48B 5EQRA 5EXLA 1E36B 1SLXB 1ANCA 2Y7XA 4IC5A 1FDPA 3VB5A 4YM9A 2ASUB 1YF4A 1BBRK 1O2RA 1Y3XA 1DLEA 4UONA 4JYTA 1SKYE 3NXPA 5DN6D 2TBSA 2VH0A 2BD8A 1NU7B 2GCHG 3URCA 1K1IA 3LH1A 1O2XA 3M3VA 2LP6A 5JBAS 3BEFB 1SGFG 1SGRE 3OFND 1HAZB 1O34A 1HUTH 3LC5A 2OTVA 3EDXB 2QF3A 3RXQA 1SFQB 2R9PA 3FO8D 4NWLA 3QTVH 5GWZA 1Q2WA 2OXSA 4XBBA 2P8OB 1YGCH 4FUFA 5B6OA 1T8LA 1UVPA 2A2QH 2GVFA 2O8WA 3QZQA 2ZC9H 1AU8A 2UWLA 5JDUB 5HKKD 1PPEE 2W6JD 1QJ6B 1NRNH 1SQAA 3GY3A 2SGDE 1Z8JB 2NU0E 2ZU5A 1AWFH 2SGAA 3BTGE 1SGQE 1O2OA 2G4TA 1H9LB 3SJKA 1CU1A 4BTIB 2F3CE 1VITH 1NPMA 2XNIA 3NK8A 4ISOA 4ACBA 2TIOA 3VGCB 4OGXA 1TPPA 3A7VA 1EAIA 1HJ8A 4Q7XA 2AH4X 1GGDB 1ZJKA 3ZVCA 4TWYA 1RFNA 1O3FA 4D8NA 3ZYEA 4BTTB 1TIOA 4UFFH 1SGFA 1V2OT 2FODA 2HLCA 1MTUA 3N7OA 1Q31A 5GCHF 1TPAE 1Z7KA 1F5RA 5ESTE 1BJVA 2ANKH 4NIVA 1AHTH 3T25A 2ZQ2A 1MU8B 3BTKE 4MPVA 2HVYB 4Y10E 2BD9A 3KQCA 3TNSA 1TONA 2ESTE 1O3AA 3EE7A 4F4OC 2A45B 1GVZA 5FPSA 1GHZA 2BHGA 1LPGB 1C5PA 4AB8A 1FIWA 1YPHC 1BRAA 4ZKOU 2TGDA 3EAJA 1GBEA 4JZIA 3VXEH 1S6FA 5I46H 1FLEE 1AVXA 1YCPM 1U6QA 5JB8S 5JBBS 3Q3XA 4XDEA 1DITH 5A8ZA 1T8MA 3RXEA 1Y3WA 1WV7H 4K1SA 1Q3XA 4Z0KA 3ZVFA 1YPGH 3M7QA 4ZKNU 1MAYA 2PW8H 4GCHF 4OS2A 1CT0E 4NA8A 5AFYH 4ABBA 2Q6DA 2WPJS 2PGBB 1W0JD 2KAIA 3E91A 8ESTE 1L2EA 1TRNA 2ZDMA 1ANBA 1C1WH 1TLDA 1C2DA 3BTHE 6GCHG 4GHQA 2XBYA 1ETSH 4F49A 2R0LA 2W3IA 1P2NA 2AYWA 1ID5H 4KTSA 2Z6BD 8KME2 4ABJA 1YPLH 5E0HA 1GJ4H 1PQ5A 2FTMA 7ESTE 1S82A 3ELAH 4MNVA 1AMHA 4JZDH 1LO6A 2Q6FA 2QN5T 3UWJH 1IQMA 5JYIA 1C1TA 4WF8A 1NU9A 1PQ7A 3I78A 1N6YA 3A84A 4FUIA 1FN8A 2XRCA 5ETXA 1WUNH 4Y0ZE 2LELA 2KCPA 1EB1H 4Y6DA 2UUKB 1ZTJA 1BRUP 1GMCF 3STIA 2ZDVH 4A1VA 3RXMA 5DG6A 2QGRA 1LMWB 2GCTC 3F9FA 3T27A 1MTSA 4H6TA 1AE8H 1QRZA 2PKAB 2AIQA 4E7NA 5AFZH 3BTEE 1FIZA 3BG4B 1C1PA 1EPTA 3VB3A 1OWKA 2ZTZA 2ZDKA 3KL6A 3P92A 2VJ1A 1GJ7B 8GCHG 1C4Y2 2IJOB 4Q4LA 1F0UA 2JETC 3VEQB 1SQRA 4JZ1A 1AI8H 1Z8IB 2LPRA 2QIQA 5T1VA 1HLTH 3JZ1B 4U2WA 3FVFB 4Y8XA 2VNTA 4X1SU 3MU1A 2HPPH 4CH8B 2SGEE 1J14A 2VH6A 1K1MA 2HRVA 3SW2B 4NG9H 1BRBE 4KELA 1NESE 3SU1A 1LHGH 1TMBH 4K3JA 4DJZB 3ZZDA 4B2BA 1SOZA 3T29A 1TYNA 1K1PA 5L2ZH 4I8KA 2A2XH 5C1UA 1GJCB 1BTUA 1TQ7B 4FUEA 1DUEA 3A85A 2QCYA 1O2LA 1W13U 1G36A 4X8VH 1W0YH 2F9PA 2BDIA 2WINI 3LT3A 1XVOA 7GCHG 1QJ7B 1GI1A 2AS9A 2TPIZ 5HGGA 2ZFRH 2ZU2A 1TMUH 1EQ9A 4WVPE 1MBQA 1G3EA 2ZU4A 2C8WB 1RTKA 3MO3A 3F9GA 3MMGA 2H5CA 1OOKB 2FPZA 4VGCB 2P94A 4AFZA 2QF5A 3SHAH 4ZXXH 4MPWA 5FXLA 1MZAA 5L6NH 3MU4A 4FXGH 1GHYH 1NRRH 2DE8A 1QURH 5C0UA 2GGVB 4NA7A 2EI8A 3VXFH 4X1NU 3TK5A 3SO3A 4BANB 5CE1A 1T31A 1TNGA 1YPEH 1V2VT 4PROA 4AB9A 2XC4A 3KF2A 3RLYH 1VITF 1RS0A 3SU4A 3RC5A 1V2RT 1DT2A 1OWHA 1UVUH 3UOPA 2UUYA 4TPYA 2NU3E 2WPLS 3BN9A 2BM2A 2VGCB 3OEHD 5EQQA 1LQDB 2FOGA 1PPHE 1UCYH 4K1TA 2A5AA 2NU1E 2XCNA 5A8XA 3P8OA 1RGQA 1A61H 1QB6A 2A4OA 5ESBA 1O2MA 3SNBA 1EZQA 3GY2A 2SFAA 5PTPA 2EI6A 2J38A 4ASUD 1NTPA 4P02A 2CN0H 3PMAB 5A8YA 1P8VC 2FO9A 1T8NA 3M5LA 3PM3A 1C2FA 1SOTA 4X6OA 5C5NA 5LPFA 1HGTH 3W95A 2J98A 1TGCA 2UUFB 3JZ2B 1C2GA 2Z94A 3AW0A 5HIYA 3FP7E 4A5TS 2FP7B 1GMDG 3DFLA 4SGBE 2Y82A 1DY9A 2H2ZA 3SYJA 5A0AE 4RKOB 1SGPE 1Y8TA 3SJ8A 2ZPRA 1G30B 2J94A 2D1JA 4Q80A 4I8HA 1ZMJA 2A0QB 3WWBA 3GDVA 4O03A 4KKDA 3TH2H 1NO9H 3NZIA 2H1UA 1C4V2 1TRMA 1BCUH 1ZRKA 4DY7B 2VWOA 3BG8A 3SU3A 1AUJA 1ESAA 3D49H 1O3LA 5CHAB 2HPQH 1NT1A 2OBQA 1NBMD 1O2KA 3MO6A 3F68H 1H8IH 4RT1A 1S85A 4ZXYH 5G4BA 1KY9A 4AFSA 1V2WT 3RXCA 3LONA 1UTMA 4ZKRU 4ISLA 3KN2A 2OBOA 4RKJB 1B5GH 2FDAA 1C2IA 4HFPB 1CHOG 3A87A 3IITA 1BRCE 2STAE 2NU4E 1HDTH 1MTWA 5A0BA 2F9VA 2I6QA 2ANYA 1X7AC 1AFQB 1YC0A 2FI4E 1P12E 2L6OA 1B0EA 1EZXC 4AORA 2WUCA 3MH4A 2FI3E 1MH0A 1G3DA 4GPGA 3RXTA 3U1JB 1SLWB 1AKSB 1P2KA 2WSSD 1UTKA 3PMJA 2BZ6H 1F0TA 3Q76A 2RA0A 1TBZH 4IMZA 5C67A 2SGPE 2Y6TA 1QY6A 1QBOA 1FN6A 4CHAB 1KYNA 1AE5A 2B7DH 3LJOA 4BXSA 3TGKE 1O5EH 2Z3CA 2CHAC 3V12A 2QYIA 4JZFH 3SJ9A 1AUTC 4MVNA 1OWIA 4BAMB 1CBWC 1QB1A 1W10U 1O2NA 2RG3A 2EA3A 4IW4E 2XTTB 3K6ZA 2BD5A 1YWUA 3PO1B 2A5KA 3RMMH 1OWDA 1P2OA 3TJNA 4DIIH 1UO6A 3O8DA 1NN6A 3ZVBA 1V2NT 4OS5A 1K28D 3RXDA 3BTQE 1O37A 1MTNC 3TGJE 1XUHA 1KSNA 3NCLA 1C2LA 4Y0YE 3SNCA 1V2TT 1EPTB 2IPQX 1ZJDA 3TH3H 5C17A 1B0FA 1ZZZA 5JB9S 3GOVB 2AFQB 1NROH 2VB0A 3FOAA 4XBDA 2NU2E 2RA3A 3TNTA 5CMXH 1EUFA 1UVOA 1DE7H 1GCTB 1GI7B 1K1JA 1EJNA 2YMSB 2ZQ1A 1YPHE 1HAIH 2GCHF 1EZUC 5L30H 3O8BA 4FUJA 1TFXA 2FOCA 2IJD1 2TGAA 1HRTH 1Y5UT 3QTOH 3C1KA 1TOCB 1A7SA 1UTOA 1FY5A 2H6MA 3AW1A 2WV9A 1Z8GA 2ZCHP 3PB1E 1TNIA 1THSH 1O5DH 3V3MA 4GLYA 1ELGA 2QF0A 1IHTH 4JMYA 2BDYA 1GI4A 4NSYA 1DICA 1TBRH 1W3CA 1NZQH 2FOMB 1RTFB 1W11U 1SVPA 3E8LA 1O36A 5J4QA 1NFUA 2PFEA 1FAXA 3KQEA 3RU4D 1NM6A 3A83A 1KTSB 1A2CH 3B9FH 4AYYB 1BBRH 1O3CA 1BTXA 1SQOA 4K60A 4D7GA 1SGCA 1S84A 3GCHB 2G00A 3GCTF 4X1RU 5EG4A 1VJ9U 1W12U 1MZDA 2F83A 2LNCA 3PWCA 3DSOA 3ODDA 4Q7YA 3DSPA 2W3KA 1C5WB 3TK6A 1P3CA 2ZPQA 1O2ZA 3RC4A 5EW2H 3V13A 1AO5A 2OINA 2H9EH 1HAPH 1C5RA 1GG6C 2BD4A 1GHAF 2P95A 1PJPA 2ZHFH 3HK3B 2KR7A 1JBUH 2P59A 3UIRA 4RN6A 1Y3YA 3OSYA 3LGTA 2ODYB 1TPOA 2VIPA 1QFKH 3TJUA 3GY8A 1CQQA 1G37A 1UTQA 2VBCA 3AK5A 1QL7A 1A5GH 3MI4A 1OYQA 2QC2A 2K0QA 1GPZA 1RXPA 1HB0B 1LKAA 2FS9A 1VZQH 4R8TB 5HMAA 1JXPA 4X1QU 1IQHA 1Y5AT 1N8OC 2J98B 3HGPA 1OWEA 3I29A 3E0PB 2J4IA 1EOJA 2BY9X 5EJ1A 3P95A 3UPEA 2G8TA 2HALA 5DP9A 1TWXB 2F4LA 3D62A 4XE4A 3LIWA 4BOHA 2G4UA 3EGKH 3GISB 4NIYA 4HZHA 1NY22 1LHCH 5JPMH 1EJAA 2ZZUH 3FZZA 3VGCC 3MFJA 4ABGA 1TQ0B 5DP7A 2QE7D 1C5LH 3VFEA 2ZU3A 4DIHH 1WU1A 1GGDC 1GI3A 1GVKB 5EODA 1DWEH 4B75A 3PTNA 1P0SH 1O3HA 2GX4A 1C5ZB 4ZMAH 4FUGA 1DSUA 3UNRA 3UB0A 3SU5A 2YNBA 1A46H 1S6HA 4H6SB 1PQAA 1VGCB 4UFDH 2ZA5A 1G2MA 4X8SH 1WCZA 5F8XA 2FZZA 1O2VA 3RP2A 4X2VA 1NRPH 1WSSH 1TAWA 5E2OA 1SLUB 4TT3D 1S6LA 1MD7A 3QGNB 1DWBH 1ZMNA 1FQ3A 1CA0B 2VVCA 5C1YA 1T8OA 1IQGA 1A3EH 1DVAH 1G2LA 3PV2A 3KIDU 1SSXA 2C90B 1UK3A 3LGVA 2BMGB 2CJIA 1O2HA 1ZTKA 2FS8A 5KECA 1C1SA 3S7KB 1SHYA 2DE9A 3MOCA 5EU8A 3BSQA 1V6DA 3QK1A 3R3GB 1UVSH 1O3OA 2ZGJA 1O30A 3TLOA 5FL7D 4NZQA 1BMFD 3GCOA 2JH0D 3TITA 3SJIA 2FEQH 2GZ8A 5DJ7A 1QTFA 1LHEH 3SV6A 2O9QA 1C1QA 3A82A 2Y5GA 2GV7A 1QGFA 4UD9H 1SGNE 1TB6H 1E0FD 1Z71A 3WY8A 1GJ6A 3SNEA 1VJAU 1ZSKA 1FZZA 1W2KH 1TBQH 1JMOH 3RM2H 3P70B 1UTJA 4K2YA 1HXEH 1TX8A 1HJ9A 1HJAB 2YOLA 1GI5A 3E3TA 1K21H 3VPKA 4IN2A 3GY7A 1THPB 2ZDLA 1A0LA 2KCOA 2ZTXA 2BD7A 2FTLE 2R2WU 3GY5A 1V2JT 1BJUA 3LGIA 1OYTH 1ESBA 1RD3B 2Y5FA 4ZAEA 1XXDA 3F2HA 4I8JA 1AD8H 2GKVE 3W94A 3SOSA 2M5TA 3I77A 4Y76A 4UDWH 5GIBA 1XM1A 1YYY1 1KLIH 1O3JA 1VR1H 2P3FH 1FY8E 1OP2A 3RXOA 5EJZA 4ZCNA 2OK5A 4I33A 1O2JA 1YPKH 3BIVH 2PP6A 3HATH 3SN8A 4Y8YA 2C8ZB 4A6LA 1L4ZA 4INKA 1C1NA 1BOQA 3ATLA 2ZPSA 1GMHG 3TVJB 3TJOA 1QCPA 1O5AB 4ABIA 3QLPH 3H5CB 3F6UH 3A8CA 3K6YA 4UE7H 2KZ4A 3ZZCA 3BIUH 4DT7B 1T32A 5AHGH 1P9SA 1H1BA 3OTPA 5E2PA 2J95A 1H4WA 3N7DA 2JH6D 1TABE 3DFJA 4AFQA 1S0RA 2PWXA 1HXFH 1AKSA 1ZRBA 2C4FH 2ODQA 3DT0H 4CBOA 5IDKA 5DK1A 1EAUA 1YBWA 1MKXK 2ZU1A 1DXWA 2BY5X 1GDUA 2FOFA 1YLDA 5E0JA 1KDQB 2V7QD 2D8WA 3KQBA 1QB9A 1GHXH 3S9AA 1V2PT 5B6LA 3FZDA 1FI8A 2RFKC 4INLA 1GI9B 1L4DA 1QNJA 5LH8A 2G55A 1KXAA 4WY3A 9ESTA 3ZZ8A 3A7ZA 2F9NA 1D3QB 3SZEA 4VGCC 4ZKSU 1AGJA 1GHWH 4AN7A 5DPAA 4WMEA 1K0HA 1F5LA 2QXJA 2B8OH 1G3BA 4MNXA 4YOGA 3U1IB 1BMLA 4IGDA 3PRBA 1FPCH 2QF4A 3B23B 1MUEB 1G3CA 1W0KD 3KQ5A 1EAWA 1Z8RA 1O3GA 1QA0A 3QDZB 1PPZA 1AFEH 1WYKA 4RSPA 1P9UA 1V3XA 2V35A 1UJ1A 2PSXA 3T5FH 1WTHD 1A3BH 2OQ5A 1K22H 4WXIA 2OC7A 3SU0A 1AZ8A 1NFYA 3GDUA 3RXLA 4YTAA 4P00A 4CRFA 2EQNA 1C4U2 4A1XA 1O2WA 1INCA 3A7WA 2KFWA 4MPUA 2GTBA 2CMYA 5K0HA 4X6NA 4ZHMU 2ZHDA 1SMFE 1MCTA 3UWIA 1YLNA 1UVTH 1QJ1B 3SJOA 1F7ZA 2J5UA 3S0NA 1WQVH 2BQWB 2XYAA 4XOJA 2ZTYA 1P02A 3MNCA 1SL3A 3F2FA 5F6MA 3KCGH 1EB2A 1GJ5H 1WTGH 4IBLH 1T7CA 1MMJN 3K9XB 5FHTA 3PV5A 1C5XB 1EASA 2IPHA 2PHBA 2FOAA 2PR3A 2VWNA 3OE7D 4Y7BA 4B6EA 2VIQA 5GCHG 4JK6A 5EXMA 4K8YA 1O31A 4K1EA 3UREA 1BTHH 4UEHH 5FCRA 1SBWA 2WYJA 1MQ6A 5C5OA 3T2NA 1QBNA 3ZZ3A 3RXSA 2Z3EA 2BXUH 4FU8A 2HLDD 1EKBB 4Y79A 3DA9B 5GNDA 4DGJA 1TGTA 1O0DH 2VINA 1GJAB 4OS4A 2ANWA 1B7XB 1UHBA 2BQ6B 3SZNA 3NRLA 4H42U 2PKSC 3F2GA 1BMAA 1O2YA 3SGAE 1ORFA 5FBEA 2VU8E 3QZRA 1QR3E 2AIPA 2BLWA 4ZUHA 1P57B 2GT8A 3DHKH 1IQNA 2CK3D 4ISHH 2F43B 4A7IB 1C9PA 1C2JA 2JETB 3M7UA 2ANMH 3LPRA 1IOEA 3ATMA 4HG6A 2BDAA 2JDID 2XXLA 2BLVA 3GY4A 3P8NA 2FLBH 1UK2A 4AGJA 5F03A 3RXIA 1CVWH 3TGIE 3L33A 2FYQA 3P6ZB 3PMHB 2SNWA 4CRAA 6ESTA 1LHDH 2V3MA 3E6PH 3ZZ6A 3DCLA 2XCFA 5EXNA 3BTWE 3D65E 1J9CH 3ZVGA 1P01A 1K1OA 3MU0A 3ZV9A 1AQ7A 1DOJA 3OYPA 2AGEX 1C5SA 2UWOA 1FMGA 1E35B 3PO1C 3C27B 1XKBC 1TE0A 3ATWA 1ABJH 1XUIA 1YKTA 4TWWA 2TGPZ 2BQ7B 3M5MA 1C5MD 1YY3A 1AN1E 1IQIA 3AAUA 3A8BA 2A7CA 4JYVH 5A0CA 4FUBA 4BNRA 1DY8A 5TCAA 9LPRA 1EPTC 3RXVA 3MU8A 4BTUB 6CHAC 3A7YA 1PPGE 1P2MA 2ZFSA 4HTCH 1O2TA 2ZCLP 1H9HE 3F0PA 5C3NA 5T6FA 2YMSC 1P09A 3VG8A 2R0KA 1ELDE 2VVUA 1HAHH 3ZZBA 1EX3A 3MH6A 1NRSH 1TA6A 3VB6A 4JZEH 2KCAA 1Z1IA 2V3HH 1XUKA 1DUAA 3ZZ9A 1IHSH 2ZDNA 1DS2E 1P05A 1TGBA 3LOXA 4AZ2B 2W7SA 4B71A 5LPEA 2HNTF 2F9BH 4AYVB 1ELFA 3SBKA 2ZEBA 1K1NA 2GMTC 3MNBA 4Y11E 4NFEA 5TJXA 2TRMA 4GUXA 1D9IA 1QHRB 3RC6A 4YT6H 4YLUA 1O3DA 2WPKS 2ZP0H 2O8TA 3MWIU 3BEUA 1TA2A 2PTNA 3KNXA 1ZR0A 4B74A 2QV1A 3H7TA 1WOFA 4U30A 2BYAX 4MNWA 3KYGA 1C5QA 1HCGA 2I6SA 3UR9A 4CR5A 1CGHA 1LVMA 1O5GH 1ANEA 2IN2A 4TY7A 3GCHC 2Q1JA 1V2QT 1HAVB 1RIWB 2G5NA 4DCDA 1FUJA 4XBCA 2F9UA 2ZG0H 3KQDA 3SNAA 4ABFA 1H8DH 4E7RG 2GD4B 2H9HA 3QUMP 4DW2U 1SHHB 1KXDA 1C1UH 1FX0B 3N99A 3BTME 3UQOA 3A81A 4YOIA 1V2UT 3F3BA 2ODPA 5T6GA 3A8DA 4Y7AA 2WPDD 4LOYH 4AOQA 2YMSD 3PWBA 1ZSJA 2VIWA 4FU9A 3NKKA 4UFGH 2CGAA 4ABEA 3ESTA 1GBMA 2ULLA 3D23A 5GJ4B 3ATKA 4TPIZ 3RUOA 2AERH 3SV8A 1UTLM 2HOBA 4AG2A 4KP0A 1LVBA 1SB1H 1V2KT 2R3YA 3T26A 4XRNA 3CS0A 4I7YH 3TIUA 1GJ8B 1ZPCA 4AFUA 4AX9H 2Z9LA 4ABDA 1NC6A 1VITG 3QGJA 1TGSZ 3OX7U 3S9BA 1F0RA 3PLKA 2G51A 1Y59T 1SGIB 1NRQH 5F8ZA 2P3UB 1E37B 1F92A 2WZQA 3Q3YA 1IAUA 3RDZA 1HIAB 4YOJA 5DKMA 1BZXE 3PRDA 5FCKA 2FOBA 4X0WU 3U98H 3P17H 1QBVH 2ZKSA 1W7XH 4E06H 2K8IA 1C1VH 3BTTE 2PGQB 2STBE 2AHME 5F53A 1HBTH 2PUQH 1GBIA 2D2DA 3FKSD 1XX9A 1C2EA 2OD3B 4YLQH 2CF9H 3PYHA 5C0TA 1BMMH 1O38A 2K1QA 2BB4A 3CP7A 1HFDA 1QZ8A 2CHAB 5HXFA 1S81A 2L74A 2XBWA 1AZZA 1BTYA 1C2MA 2A7JA 1RTLA 1KDQA 3MNXA 4CRBA 2KCYA 1FV9A 4AC9A 3A7XA 2A7HA 5CHBA 1NFWA 4X2XA 5HIZA 3TPIZ 1F0SA 3KEEA 2PUXB 4FUDA 4H4FA 5IYTA 1GJDB 5DSFA 3TK9A 1UHBB 2BDGA 3A8AA 4NWKA 1YM0A 1DWCH 3MH7A 3IG6B 4MTBA 1O5FH 1CA0C 3EA8A 1C1MA 2OLGA 1BMNH 4WMFA 5L2YH 2JH5D 4SGAE 1GI0A 3Q00A 1O2PA 3WWFA 2F9OA 2P8OC 1PYTC 1GBBA 3ZZ5A 2XW9A 1A4WH 1OXGA 1QL8A 3ODFA 1E1QD 4GHTA 2H9TH 4ISIH 5HYOA 1W0ZU 2VIOA 1GHBG 2QXGA 1V2LT 2WUBA 3U8OH 1TX6A 1PQ8A 4ISNA 3AASA 1KMHB 2W5EA 4O3TA 1ARBA 3UY9A 1D3PB 4ABHA 1C2KA 1N1LA 2C8XB 2OQUA 6LPRA 3DUXH 1C9TA 1GHVH 1UTNA 1XUGA 3LH3A 4IN1A 4K5ZA 4MNYA 5DO4H 5T3HA 4GAWA 4LK4A 4CR9A 4B2CA 3RXRA 1UMAH 1GL0E 6GCHF 5I25A 3GYMA 4BAQB 1ZPBA 1QQUA 1YPMH 1ELCA 4LZ4B 1HNEE 1XKAC 4I8LA 1GBJA 2XNDD 5DGJA 3ZV8A 1FONA 1HJAC 4IS5A 1KLTA 2AMQA 1MKWK 1KLJH 1O3BA 4B73A 3MYWA 5C1XA 4WH8A 1S5SA 4NA9H 1GBCA 3RLWH 1ELVA 1MTVA 3STJA 1ZHPA 2OC8A 1O3EA 1AIXH 4MQAA 2CF8H 1TNJA 1NBME 3DSGA 2CV3A 1O2UA 2UWPA 3U69H 1C5UA 2JJ1D 2VIDA 3LJJA 3U8RH 1GBAA 3GDSA 3ATIA 3CNRA 1QRXA 2ZECA 3SUFA 1GG6B 5E0GA 1IQFA 1WBGB 4IMQA 1YCPK 1PYTD 3VB7A 3RMLH 1KXEA 4X8UH 1SGTA 2FIRH 1CSOE 2O8LA 1Z6EA 4I31A 1G9IE 1EJMA 4KGAA 1UCYE 2OCVB 4A1TA 3GS9A 1ZLRA 4D9QA 1P03A 5FX6A 8GCHF 1A0JA 1TNHA 2EI7A 1HV7A 1HAOH 4Q63A 2Y5HA 1TMTH 1MKXH 1DXPA 1GBFA 1TPSA 5GDSH 3SGQE 1V2MT 2C93B 2IOTA 1N8OB 4OGYA 4OS7A 3RMNH 2A31A 1KXBA 2XC0A 4Q7ZA 4JCNA 5FPTA 1C5OH 4IC6A 8LPRA 4K69A 3M3TA 1E79D 2BY7X 3OTJE 4U32A 4INHA 5EOKA 4Y8ZA 1W8BH 4NIWA 1GJ9B 4DURA 3V0XA 2AEIH 2J92A 5E8EH 1OWJA 1W7GH 2GDEH 7GCHF 3H09A 3M5OA 2M2AA 2HVXA 1AB9B 2Y81A 1GI8B 3GCTG 2G5VA 2TGTA 1AVGH 3ZZAA 3QX5H 1DFPA 3SV9A 7LPRA 1JRTA 4LZ1H 4KTCA 3LKWA 3FFGA 3IWMA 3UR6A 1YPJH 1MAXA 1K9OE 5DP5A 1DX5M 2BZAA 1ZHMA 2ZHQH 1GHAG 3NUMA 2BVRH 3RXPA 4Z6AH 2B0FA 1WXRA 1PPBH 2BD2A 3DD2H 4I32A 4MPXA 3HKJB 3V7TA 5FX5A 3BG4C 2BY6X 1P06A 4TYDA 1IQKA 2FLRH 2BDCA 2RDEA 3AAVA 4BAHB 1J16A 2WV4A 5FBIA 1H8HD 4JK5A 1E34B 1FY3A 3F9HA 1QA7A 5KGOA 2XBVA 2KM0A 4X2YA 3UOUA 1H8ED 1DM4B 1DLKB 1ZOMA 1DANH 2ZHWH 3RXFA 3SNDA 2BOHB 1GBTA 2V6NA 2EY4C 1ZMLA 3TJVA 1FY4A 4FETA 1NFXA 1BT7A 4MG3A 3S7HB 2P16A 5C20A 3UQVA 2SGFE 1ETTH 4CRGA 1RRKA 1WDIA 3FAOA 3RU4E 1A5HA 1HPGA 1GI6A 3RXBA 2AGGX 1GBDA 1GMDF 1CGJE 1TALA 4I86A 4CBNA 4XFQA 3M37A 3LDXH 3GYLB 1SI5H 1HYLA 2C3SA 1L1JA 1O39A 2W26A 4DVAU 3RMOH 3SUGA 1LQEA 1SGDE 2FOEA 3M36A 2A32A 1O33A 1D3DB 1PPFE 1MU6B 2ZO3H 2HNTC 3P8GA 3OY5U 1KXCA 1CE5A 1JIMA 2SGQE 1LDTT 2ZHEH 1CHGA 1UTPA 1HAVA 2QA9E 2P93A 4B1TA 4THNH 3K65B 2ALVA 1BHXB 1SR5C 1GI2A 2OC0A 1BDAA 1O3PB 4D9RA 1WAYB 4FOUC 3T62A 1AVWA 2H5DA 4NCYA 2W6ID 4ZHAA 2AMDA 2R2MB 1TX7A 3RXHA 2ZGXH 1K1LA 1HAGE 2ZWLH 2R3UA 1EXFA 3A80A 3MQKC 1CHOF 3U9AH 1TNKA 4CRDA 5CDFE 1BITA 1G32B 3TH4H 1Z1JA 4NZLA 2VGCC 1O2QA 3EQ0H 2XWBI 2G52A 1BTZA 1LVYA 4ABAA 1ARCA 1GVLA 3RXAA 3BEIB 3SORA 3MU5A 1VCQA 5TCCA 4UFEH 2BX3A 3BF6H 1ELAA 4O97A 4QT8C
chains in the Genus database with same CATH topology
2O8UA 4AGKA 5DP6A 1BIOA 1GDQA 5EPNA 2OC1A 1CT2E 2HGTH 1J8AA 1E38B 3EYDA 1BQYA 1BTWA 1ZYOA 1IQLA 1WQSA 2B5TB 4WH6A 1XXFA 3ZZ4A 1IQEA 3O8RA 2GP9B 2VWLA 3KGPA 1BBRE 1HIAA 2ZFTA 5EQSA 1C5YB 4ZHLU 1EP6A 1H9IE 1ANDA 1SPJA 3R0FA 3S9CA 2J34A 3CENA 1LVOA 2QAAA 2Z7FE 1C1RA 2A1DB 5DP3A 1F2SE 2VWMA 2W7UA 1VCWA 3HK6B 3GCNA 1EP5A 5CHAC 3OY6U 1T4UH 1P04A 5AF9H 3G01A 4U01A 2OUAA 2P3TB 3F1SB 1ZPZA 5DP4A 1D6WA 2WPMS 5JBTA 3SGBE 2V0BA 1LTOA 2Q6GA 4A92A 7KMEH 3BTFE 1SFIA 3A86A 4NGAH 3Q77A 1JOUB 3ZYDA 1FAKH 4YO9A 2GCTB 4ASHA 3MNSA 1L0ZA 2QXIA 4X6MA 4BXWA 3QN7A 1JWTA 2F91A 2V3OH 3E16B 3PROA 2PSYA 2PV9B 4O9VA 1AFQC 1D3TB 3SV2H 1GJBB 2A4QA 3SU6A 1A0HB 1C2HA 3SV7A 1D6RA 2DUCA 1XUFA 1TOMH 3PLBA 3CS7A 1AY6H 3MHWU 4GCHG 3H7OA 1O32A 2BOKA 3SHCH 1BHXF 1O2SA 1Y3VA 4CHAC 1A1RA 2BX4A 2EEKA 1D4PB 1SG8B 4MDSA 1OPHB 1O2IA 1P11E 5ABWA 1K2I1 4KTUA 2WV5A 3E0NB 1KIGH 3A88A 1YP9A 3QO6A 3SUEA 1HAXB 3QWCH 1ZGIA 1N6XA 2BVXH 2FM2A 4K8BA 1RIWC 3HKIB 2XBXA 3UNSA 1RJXB 3KHVA 3MH5A 3UFAA 1VCPA 1MQ5A 4O3UA 3A7TA 4OS1A 1CA8B 2GZ7A 3FANA 2JKHA 1S83A 2Y7ZA 5GPIB 3M7TA 1ZHRA 1BA8B 1BUIA 3LGYA 5AVDA 3ZVEA 4LXBH 3PLPA 2C8YB 2FYRA 1GCTC 1ESTA 1GMCG 2ZFPH 3K2UA 3BV9B 2A4GA 2ZNKH 4GVUA 4YT7H 1ELEE 2FWWA 1GBLA 2QXHA 4FUCA 2PLXA 1T4VH 2BDBA 3FP6E 1J17T 5DP8A 2O8MA 3VB4A 3RXGA 2AMPA 1ELBA 1MD8A 3MTYA 3U8TH 4B2AA 1HAYB 4JYUH 2J9NA 1OS8A 4D7FA 5H4IB 4YZUA 1DWDH 2Z9IA 2B9LA 1GHBF 3URDA 2YNAA 1NS3A 2PKSB 5A09A 4WXVA 1W14U 2ZIQH 2Z3DA 3E90B 2ILNA 1KXFA 2KAIB 1C5NH 1FNIA 1OP8A 3B8JA 3EA7A 3PMBB 1GBKA 3RXUA 1L1NA 4CREA 3PV4A 1C5TA 2FXRA 2XC5A 3SQHE 4D76A 1YLCA 1Y5BT 4ESTE 1OSSA 3SUDA 1ZGVA 5BPEA 4J2YB 1EATA 1P3EA 2GT7A 3M3SA 4WMDA 1TNLA 1C5VA 1UCYK 1FXYA 1QQ4A 5EW1H 1L1GA 2Z9JA 3ZVAA 1XUJA 1SC8U 4NIXA 5A2MH 3L6PA 2VVVA 1P2IA 1PFXC 2CXVA 5FPYA 4WJG2 2RCEA 2Z9GA 2ZCKP 5J4SA 3HPTB 1P10A 3RXJA 3E1XB 1ELTA 4I8GA 3SI3H 2BDHA 1M9UA 4GSOA 3M5NA 2WPIS 3A89A 1JIRA 1O3IA 4YESB 1ZSLA 2RDLA 4FVDA 4DOQA 2ZGHA 2ALPA 3TU7H 2G81E 2ZGCA 4R0IA 1EOLA 3M61U 5JBCS 1FY1A 4X8TH 1LPKB 1O3KA 3M35A 4NSVA 1J15A 2BXTH 1OKXA 6CHAB 5HM9A 2FESH 1SGYE 4B76A 1O3NA 3O8CA 4XSKU 3LC3A 4ZROA 1FPHH 3HGNA 3F9EA 2FOHA 4WWYA 1ETRH 1BB0B 4ZH8A 5GXPA 2ZDAH 3BTDE 5HM2A 5LPRA 5K7RA 3UNQA 1LKBA 2ZFFH 1DPOA 1TGNA 2J2UA 1SGEE 2BVSH 3ENSB 4J1YA 4M7GA 2THFB 4FU7A 1MKWH 2GDDA 1UK4A 2OP9A 4X2WA 3S69A 4CH2B 3FP8E 2ZGBH 1GWAA 5BRRE 1MBMA 3P8FA 1GCDA 2BLQA 2GMTB 2FX4A 3UTUH 3SI4H 5T6DA 5LGOA 3MO9A 3L3TA 4TY6A 1S0QA 3NWUA 4X1PU 1LCYA 3ZZ7A 2PTCE 3UUZA 1CO7E 1CT4E 1V2ST 1FJSA 1CGIE 3NPSA 1XMNB 2HNTE 5F8TA 3GICB 1CBWB 1DDJA 3ITIA 1EAXA 1YCPH 2ZI2H 1GL1A 1VGCC 2XWAA 3EE0B 3PTBA 2A5IA 2SNVA 1LHFH 2UUJB 4FUHA 3GY6A 1SQTA 2ZF0H 1JRSA 1MTNB 4AG1A 3RU4T 1XVMA 1DSTA 2BTCE 4BAKB 1O5CB 3OU0A 5FAHA 4HGCA 4E05H 1PPCE 4DG4A 3Q3KA 4X6PA 1ZTLA 1LPZB 1Z6JH 2HWLB 3ZVDA 2FX6A 2Y80A 1O35A 2ZFQH 4MLFB 2EC9H 2WYGA 1F5KU 3LU9B 1THRH 2A4RA 2GV6A 1QL9A 1GMHF 3SU2A 1KTTB 1QRWA 3AVZA 1AWHB 3SQEE 4CRCA 1O5BB 2D26C 2NWNA 2BLOA 2QY0B 3RM0H 2PKAA 2GZ9A 4FVBA 3LGWA 4Q2KA 1C1OA 4Y71A 1SLVB 3LGUA 3T28A 1MCVA 1GDNA 1TRYA 1EZSC 1O3MA 4HI3A 1O2GH 1QIXB 2FI5E 2Z9KA 1P2QA 1IQJA 3EA9A 2BD3A 5SGAE 1BTPA 2WPHS 5C2ZA 1OX1A 4NFFA 2VIVA 2FMJA 1Y3UA 1OP0A 5EPYA 1AB9C 2BY8X 5EGMA 2AGIX 1ACBE 3RXKA 1A5IA 4BAOB 1ABIH 1P2JA 4OS6A 1GBHA 5EQRA 5EXLA 1E36B 1SLXB 1ANCA 2Y7XA 4IC5A 1FDPA 3VB5A 4YM9A 2ASUB 1YF4A 1BBRK 1O2RA 1Y3XA 1DLEA 4UONA 4JYTA 3NXPA 2TBSA 2VH0A 2BD8A 1NU7B 2GCHG 3URCA 1K1IA 3LH1A 1O2XA 3M3VA 5JBAS 3BEFB 1SGFG 1SGRE 1HAZB 1O34A 1HUTH 3LC5A 2OTVA 3EDXB 2QF3A 3RXQA 1SFQB 2R9PA 4NWLA 3QTVH 5GWZA 1Q2WA 2OXSA 4XBBA 2P8OB 1YGCH 4FUFA 5B6OA 1T8LA 1UVPA 2A2QH 2GVFA 2O8WA 3QZQA 2ZC9H 1AU8A 2UWLA 5JDUB 1PPEE 1QJ6B 1NRNH 1SQAA 3GY3A 2SGDE 1Z8JB 2NU0E 2ZU5A 1AWFH 2SGAA 3BTGE 1SGQE 1O2OA 2G4TA 1H9LB 3SJKA 1CU1A 4BTIB 2F3CE 1VITH 1NPMA 2XNIA 3NK8A 4ISOA 2TIOA 3VGCB 4OGXA 1TPPA 3A7VA 1EAIA 1HJ8A 4Q7XA 2AH4X 1GGDB 1ZJKA 3ZVCA 4TWYA 1RFNA 1O3FA 4D8NA 3ZYEA 4BTTB 1TIOA 4UFFH 1SGFA 1V2OT 2FODA 2HLCA 1MTUA 3N7OA 1Q31A 5GCHF 1TPAE 1Z7KA 1F5RA 5ESTE 1BJVA 2ANKH 4NIVA 1AHTH 3T25A 2ZQ2A 1MU8B 3BTKE 4MPVA 4Y10E 2BD9A 3KQCA 3TNSA 1TONA 2ESTE 1O3AA 4F4OC 2A45B 1GVZA 5FPSA 1GHZA 2BHGA 1LPGB 1C5PA 4AB8A 1FIWA 1YPHC 1BRAA 4ZKOU 2TGDA 3EAJA 1GBEA 4JZIA 3VXEH 1S6FA 5I46H 1FLEE 1AVXA 1YCPM 1U6QA 5JB8S 5JBBS 3Q3XA 4XDEA 1DITH 5A8ZA 1T8MA 3RXEA 1Y3WA 1WV7H 4K1SA 1Q3XA 4Z0KA 3ZVFA 1YPGH 3M7QA 4ZKNU 1MAYA 2PW8H 4GCHF 4OS2A 1CT0E 4NA8A 5AFYH 4ABBA 2Q6DA 2WPJS 2PGBB 2KAIA 3E91A 8ESTE 1L2EA 1TRNA 2ZDMA 1ANBA 1C1WH 1TLDA 1C2DA 3BTHE 6GCHG 4GHQA 2XBYA 1ETSH 4F49A 2R0LA 2W3IA 1P2NA 2AYWA 1ID5H 4KTSA 2Z6BD 8KME2 4ABJA 1YPLH 5E0HA 1GJ4H 1PQ5A 2FTMA 7ESTE 1S82A 3ELAH 4MNVA 1AMHA 4JZDH 1LO6A 2Q6FA 2QN5T 3UWJH 1IQMA 5JYIA 1C1TA 4WF8A 1NU9A 1PQ7A 3I78A 1N6YA 3A84A 4FUIA 1FN8A 2XRCA 5ETXA 1WUNH 4Y0ZE 1EB1H 4Y6DA 2UUKB 1ZTJA 1BRUP 1GMCF 3STIA 2ZDVH 4A1VA 3RXMA 5DG6A 2QGRA 1LMWB 2GCTC 3F9FA 3T27A 1MTSA 4H6TA 1AE8H 1QRZA 2PKAB 2AIQA 4E7NA 5AFZH 3BTEE 1FIZA 3BG4B 1C1PA 1EPTA 3VB3A 1OWKA 2ZTZA 2ZDKA 3KL6A 3P92A 2VJ1A 1GJ7B 8GCHG 1C4Y2 2IJOB 1F0UA 2JETC 3VEQB 4JZ1A 1AI8H 1Z8IB 2LPRA 2QIQA 1HLTH 3JZ1B 4U2WA 3FVFB 4Y8XA 2VNTA 4X1SU 3MU1A 2HPPH 4CH8B 2SGEE 1J14A 2VH6A 1K1MA 2HRVA 3SW2B 4NG9H 1BRBE 4KELA 1NESE 3SU1A 1LHGH 1TMBH 4K3JA 4DJZB 3ZZDA 4B2BA 1SOZA 3T29A 1TYNA 1K1PA 5L2ZH 4I8KA 2A2XH 5C1UA 1GJCB 1BTUA 1TQ7B 4FUEA 1DUEA 3A85A 2QCYA 1O2LA 1W13U 1G36A 4X8VH 1W0YH 2F9PA 2BDIA 2WINI 3LT3A 1XVOA 7GCHG 1QJ7B 1GI1A 2AS9A 2TPIZ 5HGGA 2ZFRH 2ZU2A 1TMUH 1EQ9A 4WVPE 1MBQA 1G3EA 2ZU4A 2C8WB 1RTKA 3MO3A 3F9GA 3MMGA 2H5CA 1OOKB 2FPZA 4VGCB 2P94A 4AFZA 3SHAH 4ZXXH 4MPWA 5FXLA 1MZAA 5L6NH 3MU4A 4FXGH 1GHYH 1NRRH 2DE8A 1QURH 2GGVB 4NA7A 2EI8A 3VXFH 4X1NU 3TK5A 3SO3A 4BANB 5CE1A 1T31A 1TNGA 1YPEH 1V2VT 4PROA 4AB9A 2XC4A 3KF2A 3RLYH 1VITF 1RS0A 3SU4A 3RC5A 1V2RT 1DT2A 1OWHA 1UVUH 3UOPA 2UUYA 4TPYA 2NU3E 2WPLS 3BN9A 2BM2A 2VGCB 5EQQA 1LQDB 2FOGA 1PPHE 1UCYH 4K1TA 2A5AA 2NU1E 2XCNA 5A8XA 3P8OA 1RGQA 1A61H 1QB6A 2A4OA 5ESBA 1O2MA 3SNBA 1EZQA 3GY2A 2SFAA 5PTPA 2EI6A 2J38A 1NTPA 2CN0H 3PMAB 5A8YA 1P8VC 2FO9A 1T8NA 3M5LA 3PM3A 1C2FA 1SOTA 4X6OA 5C5NA 5LPFA 1HGTH 3W95A 1TGCA 2UUFB 3JZ2B 1C2GA 2Z94A 3AW0A 3FP7E 4A5TS 2FP7B 1GMDG 3DFLA 4SGBE 2Y82A 1DY9A 2H2ZA 5A0AE 4RKOB 1SGPE 1Y8TA 3SJ8A 2ZPRA 1G30B 2J94A 2D1JA 4Q80A 4I8HA 1ZMJA 2A0QB 3GDVA 4O03A 4KKDA 3TH2H 1NO9H 3NZIA 2H1UA 1C4V2 1TRMA 1BCUH 1ZRKA 4DY7B 2VWOA 3BG8A 3SU3A 1AUJA 1ESAA 3D49H 1O3LA 5CHAB 2HPQH 1NT1A 2OBQA 1O2KA 3MO6A 3F68H 1H8IH 1S85A 4ZXYH 5G4BA 1KY9A 4AFSA 1V2WT 3RXCA 3LONA 1UTMA 4ZKRU 4ISLA 3KN2A 2OBOA 4RKJB 1B5GH 2FDAA 1C2IA 4HFPB 1CHOG 3A87A 3IITA 1BRCE 2STAE 2NU4E 1HDTH 1MTWA 5A0BA 2F9VA 2I6QA 2ANYA 1X7AC 1AFQB 1YC0A 2FI4E 1P12E 1B0EA 1EZXC 4AORA 2WUCA 3MH4A 2FI3E 1MH0A 1G3DA 4GPGA 3RXTA 3U1JB 1SLWB 1AKSB 1P2KA 1UTKA 3PMJA 2BZ6H 1F0TA 3Q76A 2RA0A 1TBZH 4IMZA 5C67A 2SGPE 2Y6TA 1QY6A 1QBOA 1FN6A 4CHAB 1KYNA 1AE5A 2B7DH 3LJOA 4BXSA 3TGKE 1O5EH 2Z3CA 2CHAC 3V12A 2QYIA 4JZFH 3SJ9A 1AUTC 4MVNA 1OWIA 4BAMB 1CBWC 1QB1A 1W10U 1O2NA 2RG3A 2EA3A 4IW4E 2XTTB 3K6ZA 2BD5A 3PO1B 2A5KA 3RMMH 1OWDA 1P2OA 3TJNA 4DIIH 1UO6A 3O8DA 1NN6A 3ZVBA 1V2NT 4OS5A 1K28D 3RXDA 3BTQE 1O37A 1MTNC 3TGJE 1XUHA 1KSNA 3NCLA 1C2LA 4Y0YE 3SNCA 1V2TT 1EPTB 3TH3H 1ZJDA 1B0FA 1ZZZA 5JB9S 3GOVB 2AFQB 1NROH 2VB0A 4XBDA 5CMXH 2NU2E 2RA3A 3TNTA 1EUFA 1UVOA 1DE7H 1GCTB 1GI7B 1K1JA 1EJNA 2ZQ1A 1YPHE 1HAIH 2GCHF 1EZUC 5L30H 3O8BA 4FUJA 1TFXA 2FOCA 2TGAA 1HRTH 1Y5UT 3QTOH 3C1KA 1TOCB 1A7SA 1UTOA 1FY5A 2H6MA 3AW1A 1Z8GA 2ZCHP 3PB1E 1TNIA 1THSH 1O5DH 3V3MA 4GLYA 1ELGA 2QF0A 1IHTH 4JMYA 2BDYA 1GI4A 4NSYA 1DICA 1TBRH 1W3CA 1NZQH 2FOMB 1RTFB 1W11U 1SVPA 3E8LA 1O36A 5J4QA 1NFUA 2PFEA 1FAXA 3KQEA 3RU4D 1NM6A 3A83A 1KTSB 1A2CH 3B9FH 4AYYB 1BBRH 1O3CA 1BTXA 1SQOA 4K60A 4D7GA 1SGCA 1S84A 3GCHB 2G00A 3GCTF 4X1RU 5EG4A 1VJ9U 1W12U 1MZDA 2F83A 2LNCA 3PWCA 3ODDA 4Q7YA 2W3KA