4X0XA

The structure of ahpe from mycobacterium tuberculosis revisited
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
153
Chain Sequence
HMLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIWATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative peroxiredoxin MT2298
publication title Revisiting sulfur H-bonds in proteins: The example of peroxiredoxin AhpE.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 54
structure length 153
sequence length 153
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4x0xA00
1SL1B 2V6OA 1SD8A 1EGRA 4NWYA 1GP1A 2H0HA 3LORA 2VCXA 1M2DA 2OACA 4N30A 3LXTA 3TJJA 3VURA 1YF1A 4ZBAA 1KBNA 2DLXA 3EINA 3KJYA 1RQMA 3HZ4A 3FZ4A 1XWAA 1Y6EA 2H71A 3D6IA 2VM1A 1Q98A 5F0GA 3RHBA 1VF3A 3MSZA 4IKHA 3A5WA 2LEGA 3FR6A 1YEPA 2PN8A 3WGEA 4HI7A 2RM5A 2B6MA 1K3YA 3C1RA 1E2YA 2A2SA 2OE1A 1ABAA 4GQCA 4IJIA 4MZWA 3NIVA 1X5CA 3ZMKA 1OKDA 4JR4A 4KX4A 1X5EA 2H76A 1XXUA 5LCZA 4YQUA 1O6JA 4N0VA 3IXRA 5DAKA 2IMIA 4DSSB 5A5KA 2MZCA 3GFKA 4TW5A 3GUSA 3TOUA 3KTLA 3O6TA 1WPIA 1YKCA 2WULA 3RDWA 3ISOA 1JLWA 1LBKA 2C4JA 3HKRA 4MPGA 4GSNA 3HDCA 3A2VA 1QK8A 3M1GA 4IP1A 4DSSA 1KEBA 3HCZA 2IMKA 3GNJA 1XFLA 4YAVA 6GSYA 2L6CA 2GLRA 2DJ2A 1NHOA 2FA8A 2YV7A 3ZRDA 3TKSE 5JWRB 3LXZA 5B6NA 3J7Yb 4NPBA 1USBA 2O87A 4PUAA 5G30A 1S3CA 4IQ1A 3VWVA 4OFTA 1XVQA 2LTKA 3Q74A 3QAWA 2L4CA 4NXIA 4K0GA 3F4TA 5ECRB 2EIRA 3EMPA 2CT6A 1RW1A 2LQQA 2JZSA 2L5OA 1TU8A 5CRDA 5HR3A 1MD3A 3D22A 1SENA 2DMMA 4WF5A 3VWUA 1TP9A 9GSSA 5D73A 4NHZA 4XS4A 3CSIA 3RBTA 2JU5A 1K0OA 1GNEA 2IFQB 5DDLA 3WT1A 1XOBA 4WF4A 3DYRA 1FVKA 4F03A 2LNSA 4TR4A 4MCUA 1G7EA 3LJRA 2ZNMA 1M2AA 4V2LA 2CVBA 4MH3A 4ZB6A 2KHPA 5DBQA 2FWFA 5H5QA 4F0BA 2VLVA 3HD5A 5DALB 2DJ0A 1EEMA 3PR8A 4FYCA 4AJ7A 1C72A 5IO0A 1U88A 3SWLA 1NM3A 1JLVA 3M9JA 4KDUA 3UOMA 3ZLPA 2Z9SA 4MJCA 2H73A 1OKTA 4V2MA 1PSQA 2IIYA 4K8MA 4OD7A 1K0BA 3UMAA 1TRWA 3QCPA 2B3SA 3GTUA 2E2GA 5ID2A 5DQYA 3J7Yk 4K2DA 4K7NA 5IMZA 4RQXA 2C3TA 2YN1A 1T8EB 3CYNA 3GMFA 4EXJA 1GSDA 3VI7A 3GH6A 4IGJA 1TRVA 3TKPA 2K6VA 4XTSA 5HQPA 1XPVA 1OE7A 2E0QA 4MMMA 4TOPA 5ECKB 3EU4A 2RLIA 2KOKA 1XOAA 3VLNA 5F07A 3A3TA 5IPHA 2P5RA 2FGXA 3GX0A 3HHVA 3TJGA 2VD1A 3ME8A 1EOGA 4GQFA 1SK2A 3F63A 3GURA 14GSA 4K6XA 1K0DA 3TKSA 3QPMA 2RUFA 3UBLA 4TXOA 2VCWA 3G7IA 2X99A 4MH2A 4BA7A 5KN2A 3C1SA 2FWGA 1HQOA 3KIJA 5DQSA 4JEDA 5FHIA 2DJ1A 3VWWA 1GULA 1JZWA 2LRCA 2XPDA 1JZOA 4IHUA 5IMFA 4AJ6A 4HOJA 4TRXA 4I97A 5D96A 1EP7A 1AC1A 2RUEA 1V9WA 2I1UA 4WR5A 4KSMA 2C1YA 1EZKA 1SU9A 2H1BA 1FO5A 5IQYA 1GLQA 2MMOA 3EE2A 2QSIA 4POKA 4PNGA 1Z6MA 4KDYA 4N11A 1WIKA 6GSVA 3W8JA 2HSYA 1JFUA 2WRTA 1AAZA 3E0UA 4PQHA 1WRYA 2RM6A 2IPAA 3M3MA 2WDUA 4PGTA 1SKWB 2LJKA 4Q5QA 1XW5A 2K8SA 1SJIA 1AQXA 1T1VA 2KUCA 3HYPA 1A8LA 2H6XA 3TUEA 3ZREA 2JL4A 1EOHA 2HT9A 1THOA 4MK3A 1U3IA 2HE3A 3HVXA 2C3QA 3F4RA 3U6VA 1GL8A 3F6DA 2HFDA 3F3RA 5G1LA 3GV1A 2CX4A 2HRFA 2GT5A 2ON5A 2AB6A 4D73B 5D9WA 3RPPA 2HZEB 1J0FA 4HS1A 4F2IA 4FIWA 3M0FA 4I6XA 6GSUA 4I2TA 4K7IA 2BMXA 2FLSA 3TCOA 4HDEA 2C80A 5F05A 8GSSA 3ERFA 4XRDA 4ML6A 3HXSA 2HRNA 2CA8A 2OBIA 2C0EA 2PPTA 4J56E 4Q5NA 4MF6A 1B8XA 1O8XA 1OVNA 4TXVA 3PGTA 4MA9A 1AQWA 2H6ZA 1S3DA 2J23A 2YOIA 1T4ZA 1OC9B 4WXTA 1R5PA 5DCHA 4FYUA 4CDOA 1T4YA 2YWMA 11GSA 2PMTA 1T3BA 4O5RA 1TK8B 4ZILA 1F3BA 5AISA 1N8JA 4MJAA 2D2ZA 3GA4A 4E8HA 4BVXA 3APSA 3KEBA 4QQ7A 1OC9A 1NW2A 1PKWA 3WGDA 2M80A 1QUWA 1A0RP 5IM9A 4GRFA 4TKYA 3DVXA 2CZ3A 2A2RA 5JWQB 3I69A 1X9WB 2M46A 3IE3A 4PQIA 2OADA 4OO5A 3ZIVA 2P5QA 4XS1A 3GSSA 5ECPB 3FZ5A 3BD2A 4KCEA 4L5LA 1HD2A 4WR4A 1GSQA 2IMFA 1PX6A 4EE0A 3C8EA 3DRNA 1R4WA 3IRAA 3EYTA 2F8AA 2JSYA 4X43A 3SBCA 3D0ZA 5H5SA 4RI6A 1NHYA 2NTOA 1YJ6A 1MDKA 1Z7PA 2O85A 1BYEA 1TW9A 1I9DA 5FT3A 5DJLA 2L57A 3HY2A 5COHA 1HYUA 3DXBA 3MNGA 2LSTA 1O8WA 2R3XA 3CMIA 2G2QA 1Y25A 1XWKA 4JZQA 1K0NA 3HJOA 3QOUA 2AHEA 5DAKB 4ECCA 3AY8A 4OFNA 1G0TA 5IMDA 2B1LA 4F9ZA 3BCIA 2MBSA 1SJZA 3I43A 1Z9HA 5CREA 3GIXA 3QMXA 5HR1A 4LL4B 1TXXA 1V2AA 4RQRA 5H5RA 4RUVA 5IMCA 1I5GA 3MWHA 1TI1A 1GRXA 1W89A 1GUHA 2VM2A 3CSHA 1TJDA 2LS5A 5E59A 3ED3A 1XW6A 1PRXA 3JCML 4JR6A 1XVWA 2GZYA 4ZIJA 2R6KA 2QC7A 2REMA 5ECLB 2PUKC 5HR2A 4FH8A 1XCCA 1CQHA 5KEJA 3TKQA 3TKRA 4TR0A 5GZZB 1UC7A 3QFBC 4O32A 5CP1A 4HUAA 1YDKA 5ECNB 2DJJA 1SKRB 1IYHA 2WFCA 4NV2A 2FNOA 4ILFA 1URMA 5HFKA 4EDZA 5J5NA 1XBSA 1IYIA 4XS4B 5AGYA 2CAIA 3IPZA 4EL1A 3GYKA 4L5OA 19GSA 4X1UA 2GDRA 4PNFA 2KP2A 2FHEA 1FHEA 1FAAA 1WJKA 2N5FA 5L71A 3HA9A 4YQMA 4K7OA 4ISDA 1T00A 20GSA 3CTFA 3LEFA 2JACA 2CV4A 1SYXA 2H70A 1YEXA 2ES7A 2YPMA 2VCZA 3I9V2 1H75A 1V57A 1BAYA 4OCEA 5IO2A 3CRUA 1SYRA 1ERUA 1PGTA 2PWJA 2R37A 1YQ1A 4OCFA 2TRCP 4PUFC 2YJ7A 1ZOFA 2VIMA 3ZL5A 1VGLA 3VWXA 3F6FA 3HJPA 1FW1A 2B5EA 3FY7A 1OE8A 4CHSA 2HYXA 4GWRA 4Z7XA 4L0WA 3KD0A 6GSWA 1TK0B 1B4QA 3EURA 4EUYA 4MZBA 3IK9A 4HEA2 5C04A 5AIXA 2EIQA 1XWCA 4KCAA 1MDIA 3BJ5A 3GKNA 4XCSA 3GTUB 2FWHA 5ID2B 1KNGA 1GTAA 6GSSA 3O76A 4FYBA 2X8CA 3UEMA 2O8VB 4IP6A 1U87A 4HZ2A 4WKWA 3LGCA 1ST9A 4DVCA 4F0CA 4GSSA 2AAWA 3TGZA 4KE3A 2GQLA 2YWNA 2N5BA 4DSQA 4F82A 1DE2A 2YJHA 4MF7A 3L4NA 1XIYA 3QDNA 2LNTA 5GAND 1VRSD 2M72A 1ILOA 4MP4A 5F8BA 3LFLA 1PKZA 1SL0B 2K9FA 4J2FA 3NZNA 3WT2A 1AUCA 3KCMA 2X8HA 2JSZA 2OBKA 1HNBA 1JZDA 2WB9A 2WJUA 5CAXA 3C7MA 2FCHA 1TKDB 3EMXA 4HU9A 2TRXA 2B7KA 2X64A 1B9XC 2R2JA 4TXOB 3C71A 3H79A 4IS0A 3TJKA 2B5YA 2NPBA 2YNXA 3LSZA 4KDXA 1WE0A 3ZVJA 1MDJA 2H66A 5CO3A 1S3AA 2GSRA 2QKEA 1GUKA 4YQVA 2H0GA 4MF5A 3IAS2 4V1Ag 1YZXA 2DC5A 2I3YA 3GRXA 5G5FA 2LQOA 4I2UA 3DIEA 1PL2A 3TRXA 3M9KA 3A2XA 1WWJA 2JZRA 4HZ4A 2QGVA 3N9JA 1BG5A 3FR3A 2H75A 4L8EA 4J57E 3KZQA 4EC0A 5A4VA 3CSJA 2V1MA 3QFAC 1AQVA 1KTEA 2F9SA 5ELGA 1OYJA 2DIZA 3VI5A 5ELAA 1K0CA 2VLUA 2X8GA 5HFIA 1TDIA 1QFNA 1AW9A 5KN3A 1R26A 3QAGA 1F3AA 3HJMA 2B7JA 2BTOT 2ZUPA 1TRUA 4ECBA 4GF0A 4EVMA 2WCIA 3FR9A 3TRPA 2EC4A 3GX8A 4BWQA 1TOFA 3DEXA 5IOWA 2LJAA 1OC8A 1LU4A 3APQA 1O7UA 3ZTLA 5G1KA 1V58A 10GSA 3HVVA 1TU7A 3N5OA 4PQ1A 4QL9A 4O7HA 2VAFA 4K1FA 1M7TA 3H1NA 3FKFA 5KN1A 2B1KA 2CQ9A 3QAVA 2R4VA 1PL1A 4TR1A 2XBQA 3KMOA 4KNDA 2NBSA 1CQGA 2MMAA 4IELA 3TB2A 1JZRA 2H1GA 3L9VA 2VCVA 2VCQA 3L78A 3QD9A 2DJ3A 4LMWA 4ZB8A 5E4WA 5INYA 1GSEA 3D4MA 5LNKe 1ERTA 4LL1B 4OFMA 3US3A 1ON4A 2OKAA 1UVZA 1YF0A 3V1WA 4JRRA 3W8SA 2L4QA 1PN9A 2R5GA 1U6TA 2FWEA 5AIVA 1BEDA 3GL3A 2PERA 4EO3A 1WP0A 3TOTA 3CTGA 7GSSA 18GSA 5D9TA 1FG4A 4JU5A 3O3TA 4WBJA 5J9BA 3EWLA 2GGTA 1EGOA 1FB0A 1DE1A 3TRQA 2DJKA 3DWVA 5J41A 1OAZA 1EV4A 2IMDA 3UIWA 5CNWA 2LV3A 5ABRA 2GQMA 3EU3A 2LRTA 4WEYA 4KA0A 1EV9A 2H1DA 1V98A 1XW9A 2GS3A 1AIUA 1SKSB 2GVPA 1ZL9A 3HZ8A 3KM6A 3L9UA 3Q6OA 2I81A 4JE1A 1Q4JA 2MMNA 1Z7RA 4KSOA 3GHAA 4PX1A 4MZCA 1ZYQB 3KH7A 4E8EA 4IW9A 2HZFA 5EVOA 17GSA 4MJEA 4POMA 3DMLA 3QR6A 3CBUA 3FEUA 2VL2C 3D4TA 3F8UA 3ZIJA 1PX7A 1M0UA 4GCIA 5ECIB 4NHWA 4TVEA 2H74A 5CRWA 2KP1A 4ML1A 4OMVA 2P31A 3W6GA 2OA7A 5ECMB 5JCGA 1XWGA 3EVIA 5J4UA 3FK8A 4Q5RA 4TN8A 2VUPA 1TTZA 1QXHA 1PMTA 4ZL9A 1A24A 2NVLA 2LJRA 4XS6A 1WOUA 1MTCA 6GSXA 4NAXA 1PD21 1WMJA 5ECQB 1UN2A 3ERGA 5ECHB 1VF1A 1GTBA 2CVKA 2H8LA 1FB6A 4GLTA 2RIIA 4OO4A 2O89A 5B8AA 1M9AA 2V32A 4KH7A 2L5LA 1F37A 2HNLA 1X0RA 4H86A 2TIRA 5IMAA 5CYYA 3UARA 2C3NA 3IR4A 3P90A 1EWXA 2ALBA 3GH9A 3E3EA 2PBJA 3UVHA 3ZFBA 2F3MA 3IDVA 5DJMA 3GL5A 5D9XA 2DIYA 4MDCA 1QGVA 5G5EA 1ACVA 3IV4A 2I4AA 4POBA 1X9MB 1A8YA 3L0HA 5IIZA 4OWYA 1Z5YE 3IA1A 2YWIA 5JCUA 2JZTA 2WZ9A 3IBHA 2CX3A 3HVSA 3F4SA 1SK1A 1SJ6A 4NMUA 3ZZXA 2C0FA 3GN3A 3FZ9A 3M8NA 5IOXA 2YZUA 1R7HA 5J3RA 3BOAA 3UBKA 1SK0A 2XBIA 5EY6A 1XWBA 1T7PB 1GSUA 1THXA 5ENUA 2XC2A 3D21A 3H8QA 3DKSA 3UJ1A 1M99A 2H72A 1M9BA 4YH2A 3IK7A 3RHCA 3VFIA 1X5DA 3KP9A 4HJMA 1XZOA 4KGIA 1GSYA 3K8NA 2PGTA 3FHKA 4NV5A 1O73A 4MPFA 5CRGA 4ZL7A 2GTUA 3PINA 2MBTA 4GXZA 4HJ2A 5HR0A 2H6YA 3ZVJD 1ZCPA 2L59A 4ID0A 4AJ8A 3LG6A 2NDOA 1J08A 1ZMAA 1B48A 4IQAA 4X0XA 1K3LA 3G9BA 1TK5B 1ERVA 3BCKA 4YAPA 1MD4A 1Z3EA 4FO5A 1LJRA 3KP8A 5A4WA 2IJYA 2V41A 5LD0A 4K9ZA 1F2EA 2YANA 2AYTA 5B6MA 2XHFA 1PQNA 2VL3A 4IVFA 2WGRA 2H01A 5ECSA 2K18A 2OE3A 3FRCA 1B9YC 1GLPA 2V2GA 3APOA 4BWSA 3G7JA 4LMVA 4XIHA 3D5JA 1U3AA 5CRHA 3P8WA 1AXDA 2H30A 2IN3A 2PU9C 3CXGA 5B7CA 2DBCA 4BL7A 3WD6A 4IBPA 13GSA 4G10A 16GSA 4POLA 5C00A 2IFQA 2CVDA 5GAPD 4ULXA 4IN0A 3F0IA 2G0FA 1GSFA 2B5XA 12GSA 5JWOB 5EPFA 5F06A 4GTUA 2PVOC 4EF0A 5DCGA 1GH2A 2VO4A 1Z6NA 1J9BA 2AV4A 5DALA 1A2LA 2FY6A 3VPTA 3GKMA 1GTUA 1GUMA 4EKZA 2N5AA 2AJQB 3NOFA 4G19A 1O85A 1FVJA 4RI7A 2OE0A 4HQZA 3LYPA 5D8IA 4O92A 3L9SA 2HXKA 1JHBA 2YZHA 5ECOB 3TJBA 1ERWA 1SD9A 4DEJA 3CRTA 2WS2A 4PURA 2BJXA 2IMEA 5FWGA 2CAQA 1DSBA 4N0ZA 4ZL8A 3VPQA 5GSSA 3Q18A 1VF4A 2VL9A 3UAPA 4LA1A 4N10A 2H1AA 3BBYA 2CZ2A 4KW6A 3C73A 3PH9A 2YP6A 1HNCA 2YV9A 2OJLA 3I6AA 4BPYA 5G2ZA 2K8VA 1H4OA 2H0IA 3S9FA 1ML6A 2FD3A 4Q5FA 3H93A 3WYWA 3ZFLA 4KUNA 3FW2A 4ZBBA 3ZMLA 2FUG2 3OR5A 4K0NA 3R2QA 4AF2A 4EDYA 2A4VA 2DSAA 4KB3A 2GSTA 5A4UA 3GKKA 3KXOA 3TKSC 3ZITA 4L0UA 4G2EA 3A2WA 2YCDA 4TR1B 4TR3A 1N2AA 5AN1A 3ERWA 4ZXGA 2GT6A 3LWAA 1A2JA 1F6MC 3IHQA 4P3YB 3DGQA 3KMNA 1BX9A 4JBBA 2LKUA 2KLXA 3DVWA 4ZBDA 1DUGA 4CW9A 2F51A 3TJFA 4ECIA 1HNAA 2O7KA 5KN0A 1PA3A 2V6KA 4WBRD 1K3OA 2XPEA 1VF2A 3LYKA 1GWCA 4MABA 1NSWA 5D93A 3E9JB 5HFGA 1SL2B 2IL3A 22GSA 2L6DA 4WETA 1R5AA 3FZAA 4PXOA 2J9HA 3F9UA 2GQKA 4IJ3A 2GSQA 4ZB9A 3P7XA 1QMVA 2GSSA 5D9VA 2VD0A 1DBYA 1FOVA 5G31A 2VCTA 3KTBA 4HU7A 3ME7A 1TRSA 1G6YA 1BJXA 2HSHA 1G6WA 3GSTA 3KGKA 2ZCTA 4ECJA 3GKXA 4DSRA 1F9MA 4G9HA 3F3QA 1MEKA 1GNWA 3Q19A 2H19A 3DD3A 3EC3A 4GSTA 2AUVA 1GTIA 4MJBA 3KH9A 5J9CA 2JADA 1G7OA 2HLSA 3G7YA 2I9HA 3TDGA 1BQ7A 1A0FA 3VK9A 2MMZA 5DVBA 1M2BA 1K0MA 1RK4A 2LRNA 4I8BA 2IWTA 4D73A 2FA4A 5B8BA 2VLTA 1YY7A 1EP8A 2HZEA 1QQ2A 1ZGNA 2YWOA 6GSTA 4V2NA 3UVTA 3RAZA 2PVQA 3RPNA 1YKAA 4KAEA 5EL8A 2C8UA 4V1Ap 2GZZA 3MDKA 2E2MA 3P2AA 2EIOA 4AGSA 5JCWA 1O81A 1EEJA 2VL2A 2E7PA 2MYGA 1A2MA 1X9SB 3IOSA 2F8FA 3H4KA 4QL7A 4MLYA 2ON7A 3UL3A 3IC4A 2LUSA 4HQSA 2GZPA 4LLRA 3IAM2 1ZZYA 3U5RE 3LQ7A 2P0GA 3FYGA 2C0DA 4XHMA 5IPGA 2HI7A 5IMVA 3WGXA 3MAKA 2VOCA 1TI3A 1A23A 1K0AA 2C0GA 1E6BA 1UA5A 4I5QA 1W4VA 4BVYA 1GSSA 3ZYWA 5GSTA 2DMLA 1ZYEA 1B4PA 4XRAA 4ACSA 1V40A 1OC3A
chains in the Genus database with same CATH superfamily
1SL1B 2V6OA 1SD8A 1EGRA 4NWYA 1GP1A 2H0HA 3LORA 1S3RA 2VCXA 1M2DA 2OACA 4N30A 3LXTA 2R0GA 3TJJA 3VURA 1YF1A 4ZBAA 1KBNA 2DLXA 3EINA 3KJYA 1RQMA 3HZ4A 3FZ4A 1XWAA 1Y6EA 2H71A 3D6IA 2VM1A 1Q98A 5F0GA 3RHBA 1VF3A 3MSZA 4IKHA 3A5WA 2LEGA 3FR6A 1YEPA 2PN8A 3WGEA 4HI7A 2RM5A 2B6MA 1K3YA 3C1RA 1E2YA 2A2SA 2OE1A 1ABAA 4GQCA 4IJIA 4MZWA 3NIVA 1X5CA 3ZMKA 1OKDA 4JR4A 4KX4A 1X5EA 2H76A 1XXUA 5LCZA 4YQUA 1O6JA 4N0VA 3IXRA 5DAKA 2IMIA 4DSSB 5A5KA 2MZCA 2HRAA 3GFKA 4TW5A 3GUSA 3TOUA 3KTLA 3O6TA 1WPIA 2DKIA 1YKCA 2WULA 3RDWA 3ISOA 1JLWA 1LBKA 2C4JA 3HKRA 4FQUA 4MPGA 4GSNA 3HDCA 3A2VA 1QK8A 3M1GA 4IP1A 4DSSA 1KEBA 3HCZA 2IMKA 3GNJA 1XFLA 4YAVA 6GSYA 2L6CA 2GLRA 2DJ2A 1NHOA 2FA8A 2YV7A 3ZRDA 3TKSE 5JWRB 4Z2UA 3LXZA 5B6NA 3J7Yb 4NPBA 1USBA 2O87A 4PUAA 5G30A 1S3CA 4IQ1A 3VWVA 4OFTA 1XVQA 2LTKA 4Z2RA 3Q74A 3QAWA 2L4CA 4NXIA 4K0GA 3F4TA 5ECRB 2EIRA 3EMPA 2CT6A 1RW1A 2LQQA 2JZSA 2L5OA 1TU8A 5CRDA 5HR3A 1MD3A 3D22A 1SENA 2DMMA 4WF5A 3VWUA 4BL7B 1TP9A 9GSSA 5D73A 4NHZA 4XS4A 3CSIA 3RBTA 2JU5A 1K0OA 2A2PA 2A4HA 1GNEA 2IFQB 5DDLA 3WT1A 1XOBA 4WF4A 4YKFA 4Z2TA 3DYRA 1FVKA 4F03A 2LNSA 4TR4A 4MCUA 1G7EA 3LJRA 2ZNMA 1M2AA 4V2LA 2CVBA 4MH3A 4ZB6A 2KHPA 5DBQA 2FWFA 5H5QA 4F0BA 2VLVA 3HD5A 5DALB 2DJ0A 1EEMA 3PR8A 4FYCA 4AJ7A 1C72A 5IO0A 1U88A 3SWLA 1NM3A 1JLVA 3M9JA 4KDUA 3UOMA 3ZLPA 2Z9SA 4MJCA 2H73A 1OKTA 4V2MA 1PSQA 2IIYA 4K8MA 4OD7A 1K0BA 3UMAA 1TRWA 3QCPA 2B3SA 3GTUA 2E2GA 5ID2A 5DQYA 3J7Yk 4K2DA 4K7NA 5IMZA 4RQXA 2C3TA 2YN1A 1T8EB 3CYNA 3GMFA 4EXJA 1GSDA 3VI7A 3GH6A 4IGJA 1TRVA 4USSA 3TKPA 2K6VA 4XTSA 5HQPA 1XPVA 1OE7A 2E0QA 4MMMA 4TOPA 5ECKB 3EU4A 2RLIA 2KOKA 1XOAA 3VLNA 5F07A 3A3TA 5IPHA 2P5RA 2FGXA 3GX0A 3HHVA 3TJGA 2VD1A 3ME8A 1EOGA 4GQFA 1SK2A 3F63A 3GURA 14GSA 4K6XA 1K0DA 3TKSA 3QPMA 2RUFA 3UBLA 4TXOA 2VCWA 3G7IA 2X99A 4MH2A 4BA7A 5KN2A 3C1SA 2FWGA 1HQOA 3KIJA 5DQSA 4JEDA 5FHIA 2DJ1A 3VWWA 1GULA 1JZWA 2LRCA 2XPDA 1JZOA 4IHUA 5IMFA 4AJ6A 4HOJA 4TRXA 4I97A 5D96A 1EP7A 1AC1A 2RUEA 1V9WA 2I1UA 3A5IA 4WR5A 4KSMA 2C1YA 1EZKA 1SU9A 2H1BA 1FO5A 5IQYA 1GLQA 2MMOA 3EE2A 2QSIA 4POKA 4PNGA 1Z6MA 3IC8A 4KDYA 4N11A 1WIKA 6GSVA 3W8JA 2HSYA 1JFUA 2WRTA 1AAZA 3E0UA 4PQHA 1WRYA 2RM6A 2IPAA 3M3MA 2WDUA 4PGTA 1SKWB 4CY6A 2LJKA 4Q5QA 1XW5A 2K8SA 1SJIA 1AQXA 1T1VA 2R0PA 2KUCA 3HYPA 1A8LA 2H6XA 3TUEA 3ZREA 2JL4A 2X49A 1EOHA 2HT9A 1THOA 4MK3A 1U3IA 2HE3A 3HVXA 2C3QA 3F4RA 3U6VA 3LW9A 1GL8A 3F6DA 2HFDA 3F3RA 5G1LA 3GV1A 2CX4A 2HRFA 2GT5A 2ON5A 4G0IA 2AB6A 4D73B 5D9WA 3RPPA 2HZEB 1J0FA 4HS1A 4F2IA 5BRTA 4FIWA 3M0FA 4I6XA 6GSUA 4I2TA 4K7IA 2BMXA 2FLSA 3TCOA 4HDEA 2C80A 5F05A 8GSSA 3ERFA 4XRDA 4ML6A 3HXSA 2HRNA 2CA8A 2OBIA 2C0EA 2PPTA 4J56E 4Q5NA 4MF6A 1B8XA 1O8XA 1OVNA 4TXVA 3PGTA 4MA9A 1AQWA 2H6ZA 1S3DA 2J23A 2YOIA 1T4ZA 1OC9B 4WXTA 1R5PA 5DCHA 4FYUA 4CDOA 1T4YA 2YWMA 11GSA 2PMTA 1T3BA 4O5RA 1TK8B 4ZILA 1F3BA 5AISA 1N8JA 4MJAA 2D2ZA 3GA4A 4E8HA 4BVXA 3APSA 3KEBA 4QQ7A 1OC9A 1NW2A 1PKWA 4BVYB 3WGDA 2M80A 1QUWA 1A0RP 5IM9A 4GRFA 4TKYA 3DVXA 2CZ3A 2A2RA 5JWQB 3I69A 1X9WB 2M46A 3IE3A 4PQIA 2OADA 4OO5A 3ZIVA 2P5QA 4XS1A 3GSSA 5ECPB 3FZ5A 3BD2A 4KCEA 4L5LA 1HD2A 4WR4A 1GSQA 2IMFA 1PX6A 4EE0A 3C8EA 3DRNA 1R4WA 4CY8A 3IRAA 3EYTA 2F8AA 2JSYA 4X43A 3SBCA 3D0ZA 5H5SA 4RI6A 4K5SA 1NHYA 2NTOA 1YJ6A 1MDKA 4EIPA 1Z7PA 2O85A 1BYEA 1TW9A 1I9DA 5FT3A 5DJLA 2X4AA 2L57A 3HY2A 5COHA 1HYUA 2UZ8A 3DXBA 3MNGA 2LSTA 1O8WA 2R3XA 3CMIA 2G2QA 1Y25A 1XWKA 4JZQA 1K0NA 3HJOA 3QOUA 2AHEA 5DAKB 4ECCA 3AY8A 4OFNA 1G0TA 5IMDA 2B1LA 4F9ZA 3BCIA 2MBSA 1SJZA 3I43A 1Z9HA 5CREA 3GIXA 3QMXA 5HR1A 4LL4B 1TXXA 1V2AA 4RQRA 5H5RA 4RUVA 5IMCA 1I5GA 3MWHA 1TI1A 1GRXA 1W89A 1GUHA 2VM2A 3CSHA 1TJDA 2LS5A 5E59A 3ED3A 1XW6A 1PRXA 3JCML 4JR6A 1XVWA 2GZYA 4ZIJA 2R6KA 2QC7A 2REMA 5ECLB 2PUKC 5HR2A 4FH8A 1XCCA 1CQHA 5KEJA 3TKQA 3TKRA 4TR0A 5GZZB 1UC7A 3QFBC 4O32A 5CP1A 4HUAA 1YDKA 5ECNB 2DJJA 1SKRB 1IYHA 2WFCA 4NV2A 2FNOA 4ILFA 1URMA 4MNNA 5HFKA 4EDZA 5J5NA 1XBSA 1IYIA 4XS4B 5AGYA 2CAIA 3IPZA 4EL1A 3GYKA 4L5OA 19GSA 4X1UA 2GDRA 4PNFA 2KP2A 2FHEA 1FHEA 1FAAA 1WJKA 2N5FA 5L71A 3HA9A 4YQMA 4K7OA 4ISDA 1T00A 20GSA 3CTFA 3LEFA 2JACA 2CV4A 1SYXA 2H70A 1YEXA 2ES7A 2YPMA 2VCZA 3I9V2 1H75A 1V57A 1BAYA 5BMUA 4OCEA 5IO2A 3CRUA 1SYRA 1ERUA 1PGTA 2PWJA 2R37A 1YQ1A 4OCFA 2TRCP 4PUFC 2YJ7A 1ZOFA 2VIMA 3ZL5A 1VGLA 3VWXA 3F6FA 3HJPA 1FW1A 2B5EA 3FY7A 1OE8A 4CHSA 2HYXA 4GWRA 4Z7XA 4L0WA 3KD0A 6GSWA 5KOXA 1TK0B 1B4QA 3EURA 4EUYA 4MZBA 3IK9A 4HEA2 5C04A 5AIXA 2EIQA 1XWCA 4KCAA 1MDIA 3BJ5A 3GKNA 4XCSA 3GTUB 2FWHA 5ID2B 1KNGA 3EPTA 1GTAA 6GSSA 3O76A 4FYBA 2X8CA 3UEMA 2O8VB 4IP6A 1U87A 4HZ2A 4WKWA 3LGCA 2DKHA 1ST9A 4DVCA 4F0CA 4GSSA 2AAWA 3TGZA 4KE3A 2GQLA 2YWNA 2N5BA 4ICYA 4DSQA 4F82A 1DE2A 2YJHA 4MF7A 3L4NA 1XIYA 3QDNA 2LNTA 5GAND 1VRSD 2M72A 1ILOA 4MP4A 5F8BA 3LFLA 1PKZA 1SL0B 2K9FA 4J2FA 3NZNA 3WT2A 1AUCA 3KCMA 4A5PA 2X8HA 2JSZA 2OBKA 1HNBA 1JZDA 2WB9A 2WJUA 5CAXA 3C7MA 2FCHA 1TKDB 3EMXA 4HU9A 2TRXA 2B7KA 2X64A 1B9XC 2R2JA 4TXOB 3C71A 3H79A 4IS0A 3TJKA 2B5YA 2NPBA 2YNXA 3LSZA 4KDXA 1WE0A 3ZVJA 1MDJA 2H66A 5CO3A 1S3AA 2GSRA 2QKEA 1GUKA 4YQVA 2H0GA 4MF5A 3IAS2 4V1Ag 1YZXA 2DC5A 2I3YA 3GRXA 5G5FA 2LQOA 4I2UA 3DIEA 1PL2A 3TRXA 3M9KA 3A2XA 1WWJA 2JZRA 4HZ4A 2QGVA 3N9JA 1BG5A 3FR3A 2H75A 4L8EA 4J57E 3KZQA 4EC0A 5A4VA 3CSJA 2V1MA 3QFAC 1AQVA 1KTEA 2F9SA 4X4JA 5ELGA 1OYJA 2DIZA 3VI5A 5ELAA 1K0CA 2VLUA 2X8GA 5HFIA 1TDIA 1QFNA 1AW9A 5KN3A 1R26A 3QAGA 1F3AA 3HJMA 2B7JA 2BTOT 2ZUPA 1TRUA 4ECBA 4GF0A 4EVMA 2WCIA 3FR9A 3TRPA 2EC4A 3GX8A 4BWQA 1TOFA 3DEXA 3PPUA 5IOWA 2LJAA 1OC8A 1LU4A 3APQA 1O7UA 3ZTLA 5G1KA 1V58A 10GSA 3HVVA 1TU7A 3N5OA 4PQ1A 4QL9A 4O7HA 2VAFA 4K1FA 1M7TA 3H1NA 3FKFA 5KN1A 2B1KA 2CQ9A 4G0LA 3QAVA 2R4VA 1PL1A 4TR1A 2XBQA 3KMOA 4KNDA 2NBSA 1CQGA 2MMAA 4IELA 3TB2A 1JZRA 2H1GA 3L9VA 2VCVA 2VCQA 3L78A 3QD9A 2DJ3A 4LMWA 4ZB8A 5E4WA 3IHGA 5INYA 1GSEA 3D4MA 5LNKe 1ERTA 4LL1B 4OFMA 2HSMA 3US3A 3FMWA 1ON4A 2OKAA 1UVZA 1YF0A 3V1WA 4JRRA 3W8SA 2L4QA 1PN9A 2R5GA 1U6TA 2FWEA 5AIVA 1BEDA 3GL3A 2PERA 4EO3A 1WP0A 3TOTA 3CTGA 7GSSA 18GSA 5D9TA 1FG4A 4JU5A 3O3TA 1PN0A 4WBJA 4BVXB 5J9BA 4K5RA 3EWLA 2GGTA 1EGOA 1FB0A 1DE1A 3TRQA 2DJKA 3DWVA 5J41A 3MYDA 1OAZA 1EV4A 1XG8A 2IMDA 3UIWA 5CNWA 2LV3A 5ABRA 2GQMA 3EU3A 2LRTA 4WEYA 4KA0A 1EV9A 2H1DA 1V98A 1XW9A 2GS3A 1AIUA 1SKSB 2GVPA 1ZL9A 3HZ8A 3KM6A 3L9UA 3Q6OA 2I81A 4JE1A 1Q4JA 2MMNA 3HVNA 1Z7RA 4KSOA 3GHAA 4PX1A 4MZCA 1ZYQB 3KH7A 4E8EA 4IW9A 2HZFA 5EVOA 17GSA 4MJEA 4POMA 3DMLA 3QR6A 3CBUA 3FEUA 2VL2C 3D4TA 3F8UA 3ZIJA 1PX7A 1M0UA 4GCIA 5ECIB 4NHWA 4TVEA 2H74A 5CRWA 2KP1A 4ML1A 4OMVA 2P31A 3W6GA 2OA7A 5ECMB 5JCGA 1XWGA 3EVIA 4HSCX 5J4UA 3FK8A 4Q5RA 4TN8A 2VUPA 1TTZA 1QXHA 1PMTA 4ZL9A 1A24A 2NVLA 2LJRA 4XS6A 1WOUA 1MTCA 6GSXA 4NAXA 1PD21 1WMJA 5ECQB 1UN2A 3ERGA 5ECHB 1VF1A 1GTBA 2CVKA 2H8LA 1FB6A 4GLTA 2RIIA 4OO4A 2O89A 5B8AA 1M9AA 2V32A 4KH7A 2L5LA 1F37A 2HNLA 1X0RA 4H86A 2TIRA 5IMAA 5CYYA 3UARA 2C3NA 3IR4A 2R0CA 3P90A 1EWXA 2ALBA 3GH9A 3E3EA 2PBJA 3UVHA 3ZFBA 2F3MA 1ZYNA 3IDVA 5DJMA 3GL5A 5D9XA 2DIYA 4MDCA 1QGVA 5G5EA 1ACVA 3IV4A 2I4AA 4POBA 1X9MB 1A8YA 3L0HA 5IIZA 4OWYA 1Z5YE 3IA1A 2YWIA 5JCUA 2JZTA 2WZ9A 3IBHA 2CX3A 3HVSA 3F4SA 1SK1A 1SJ6A 4NMUA 3ZZXA 1ZYPA 2C0FA 3GN3A 3FZ9A 3M8NA 5IOXA 2YZUA 1R7HA 5J3RA 3BOAA 3UBKA 1SK0A 2XBIA 5EY6A 1XWBA 1T7PB 1GSUA 1THXA 5ENUA 2XC2A 3D21A 3H8QA 3DKSA 3UJ1A 1M99A 2H72A 1M9BA 4YH2A 3IK7A 3RHCA 3VFIA 1X5DA 3KP9A 4HJMA 1XZOA 4KGIA 1GSYA 3K8NA 2PGTA 3FHKA 4NV5A 1O73A 4MPFA 5CRGA 4ZL7A 2GTUA 3PINA 2MBTA 4GXZA 4HJ2A 5HR0A 2H6YA 3ZVJD 1ZCPA 2L59A 4ID0A 4AJ8A 3LG6A 2NDOA 1J08A 4BIKA 1ZMAA 1B48A 4IQAA 4X0XA 1K3LA 3G9BA 1TK5B 1ERVA 3BCKA 4YAPA 1MD4A 1Z3EA 4FO5A 1LJRA 3KP8A 5A4WA 2IJYA 2V41A 5LD0A 4K9ZA 1F2EA 2YANA 2AYTA 5B6MA 2XHFA 5KOWA 1PQNA 2VL3A 4IVFA 2WGRA 2H01A 5ECSA 2K18A 2OE3A 3FRCA 1B9YC 1GLPA 2V2GA 3APOA 4BWSA 3G7JA 4LMVA 4XIHA 3D5JA 1U3AA 5CRHA 3P8WA 1AXDA 2H30A 2IN3A 2PU9C 3CXGA 5B7CA 2DBCA 4BL7A 3WD6A 4IBPA 13GSA 4G10A 4EIQA 16GSA 4POLA 5C00A 2IFQA 2CVDA 5GAPD 4KF9A 4ULXA 4O5QA 4IN0A 3F0IA 2G0FA 1GSFA 2B5XA 12GSA 5JWOB 5EPFA 5F06A 4GTUA 2PVOC 4EF0A 5DCGA 1GH2A 2VO4A 1Z6NA 1J9BA 2AV4A 5DALA 1A2LA 2FY6A 3VPTA 3GKMA 1GTUA 1GUMA 4EKZA 2N5AA 2AJQB 3NOFA 4G19A 1O85A 4PTSA 1FVJA 4RI7A 2OE0A 4HQZA 3LYPA 5D8IA 4O92A 3L9SA 2HXKA 1JHBA 2YZHA 5ECOB 3TJBA 1ERWA 1SD9A 4DEJA 3CRTA 2WS2A 1PFOA 2BJXA 4PURA 2IMEA 5FWGA 2CAQA 1DSBA 4N0ZA 4ZL8A 3VPQA 5GSSA 3Q18A 1VF4A 2VL9A 3UAPA 4LA1A 4N10A 2H1AA 1M3JA 3BBYA 2CZ2A 4KW6A 3C73A 3PH9A 2YP6A 1HNCA 2YV9A 2OJLA 3I6AA 4BPYA 5G2ZA 2K8VA 1H4OA 2H0IA 4YKGA 3S9FA 1ML6A 2FD3A 4Q5FA 3CQFA 3H93A 3WYWA 3ZFLA 4KUNA 3FW2A 4ZBBA 3ZMLA 2FUG2 3OR5A 4K0NA 3R2QA 4AF2A 4EDYA 2A4VA 2DSAA 4KB3A 2GSTA 5A4UA 3GKKA 3KXOA 3TKSC 3ZITA 4L0UA 4G2EA 3A2WA 2YCDA 4TR1B 4TR3A 1N2AA 2HRKA 5AN1A 3ERWA 4ZXGA 2GT6A 3LWAA 1A2JA 1F6MC 3IHQA 4P3YB 3DGQA 3KMNA 1BX9A 4JBBA 2LKUA 2KLXA 3DVWA 4ZBDA 1DUGA 4CW9A 2F51A 3TJFA 4ECIA 1HNAA 2O7KA 5KN0A 1PA3A 2V6KA 4WBRD 1K3OA 2XPEA 1VF2A 3LYKA 1GWCA 4MABA 1NSWA 5D93A 2QA1A 3E9JB 5HFGA 1SL2B 2IL3A 22GSA 2L6DA 4WETA 1R5AA 3FZAA 4PXOA 2J9HA 3F9UA 2GQKA 4IJ3A 2GSQA 4ZB9A 3P7XA 1QMVA 2GSSA 5D9VA 2VD0A 1DBYA 1FOVA 5G31A 2VCTA 3KTBA 4HU7A 3ME7A 1TRSA 1G6YA 1BJXA 2HSHA 1G6WA 3GSTA 3KGKA 2ZCTA 4ECJA 3GKXA 4DSRA 1F9MA 4G9HA 3F3QA 1MEKA 1GNWA 3Q19A 2H19A 3DD3A 3EC3A 4GSTA 2AUVA 1GTIA 4MJBA 3KH9A 5J9CA 2JADA 1G7OA 2HLSA 3G7YA 2I9HA 3TDGA 3MIXA 1BQ7A 1A0FA 3VK9A 2MMZA 5DVBA 1M2BA 1K0MA 1RK4A 2LRNA 4I8BA 2IWTA 4D73A 2FA4A 5B8BA 2VLTA 1YY7A 1EP8A 2HZEA 1QQ2A 1ZGNA 2YWOA 6GSTA 4V2NA 3UVTA 2QA2A 3RAZA 2PVQA 3RPNA 1FOHA 1YKAA 4KAEA 5EL8A 2C8UA 4V1Ap 2GZZA 3MDKA 2E2MA 3P2AA 2EIOA 4K2XA 4AGSA 3R3EA 5JCWA 1O81A 1EEJA 2VL2A 2E7PA 2MYGA 1A2MA 1X9SB 3IOSA 2F8FA 3H4KA 4QL7A 4MLYA 2ON7A 3UL3A 3IC4A 2LUSA 4HQSA 2GZPA 4LLRA 4O5UA 3IAM2 1ZZYA 3U5RE 3LQ7A 2P0GA 3FYGA 2C0DA 4XHMA 5IPGA 1M3IA 2HI7A 5IMVA 3WGXA 3MAKA 2VOCA 1TI3A 1A23A 1K0AA 2C0GA 1E6BA 1UA5A 4I5QA 1W4VA 4G0KA 4BVYA 1GSSA 3ZYWA 5GSTA 2DMLA 1ZYEA 1B4PA 4XRAA 4ACSA 1V40A 1OC3A
chains in the Genus database with same CATH topology
1SL1B 2V6OA 1SD8A 1EGRA 4NWYA 1GP1A 2H0HA 3LORA 2VCXA 1M2DA 2OACA 4N30A 3LXTA 2R0GA 3TJJA 3VURA 1YF1A 4ZBAA 1KBNA 2DLXA 3EINA 3KJYA 1RQMA 3HZ4A 3FZ4A 1XWAA 1Y6EA 2H71A 3D6IA 2VM1A 1Q98A 5F0GA 3RHBA 1VF3A 3MSZA 4IKHA 3A5WA 2LEGA 3FR6A 1YEPA 2PN8A 3WGEA 4HI7A 2RM5A 2B6MA 1K3YA 3C1RA 1E2YA 2A2SA 2OE1A 1ABAA 4GQCA 4IJIA 4MZWA 3NIVA 1X5CA 3ZMKA 1OKDA 4JR4A 4KX4A 1X5EA 2H76A 1XXUA 5LCZA 4YQUA 1O6JA 4N0VA 3IXRA 5DAKA 2IMIA 4DSSB 5A5KA 2MZCA 2HRAA 3GFKA 4TW5A 3GUSA 3TOUA 3KTLA 3O6TA 1WPIA 2DKIA 1YKCA 2WULA 3RDWA 3ISOA 1JLWA 1LBKA 2C4JA 3HKRA 4FQUA 4MPGA 4GSNA 3HDCA 3A2VA 1QK8A 3M1GA 4IP1A 4DSSA 1KEBA 3HCZA 2IMKA 3GNJA 1XFLA 4YAVA 6GSYA 2L6CA 2GLRA 2DJ2A 1NHOA 2FA8A 2YV7A 3ZRDA 3TKSE 5JWRB 4Z2UA 3LXZA 5B6NA 3J7Yb 4NPBA 1USBA 2O87A 4PUAA 5G30A 1S3CA 4IQ1A 3VWVA 4OFTA 1XVQA 2LTKA 4Z2RA 3Q74A 3QAWA 2L4CA 4NXIA 4K0GA 3F4TA 5ECRB 2EIRA 3EMPA 2CT6A 1RW1A 2LQQA 2JZSA 2L5OA 1TU8A 5CRDA 5HR3A 1MD3A 3D22A 1SENA 2DMMA 4WF5A 3VWUA 4BL7B 1TP9A 9GSSA 5D73A 4NHZA 4XS4A 3CSIA 3RBTA 2JU5A 1K0OA 2A2PA 2A4HA 1GNEA 2IFQB 5DDLA 3WT1A 1XOBA 4WF4A 4YKFA 4Z2TA 3DYRA 1FVKA 4F03A 2LNSA 4TR4A 4MCUA 1G7EA 3LJRA 2ZNMA 1M2AA 4V2LA 2CVBA 4MH3A 4ZB6A 2KHPA 5DBQA 2FWFA 5H5QA 4F0BA 2VLVA 3HD5A 5DALB 2DJ0A 1EEMA 3PR8A 4FYCA 4AJ7A 1C72A 5IO0A 1U88A 3SWLA 1NM3A 1JLVA 3M9JA 4KDUA 3UOMA 3ZLPA 2Z9SA 4MJCA 2H73A 1OKTA 4V2MA 1PSQA 2IIYA 4K8MA 4OD7A 1K0BA 3UMAA 1TRWA 3QCPA 2B3SA 3GTUA 2E2GA 5ID2A 5DQYA 3J7Yk 4K2DA 4K7NA 5IMZA 4RQXA 2C3TA 2YN1A 1T8EB 3CYNA 3GMFA 4EXJA 1GSDA 3VI7A 3GH6A 4IGJA 1TRVA 4USSA 3TKPA 2K6VA 4XTSA 5HQPA 1XPVA 1OE7A 2E0QA 4MMMA 4TOPA 5ECKB 3EU4A 2RLIA 2KOKA 1XOAA 3VLNA 5F07A 3A3TA 5IPHA 2P5RA 2FGXA 3GX0A 3HHVA 3TJGA 2VD1A 3ME8A 1EOGA 4GQFA 1SK2A 3F63A 3GURA 14GSA 4K6XA 1K0DA 3TKSA 3QPMA 2RUFA 3UBLA 4TXOA 2VCWA 3G7IA 2X99A 4MH2A 4BA7A 5KN2A 3C1SA 2FWGA 1HQOA 3KIJA 5DQSA 4JEDA 5FHIA 2DJ1A 3VWWA 1GULA 1JZWA 2LRCA 2XPDA 1JZOA 4IHUA 5IMFA 4AJ6A 4HOJA 4TRXA 4I97A 5D96A 1EP7A 1AC1A 2RUEA 1V9WA 2I1UA 3A5IA 4WR5A 4KSMA 2C1YA 1EZKA 1SU9A 2H1BA 1FO5A 5IQYA 1GLQA 2MMOA 3EE2A 2QSIA 4POKA 4PNGA 1Z6MA 3IC8A 4KDYA 4N11A 1WIKA 6GSVA 3W8JA 2HSYA 1JFUA 2WRTA 1AAZA 3E0UA 4PQHA 1WRYA 2RM6A 2IPAA 3M3MA 2WDUA 4PGTA 1SKWB 4CY6A 2LJKA 4Q5QA 1XW5A 2K8SA 1SJIA 1AQXA 1T1VA 2R0PA 2KUCA 3HYPA 1A8LA 2H6XA 3TUEA 3ZREA 2JL4A 2X49A 1EOHA 2HT9A 1THOA 4MK3A 1U3IA 2HE3A 3HVXA 2C3QA 3F4RA 3U6VA 3LW9A 1GL8A 3F6DA 2HFDA 3F3RA 5G1LA 3GV1A 2CX4A 2HRFA 2GT5A 2ON5A 4G0IA 2AB6A 4D73B 5D9WA 3RPPA 2HZEB 1J0FA 4HS1A 4F2IA 5BRTA 4FIWA 3M0FA 4I6XA 6GSUA 4I2TA 4K7IA 2BMXA 2FLSA 3TCOA 4HDEA 2C80A 5F05A 8GSSA 3ERFA 4XRDA 4ML6A 3HXSA 2HRNA 2CA8A 2OBIA 2C0EA 2PPTA 4J56E 4Q5NA 4MF6A 1B8XA 1O8XA 1OVNA 4TXVA 3PGTA 4MA9A 1AQWA 2H6ZA 1S3DA 2J23A 2YOIA 1T4ZA 1OC9B 4WXTA 1R5PA 5DCHA 4FYUA 4CDOA 1T4YA 2YWMA 11GSA 2PMTA 1T3BA 4O5RA 1TK8B 4ZILA 1F3BA 5AISA 1N8JA 4MJAA 2D2ZA 3GA4A 4E8HA 4BVXA 3APSA 3KEBA 4QQ7A 1OC9A 1NW2A 1PKWA 4BVYB 3WGDA 2M80A 1QUWA 1A0RP 5IM9A 4GRFA 4TKYA 3DVXA 2CZ3A 2A2RA 5JWQB 3I69A 1X9WB 2M46A 3IE3A 4PQIA 2OADA 4OO5A 3ZIVA 2P5QA 4XS1A 3GSSA 5ECPB 3FZ5A 3BD2A 4KCEA 4L5LA 1HD2A 4WR4A 1GSQA 2IMFA 1PX6A 4EE0A 3C8EA 3DRNA 1R4WA 4CY8A 3IRAA 3EYTA 2F8AA 2JSYA 4X43A 3SBCA 3D0ZA 5H5SA 4RI6A 4K5SA 1NHYA 2NTOA 1YJ6A 1MDKA 4EIPA 1Z7PA 2O85A 1BYEA 1TW9A 1I9DA 5FT3A 5DJLA 2X4AA 2L57A 3HY2A 5COHA 1HYUA 2UZ8A 3DXBA 3MNGA 2LSTA 1O8WA 2R3XA 3CMIA 2G2QA 1Y25A 1XWKA 4JZQA 1K0NA 3HJOA 3QOUA 2AHEA 5DAKB 4ECCA 3AY8A 4OFNA 1G0TA 5IMDA 2B1LA 4F9ZA 3BCIA 2MBSA 1SJZA 3I43A 1Z9HA 5CREA 3GIXA 3QMXA 5HR1A 4LL4B 1TXXA 1V2AA 4RQRA 5H5RA 4RUVA 5IMCA 1I5GA 3MWHA 1TI1A 1GRXA 1W89A 1GUHA 2VM2A 3CSHA 1TJDA 2LS5A 5E59A 3ED3A 1XW6A 1PRXA 3JCML 4JR6A 1XVWA 2GZYA 4ZIJA 2R6KA 2QC7A 2REMA 5ECLB 2PUKC 5HR2A 4FH8A 1XCCA 1CQHA 5KEJA 3TKQA 3TKRA 4TR0A 5GZZB 1UC7A 3QFBC 4O32A 5CP1A 4HUAA 1YDKA 5ECNB 2DJJA 1SKRB 1IYHA 2WFCA 4NV2A 2FNOA 4ILFA 1URMA 4MNNA 5HFKA 4EDZA 5J5NA 1XBSA 1IYIA 4XS4B 5AGYA 2CAIA 3IPZA 4EL1A 3GYKA 4L5OA 19GSA 4X1UA 2GDRA 4PNFA 2KP2A 2FHEA 1FHEA 1FAAA 1WJKA 2N5FA 5L71A 3HA9A 4YQMA 4K7OA 4ISDA 1T00A 20GSA 3CTFA 3LEFA 2JACA 2CV4A 1SYXA 2H70A 1YEXA 2ES7A 2YPMA 2VCZA 3I9V2 1H75A 1V57A 1BAYA 5BMUA 4OCEA 5IO2A 3CRUA 1SYRA 1ERUA 1PGTA 2PWJA 2R37A 1YQ1A 4OCFA 2TRCP 4PUFC 2YJ7A 1ZOFA 2VIMA 3ZL5A 1VGLA 3VWXA 3F6FA 3HJPA 1FW1A 2B5EA 3FY7A 1OE8A 4CHSA 2HYXA 4GWRA 4Z7XA 4L0WA 3KD0A 6GSWA 5KOXA 1TK0B 1B4QA 3EURA 4EUYA 4MZBA 3IK9A 4HEA2 5C04A 5AIXA 2EIQA 1XWCA 4KCAA 1MDIA 3BJ5A 3GKNA 4XCSA 3GTUB 2FWHA 5ID2B 1KNGA 3EPTA 1GTAA 6GSSA 3O76A 4FYBA 2X8CA 3UEMA 2O8VB 4IP6A 1U87A 4HZ2A 4WKWA 3LGCA 2DKHA 1ST9A 4DVCA 4F0CA 4GSSA 2AAWA 3TGZA 4KE3A 2GQLA 2YWNA 2N5BA 4ICYA 4DSQA 4F82A 1DE2A 2YJHA 4MF7A 3L4NA 1XIYA 3QDNA 2LNTA 5GAND 1VRSD 2M72A 1ILOA 4MP4A 5F8BA 3LFLA 1PKZA 1SL0B 2K9FA 4J2FA 3NZNA 3WT2A 1AUCA 3KCMA 4A5PA 2X8HA 2JSZA 2OBKA 1HNBA 1JZDA 2WB9A 2WJUA 5CAXA 3C7MA 2FCHA 1TKDB 3EMXA 4HU9A 2TRXA 2B7KA 2X64A 1B9XC 2R2JA 4TXOB 3C71A 3H79A 4IS0A 3TJKA 2B5YA 2NPBA 2YNXA 3LSZA 4KDXA 1WE0A 3ZVJA 1MDJA 2H66A 5CO3A 1S3AA 2GSRA 2QKEA 1GUKA 4YQVA 2H0GA 4MF5A 3IAS2 4V1Ag 1YZXA 2DC5A 2I3YA 3GRXA 5G5FA 2LQOA 4I2UA 3DIEA 1PL2A 3TRXA 3M9KA 3A2XA 1WWJA 2JZRA 4HZ4A 2QGVA 3N9JA 1BG5A 3FR3A 2H75A 4L8EA 4J57E 3KZQA 4EC0A 5A4VA 3CSJA 2V1MA 3QFAC 1AQVA 1KTEA 2F9SA 4X4JA 5ELGA 1OYJA 2DIZA 3VI5A 5ELAA 1K0CA 2VLUA 2X8GA 5HFIA 1TDIA 1QFNA 1AW9A 5KN3A 1R26A 3QAGA 1F3AA 3HJMA 2B7JA 2BTOT 2ZUPA 1TRUA 4ECBA 4GF0A 4EVMA 2WCIA 3FR9A 3TRPA 2EC4A 3GX8A 4BWQA 1TOFA 3DEXA 3PPUA 5IOWA 2LJAA 1OC8A 1LU4A 3APQA 1O7UA 3ZTLA 5G1KA 1V58A 10GSA 3HVVA 1TU7A 3N5OA 4PQ1A 4QL9A 4O7HA 2VAFA 4K1FA 1M7TA 3H1NA 3FKFA 5KN1A 2B1KA 2CQ9A 4G0LA 3QAVA 2R4VA 1PL1A 4TR1A 2XBQA 3KMOA 4KNDA 2NBSA 1CQGA 2MMAA 4IELA 3TB2A 1JZRA 2H1GA 3L9VA 2VCVA 2VCQA 3L78A 3QD9A 2DJ3A 4LMWA 4ZB8A 5E4WA 3IHGA 5INYA 1GSEA 3D4MA 5LNKe 1ERTA 4LL1B 4OFMA 2HSMA 3US3A 3FMWA 1ON4A 2OKAA 1UVZA 1YF0A 3V1WA 4JRRA 3W8SA 2L4QA 1PN9A 2R5GA 1U6TA 2FWEA 5AIVA 1BEDA 3GL3A 2PERA 4EO3A 1WP0A 3TOTA 3CTGA 7GSSA 18GSA 5D9TA 1FG4A 4JU5A 3O3TA 1PN0A 4WBJA 4BVXB 5J9BA 4K5RA 3EWLA 2GGTA 1EGOA 1FB0A 1DE1A 3TRQA 2DJKA 3DWVA 5J41A 3MYDA 1OAZA 1EV4A 2IMDA 3UIWA 5CNWA 2LV3A 5ABRA 2GQMA 3EU3A 2LRTA 4WEYA 4KA0A 1EV9A 2H1DA 1V98A 1XW9A 2GS3A 1AIUA 1SKSB 2GVPA 1ZL9A 3HZ8A 3KM6A 3L9UA 3Q6OA 2I81A 4JE1A 1Q4JA 2MMNA 1Z7RA 4KSOA 3GHAA 4PX1A 4MZCA 1ZYQB 3KH7A 4E8EA 4IW9A 2HZFA 5EVOA 17GSA 4MJEA 4POMA 3DMLA 3QR6A 3CBUA 3FEUA 2VL2C 3D4TA 3F8UA 3ZIJA 1PX7A 1M0UA 4GCIA 5ECIB 4NHWA 4TVEA 2H74A 5CRWA 2KP1A 4ML1A 4OMVA 2P31A 3W6GA 2OA7A 5ECMB 5JCGA 1XWGA 3EVIA 5J4UA 3FK8A 4Q5RA 4TN8A 2VUPA 1TTZA 1QXHA 1PMTA 4ZL9A 1A24A 2NVLA 2LJRA 4XS6A 1WOUA 1MTCA 6GSXA 4NAXA 1PD21 1WMJA 5ECQB 1UN2A 3ERGA 5ECHB 1VF1A 1GTBA 2CVKA 2H8LA 1FB6A 4GLTA 2RIIA 4OO4A 2O89A 5B8AA 1M9AA 2V32A 4KH7A 2L5LA 1F37A 2HNLA 1X0RA 4H86A 2TIRA 5IMAA 5CYYA 3UARA 2C3NA 3IR4A 2R0CA 3P90A 1EWXA 2ALBA 3GH9A 3E3EA 2PBJA 3UVHA 3ZFBA 2F3MA 1ZYNA 3IDVA 5DJMA 3GL5A 5D9XA 2DIYA 4MDCA 1QGVA 5G5EA 1ACVA 3IV4A 2I4AA 4POBA 1X9MB 1A8YA 3L0HA 5IIZA 4OWYA 1Z5YE 3IA1A 2YWIA 5JCUA 2JZTA 2WZ9A 3IBHA 2CX3A 3HVSA 3F4SA 1SK1A 1SJ6A 4NMUA 3ZZXA 1ZYPA 2C0FA 3GN3A 3FZ9A 3M8NA 5IOXA 2YZUA 1R7HA 5J3RA 3BOAA 3UBKA 1SK0A 2XBIA 5EY6A 1XWBA 1T7PB 1GSUA 1THXA 5ENUA 2XC2A 3D21A 3H8QA 3DKSA 3UJ1A 1M99A 2H72A 1M9BA 4YH2A 3IK7A 3RHCA 3VFIA 1X5DA 3KP9A 4HJMA 1XZOA 4KGIA 1GSYA 3K8NA 2PGTA 3FHKA 4NV5A 1O73A 4MPFA 5CRGA 4ZL7A 2GTUA 3PINA 2MBTA 4GXZA 4HJ2A 5HR0A 2H6YA 3ZVJD 1ZCPA 2L59A 4ID0A 4AJ8A 3LG6A 2NDOA 1J08A 1ZMAA 1B48A 4IQAA 4X0XA 1K3LA 3G9BA 1TK5B 1ERVA 3BCKA 4YAPA 1MD4A 1Z3EA 4FO5A 1LJRA 3KP8A 5A4WA 2IJYA 2V41A 5LD0A 4K9ZA 1F2EA 2YANA 2AYTA 5B6MA 2XHFA 5KOWA 1PQNA 2VL3A 4IVFA 2WGRA 2H01A 5ECSA 2K18A 2OE3A 3FRCA 1B9YC 1GLPA 2V2GA 3APOA 4BWSA 3G7JA 4LMVA 4XIHA 3D5JA 1U3AA 5CRHA 3P8WA 1AXDA 2H30A 2IN3A 2PU9C 3CXGA 5B7CA 2DBCA 4BL7A 3WD6A 4IBPA 13GSA 4G10A 4EIQA 16GSA 4POLA 5C00A 2IFQA 2CVDA 5GAPD 4KF9A 4ULXA 4O5QA 4IN0A 3F0IA 2G0FA 1GSFA 2B5XA 12GSA 5JWOB 5EPFA 5F06A 4GTUA 2PVOC 4EF0A 5DCGA 1GH2A 2VO4A 1Z6NA 1J9BA 2AV4A 5DALA 1A2LA 2FY6A 3VPTA 3GKMA 1GTUA 1GUMA 4EKZA 2N5AA 2AJQB 3NOFA 4G19A 1O85A 4PTSA 1FVJA 4RI7A 2OE0A 4HQZA 3LYPA 5D8IA 4O92A 3L9SA 2HXKA 1JHBA 2YZHA 5ECOB 3TJBA 1ERWA 1SD9A 4DEJA 3CRTA 2WS2A 4PURA 2BJXA 2IMEA 5FWGA 2CAQA 1DSBA 4N0ZA 4ZL8A 3VPQA 5GSSA 3Q18A 1VF4A 2VL9A 3UAPA 4LA1A 4N10A 2H1AA 3BBYA 2CZ2A 4KW6A 3C73A 3PH9A 2YP6A 1HNCA 2YV9A 2OJLA 3I6AA 4BPYA 5G2ZA 2K8VA 1H4OA 2H0IA 4YKGA 3S9FA 1ML6A 2FD3A 4Q5FA 3H93A 3WYWA 3ZFLA 4KUNA 3FW2A 4ZBBA 3ZMLA 2FUG2 3OR5A 4K0NA 3R2QA 4AF2A 4EDYA 2A4VA 2DSAA 4KB3A 2GSTA 5A4UA 3GKKA 3KXOA 3TKSC 3ZITA 4L0UA 4G2EA 3A2WA 2YCDA 4TR1B 4TR3A 1N2AA 2HRKA 5AN1A 3ERWA 4ZXGA 2GT6A 3LWAA 1A2JA 1F6MC 3IHQA 4P3YB 3DGQA 3KMNA 1BX9A 4JBBA 2LKUA 2KLXA 3DVWA 4ZBDA 1DUGA 4CW9A 2F51A 3TJFA 4ECIA 1HNAA 2O7KA 5KN0A 1PA3A 2V6KA 4WBRD 1K3OA 2XPEA 1VF2A 3LYKA 1GWCA 4MABA 1NSWA 5D93A 2QA1A 3E9JB 5HFGA 1SL2B 2IL3A 22GSA 2L6DA 4WETA 1R5AA 3FZAA 4PXOA 2J9HA 3F9UA 2GQKA 4IJ3A 2GSQA 4ZB9A 3P7XA 1QMVA 2GSSA 5D9VA 2VD0A 1DBYA 1FOVA 5G31A 2VCTA 3KTBA 4HU7A 3ME7A 1TRSA 1G6YA 1BJXA 2HSHA 1G6WA 3GSTA 3KGKA 2ZCTA 4ECJA 3GKXA 4DSRA 1F9MA 4G9HA 3F3QA 1MEKA 1GNWA 3Q19A 2H19A 3DD3A 3EC3A 4GSTA 2AUVA 1GTIA 4MJBA 3KH9A 5J9CA 2JADA 1G7OA 2HLSA 3G7YA 2I9HA 3TDGA 3MIXA 1BQ7A 1A0FA 3VK9A 2MMZA 5DVBA 1M2BA 1K0MA 1RK4A 2LRNA 4I8BA 2IWTA 4D73A 2FA4A 5B8BA 2VLTA 1YY7A 1EP8A 2HZEA 1QQ2A 1ZGNA 2YWOA 6GSTA 4V2NA 3UVTA 2QA2A 3RAZA 2PVQA 3RPNA 1FOHA 1YKAA 4KAEA 5EL8A 2C8UA 4V1Ap 2GZZA 3MDKA 2E2MA 3P2AA 2EIOA 4K2XA 4AGSA 3R3EA 5JCWA 1O81A 1EEJA 2VL2A 2E7PA 2MYGA 1A2MA 1X9SB 3IOSA 2F8FA 3H4KA 4QL7A 4MLYA 2ON7A 3UL3A 3IC4A 2LUSA 4HQSA 2GZPA 4LLRA 4O5UA 3IAM2 1ZZYA 3U5RE 3LQ7A 2P0GA 3FYGA 2C0DA 4XHMA 5IPGA 2HI7A 5IMVA 3WGXA 3MAKA 2VOCA 1TI3A 1A23A 1K0AA 2C0GA 1E6BA 1UA5A 4I5QA 1W4VA 4G0KA 4BVYA 1GSSA 3ZYWA 5GSTA 2DMLA 1ZYEA 1B4PA 4XRAA 4ACSA 1V40A 1OC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL1 B;  2V6O A;  1SD8 A;  1EGR A;  4NWY A;  1GP1 A;  2H0H A;  3LOR A;  2VCX A;  1M2D A;  2OAC A;  4N30 A;  3LXT A;  3TJJ A;  3VUR A;  1YF1 A;  4ZBA A;  1KBN A;  2DLX A;  3EIN A;  3KJY A;  1RQM A;  3HZ4 A;  3FZ4 A;  1XWA A;  1Y6E A;  2H71 A;  3D6I A;  2VM1 A;  1Q98 A;  5F0G A;  3RHB A;  1VF3 A;  3MSZ A;  4IKH A;  3A5W A;  2LEG A;  3FR6 A;  1YEP A;  2PN8 A;  3WGE A;  4HI7 A;  2RM5 A;  2B6M A;  1K3Y A;  3C1R A;  1E2Y A;  2A2S A;  2OE1 A;  1ABA A;  4GQC A;  4IJI A;  4MZW A;  3NIV A;  1X5C A;  3ZMK A;  1OKD A;  4JR4 A;  4KX4 A;  1X5E A;  2H76 A;  1XXU A;  5LCZ A;  4YQU A;  1O6J A;  4N0V A;  3IXR A;  5DAK A;  2IMI A;  4DSS B;  5A5K A;  2MZC A;  3GFK A;  4TW5 A;  3GUS A;  3TOU A;  3KTL A;  3O6T A;  1WPI A;  1YKC A;  2WUL A;  3RDW A;  3ISO A;  1JLW A;  1LBK A;  2C4J A;  3HKR A;  4MPG A;  4GSN A;  3HDC A;  3A2V A;  1QK8 A;  3M1G A;  4IP1 A;  4DSS A;  1KEB A;  3HCZ A;  2IMK A;  3GNJ A;  1XFL A;  4YAV A;  6GSY A;  2L6C A;  2GLR A;  2DJ2 A;  1NHO A;  2FA8 A;  2YV7 A;  3ZRD A;  3TKS E;  5JWR B;  3LXZ A;  5B6N A;  3J7Y b;  4NPB A;  1USB A;  2O87 A;  4PUA A;  5G30 A;  1S3C A;  4IQ1 A;  3VWV A;  4OFT A;  1XVQ A;  2LTK A;  3Q74 A;  3QAW A;  2L4C A;  4NXI A;  4K0G A;  3F4T A;  5ECR B;  2EIR A;  3EMP A;  2CT6 A;  1RW1 A;  2LQQ A;  2JZS A;  2L5O A;  1TU8 A;  5CRD A;  5HR3 A;  1MD3 A;  3D22 A;  1SEN A;  2DMM A;  4WF5 A;  3VWU A;  1TP9 A;  9GSS A;  5D73 A;  4NHZ A;  4XS4 A;  3CSI A;  3RBT A;  2JU5 A;  1K0O A;  1GNE A;  2IFQ B;  5DDL A;  3WT1 A;  1XOB A;  4WF4 A;  3DYR A;  1FVK A;  4F03 A;  2LNS A;  4TR4 A;  4MCU A;  1G7E A;  3LJR A;  2ZNM A;  1M2A A;  4V2L A;  2CVB A;  4MH3 A;  4ZB6 A;  2KHP A;  5DBQ A;  2FWF A;  5H5Q A;  4F0B A;  2VLV A;  3HD5 A;  5DAL B;  2DJ0 A;  1EEM A;  3PR8 A;  4FYC A;  4AJ7 A;  1C72 A;  5IO0 A;  1U88 A;  3SWL A;  1NM3 A;  1JLV A;  3M9J A;  4KDU A;  3UOM A;  3ZLP A;  2Z9S A;  4MJC A;  2H73 A;  1OKT A;  4V2M A;  1PSQ A;  2IIY A;  4K8M A;  4OD7 A;  1K0B A;  3UMA A;  1TRW A;  3QCP A;  2B3S A;  3GTU A;  2E2G A;  5ID2 A;  5DQY A;  3J7Y k;  4K2D A;  4K7N A;  5IMZ A;  4RQX A;  2C3T A;  2YN1 A;  1T8E B;  3CYN A;  3GMF A;  4EXJ A;  1GSD A;  3VI7 A;  3GH6 A;  4IGJ A;  1TRV A;  3TKP A;  2K6V A;  4XTS A;  5HQP A;  1XPV A;  1OE7 A;  2E0Q A;  4MMM A;  4TOP A;  5ECK B;  3EU4 A;  2RLI A;  2KOK A;  1XOA A;  3VLN A;  5F07 A;  3A3T A;  5IPH A;  2P5R A;  2FGX A;  3GX0 A;  3HHV A;  3TJG A;  2VD1 A;  3ME8 A;  1EOG A;  4GQF A;  1SK2 A;  3F63 A;  3GUR A;  14GS A;  4K6X A;  1K0D A;  3TKS A;  3QPM A;  2RUF A;  3UBL A;  4TXO A;  2VCW A;  3G7I A;  2X99 A;  4MH2 A;  4BA7 A;  5KN2 A;  3C1S A;  2FWG A;  1HQO A;  3KIJ A;  5DQS A;  4JED A;  5FHI A;  2DJ1 A;  3VWW A;  1GUL A;  1JZW A;  2LRC A;  2XPD A;  1JZO A;  4IHU A;  5IMF A;  4AJ6 A;  4HOJ A;  4TRX A;  4I97 A;  5D96 A;  1EP7 A;  1AC1 A;  2RUE A;  1V9W A;  2I1U A;  4WR5 A;  4KSM A;  2C1Y A;  1EZK A;  1SU9 A;  2H1B A;  1FO5 A;  5IQY A;  1GLQ A;  2MMO A;  3EE2 A;  2QSI A;  4POK A;  4PNG A;  1Z6M A;  4KDY A;  4N11 A;  1WIK A;  6GSV A;  3W8J A;  2HSY A;  1JFU A;  2WRT A;  1AAZ A;  3E0U A;  4PQH A;  1WRY A;  2RM6 A;  2IPA A;  3M3M A;  2WDU A;  4PGT A;  1SKW B;  2LJK A;  4Q5Q A;  1XW5 A;  2K8S A;  1SJI A;  1AQX A;  1T1V A;  2KUC A;  3HYP A;  1A8L A;  2H6X A;  3TUE A;  3ZRE A;  2JL4 A;  1EOH A;  2HT9 A;  1THO A;  4MK3 A;  1U3I A;  2HE3 A;  3HVX A;  2C3Q A;  3F4R A;  3U6V A;  1GL8 A;  3F6D A;  2HFD A;  3F3R A;  5G1L A;  3GV1 A;  2CX4 A;  2HRF A;  2GT5 A;  2ON5 A;  2AB6 A;  4D73 B;  5D9W A;  3RPP A;  2HZE B;  1J0F A;  4HS1 A;  4F2I A;  4FIW A;  3M0F A;  4I6X A;  6GSU A;  4I2T A;  4K7I A;  2BMX A;  2FLS A;  3TCO A;  4HDE A;  2C80 A;  5F05 A;  8GSS A;  3ERF A;  4XRD A;  4ML6 A;  3HXS A;  2HRN A;  2CA8 A;  2OBI A;  2C0E A;  2PPT A;  4J56 E;  4Q5N A;  4MF6 A;  1B8X A;  1O8X A;  1OVN A;  4TXV A;  3PGT A;  4MA9 A;  1AQW A;  2H6Z A;  1S3D A;  2J23 A;  2YOI A;  1T4Z A;  1OC9 B;  4WXT A;  1R5P A;  5DCH A;  4FYU A;  4CDO A;  1T4Y A;  2YWM A;  11GS A;  2PMT A;  1T3B A;  4O5R A;  1TK8 B;  4ZIL A;  1F3B A;  5AIS A;  1N8J A;  4MJA A;  2D2Z A;  3GA4 A;  4E8H A;  4BVX A;  3APS A;  3KEB A;  4QQ7 A;  1OC9 A;  1NW2 A;  1PKW A;  3WGD A;  2M80 A;  1QUW A;  1A0R P;  5IM9 A;  4GRF A;  4TKY A;  3DVX A;  2CZ3 A;  2A2R A;  5JWQ B;  3I69 A;  1X9W B;  2M46 A;  3IE3 A;  4PQI A;  2OAD A;  4OO5 A;  3ZIV A;  2P5Q A;  4XS1 A;  3GSS A;  5ECP B;  3FZ5 A;  3BD2 A;  4KCE A;  4L5L A;  1HD2 A;  4WR4 A;  1GSQ A;  2IMF A;  1PX6 A;  4EE0 A;  3C8E A;  3DRN A;  1R4W A;  3IRA A;  3EYT A;  2F8A A;  2JSY A;  4X43 A;  3SBC A;  3D0Z A;  5H5S A;  4RI6 A;  1NHY A;  2NTO A;  1YJ6 A;  1MDK A;  1Z7P A;  2O85 A;  1BYE A;  1TW9 A;  1I9D A;  5FT3 A;  5DJL A;  2L57 A;  3HY2 A;  5COH A;  1HYU A;  3DXB A;  3MNG A;  2LST A;  1O8W A;  2R3X A;  3CMI A;  2G2Q A;  1Y25 A;  1XWK A;  4JZQ A;  1K0N A;  3HJO A;  3QOU A;  2AHE A;  5DAK B;  4ECC A;  3AY8 A;  4OFN A;  1G0T A;  5IMD A;  2B1L A;  4F9Z A;  3BCI A;  2MBS A;  1SJZ A;  3I43 A;  1Z9H A;  5CRE A;  3GIX A;  3QMX A;  5HR1 A;  4LL4 B;  1TXX A;  1V2A A;  4RQR A;  5H5R A;  4RUV A;  5IMC A;  1I5G A;  3MWH A;  1TI1 A;  1GRX A;  1W89 A;  1GUH A;  2VM2 A;  3CSH A;  1TJD A;  2LS5 A;  5E59 A;  3ED3 A;  1XW6 A;  1PRX A;  3JCM L;  4JR6 A;  1XVW A;  2GZY A;  4ZIJ A;  2R6K A;  2QC7 A;  2REM A;  5ECL B;  2PUK C;  5HR2 A;  4FH8 A;  1XCC A;  1CQH A;  5KEJ A;  3TKQ A;  3TKR A;  4TR0 A;  5GZZ B;  1UC7 A;  3QFB C;  4O32 A;  5CP1 A;  4HUA A;  1YDK A;  5ECN B;  2DJJ A;  1SKR B;  1IYH A;  2WFC A;  4NV2 A;  2FNO A;  4ILF A;  1URM A;  5HFK A;  4EDZ A;  5J5N A;  1XBS A;  1IYI A;  4XS4 B;  5AGY A;  2CAI A;  3IPZ A;  4EL1 A;  3GYK A;  4L5O A;  19GS A;  4X1U A;  2GDR A;  4PNF A;  2KP2 A;  2FHE A;  1FHE A;  1FAA A;  1WJK A;  2N5F A;  5L71 A;  3HA9 A;  4YQM A;  4K7O A;  4ISD A;  1T00 A;  20GS A;  3CTF A;  3LEF A;  2JAC A;  2CV4 A;  1SYX A;  2H70 A;  1YEX A;  2ES7 A;  2YPM A;  2VCZ A;  3I9V 2;  1H75 A;  1V57 A;  1BAY A;  4OCE A;  5IO2 A;  3CRU A;  1SYR A;  1ERU A;  1PGT A;  2PWJ A;  2R37 A;  1YQ1 A;  4OCF A;  2TRC P;  4PUF C;  2YJ7 A;  1ZOF A;  2VIM A;  3ZL5 A;  1VGL A;  3VWX A;  3F6F A;  3HJP A;  1FW1 A;  2B5E A;  3FY7 A;  1OE8 A;  4CHS A;  2HYX A;  4GWR A;  4Z7X A;  4L0W A;  3KD0 A;  6GSW A;  1TK0 B;  1B4Q A;  3EUR A;  4EUY A;  4MZB A;  3IK9 A;  4HEA 2;  5C04 A;  5AIX A;  2EIQ A;  1XWC A;  4KCA A;  1MDI A;  3BJ5 A;  3GKN A;  4XCS A;  3GTU B;  2FWH A;  5ID2 B;  1KNG A;  1GTA A;  6GSS A;  3O76 A;  4FYB A;  2X8C A;  3UEM A;  2O8V B;  4IP6 A;  1U87 A;  4HZ2 A;  4WKW A;  3LGC A;  1ST9 A;  4DVC A;  4F0C A;  4GSS A;  2AAW A;  3TGZ A;  4KE3 A;  2GQL A;  2YWN A;  2N5B A;  4DSQ A;  4F82 A;  1DE2 A;  2YJH A;  4MF7 A;  3L4N A;  1XIY A;  3QDN A;  2LNT A;  5GAN D;  1VRS D;  2M72 A;  1ILO A;  4MP4 A;  5F8B A;  3LFL A;  1PKZ A;  1SL0 B;  2K9F A;  4J2F A;  3NZN A;  3WT2 A;  1AUC A;  3KCM A;  2X8H A;  2JSZ A;  2OBK A;  1HNB A;  1JZD A;  2WB9 A;  2WJU A;  5CAX A;  3C7M A;  2FCH A;  1TKD B;  3EMX A;  4HU9 A;  2TRX A;  2B7K A;  2X64 A;  1B9X C;  2R2J A;  4TXO B;  3C71 A;  3H79 A;  4IS0 A;  3TJK A;  2B5Y A;  2NPB A;  2YNX A;  3LSZ A;  4KDX A;  1WE0 A;  3ZVJ A;  1MDJ A;  2H66 A;  5CO3 A;  1S3A A;  2GSR A;  2QKE A;  1GUK A;  4YQV A;  2H0G A;  4MF5 A;  3IAS 2;  4V1A g;  1YZX A;  2DC5 A;  2I3Y A;  3GRX A;  5G5F A;  2LQO A;  4I2U A;  3DIE A;  1PL2 A;  3TRX A;  3M9K A;  3A2X A;  1WWJ A;  2JZR A;  4HZ4 A;  2QGV A;  3N9J A;  1BG5 A;  3FR3 A;  2H75 A;  4L8E A;  4J57 E;  3KZQ A;  4EC0 A;  5A4V A;  3CSJ A;  2V1M A;  3QFA C;  1AQV A;  1KTE A;  2F9S A;  5ELG A;  1OYJ A;  2DIZ A;  3VI5 A;  5ELA A;  1K0C A;  2VLU A;  2X8G A;  5HFI A;  1TDI A;  1QFN A;  1AW9 A;  5KN3 A;  1R26 A;  3QAG A;  1F3A A;  3HJM A;  2B7J A;  2BTO T;  2ZUP A;  1TRU A;  4ECB A;  4GF0 A;  4EVM A;  2WCI A;  3FR9 A;  3TRP A;  2EC4 A;  3GX8 A;  4BWQ A;  1TOF A;  3DEX A;  5IOW A;  2LJA A;  1OC8 A;  1LU4 A;  3APQ A;  1O7U A;  3ZTL A;  5G1K A;  1V58 A;  10GS A;  3HVV A;  1TU7 A;  3N5O A;  4PQ1 A;  4QL9 A;  4O7H A;  2VAF A;  4K1F A;  1M7T A;  3H1N A;  3FKF A;  5KN1 A;  2B1K A;  2CQ9 A;  3QAV A;  2R4V A;  1PL1 A;  4TR1 A;  2XBQ A;  3KMO A;  4KND A;  2NBS A;  1CQG A;  2MMA A;  4IEL A;  3TB2 A;  1JZR A;  2H1G A;  3L9V A;  2VCV A;  2VCQ A;  3L78 A;  3QD9 A;  2DJ3 A;  4LMW A;  4ZB8 A;  5E4W A;  5INY A;  1GSE A;  3D4M A;  5LNK e;  1ERT A;  4LL1 B;  4OFM A;  3US3 A;  1ON4 A;  2OKA A;  1UVZ A;  1YF0 A;  3V1W A;  4JRR A;  3W8S A;  2L4Q A;  1PN9 A;  2R5G A;  1U6T A;  2FWE A;  5AIV A;  1BED A;  3GL3 A;  2PER A;  4EO3 A;  1WP0 A;  3TOT A;  3CTG A;  7GSS A;  18GS A;  5D9T A;  1FG4 A;  4JU5 A;  3O3T A;  4WBJ A;  5J9B A;  3EWL A;  2GGT A;  1EGO A;  1FB0 A;  1DE1 A;  3TRQ A;  2DJK A;  3DWV A;  5J41 A;  1OAZ A;  1EV4 A;  2IMD A;  3UIW A;  5CNW A;  2LV3 A;  5ABR A;  2GQM A;  3EU3 A;  2LRT A;  4WEY A;  4KA0 A;  1EV9 A;  2H1D A;  1V98 A;  1XW9 A;  2GS3 A;  1AIU A;  1SKS B;  2GVP A;  1ZL9 A;  3HZ8 A;  3KM6 A;  3L9U A;  3Q6O A;  2I81 A;  4JE1 A;  1Q4J A;  2MMN A;  1Z7R A;  4KSO A;  3GHA A;  4PX1 A;  4MZC A;  1ZYQ B;  3KH7 A;  4E8E A;  4IW9 A;  2HZF A;  5EVO A;  17GS A;  4MJE A;  4POM A;  3DML A;  3QR6 A;  3CBU A;  3FEU A;  2VL2 C;  3D4T A;  3F8U A;  3ZIJ A;  1PX7 A;  1M0U A;  4GCI A;  5ECI B;  4NHW A;  4TVE A;  2H74 A;  5CRW A;  2KP1 A;  4ML1 A;  4OMV A;  2P31 A;  3W6G A;  2OA7 A;  5ECM B;  5JCG A;  1XWG A;  3EVI A;  5J4U A;  3FK8 A;  4Q5R A;  4TN8 A;  2VUP A;  1TTZ A;  1QXH A;  1PMT A;  4ZL9 A;  1A24 A;  2NVL A;  2LJR A;  4XS6 A;  1WOU A;  1MTC A;  6GSX A;  4NAX A;  1PD2 1;  1WMJ A;  5ECQ B;  1UN2 A;  3ERG A;  5ECH B;  1VF1 A;  1GTB A;  2CVK A;  2H8L A;  1FB6 A;  4GLT A;  2RII A;  4OO4 A;  2O89 A;  5B8A A;  1M9A A;  2V32 A;  4KH7 A;  2L5L A;  1F37 A;  2HNL A;  1X0R A;  4H86 A;  2TIR A;  5IMA A;  5CYY A;  3UAR A;  2C3N A;  3IR4 A;  3P90 A;  1EWX A;  2ALB A;  3GH9 A;  3E3E A;  2PBJ A;  3UVH A;  3ZFB A;  2F3M A;  3IDV A;  5DJM A;  3GL5 A;  5D9X A;  2DIY A;  4MDC A;  1QGV A;  5G5E A;  1ACV A;  3IV4 A;  2I4A A;  4POB A;  1X9M B;  1A8Y A;  3L0H A;  5IIZ A;  4OWY A;  1Z5Y E;  3IA1 A;  2YWI A;  5JCU A;  2JZT A;  2WZ9 A;  3IBH A;  2CX3 A;  3HVS A;  3F4S A;  1SK1 A;  1SJ6 A;  4NMU A;  3ZZX A;  2C0F A;  3GN3 A;  3FZ9 A;  3M8N A;  5IOX A;  2YZU A;  1R7H A;  5J3R A;  3BOA A;  3UBK A;  1SK0 A;  2XBI A;  5EY6 A;  1XWB A;  1T7P B;  1GSU A;  1THX A;  5ENU A;  2XC2 A;  3D21 A;  3H8Q A;  3DKS A;  3UJ1 A;  1M99 A;  2H72 A;  1M9B A;  4YH2 A;  3IK7 A;  3RHC A;  3VFI A;  1X5D A;  3KP9 A;  4HJM A;  1XZO A;  4KGI A;  1GSY A;  3K8N A;  2PGT A;  3FHK A;  4NV5 A;  1O73 A;  4MPF A;  5CRG A;  4ZL7 A;  2GTU A;  3PIN A;  2MBT A;  4GXZ A;  4HJ2 A;  5HR0 A;  2H6Y A;  3ZVJ D;  1ZCP A;  2L59 A;  4ID0 A;  4AJ8 A;  3LG6 A;  2NDO A;  1J08 A;  1ZMA A;  1B48 A;  4IQA A;  4X0X A;  1K3L A;  3G9B A;  1TK5 B;  1ERV A;  3BCK A;  4YAP A;  1MD4 A;  1Z3E A;  4FO5 A;  1LJR A;  3KP8 A;  5A4W A;  2IJY A;  2V41 A;  5LD0 A;  4K9Z A;  1F2E A;  2YAN A;  2AYT A;  5B6M A;  2XHF A;  1PQN A;  2VL3 A;  4IVF A;  2WGR A;  2H01 A;  5ECS A;  2K18 A;  2OE3 A;  3FRC A;  1B9Y C;  1GLP A;  2V2G A;  3APO A;  4BWS A;  3G7J A;  4LMV A;  4XIH A;  3D5J A;  1U3A A;  5CRH A;  3P8W A;  1AXD A;  2H30 A;  2IN3 A;  2PU9 C;  3CXG A;  5B7C A;  2DBC A;  4BL7 A;  3WD6 A;  4IBP A;  13GS A;  4G10 A;  16GS A;  4POL A;  5C00 A;  2IFQ A;  2CVD A;  5GAP D;  4ULX A;  4IN0 A;  3F0I A;  2G0F A;  1GSF A;  2B5X A;  12GS A;  5JWO B;  5EPF A;  5F06 A;  4GTU A;  2PVO C;  4EF0 A;  5DCG A;  1GH2 A;  2VO4 A;  1Z6N A;  1J9B A;  2AV4 A;  5DAL A;  1A2L A;  2FY6 A;  3VPT A;  3GKM A;  1GTU A;  1GUM A;  4EKZ A;  2N5A A;  2AJQ B;  3NOF A;  4G19 A;  1O85 A;  1FVJ A;  4RI7 A;  2OE0 A;  4HQZ A;  3LYP A;  5D8I A;  4O92 A;  3L9S A;  2HXK A;  1JHB A;  2YZH A;  5ECO B;  3TJB A;  1ERW A;  1SD9 A;  4DEJ A;  3CRT A;  2WS2 A;  4PUR A;  2BJX A;  2IME A;  5FWG A;  2CAQ A;  1DSB A;  4N0Z A;  4ZL8 A;  3VPQ A;  5GSS A;  3Q18 A;  1VF4 A;  2VL9 A;  3UAP A;  4LA1 A;  4N10 A;  2H1A A;  3BBY A;  2CZ2 A;  4KW6 A;  3C73 A;  3PH9 A;  2YP6 A;  1HNC A;  2YV9 A;  2OJL A;  3I6A A;  4BPY A;  5G2Z A;  2K8V A;  1H4O A;  2H0I A;  3S9F A;  1ML6 A;  2FD3 A;  4Q5F A;  3H93 A;  3WYW A;  3ZFL A;  4KUN A;  3FW2 A;  4ZBB A;  3ZML A;  2FUG 2;  3OR5 A;  4K0N A;  3R2Q A;  4AF2 A;  4EDY A;  2A4V A;  2DSA A;  4KB3 A;  2GST A;  5A4U A;  3GKK A;  3KXO A;  3TKS C;  3ZIT A;  4L0U A;  4G2E A;  3A2W A;  2YCD A;  4TR1 B;  4TR3 A;  1N2A A;  5AN1 A;  3ERW A;  4ZXG A;  2GT6 A;  3LWA A;  1A2J A;  1F6M C;  3IHQ A;  4P3Y B;  3DGQ A;  3KMN A;  1BX9 A;  4JBB A;  2LKU A;  2KLX A;  3DVW A;  4ZBD A;  1DUG A;  4CW9 A;  2F51 A;  3TJF A;  4ECI A;  1HNA A;  2O7K A;  5KN0 A;  1PA3 A;  2V6K A;  4WBR D;  1K3O A;  2XPE A;  1VF2 A;  3LYK A;  1GWC A;  4MAB A;  1NSW A;  5D93 A;  3E9J B;  5HFG A;  1SL2 B;  2IL3 A;  22GS A;  2L6D A;  4WET A;  1R5A A;  3FZA A;  4PXO A;  2J9H A;  3F9U A;  2GQK A;  4IJ3 A;  2GSQ A;  4ZB9 A;  3P7X A;  1QMV A;  2GSS A;  5D9V A;  2VD0 A;  1DBY A;  1FOV A;  5G31 A;  2VCT A;  3KTB A;  4HU7 A;  3ME7 A;  1TRS A;  1G6Y A;  1BJX A;  2HSH A;  1G6W A;  3GST A;  3KGK A;  2ZCT A;  4ECJ A;  3GKX A;  4DSR A;  1F9M A;  4G9H A;  3F3Q A;  1MEK A;  1GNW A;  3Q19 A;  2H19 A;  3DD3 A;  3EC3 A;  4GST A;  2AUV A;  1GTI A;  4MJB A;  3KH9 A;  5J9C A;  2JAD A;  1G7O A;  2HLS A;  3G7Y A;  2I9H A;  3TDG A;  1BQ7 A;  1A0F A;  3VK9 A;  2MMZ A;  5DVB A;  1M2B A;  1K0M A;  1RK4 A;  2LRN A;  4I8B A;  2IWT A;  4D73 A;  2FA4 A;  5B8B A;  2VLT A;  1YY7 A;  1EP8 A;  2HZE A;  1QQ2 A;  1ZGN A;  2YWO A;  6GST A;  4V2N A;  3UVT A;  3RAZ A;  2PVQ A;  3RPN A;  1YKA A;  4KAE A;  5EL8 A;  2C8U A;  4V1A p;  2GZZ A;  3MDK A;  2E2M A;  3P2A A;  2EIO A;  4AGS A;  5JCW A;  1O81 A;  1EEJ A;  2VL2 A;  2E7P A;  2MYG A;  1A2M A;  1X9S B;  3IOS A;  2F8F A;  3H4K A;  4QL7 A;  4MLY A;  2ON7 A;  3UL3 A;  3IC4 A;  2LUS A;  4HQS A;  2GZP A;  4LLR A;  3IAM 2;  1ZZY A;  3U5R E;  3LQ7 A;  2P0G A;  3FYG A;  2C0D A;  4XHM A;  5IPG A;  2HI7 A;  5IMV A;  3WGX A;  3MAK A;  2VOC A;  1TI3 A;  1A23 A;  1K0A A;  2C0G A;  1E6B A;  1UA5 A;  4I5Q A;  1W4V A;  4BVY A;  1GSS A;  3ZYW A;  5GST A;  2DML A;  1ZYE A;  1B4P A;  4XRA A;  4ACS A;  1V40 A;  1OC3 A; 
#chains in the Genus database with same CATH topology
 1SL1 B;  2V6O A;  1SD8 A;  1EGR A;  4NWY A;  1GP1 A;  2H0H A;  3LOR A;  1S3R A;  2VCX A;  1M2D A;  2OAC A;  4N30 A;  3LXT A;  2R0G A;  3TJJ A;  3VUR A;  1YF1 A;  4ZBA A;  1KBN A;  2DLX A;  3EIN A;  3KJY A;  1RQM A;  3HZ4 A;  3FZ4 A;  1XWA A;  1Y6E A;  2H71 A;  3D6I A;  2VM1 A;  1Q98 A;  5F0G A;  3RHB A;  1VF3 A;  3MSZ A;  4IKH A;  3A5W A;  2LEG A;  3FR6 A;  1YEP A;  2PN8 A;  3WGE A;  4HI7 A;  2RM5 A;  2B6M A;  1K3Y A;  3C1R A;  1E2Y A;  2A2S A;  2OE1 A;  1ABA A;  4GQC A;  4IJI A;  4MZW A;  3NIV A;  1X5C A;  3ZMK A;  1OKD A;  4JR4 A;  4KX4 A;  1X5E A;  2H76 A;  1XXU A;  5LCZ A;  4YQU A;  1O6J A;  4N0V A;  3IXR A;  5DAK A;  2IMI A;  4DSS B;  5A5K A;  2MZC A;  2HRA A;  3GFK A;  4TW5 A;  3GUS A;  3TOU A;  3KTL A;  3O6T A;  1WPI A;  2DKI A;  1YKC A;  2WUL A;  3RDW A;  3ISO A;  1JLW A;  1LBK A;  2C4J A;  3HKR A;  4FQU A;  4MPG A;  4GSN A;  3HDC A;  3A2V A;  1QK8 A;  3M1G A;  4IP1 A;  4DSS A;  1KEB A;  3HCZ A;  2IMK A;  3GNJ A;  1XFL A;  4YAV A;  6GSY A;  2L6C A;  2GLR A;  2DJ2 A;  1NHO A;  2FA8 A;  2YV7 A;  3ZRD A;  3TKS E;  5JWR B;  4Z2U A;  3LXZ A;  5B6N A;  3J7Y b;  4NPB A;  1USB A;  2O87 A;  4PUA A;  5G30 A;  1S3C A;  4IQ1 A;  3VWV A;  4OFT A;  1XVQ A;  2LTK A;  4Z2R A;  3Q74 A;  3QAW A;  2L4C A;  4NXI A;  4K0G A;  3F4T A;  5ECR B;  2EIR A;  3EMP A;  2CT6 A;  1RW1 A;  2LQQ A;  2JZS A;  2L5O A;  1TU8 A;  5CRD A;  5HR3 A;  1MD3 A;  3D22 A;  1SEN A;  2DMM A;  4WF5 A;  3VWU A;  4BL7 B;  1TP9 A;  9GSS A;  5D73 A;  4NHZ A;  4XS4 A;  3CSI A;  3RBT A;  2JU5 A;  1K0O A;  2A2P A;  2A4H A;  1GNE A;  2IFQ B;  5DDL A;  3WT1 A;  1XOB A;  4WF4 A;  4YKF A;  4Z2T A;  3DYR A;  1FVK A;  4F03 A;  2LNS A;  4TR4 A;  4MCU A;  1G7E A;  3LJR A;  2ZNM A;  1M2A A;  4V2L A;  2CVB A;  4MH3 A;  4ZB6 A;  2KHP A;  5DBQ A;  2FWF A;  5H5Q A;  4F0B A;  2VLV A;  3HD5 A;  5DAL B;  2DJ0 A;  1EEM A;  3PR8 A;  4FYC A;  4AJ7 A;  1C72 A;  5IO0 A;  1U88 A;  3SWL A;  1NM3 A;  1JLV A;  3M9J A;  4KDU A;  3UOM A;  3ZLP A;  2Z9S A;  4MJC A;  2H73 A;  1OKT A;  4V2M A;  1PSQ A;  2IIY A;  4K8M A;  4OD7 A;  1K0B A;  3UMA A;  1TRW A;  3QCP A;  2B3S A;  3GTU A;  2E2G A;  5ID2 A;  5DQY A;  3J7Y k;  4K2D A;  4K7N A;  5IMZ A;  4RQX A;  2C3T A;  2YN1 A;  1T8E B;  3CYN A;  3GMF A;  4EXJ A;  1GSD A;  3VI7 A;  3GH6 A;  4IGJ A;  1TRV A;  4USS A;  3TKP A;  2K6V A;  4XTS A;  5HQP A;  1XPV A;  1OE7 A;  2E0Q A;  4MMM A;  4TOP A;  5ECK B;  3EU4 A;  2RLI A;  2KOK A;  1XOA A;  3VLN A;  5F07 A;  3A3T A;  5IPH A;  2P5R A;  2FGX A;  3GX0 A;  3HHV A;  3TJG A;  2VD1 A;  3ME8 A;  1EOG A;  4GQF A;  1SK2 A;  3F63 A;  3GUR A;  14GS A;  4K6X A;  1K0D A;  3TKS A;  3QPM A;  2RUF A;  3UBL A;  4TXO A;  2VCW A;  3G7I A;  2X99 A;  4MH2 A;  4BA7 A;  5KN2 A;  3C1S A;  2FWG A;  1HQO A;  3KIJ A;  5DQS A;  4JED A;  5FHI A;  2DJ1 A;  3VWW A;  1GUL A;  1JZW A;  2LRC A;  2XPD A;  1JZO A;  4IHU A;  5IMF A;  4AJ6 A;  4HOJ A;  4TRX A;  4I97 A;  5D96 A;  1EP7 A;  1AC1 A;  2RUE A;  1V9W A;  2I1U A;  3A5I A;  4WR5 A;  4KSM A;  2C1Y A;  1EZK A;  1SU9 A;  2H1B A;  1FO5 A;  5IQY A;  1GLQ A;  2MMO A;  3EE2 A;  2QSI A;  4POK A;  4PNG A;  1Z6M A;  3IC8 A;  4KDY A;  4N11 A;  1WIK A;  6GSV A;  3W8J A;  2HSY A;  1JFU A;  2WRT A;  1AAZ A;  3E0U A;  4PQH A;  1WRY A;  2RM6 A;  2IPA A;  3M3M A;  2WDU A;  4PGT A;  1SKW B;  4CY6 A;  2LJK A;  4Q5Q A;  1XW5 A;  2K8S A;  1SJI A;  1AQX A;  1T1V A;  2R0P A;  2KUC A;  3HYP A;  1A8L A;  2H6X A;  3TUE A;  3ZRE A;  2JL4 A;  2X49 A;  1EOH A;  2HT9 A;  1THO A;  4MK3 A;  1U3I A;  2HE3 A;  3HVX A;  2C3Q A;  3F4R A;  3U6V A;  3LW9 A;  1GL8 A;  3F6D A;  2HFD A;  3F3R A;  5G1L A;  3GV1 A;  2CX4 A;  2HRF A;  2GT5 A;  2ON5 A;  4G0I A;  2AB6 A;  4D73 B;  5D9W A;  3RPP A;  2HZE B;  1J0F A;  4HS1 A;  4F2I A;  5BRT A;  4FIW A;  3M0F A;  4I6X A;  6GSU A;  4I2T A;  4K7I A;  2BMX A;  2FLS A;  3TCO A;  4HDE A;  2C80 A;  5F05 A;  8GSS A;  3ERF A;  4XRD A;  4ML6 A;  3HXS A;  2HRN A;  2CA8 A;  2OBI A;  2C0E A;  2PPT A;  4J56 E;  4Q5N A;  4MF6 A;  1B8X A;  1O8X A;  1OVN A;  4TXV A;  3PGT A;  4MA9 A;  1AQW A;  2H6Z A;  1S3D A;  2J23 A;  2YOI A;  1T4Z A;  1OC9 B;  4WXT A;  1R5P A;  5DCH A;  4FYU A;  4CDO A;  1T4Y A;  2YWM A;  11GS A;  2PMT A;  1T3B A;  4O5R A;  1TK8 B;  4ZIL A;  1F3B A;  5AIS A;  1N8J A;  4MJA A;  2D2Z A;  3GA4 A;  4E8H A;  4BVX A;  3APS A;  3KEB A;  4QQ7 A;  1OC9 A;  1NW2 A;  1PKW A;  4BVY B;  3WGD A;  2M80 A;  1QUW A;  1A0R P;  5IM9 A;  4GRF A;  4TKY A;  3DVX A;  2CZ3 A;  2A2R A;  5JWQ B;  3I69 A;  1X9W B;  2M46 A;  3IE3 A;  4PQI A;  2OAD A;  4OO5 A;  3ZIV A;  2P5Q A;  4XS1 A;  3GSS A;  5ECP B;  3FZ5 A;  3BD2 A;  4KCE A;  4L5L A;  1HD2 A;  4WR4 A;  1GSQ A;  2IMF A;  1PX6 A;  4EE0 A;  3C8E A;  3DRN A;  1R4W A;  4CY8 A;  3IRA A;  3EYT A;  2F8A A;  2JSY A;  4X43 A;  3SBC A;  3D0Z A;  5H5S A;  4RI6 A;  4K5S A;  1NHY A;  2NTO A;  1YJ6 A;  1MDK A;  4EIP A;  1Z7P A;  2O85 A;  1BYE A;  1TW9 A;  1I9D A;  5FT3 A;  5DJL A;  2X4A A;  2L57 A;  3HY2 A;  5COH A;  1HYU A;  2UZ8 A;  3DXB A;  3MNG A;  2LST A;  1O8W A;  2R3X A;  3CMI A;  2G2Q A;  1Y25 A;  1XWK A;  4JZQ A;  1K0N A;  3HJO A;  3QOU A;  2AHE A;  5DAK B;  4ECC A;  3AY8 A;  4OFN A;  1G0T A;  5IMD A;  2B1L A;  4F9Z A;  3BCI A;  2MBS A;  1SJZ A;  3I43 A;  1Z9H A;  5CRE A;  3GIX A;  3QMX A;  5HR1 A;  4LL4 B;  1TXX A;  1V2A A;  4RQR A;  5H5R A;  4RUV A;  5IMC A;  1I5G A;  3MWH A;  1TI1 A;  1GRX A;  1W89 A;  1GUH A;  2VM2 A;  3CSH A;  1TJD A;  2LS5 A;  5E59 A;  3ED3 A;  1XW6 A;  1PRX A;  3JCM L;  4JR6 A;  1XVW A;  2GZY A;  4ZIJ A;  2R6K A;  2QC7 A;  2REM A;  5ECL B;  2PUK C;  5HR2 A;  4FH8 A;  1XCC A;  1CQH A;  5KEJ A;  3TKQ A;  3TKR A;  4TR0 A;  5GZZ B;  1UC7 A;  3QFB C;  4O32 A;  5CP1 A;  4HUA A;  1YDK A;  5ECN B;  2DJJ A;  1SKR B;  1IYH A;  2WFC A;  4NV2 A;  2FNO A;  4ILF A;  1URM A;  4MNN A;  5HFK A;  4EDZ A;  5J5N A;  1XBS A;  1IYI A;  4XS4 B;  5AGY A;  2CAI A;  3IPZ A;  4EL1 A;  3GYK A;  4L5O A;  19GS A;  4X1U A;  2GDR A;  4PNF A;  2KP2 A;  2FHE A;  1FHE A;  1FAA A;  1WJK A;  2N5F A;  5L71 A;  3HA9 A;  4YQM A;  4K7O A;  4ISD A;  1T00 A;  20GS A;  3CTF A;  3LEF A;  2JAC A;  2CV4 A;  1SYX A;  2H70 A;  1YEX A;  2ES7 A;  2YPM A;  2VCZ A;  3I9V 2;  1H75 A;  1V57 A;  1BAY A;  5BMU A;  4OCE A;  5IO2 A;  3CRU A;  1SYR A;  1ERU A;  1PGT A;  2PWJ A;  2R37 A;  1YQ1 A;  4OCF A;  2TRC P;  4PUF C;  2YJ7 A;  1ZOF A;  2VIM A;  3ZL5 A;  1VGL A;  3VWX A;  3F6F A;  3HJP A;  1FW1 A;  2B5E A;  3FY7 A;  1OE8 A;  4CHS A;  2HYX A;  4GWR A;  4Z7X A;  4L0W A;  3KD0 A;  6GSW A;  5KOX A;  1TK0 B;  1B4Q A;  3EUR A;  4EUY A;  4MZB A;  3IK9 A;  4HEA 2;  5C04 A;  5AIX A;  2EIQ A;  1XWC A;  4KCA A;  1MDI A;  3BJ5 A;  3GKN A;  4XCS A;  3GTU B;  2FWH A;  5ID2 B;  1KNG A;  3EPT A;  1GTA A;  6GSS A;  3O76 A;  4FYB A;  2X8C A;  3UEM A;  2O8V B;  4IP6 A;  1U87 A;  4HZ2 A;  4WKW A;  3LGC A;  2DKH A;  1ST9 A;  4DVC A;  4F0C A;  4GSS A;  2AAW A;  3TGZ A;  4KE3 A;  2GQL A;  2YWN A;  2N5B A;  4ICY A;  4DSQ A;  4F82 A;  1DE2 A;  2YJH A;  4MF7 A;  3L4N A;  1XIY A;  3QDN A;  2LNT A;  5GAN D;  1VRS D;  2M72 A;  1ILO A;  4MP4 A;  5F8B A;  3LFL A;  1PKZ A;  1SL0 B;  2K9F A;  4J2F A;  3NZN A;  3WT2 A;  1AUC A;  3KCM A;  4A5P A;  2X8H A;  2JSZ A;  2OBK A;  1HNB A;  1JZD A;  2WB9 A;  2WJU A;  5CAX A;  3C7M A;  2FCH A;  1TKD B;  3EMX A;  4HU9 A;  2TRX A;  2B7K A;  2X64 A;  1B9X C;  2R2J A;  4TXO B;  3C71 A;  3H79 A;  4IS0 A;  3TJK A;  2B5Y A;  2NPB A;  2YNX A;  3LSZ A;  4KDX A;  1WE0 A;  3ZVJ A;  1MDJ A;  2H66 A;  5CO3 A;  1S3A A;  2GSR A;  2QKE A;  1GUK A;  4YQV A;  2H0G A;  4MF5 A;  3IAS 2;  4V1A g;  1YZX A;  2DC5 A;  2I3Y A;  3GRX A;  5G5F A;  2LQO A;  4I2U A;  3DIE A;  1PL2 A;  3TRX A;  3M9K A;  3A2X A;  1WWJ A;  2JZR A;  4HZ4 A;  2QGV A;  3N9J A;  1BG5 A;  3FR3 A;  2H75 A;  4L8E A;  4J57 E;  3KZQ A;  4EC0 A;  5A4V A;  3CSJ A;  2V1M A;  3QFA C;  1AQV A;  1KTE A;  2F9S A;  4X4J A;  5ELG A;  1OYJ A;  2DIZ A;  3VI5 A;  5ELA A;  1K0C A;  2VLU A;  2X8G A;  5HFI A;  1TDI A;  1QFN A;  1AW9 A;  5KN3 A;  1R26 A;  3QAG A;  1F3A A;  3HJM A;  2B7J A;  2BTO T;  2ZUP A;  1TRU A;  4ECB A;  4GF0 A;  4EVM A;  2WCI A;  3FR9 A;  3TRP A;  2EC4 A;  3GX8 A;  4BWQ A;  1TOF A;  3DEX A;  3PPU A;  5IOW A;  2LJA A;  1OC8 A;  1LU4 A;  3APQ A;  1O7U A;  3ZTL A;  5G1K A;  1V58 A;  10GS A;  3HVV A;  1TU7 A;  3N5O A;  4PQ1 A;  4QL9 A;  4O7H A;  2VAF A;  4K1F A;  1M7T A;  3H1N A;  3FKF A;  5KN1 A;  2B1K A;  2CQ9 A;  4G0L A;  3QAV A;  2R4V A;  1PL1 A;  4TR1 A;  2XBQ A;  3KMO A;  4KND A;  2NBS A;  1CQG A;  2MMA A;  4IEL A;  3TB2 A;  1JZR A;  2H1G A;  3L9V A;  2VCV A;  2VCQ A;  3L78 A;  3QD9 A;  2DJ3 A;  4LMW A;  4ZB8 A;  5E4W A;  3IHG A;  5INY A;  1GSE A;  3D4M A;  5LNK e;  1ERT A;  4LL1 B;  4OFM A;  2HSM A;  3US3 A;  3FMW A;  1ON4 A;  2OKA A;  1UVZ A;  1YF0 A;  3V1W A;  4JRR A;  3W8S A;  2L4Q A;  1PN9 A;  2R5G A;  1U6T A;  2FWE A;  5AIV A;  1BED A;  3GL3 A;  2PER A;  4EO3 A;  1WP0 A;  3TOT A;  3CTG A;  7GSS A;  18GS A;  5D9T A;  1FG4 A;  4JU5 A;  3O3T A;  1PN0 A;  4WBJ A;  4BVX B;  5J9B A;  4K5R A;  3EWL A;  2GGT A;  1EGO A;  1FB0 A;  1DE1 A;  3TRQ A;  2DJK A;  3DWV A;  5J41 A;  3MYD A;  1OAZ A;  1EV4 A;  1XG8 A;  2IMD A;  3UIW A;  5CNW A;  2LV3 A;  5ABR A;  2GQM A;  3EU3 A;  2LRT A;  4WEY A;  4KA0 A;  1EV9 A;  2H1D A;  1V98 A;  1XW9 A;  2GS3 A;  1AIU A;  1SKS B;  2GVP A;  1ZL9 A;  3HZ8 A;  3KM6 A;  3L9U A;  3Q6O A;  2I81 A;  4JE1 A;  1Q4J A;  2MMN A;  3HVN A;  1Z7R A;  4KSO A;  3GHA A;  4PX1 A;  4MZC A;  1ZYQ B;  3KH7 A;  4E8E A;  4IW9 A;  2HZF A;  5EVO A;  17GS A;  4MJE A;  4POM A;  3DML A;  3QR6 A;  3CBU A;  3FEU A;  2VL2 C;  3D4T A;  3F8U A;  3ZIJ A;  1PX7 A;  1M0U A;  4GCI A;  5ECI B;  4NHW A;  4TVE A;  2H74 A;  5CRW A;  2KP1 A;  4ML1 A;  4OMV A;  2P31 A;  3W6G A;  2OA7 A;  5ECM B;  5JCG A;  1XWG A;  3EVI A;  4HSC X;  5J4U A;  3FK8 A;  4Q5R A;  4TN8 A;  2VUP A;  1TTZ A;  1QXH A;  1PMT A;  4ZL9 A;  1A24 A;  2NVL A;  2LJR A;  4XS6 A;  1WOU A;  1MTC A;  6GSX A;  4NAX A;  1PD2 1;  1WMJ A;  5ECQ B;  1UN2 A;  3ERG A;  5ECH B;  1VF1 A;  1GTB A;  2CVK A;  2H8L A;  1FB6 A;  4GLT A;  2RII A;  4OO4 A;  2O89 A;  5B8A A;  1M9A A;  2V32 A;  4KH7 A;  2L5L A;  1F37 A;  2HNL A;  1X0R A;  4H86 A;  2TIR A;  5IMA A;  5CYY A;  3UAR A;  2C3N A;  3IR4 A;  2R0C A;  3P90 A;  1EWX A;  2ALB A;  3GH9 A;  3E3E A;  2PBJ A;  3UVH A;  3ZFB A;  2F3M A;  1ZYN A;  3IDV A;  5DJM A;  3GL5 A;  5D9X A;  2DIY A;  4MDC A;  1QGV A;  5G5E A;  1ACV A;  3IV4 A;  2I4A A;  4POB A;  1X9M B;  1A8Y A;  3L0H A;  5IIZ A;  4OWY A;  1Z5Y E;  3IA1 A;  2YWI A;  5JCU A;  2JZT A;  2WZ9 A;  3IBH A;  2CX3 A;  3HVS A;  3F4S A;  1SK1 A;  1SJ6 A;  4NMU A;  3ZZX A;  1ZYP A;  2C0F A;  3GN3 A;  3FZ9 A;  3M8N A;  5IOX A;  2YZU A;  1R7H A;  5J3R A;  3BOA A;  3UBK A;  1SK0 A;  2XBI A;  5EY6 A;  1XWB A;  1T7P B;  1GSU A;  1THX A;  5ENU A;  2XC2 A;  3D21 A;  3H8Q A;  3DKS A;  3UJ1 A;  1M99 A;  2H72 A;  1M9B A;  4YH2 A;  3IK7 A;  3RHC A;  3VFI A;  1X5D A;  3KP9 A;  4HJM A;  1XZO A;  4KGI A;  1GSY A;  3K8N A;  2PGT A;  3FHK A;  4NV5 A;  1O73 A;  4MPF A;  5CRG A;  4ZL7 A;  2GTU A;  3PIN A;  2MBT A;  4GXZ A;  4HJ2 A;  5HR0 A;  2H6Y A;  3ZVJ D;  1ZCP A;  2L59 A;  4ID0 A;  4AJ8 A;  3LG6 A;  2NDO A;  1J08 A;  4BIK A;  1ZMA A;  1B48 A;  4IQA A;  4X0X A;  1K3L A;  3G9B A;  1TK5 B;  1ERV A;  3BCK A;  4YAP A;  1MD4 A;  1Z3E A;  4FO5 A;  1LJR A;  3KP8 A;  5A4W A;  2IJY A;  2V41 A;  5LD0 A;  4K9Z A;  1F2E A;  2YAN A;  2AYT A;  5B6M A;  2XHF A;  5KOW A;  1PQN A;  2VL3 A;  4IVF A;  2WGR A;  2H01 A;  5ECS A;  2K18 A;  2OE3 A;  3FRC A;  1B9Y C;  1GLP A;  2V2G A;  3APO A;  4BWS A;  3G7J A;  4LMV A;  4XIH A;  3D5J A;  1U3A A;  5CRH A;  3P8W A;  1AXD A;  2H30 A;  2IN3 A;  2PU9 C;  3CXG A;  5B7C A;  2DBC A;  4BL7 A;  3WD6 A;  4IBP A;  13GS A;  4G10 A;  4EIQ A;  16GS A;  4POL A;  5C00 A;  2IFQ A;  2CVD A;  5GAP D;  4KF9 A;  4ULX A;  4O5Q A;  4IN0 A;  3F0I A;  2G0F A;  1GSF A;  2B5X A;  12GS A;  5JWO B;  5EPF A;  5F06 A;  4GTU A;  2PVO C;  4EF0 A;  5DCG A;  1GH2 A;  2VO4 A;  1Z6N A;  1J9B A;  2AV4 A;  5DAL A;  1A2L A;  2FY6 A;  3VPT A;  3GKM A;  1GTU A;  1GUM A;  4EKZ A;  2N5A A;  2AJQ B;  3NOF A;  4G19 A;  1O85 A;  4PTS A;  1FVJ A;  4RI7 A;  2OE0 A;  4HQZ A;  3LYP A;  5D8I A;  4O92 A;  3L9S A;  2HXK A;  1JHB A;  2YZH A;  5ECO B;  3TJB A;  1ERW A;  1SD9 A;  4DEJ A;  3CRT A;  2WS2 A;  1PFO A;  2BJX A;  4PUR A;  2IME A;  5FWG A;  2CAQ A;  1DSB A;  4N0Z A;  4ZL8 A;  3VPQ A;  5GSS A;  3Q18 A;  1VF4 A;  2VL9 A;  3UAP A;  4LA1 A;  4N10 A;  2H1A A;  1M3J A;  3BBY A;  2CZ2 A;  4KW6 A;  3C73 A;  3PH9 A;  2YP6 A;  1HNC A;  2YV9 A;  2OJL A;  3I6A A;  4BPY A;  5G2Z A;  2K8V A;  1H4O A;  2H0I A;  4YKG A;  3S9F A;  1ML6 A;  2FD3 A;  4Q5F A;  3CQF A;  3H93 A;  3WYW A;  3ZFL A;  4KUN A;  3FW2 A;  4ZBB A;  3ZML A;  2FUG 2;  3OR5 A;  4K0N A;  3R2Q A;  4AF2 A;  4EDY A;  2A4V A;  2DSA A;  4KB3 A;  2GST A;  5A4U A;  3GKK A;  3KXO A;  3TKS C;  3ZIT A;  4L0U A;  4G2E A;  3A2W A;  2YCD A;  4TR1 B;  4TR3 A;  1N2A A;  2HRK A;  5AN1 A;  3ERW A;  4ZXG A;  2GT6 A;  3LWA A;  1A2J A;  1F6M C;  3IHQ A;  4P3Y B;  3DGQ A;  3KMN A;  1BX9 A;  4JBB A;  2LKU A;  2KLX A;  3DVW A;  4ZBD A;  1DUG A;  4CW9 A;  2F51 A;  3TJF A;  4ECI A;  1HNA A;  2O7K A;  5KN0 A;  1PA3 A;  2V6K A;  4WBR D;  1K3O A;  2XPE A;  1VF2 A;  3LYK A;  1GWC A;  4MAB A;  1NSW A;  5D93 A;  2QA1 A;  3E9J B;  5HFG A;  1SL2 B;  2IL3 A;  22GS A;  2L6D A;  4WET A;  1R5A A;  3FZA A;  4PXO A;  2J9H A;  3F9U A;  2GQK A;  4IJ3 A;  2GSQ A;  4ZB9 A;  3P7X A;  1QMV A;  2GSS A;  5D9V A;  2VD0 A;  1DBY A;  1FOV A;  5G31 A;  2VCT A;  3KTB A;  4HU7 A;  3ME7 A;  1TRS A;  1G6Y A;  1BJX A;  2HSH A;  1G6W A;  3GST A;  3KGK A;  2ZCT A;  4ECJ A;  3GKX A;  4DSR A;  1F9M A;  4G9H A;  3F3Q A;  1MEK A;  1GNW A;  3Q19 A;  2H19 A;  3DD3 A;  3EC3 A;  4GST A;  2AUV A;  1GTI A;  4MJB A;  3KH9 A;  5J9C A;  2JAD A;  1G7O A;  2HLS A;  3G7Y A;  2I9H A;  3TDG A;  3MIX A;  1BQ7 A;  1A0F A;  3VK9 A;  2MMZ A;  5DVB A;  1M2B A;  1K0M A;  1RK4 A;  2LRN A;  4I8B A;  2IWT A;  4D73 A;  2FA4 A;  5B8B A;  2VLT A;  1YY7 A;  1EP8 A;  2HZE A;  1QQ2 A;  1ZGN A;  2YWO A;  6GST A;  4V2N A;  3UVT A;  2QA2 A;  3RAZ A;  2PVQ A;  3RPN A;  1FOH A;  1YKA A;  4KAE A;  5EL8 A;  2C8U A;  4V1A p;  2GZZ A;  3MDK A;  2E2M A;  3P2A A;  2EIO A;  4K2X A;  4AGS A;  3R3E A;  5JCW A;  1O81 A;  1EEJ A;  2VL2 A;  2E7P A;  2MYG A;  1A2M A;  1X9S B;  3IOS A;  2F8F A;  3H4K A;  4QL7 A;  4MLY A;  2ON7 A;  3UL3 A;  3IC4 A;  2LUS A;  4HQS A;  2GZP A;  4LLR A;  4O5U A;  3IAM 2;  1ZZY A;  3U5R E;  3LQ7 A;  2P0G A;  3FYG A;  2C0D A;  4XHM A;  5IPG A;  1M3I A;  2HI7 A;  5IMV A;  3WGX A;  3MAK A;  2VOC A;  1TI3 A;  1A23 A;  1K0A A;  2C0G A;  1E6B A;  1UA5 A;  4I5Q A;  1W4V A;  4G0K A;  4BVY A;  1GSS A;  3ZYW A;  5GST A;  2DML A;  1ZYE A;  1B4P A;  4XRA A;  4ACS A;  1V40 A;  1OC3 A; 
#chains in the Genus database with same CATH homology
 1SL1 B;  2V6O A;  1SD8 A;  1EGR A;  4NWY A;  1GP1 A;  2H0H A;  3LOR A;  2VCX A;  1M2D A;  2OAC A;  4N30 A;  3LXT A;  2R0G A;  3TJJ A;  3VUR A;  1YF1 A;  4ZBA A;  1KBN A;  2DLX A;  3EIN A;  3KJY A;  1RQM A;  3HZ4 A;  3FZ4 A;  1XWA A;  1Y6E A;  2H71 A;  3D6I A;  2VM1 A;  1Q98 A;  5F0G A;  3RHB A;  1VF3 A;  3MSZ A;  4IKH A;  3A5W A;  2LEG A;  3FR6 A;  1YEP A;  2PN8 A;  3WGE A;  4HI7 A;  2RM5 A;  2B6M A;  1K3Y A;  3C1R A;  1E2Y A;  2A2S A;  2OE1 A;  1ABA A;  4GQC A;  4IJI A;  4MZW A;  3NIV A;  1X5C A;  3ZMK A;  1OKD A;  4JR4 A;  4KX4 A;  1X5E A;  2H76 A;  1XXU A;  5LCZ A;  4YQU A;  1O6J A;  4N0V A;  3IXR A;  5DAK A;  2IMI A;  4DSS B;  5A5K A;  2MZC A;  2HRA A;  3GFK A;  4TW5 A;  3GUS A;  3TOU A;  3KTL A;  3O6T A;  1WPI A;  2DKI A;  1YKC A;  2WUL A;  3RDW A;  3ISO A;  1JLW A;  1LBK A;  2C4J A;  3HKR A;  4FQU A;  4MPG A;  4GSN A;  3HDC A;  3A2V A;  1QK8 A;  3M1G A;  4IP1 A;  4DSS A;  1KEB A;  3HCZ A;  2IMK A;  3GNJ A;  1XFL A;  4YAV A;  6GSY A;  2L6C A;  2GLR A;  2DJ2 A;  1NHO A;  2FA8 A;  2YV7 A;  3ZRD A;  3TKS E;  5JWR B;  4Z2U A;  3LXZ A;  5B6N A;  3J7Y b;  4NPB A;  1USB A;  2O87 A;  4PUA A;  5G30 A;  1S3C A;  4IQ1 A;  3VWV A;  4OFT A;  1XVQ A;  2LTK A;  4Z2R A;  3Q74 A;  3QAW A;  2L4C A;  4NXI A;  4K0G A;  3F4T A;  5ECR B;  2EIR A;  3EMP A;  2CT6 A;  1RW1 A;  2LQQ A;  2JZS A;  2L5O A;  1TU8 A;  5CRD A;  5HR3 A;  1MD3 A;  3D22 A;  1SEN A;  2DMM A;  4WF5 A;  3VWU A;  4BL7 B;  1TP9 A;  9GSS A;  5D73 A;  4NHZ A;  4XS4 A;  3CSI A;  3RBT A;  2JU5 A;  1K0O A;  2A2P A;  2A4H A;  1GNE A;  2IFQ B;  5DDL A;  3WT1 A;  1XOB A;  4WF4 A;  4YKF A;  4Z2T A;  3DYR A;  1FVK A;  4F03 A;  2LNS A;  4TR4 A;  4MCU A;  1G7E A;  3LJR A;  2ZNM A;  1M2A A;  4V2L A;  2CVB A;  4MH3 A;  4ZB6 A;  2KHP A;  5DBQ A;  2FWF A;  5H5Q A;  4F0B A;  2VLV A;  3HD5 A;  5DAL B;  2DJ0 A;  1EEM A;  3PR8 A;  4FYC A;  4AJ7 A;  1C72 A;  5IO0 A;  1U88 A;  3SWL A;  1NM3 A;  1JLV A;  3M9J A;  4KDU A;  3UOM A;  3ZLP A;  2Z9S A;  4MJC A;  2H73 A;  1OKT A;  4V2M A;  1PSQ A;  2IIY A;  4K8M A;  4OD7 A;  1K0B A;  3UMA A;  1TRW A;  3QCP A;  2B3S A;  3GTU A;  2E2G A;  5ID2 A;  5DQY A;  3J7Y k;  4K2D A;  4K7N A;  5IMZ A;  4RQX A;  2C3T A;  2YN1 A;  1T8E B;  3CYN A;  3GMF A;  4EXJ A;  1GSD A;  3VI7 A;  3GH6 A;  4IGJ A;  1TRV A;  4USS A;  3TKP A;  2K6V A;  4XTS A;  5HQP A;  1XPV A;  1OE7 A;  2E0Q A;  4MMM A;  4TOP A;  5ECK B;  3EU4 A;  2RLI A;  2KOK A;  1XOA A;  3VLN A;  5F07 A;  3A3T A;  5IPH A;  2P5R A;  2FGX A;  3GX0 A;  3HHV A;  3TJG A;  2VD1 A;  3ME8 A;  1EOG A;  4GQF A;  1SK2 A;  3F63 A;  3GUR A;  14GS A;  4K6X A;  1K0D A;  3TKS A;  3QPM A;  2RUF A;  3UBL A;  4TXO A;  2VCW A;  3G7I A;  2X99 A;  4MH2 A;  4BA7 A;  5KN2 A;  3C1S A;  2FWG A;  1HQO A;  3KIJ A;  5DQS A;  4JED A;  5FHI A;  2DJ1 A;  3VWW A;  1GUL A;  1JZW A;  2LRC A;  2XPD A;  1JZO A;  4IHU A;  5IMF A;  4AJ6 A;  4HOJ A;  4TRX A;  4I97 A;  5D96 A;  1EP7 A;  1AC1 A;  2RUE A;  1V9W A;  2I1U A;  3A5I A;  4WR5 A;  4KSM A;  2C1Y A;  1EZK A;  1SU9 A;  2H1B A;  1FO5 A;  5IQY A;  1GLQ A;  2MMO A;  3EE2 A;  2QSI A;  4POK A;  4PNG A;  1Z6M A;  3IC8 A;  4KDY A;  4N11 A;  1WIK A;  6GSV A;  3W8J A;  2HSY A;  1JFU A;  2WRT A;  1AAZ A;  3E0U A;  4PQH A;  1WRY A;  2RM6 A;  2IPA A;  3M3M A;  2WDU A;  4PGT A;  1SKW B;  4CY6 A;  2LJK A;  4Q5Q A;  1XW5 A;  2K8S A;  1SJI A;  1AQX A;  1T1V A;  2R0P A;  2KUC A;  3HYP A;  1A8L A;  2H6X A;  3TUE A;  3ZRE A;  2JL4 A;  2X49 A;  1EOH A;  2HT9 A;  1THO A;  4MK3 A;  1U3I A;  2HE3 A;  3HVX A;  2C3Q A;  3F4R A;  3U6V A;  3LW9 A;  1GL8 A;  3F6D A;  2HFD A;  3F3R A;  5G1L A;  3GV1 A;  2CX4 A;  2HRF A;  2GT5 A;  2ON5 A;  4G0I A;  2AB6 A;  4D73 B;  5D9W A;  3RPP A;  2HZE B;  1J0F A;  4HS1 A;  4F2I A;  5BRT A;  4FIW A;  3M0F A;  4I6X A;  6GSU A;  4I2T A;  4K7I A;  2BMX A;  2FLS A;  3TCO A;  4HDE A;  2C80 A;  5F05 A;  8GSS A;  3ERF A;  4XRD A;  4ML6 A;  3HXS A;  2HRN A;  2CA8 A;  2OBI A;  2C0E A;  2PPT A;  4J56 E;  4Q5N A;  4MF6 A;  1B8X A;  1O8X A;  1OVN A;  4TXV A;  3PGT A;  4MA9 A;  1AQW A;  2H6Z A;  1S3D A;  2J23 A;  2YOI A;  1T4Z A;  1OC9 B;  4WXT A;  1R5P A;  5DCH A;  4FYU A;  4CDO A;  1T4Y A;  2YWM A;  11GS A;  2PMT A;  1T3B A;  4O5R A;  1TK8 B;  4ZIL A;  1F3B A;  5AIS A;  1N8J A;  4MJA A;  2D2Z A;  3GA4 A;  4E8H A;  4BVX A;  3APS A;  3KEB A;  4QQ7 A;  1OC9 A;  1NW2 A;  1PKW A;  4BVY B;  3WGD A;  2M80 A;  1QUW A;  1A0R P;  5IM9 A;  4GRF A;  4TKY A;  3DVX A;  2CZ3 A;  2A2R A;  5JWQ B;  3I69 A;  1X9W B;  2M46 A;  3IE3 A;  4PQI A;  2OAD A;  4OO5 A;  3ZIV A;  2P5Q A;  4XS1 A;  3GSS A;  5ECP B;  3FZ5 A;  3BD2 A;  4KCE A;  4L5L A;  1HD2 A;  4WR4 A;  1GSQ A;  2IMF A;  1PX6 A;  4EE0 A;  3C8E A;  3DRN A;  1R4W A;  4CY8 A;  3IRA A;  3EYT A;  2F8A A;  2JSY A;  4X43 A;  3SBC A;  3D0Z A;  5H5S A;  4RI6 A;  4K5S A;  1NHY A;  2NTO A;  1YJ6 A;  1MDK A;  4EIP A;  1Z7P A;  2O85 A;  1BYE A;  1TW9 A;  1I9D A;  5FT3 A;  5DJL A;  2X4A A;  2L57 A;  3HY2 A;  5COH A;  1HYU A;  2UZ8 A;  3DXB A;  3MNG A;  2LST A;  1O8W A;  2R3X A;  3CMI A;  2G2Q A;  1Y25 A;  1XWK A;  4JZQ A;  1K0N A;  3HJO A;  3QOU A;  2AHE A;  5DAK B;  4ECC A;  3AY8 A;  4OFN A;  1G0T A;  5IMD A;  2B1L A;  4F9Z A;  3BCI A;  2MBS A;  1SJZ A;  3I43 A;  1Z9H A;  5CRE A;  3GIX A;  3QMX A;  5HR1 A;  4LL4 B;  1TXX A;  1V2A A;  4RQR A;  5H5R A;  4RUV A;  5IMC A;  1I5G A;  3MWH A;  1TI1 A;  1GRX A;  1W89 A;  1GUH A;  2VM2 A;  3CSH A;  1TJD A;  2LS5 A;  5E59 A;  3ED3 A;  1XW6 A;  1PRX A;  3JCM L;  4JR6 A;  1XVW A;  2GZY A;  4ZIJ A;  2R6K A;  2QC7 A;  2REM A;  5ECL B;  2PUK C;  5HR2 A;  4FH8 A;  1XCC A;  1CQH A;  5KEJ A;  3TKQ A;  3TKR A;  4TR0 A;  5GZZ B;  1UC7 A;  3QFB C;  4O32 A;  5CP1 A;  4HUA A;  1YDK A;  5ECN B;  2DJJ A;  1SKR B;  1IYH A;  2WFC A;  4NV2 A;  2FNO A;  4ILF A;  1URM A;  4MNN A;  5HFK A;  4EDZ A;  5J5N A;  1XBS A;  1IYI A;  4XS4 B;  5AGY A;  2CAI A;  3IPZ A;  4EL1 A;  3GYK A;  4L5O A;  19GS A;  4X1U A;  2GDR A;  4PNF A;  2KP2 A;  2FHE A;  1FHE A;  1FAA A;  1WJK A;  2N5F A;  5L71 A;  3HA9 A;  4YQM A;  4K7O A;  4ISD A;  1T00 A;  20GS A;  3CTF A;  3LEF A;  2JAC A;  2CV4 A;  1SYX A;  2H70 A;  1YEX A;  2ES7 A;  2YPM A;  2VCZ A;  3I9V 2;  1H75 A;  1V57 A;  1BAY A;  5BMU A;  4OCE A;  5IO2 A;  3CRU A;  1SYR A;  1ERU A;  1PGT A;  2PWJ A;  2R37 A;  1YQ1 A;  4OCF A;  2TRC P;  4PUF C;  2YJ7 A;  1ZOF A;  2VIM A;  3ZL5 A;  1VGL A;  3VWX A;  3F6F A;  3HJP A;  1FW1 A;  2B5E A;  3FY7 A;  1OE8 A;  4CHS A;  2HYX A;  4GWR A;  4Z7X A;  4L0W A;  3KD0 A;  6GSW A;  5KOX A;  1TK0 B;  1B4Q A;  3EUR A;  4EUY A;  4MZB A;  3IK9 A;  4HEA 2;  5C04 A;  5AIX A;  2EIQ A;  1XWC A;  4KCA A;  1MDI A;  3BJ5 A;  3GKN A;  4XCS A;  3GTU B;  2FWH A;  5ID2 B;  1KNG A;  3EPT A;  1GTA A;  6GSS A;  3O76 A;  4FYB A;  2X8C A;  3UEM A;  2O8V B;  4IP6 A;  1U87 A;  4HZ2 A;  4WKW A;  3LGC A;  2DKH A;  1ST9 A;  4DVC A;  4F0C A;  4GSS A;  2AAW A;  3TGZ A;  4KE3 A;  2GQL A;  2YWN A;  2N5B A;  4ICY A;  4DSQ A;  4F82 A;  1DE2 A;  2YJH A;  4MF7 A;  3L4N A;  1XIY A;  3QDN A;  2LNT A;  5GAN D;  1VRS D;  2M72 A;  1ILO A;  4MP4 A;  5F8B A;  3LFL A;  1PKZ A;  1SL0 B;  2K9F A;  4J2F A;  3NZN A;  3WT2 A;  1AUC A;  3KCM A;  4A5P A;  2X8H A;  2JSZ A;  2OBK A;  1HNB A;  1JZD A;  2WB9 A;  2WJU A;  5CAX A;  3C7M A;  2FCH A;  1TKD B;  3EMX A;  4HU9 A;  2TRX A;  2B7K A;  2X64 A;  1B9X C;  2R2J A;  4TXO B;  3C71 A;  3H79 A;  4IS0 A;  3TJK A;  2B5Y A;  2NPB A;  2YNX A;  3LSZ A;  4KDX A;  1WE0 A;  3ZVJ A;  1MDJ A;  2H66 A;  5CO3 A;  1S3A A;  2GSR A;  2QKE A;  1GUK A;  4YQV A;  2H0G A;  4MF5 A;  3IAS 2;  4V1A g;  1YZX A;  2DC5 A;  2I3Y A;  3GRX A;  5G5F A;  2LQO A;  4I2U A;  3DIE A;  1PL2 A;  3TRX A;  3M9K A;  3A2X A;  1WWJ A;  2JZR A;  4HZ4 A;  2QGV A;  3N9J A;  1BG5 A;  3FR3 A;  2H75 A;  4L8E A;  4J57 E;  3KZQ A;  4EC0 A;  5A4V A;  3CSJ A;  2V1M A;  3QFA C;  1AQV A;  1KTE A;  2F9S A;  4X4J A;  5ELG A;  1OYJ A;  2DIZ A;  3VI5 A;  5ELA A;  1K0C A;  2VLU A;  2X8G A;  5HFI A;  1TDI A;  1QFN A;  1AW9 A;  5KN3 A;  1R26 A;  3QAG A;  1F3A A;  3HJM A;  2B7J A;  2BTO T;  2ZUP A;  1TRU A;  4ECB A;  4GF0 A;  4EVM A;  2WCI A;  3FR9 A;  3TRP A;  2EC4 A;  3GX8 A;  4BWQ A;  1TOF A;  3DEX A;  3PPU A;  5IOW A;  2LJA A;  1OC8 A;  1LU4 A;  3APQ A;  1O7U A;  3ZTL A;  5G1K A;  1V58 A;  10GS A;  3HVV A;  1TU7 A;  3N5O A;  4PQ1 A;  4QL9 A;  4O7H A;  2VAF A;  4K1F A;  1M7T A;  3H1N A;  3FKF A;  5KN1 A;  2B1K A;  2CQ9 A;  4G0L A;  3QAV A;  2R4V A;  1PL1 A;  4TR1 A;  2XBQ A;  3KMO A;  4KND A;  2NBS A;  1CQG A;  2MMA A;  4IEL A;  3TB2 A;  1JZR A;  2H1G A;  3L9V A;  2VCV A;  2VCQ A;  3L78 A;  3QD9 A;  2DJ3 A;  4LMW A;  4ZB8 A;  5E4W A;  3IHG A;  5INY A;  1GSE A;  3D4M A;  5LNK e;  1ERT A;  4LL1 B;  4OFM A;  2HSM A;  3US3 A;  3FMW A;  1ON4 A;  2OKA A;  1UVZ A;  1YF0 A;  3V1W A;  4JRR A;  3W8S A;  2L4Q A;  1PN9 A;  2R5G A;  1U6T A;  2FWE A;  5AIV A;  1BED A;  3GL3 A;  2PER A;  4EO3 A;  1WP0 A;  3TOT A;  3CTG A;  7GSS A;  18GS A;  5D9T A;  1FG4 A;  4JU5 A;  3O3T A;  1PN0 A;  4WBJ A;  4BVX B;  5J9B A;  4K5R A;  3EWL A;  2GGT A;  1EGO A;  1FB0 A;  1DE1 A;  3TRQ A;  2DJK A;  3DWV A;  5J41 A;  3MYD A;  1OAZ A;  1EV4 A;  2IMD A;  3UIW A;  5CNW A;  2LV3 A;  5ABR A;  2GQM A;  3EU3 A;  2LRT A;  4WEY A;  4KA0 A;  1EV9 A;  2H1D A;  1V98 A;  1XW9 A;  2GS3 A;  1AIU A;  1SKS B;  2GVP A;  1ZL9 A;  3HZ8 A;  3KM6 A;  3L9U A;  3Q6O A;  2I81 A;  4JE1 A;  1Q4J A;  2MMN A;  1Z7R A;  4KSO A;  3GHA A;  4PX1 A;  4MZC A;  1ZYQ B;  3KH7 A;  4E8E A;  4IW9 A;  2HZF A;  5EVO A;  17GS A;  4MJE A;  4POM A;  3DML A;  3QR6 A;  3CBU A;  3FEU A;  2VL2 C;  3D4T A;  3F8U A;  3ZIJ A;  1PX7 A;  1M0U A;  4GCI A;  5ECI B;  4NHW A;  4TVE A;  2H74 A;  5CRW A;  2KP1 A;  4ML1 A;  4OMV A;  2P31 A;  3W6G A;  2OA7 A;  5ECM B;  5JCG A;  1XWG A;  3EVI A;  5J4U A;  3FK8 A;  4Q5R A;  4TN8 A;  2VUP A;  1TTZ A;  1QXH A;  1PMT A;  4ZL9 A;  1A24 A;  2NVL A;  2LJR A;  4XS6 A;  1WOU A;  1MTC A;  6GSX A;  4NAX A;  1PD2 1;  1WMJ A;  5ECQ B;  1UN2 A;  3ERG A;  5ECH B;  1VF1 A;  1GTB A;  2CVK A;  2H8L A;  1FB6 A;  4GLT A;  2RII A;  4OO4 A;  2O89 A;  5B8A A;  1M9A A;  2V32 A;  4KH7 A;  2L5L A;  1F37 A;  2HNL A;  1X0R A;  4H86 A;  2TIR A;  5IMA A;  5CYY A;  3UAR A;  2C3N A;  3IR4 A;  2R0C A;  3P90 A;  1EWX A;  2ALB A;  3GH9 A;  3E3E A;  2PBJ A;  3UVH A;  3ZFB A;  2F3M A;  1ZYN A;  3IDV A;  5DJM A;  3GL5 A;  5D9X A;  2DIY A;  4MDC A;  1QGV A;  5G5E A;  1ACV A;  3IV4 A;  2I4A A;  4POB A;  1X9M B;  1A8Y A;  3L0H A;  5IIZ A;  4OWY A;  1Z5Y E;  3IA1 A;  2YWI A;  5JCU A;  2JZT A;  2WZ9 A;  3IBH A;  2CX3 A;  3HVS A;  3F4S A;  1SK1 A;  1SJ6 A;  4NMU A;  3ZZX A;  1ZYP A;  2C0F A;  3GN3 A;  3FZ9 A;  3M8N A;  5IOX A;  2YZU A;  1R7H A;  5J3R A;  3BOA A;  3UBK A;  1SK0 A;  2XBI A;  5EY6 A;  1XWB A;  1T7P B;  1GSU A;  1THX A;  5ENU A;  2XC2 A;  3D21 A;  3H8Q A;  3DKS A;  3UJ1 A;  1M99 A;  2H72 A;  1M9B A;  4YH2 A;  3IK7 A;  3RHC A;  3VFI A;  1X5D A;  3KP9 A;  4HJM A;  1XZO A;  4KGI A;  1GSY A;  3K8N A;  2PGT A;  3FHK A;  4NV5 A;  1O73 A;  4MPF A;  5CRG A;  4ZL7 A;  2GTU A;  3PIN A;  2MBT A;  4GXZ A;  4HJ2 A;  5HR0 A;  2H6Y A;  3ZVJ D;  1ZCP A;  2L59 A;  4ID0 A;  4AJ8 A;  3LG6 A;  2NDO A;  1J08 A;  1ZMA A;  1B48 A;  4IQA A;  4X0X A;  1K3L A;  3G9B A;  1TK5 B;  1ERV A;  3BCK A;  4YAP A;  1MD4 A;  1Z3E A;  4FO5 A;  1LJR A;  3KP8 A;  5A4W A;  2IJY A;  2V41 A;  5LD0 A;  4K9Z A;  1F2E A;  2YAN A;  2AYT A;  5B6M A;  2XHF A;  5KOW A;  1PQN A;  2VL3 A;  4IVF A;  2WGR A;  2H01 A;  5ECS A;  2K18 A;  2OE3 A;  3FRC A;  1B9Y C;  1GLP A;  2V2G A;  3APO A;  4BWS A;  3G7J A;  4LMV A;  4XIH A;  3D5J A;  1U3A A;  5CRH A;  3P8W A;  1AXD A;  2H30 A;  2IN3 A;  2PU9 C;  3CXG A;  5B7C A;  2DBC A;  4BL7 A;  3WD6 A;  4IBP A;  13GS A;  4G10 A;  4EIQ A;  16GS A;  4POL A;  5C00 A;  2IFQ A;  2CVD A;  5GAP D;  4KF9 A;  4ULX A;  4O5Q A;  4IN0 A;  3F0I A;  2G0F A;  1GSF A;  2B5X A;  12GS A;  5JWO B;  5EPF A;  5F06 A;  4GTU A;  2PVO C;  4EF0 A;  5DCG A;  1GH2 A;  2VO4 A;  1Z6N A;  1J9B A;  2AV4 A;  5DAL A;  1A2L A;  2FY6 A;  3VPT A;  3GKM A;  1GTU A;  1GUM A;  4EKZ A;  2N5A A;  2AJQ B;  3NOF A;  4G19 A;  1O85 A;  4PTS A;  1FVJ A;  4RI7 A;  2OE0 A;  4HQZ A;  3LYP A;  5D8I A;  4O92 A;  3L9S A;  2HXK A;  1JHB A;  2YZH A;  5ECO B;  3TJB A;  1ERW A;  1SD9 A;  4DEJ A;  3CRT A;  2WS2 A;  4PUR A;  2BJX A;  2IME A;  5FWG A;  2CAQ A;  1DSB A;  4N0Z A;  4ZL8 A;  3VPQ A;  5GSS A;  3Q18 A;  1VF4 A;  2VL9 A;  3UAP A;  4LA1 A;  4N10 A;  2H1A A;  3BBY A;  2CZ2 A;  4KW6 A;  3C73 A;  3PH9 A;  2YP6 A;  1HNC A;  2YV9 A;  2OJL A;  3I6A A;  4BPY A;  5G2Z A;  2K8V A;  1H4O A;  2H0I A;  4YKG A;  3S9F A;  1ML6 A;  2FD3 A;  4Q5F A;  3H93 A;  3WYW A;  3ZFL A;  4KUN A;  3FW2 A;  4ZBB A;  3ZML A;  2FUG 2;  3OR5 A;  4K0N A;  3R2Q A;  4AF2 A;  4EDY A;  2A4V A;  2DSA A;  4KB3 A;  2GST A;  5A4U A;  3GKK A;  3KXO A;  3TKS C;  3ZIT A;  4L0U A;  4G2E A;  3A2W A;  2YCD A;  4TR1 B;  4TR3 A;  1N2A A;  2HRK A;  5AN1 A;  3ERW A;  4ZXG A;  2GT6 A;  3LWA A;  1A2J A;  1F6M C;  3IHQ A;  4P3Y B;  3DGQ A;  3KMN A;  1BX9 A;  4JBB A;  2LKU A;  2KLX A;  3DVW A;  4ZBD A;  1DUG A;  4CW9 A;  2F51 A;  3TJF A;  4ECI A;  1HNA A;  2O7K A;  5KN0 A;  1PA3 A;  2V6K A;  4WBR D;  1K3O A;  2XPE A;  1VF2 A;  3LYK A;  1GWC A;  4MAB A;  1NSW A;  5D93 A;  2QA1 A;  3E9J B;  5HFG A;  1SL2 B;  2IL3 A;  22GS A;  2L6D A;  4WET A;  1R5A A;  3FZA A;  4PXO A;  2J9H A;  3F9U A;  2GQK A;  4IJ3 A;  2GSQ A;  4ZB9 A;  3P7X A;  1QMV A;  2GSS A;  5D9V A;  2VD0 A;  1DBY A;  1FOV A;  5G31 A;  2VCT A;  3KTB A;  4HU7 A;  3ME7 A;  1TRS A;  1G6Y A;  1BJX A;  2HSH A;  1G6W A;  3GST A;  3KGK A;  2ZCT A;  4ECJ A;  3GKX A;  4DSR A;  1F9M A;  4G9H A;  3F3Q A;  1MEK A;  1GNW A;  3Q19 A;  2H19 A;  3DD3 A;  3EC3 A;  4GST A;  2AUV A;  1GTI A;  4MJB A;  3KH9 A;  5J9C A;  2JAD A;  1G7O A;  2HLS A;  3G7Y A;  2I9H A;  3TDG A;  3MIX A;  1BQ7 A;  1A0F A;  3VK9 A;  2MMZ A;  5DVB A;  1M2B A;  1K0M A;  1RK4 A;  2LRN A;  4I8B A;  2IWT A;  4D73 A;  2FA4 A;  5B8B A;  2VLT A;  1YY7 A;  1EP8 A;  2HZE A;  1QQ2 A;  1ZGN A;  2YWO A;  6GST A;  4V2N A;  3UVT A;  2QA2 A;  3RAZ A;  2PVQ A;  3RPN A;  1FOH A;  1YKA A;  4KAE A;  5EL8 A;  2C8U A;  4V1A p;  2GZZ A;  3MDK A;  2E2M A;  3P2A A;  2EIO A;  4K2X A;  4AGS A;  3R3E A;  5JCW A;  1O81 A;  1EEJ A;  2VL2 A;  2E7P A;  2MYG A;  1A2M A;  1X9S B;  3IOS A;  2F8F A;  3H4K A;  4QL7 A;  4MLY A;  2ON7 A;  3UL3 A;  3IC4 A;  2LUS A;  4HQS A;  2GZP A;  4LLR A;  4O5U A;  3IAM 2;  1ZZY A;  3U5R E;  3LQ7 A;  2P0G A;  3FYG A;  2C0D A;  4XHM A;  5IPG A;  2HI7 A;  5IMV A;  3WGX A;  3MAK A;  2VOC A;  1TI3 A;  1A23 A;  1K0A A;  2C0G A;  1E6B A;  1UA5 A;  4I5Q A;  1W4V A;  4G0K A;  4BVY A;  1GSS A;  3ZYW A;  5GST A;  2DML A;  1ZYE A;  1B4P A;  4XRA A;  4ACS A;  1V40 A;  1OC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...