4X1KB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
428
structure length
428
Chain Sequence
b'EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 134
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1kB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1kB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1kB01
1RQ7A 3VPAA 4O4IA 5MN5A 3RYIB 4ZHQB 4ZI7A 1TUBA 4O4HB 3HKCB 4FFBB 3HKEA 5JQGB 3WGLA 4B45A 3N2KA 5KX5B 5LXTB 5JVDB 5IJ0B 3E22B 5FNVB 1Z5WA 5LYJB 5M7EA 4ZHQA 4X20B 4O4HA 3HKCA 4FFBA 5BMVA 3UT5B 5JQGA 1OFUA 2GVIA 1W5BA 4WBNB 5KX5A 5LXTA 5IJ0A 2VXYA 5FNVA 5LYJA 5J2UB 4X20A 4M8IA 1W581 2VAPA 3UT5A 3JAWB 3VO9A 4WBNA 4LNUA 4O2BB 3WGNA 3CB2A 4E6EA 4X1KB 4EB6A 5J2UA 2BTQB 1RQ2A 3RB8A 4O2BA 4TUYA 3RYCB 5BMVB 2XKAA 4X1KA 2Q1YA 4DXDA 1W5EA 2BTQA 5CA1B 5JH7B 1FFXA 3RYCA 1RLUA 2Q1XA 1TVKB 2R6R1 5CA1A 4LNUB 5JH7A 4TV9B 4HNAB 4EB6B 4YJ3B 5MN6A 3HKBB 2BTOA 1TVKA 4F6RB 1W5AA 5LA6B 4X1IB 3N2GA 5ITZA 5EIBC 3RYFA 4TUYB 4EI7A 5GONB 4TV9A 4ZOLB 4HNAA 4YJ3A 3JATB 4B46A 3HKBA 4F6RA 1JFFA 5LA6A 4DRXB 3JAKB 4X1IA 2RHLA 1FFXB 5IYZB 2VAWA 4O2AB 5GONA 5JCOC 4U39A 3ZIDA 5EYPB 4ZOLA 1W59A 3JATA 2RHJA 1SA0B 4I55B 3RYHB 4DRXA 3JAKA 1Z5VA 5IYZA 4O2AA 4O4LB 1FSZA 5EYPA 5JCOA 4EI8A 4U3JB 2R751 3N2GB 5ITZB 1SA0A 3RYFB 4I55A 3RYHA 4IHJB 1W5FA 2RHHA 4TV8B 5LP6A 3WGJA 4O4LA 5J2TB 1JFFB 5EZYB 3V3TA 4U3JA 4EI9A 4IHJA 5KMGB 3VO8A 2RHOA 4TV8A 5IJ9B 3C8LA 5J2TA 4O4JA 3HKDA 3ZBQA 5EZYA 4IIJA 4YJ2A 3JASB 5LOVA 2XKBA 5C8YB 4X1YB 5CB4B 5KMGA 3ZBPA 3WGKA 3RYIA 5MN4A 5IJ9A 3JARB 5LP6C 5JVDA 4I50B 3E22A 3JASA 5LP6B 3JALB 4X1YA 4I4TB 5C8YA 5CA0B 5CB4A 3VOAA 4XCQA 3M8KA 3JARA 5EIBD 3M89A 3R4VA 4I50A 4O4IB 2VAMA 3JALA 1TUBB 4I4TA 5CA0A 4ZI7B 3HKEB 4KWEA 4O4JB 3HKDB 3N2KB 3VOBA 3WGMA 4IIJB 3JAWA 4YJ2B 5LOVB
chains in the Genus database with same CATH superfamily
3D5EA 1KP2A 3SHQA 3DAGA 3PX2A 2P06A 1N1MA 4ZHQA 2PBZA 2CK3D 1GY8A 1FLVA 3NDJA 3RS3A 4D0RA 4UDNA 4ASUD 1UPBA 2WHQA 1X0VA 2H07A 3SNKA 2AE1A 3L6UA 1ZJZA 4UAJA 1SCAA 2R7NA 4RIIA 2B5UA 2VH5R 3AU9A 3EQ2A 4AZTA 4BC0A 2YKGA 1SC9A 4UCTA 1JR3E 1JHPA 1R0RE 3FVVA 4WKOA 1MJNA 4AB1A 4XD7A 2GETA 1VF5B 4AX4A 2ZRNA 1MJHA 4LVOA 4PFQA 1HNZB 2QP3A 1L5WA 2H65A 4NBTA 4FHZA 1NPYA 2AFIB 3M4XA 2XF8A 5AVMA 3ZKAA 1CIVA 3PV0A 1M9NA 3NHZA 1THMA 3H1TA 5F21A 3RK4A 2IHUA 1N2BA 4J4BA 4BO0A 3RHZA 4Q4LA 1GUDA 4PSAA 2HRBA 3K79A 2PLRA 2NYUA 2XE6A 3MUNA 4IRXA 3I6ZA 2Y1OA 1D8AA 3IIKA 3MSXA 4DV6B 3K2BA 1RDFA 1OROA 5JAZA 3GFOA 2AYZA 3BCRA 3HYSA 4IWNA 2P4KA 5NLLA 5IK2D 4G2KA 1KZ6A 1XXHB 1K73H 1GRVA 4EKYA 4OJYA 4WXHA 2EU8A 3SHVA 5EJ8A 1SFRA 1W5AA 2PUBA 1FJXA 4X6UA 3FRJA 2M7WA 3O3MB 3O9MA 2HT6A 2VTKA 4HVLA 3M6XA 2FSHA 3UCFA 5CK5A 4RNDB 4FGUA 3VYUC 1BCRB 5NULA 3INNA 1E4OA 3CX5F 3PNPA 2W2VA 2YIJA 2OFXA 4WL0A 3DMGA 2BMFA 4MV3A 4J0JA 3I92A 4ESVA 3RVQA 4C6RA 4ECEA 5HIKA 4Z7NB 5DE3A 4G1BA 4HBZA 2OTLV 1VKRA 1TUBB 3AB3A 1EFRG 4I5GA 1Y4UA 2V6JA 2BFCB 4KSYA 1D6JA 1TT5A 4XA8A 3NWOA 1MA0A 1ECJA 7MHTA 4CKCA 4LY9A 4D4KA 3QF4B 2QTBA 3V7WA 2A06H 4V2IA 1T0KB 1RLGA 1CS0B 2W6CX 5CJ2A 3QOWA 1GDDA 3BG5A 2ZIXB 4C7OB 4KXLA 3O92A 2ESRA 1CDOA 3K0CC 1EUCB 4W4LA 4FM9A 3ITDA 4LK3A 3P3NA 3HCCA 4BC1A 3H1JH 4L07A 2VP6A 1YOVB 5J5AA 1AKTA 3IRVA 2HHAA 4TTSA 4JBYA 1Q6ZA 3OQPA 5FNZA 3CE2A 3PFWO 3ZV7A 1B8PA 2QZ9A 5KJEA 3JY6A 4HQRA 1P4SA 5IMSA 3S03A 1RKVA 1U2RA 1GN6A 5IM5A 3SDSA 1RD4A 3JWHA 1SXQA 1HP8A 1Z7GA 1P2BA 4CLOB 3LK6A 1HEIA 3DV0A 2X4DA 5HM6A 1EFRA 4GKKB 4LKOA 3GLFA 4BZPA 4JROA 3NHFA 3OM8A 3PI6A 1NVFA 2HMAA 2I2AA 1KQGA 1AZWA 2FZVA 4Q3DA 1W19A 3VPXA 2ZNJA 3SX0A 2LRHA 2AW9A 3LT0A 3ZJZA 5E3JA 1T0AA 5F9HA 5C7IO 4R50A 3AHHA 1T1JA 5P8WA 1VCIA 1E32A 4R3UC 3MQFA 4PFJA 3FYUA 3N07A 1DKRA 1U1DA 2WPNA 4RD3A 3A25A 3ND5A 3MB5A 2WD9A 3CPSA 2Q5IA 2MTBA 1Z3CA 4HFJA 5ESXA 3TEFA 4C6TB 1GTG1 2XBUA 3UA3A 2IPLA 2P2GA 2WMYA 3A05A 1JP7A 5BWBA 2VPPA 3I9FA 3LT2A 4ER3A 3ODPA 3C8MA 3JVHA 1R6BX 3W4JA 5FUQA 5HZGA 4FQ7A 3TD3A 5I48A 4P22A 4PPGA 2UUBO 3ETLA 3ZMZA 1QJ4A 1T5TA 1HT1E 5DHSA 1FZTA 2N05A 4JSTA 3ETJA 2JD0A 3CJHA 3T3IA 4XJXA 3DE4X 2YHIA 2N75A 3U81A 1QJCA 2A58A 1JQJC 1U3LA 3L7OA 1TZKA 2NTNA 1BZKA 2PKXA 4B83A 4Z1VA 1UODA 1Y7TA 4BIMA 3GLIB 4XDJA 4A8PA 1COWG 1DAEA 4XX0B 3PDWA 1Q0UA 1GJRA 3TCKA 4PWYA 5KQSA 1VJCA 4AO7A 2P6NA 4XVQA 1OXVA 1S3JA 1N8NA 2YEVB 4Y6PA 4BMVA 1Q44A 2J9FB 4IFBA 4ZOLB 4MQUA 3C48A 5MGBA 4KPYA 3NOOA 2DUJA 3BS4A 4OQZA 1D3AA 3PUYA 1F8XA 2BOCC 3CPHA 4OKSA 1ECBA 2CXOA 4DDHA 1Z5VA 4FJ1A 4HN9A 4B47A 2IHVA 2N04A 4HMPA 1K7DA 4CM1A 4I1YA 1RPTA 2GAFA 3M49A 3QE9Y 3GP3A 4WFKA 4WUVA 2QTVA 4RK4A 4RO0A 1K8AH 4H31A 4LFCO 3OLYA 4R9SA 5IZCA 2C3OA 5K0BA 3JAWA 1Z4MA 2VWGA 1PR3A 1XL1A 3THXB 3TL3A 3T35A 3DLPX 1EX6A 1SUSA 3RRMA 1VHLA 3WG9A 1CUHA 4AURA 4KTVE 1COWA 4RK1A 3V4ZA 4WBNA 3OZ7A 2AJDA 1L7QA 2Q5QA 1L8AA 3AK2A 3RRXA 2LVBA 3VTZA 2QYHA 1AVMA 3OIDA 4YBRA 3RO7A 5K0FA 3TLMA 5DGHA 1T2CA 1W36D 5HUJA 2VDUE 2FEXA 1R4NB 1B04A 2KW5A 2FSGA 2R7LA 5FX2A 1E3EA 3H9BA 3JD0A 3ABZA 1F51A 1EQUA 3OOJA 3VDMA 1TEZA 3A0BZ 1FY2A 5TQ2B 4AJOA 3EGEA 2Q0XA 5K0SA 2NU8A 2RIRA 2G1KA 3NT2A 5ICGA 2NT3A 5FR1A 4EA7A 1CSEE 1T5SA 3OONA 3UCSC 1PWXA 2Q3JA 3T1YB 3EFHA 4YV1A 4KXYA 5DTMA 4F6LA 3CW8X 4AI6A 2PWBA 4B34A 2QTOA 3UJCA 4P4SA 4UTNA 5IZCC 2GCIA 3EZYA 3T3OA 1GKIA 1TYCA 1Z38A 3ZY5A 1F23A 4DV1O 2CKMA 4BECA 2PTHA 2PWZA 2BFBA 1LDMA 1RQGA 3GAAA 5CMLA 3ZUPA 2B5VA 1Y1SA 3G5TA 1OHHD 1BOFA 3FPEA 2R8RA 3QMWA 1TTPB 7REQA 4XLZA 5JI2E 3EW9A 1UXKA 4EGCB 5E7IA 4KK4A 3W9YA 4PPFA 2GA8A 3AVPA 1XMVA 1X19A 1F14A 4S2UA 2DMXA 1QC5A 4PSDA 1F8GA 4Y1GA 1RW4A 2AJCA 5HIMA 3FUCA 3FX2A 2XMDA 4HMOA 1H1LA 1G3MA 4ARAA 3R4VA 2IGBA 1N8SA 5FBRB 3FBAA 3ACDA 2Q29A 2QTWB 1RLJA 4U1RA 4J1QA 4A6EA 5CNJA 4Y30A 2C4TA 5LA6F 2P5TB 2VQ6A 3L79A 2OTJF 1YAHA 2DJVA 3H11A 2C2AA 4L6CA 2P9ZA 1Q21A 4AYXA 1K8ZB 2JJYA 2GHTA 5AOBA 1CE8B 2GYVA 5ITSA 1LNQA 2WT4A 1ZH4A 3BIXA 4W1RA 2QRUA 4C76A 1Z5UA 1GTZA 3W77A 4NOKA 4EEZA 1XD2B 4BNMA 1Q50A 2SCUA 4KQEA 2QYOA 2Q69A 3BGOS 4YLGA 4GE3A 4C29A 1GPAA 5E7QA 4A36A 2H54A 2BBSA 3V7UA 3L4SO 3HYTA 5CA0A 1Q20A 3P5SA 2O7NA 1IUOA 4A0HA 5EJAA 2Q5JA 3CW9A 3GYBA 4NQZA 4RL6A 3UV3A 1B73A 1L3IA 4O8ZA 1TFUA 2QSYA 1DARA 3AFOA 3HI4A 2Z4TA 1NZ6A 1UJ6A 3KZ1E 2O0JA 5JRZA 2J67A 2IL1A 3U9TA 1IM8A 3RC9A 3CTPA 3TQSA 2UYQA 5F3DA 3NTRA 3AJDA 2X77A 3AF1A 1WZNA 3CCMV 5JEEA 2GTSA 2PMDA 3E6AA 5GM2A 3BF7A 4JL6A 1YZKA 3QWFA 3L7BA 3KSZO 1CNFA 2GBLC 2WT9A 2I65A 2CL0X 1JVMA 3SXUA 2JAQA 1ZWZA 4BTLA 5IRCD 2ZULA 3LUCA 2X0LA 3OC0A 2HK6A 2CWWA 3NDRA 4X9XA 1H5QA 3NIWA 4AT1A 4ICGA 2GHYA 3X1XA 1FNBA 1G8GA 2G08A 2IF2A 1ZYUA 4U7WA 5G40A 3R8XA 1EXVA 3B1JA 4KP7A 3T80A 4ISCA 3V80A 2Y69B 2Y0EA 2A0KA 3UT5B 3P2JA 1T0UA 4NECA 2BVNA 4R81A 5BV8A 5EPEA 5DN6A 5JS1A 2HX1A 4MO9A 5LU8A 3QXXA 2F3SA 3ZZMA 3SJ7A 2B8NA 1QIMA 4JKYA 1DAFA 4J7UA 3RGWS 4IDNA 3ABUA 2AYXA 3REGA 2BFOA 1XJCA 1ZNQO 2OTLF 1K4KA 1P7VA 4Z4EA 4RUEA 1KOJA 3AG2C 2WLLB 4IXNA 1U3TA 2JIDA 1W5FA 2UUCB 1DOHA 4UVHA 4C0BA 2JGNA 1R6UA 3UAVA 1ZUHA 1I3MA 4QVKA 2GHRA 1D09A 1E5TA 1PJCA 4MDHA 2CK3G 1SULA 1V39A 3ABMB 1NXQA 2CTPA 3W6OA 4OPHA 2V7XA 3NHKA 2EFJA 3LL4A 3RA5A 5LGUA 5ALMA 3SPCA 1QP4A 2FWRA 2GPWA 5F23A 4R0MA 3IA2A 4PCLA 5HA5A 1BFDA 1YHZA 4O2BB 2OHXA 4MTLA 4Q4JA 3GA0A 4OXRA 5BORA 4UD2A 1UDWA 3VR6D 1ZWLA 4MUBA 4X91A 1JX9A 5K0JA 3AJ9A 5T6MA 3ZQ6A 3GBPA 4A0FA 2EIJB 4LXQA 2GRUA 1QOQB 1M6VA 1V0JA 4JKIA 5DMHA 5E7JA 4QO8A 4DKXA 4YMHA 3SK0A 3W2GA 1N2CE 3W34A 2PHZA 4US0R 2HPAA 2V7WA 2W58A 4GGPA 5DBOA 3PFFA 4JL5A 4DDMA 4HNUA 3G7NA 3S3XA 5DP1A 3QMMA 4ND7A 2QJFA 3C97A 2R1TB 4MJXA 2OZEA 2FSPA 1LRJA 4HEA6 1ZLZA 4UHCA 4AP9A 5KHGA 1QUEA 4WTOA 4E70A 4EYEA 2F59A 3C3CA 1QR2A 1PG2A 3KT3A 5I7HA 2H4HA 2FXIA 2VF7A 3ZCTA 1LDYA 1MXHA 5E1OA 3EVBA 4XTCS 4RE5A 4QBIA 4US1R 3FTCA 1QGUA 4ERXA 1MTOA 2JANA 1R73A 1OVGA 1FEZA 2M6KA 1E3DA 1TM7E 1E5QA 3I2HA 2NVBA 1RQRA 4GO1A 4RMNA 3BKXA 1GVHA 1ZGZA 1L5NA 1JALA 4A03A 5K4GA 4HTAA 5D87A 3RM3A 2F00A 1D04A 3UMJA 4YRPA 4F2HA 1TIPA 4BCCA 2Q3FA 4CDMA 4C8GA 1QZXA 1VJDA 2Q1WA 4BMOB 2BD0A 5JAOA 3ZXYA 4CTMA 2IY9A 2ENWA 4G07A 1V2HE 2WD7A 4G84A 2P4QA 4UDXX 3AB7A 4S24A 5IK2A 2IH5A 3F5DA 1YJAA 4KYTA 1DXYA 1SBYA 4H4CA 4DW1A 2I99A 2VDLB 1J06A 4NBKA 1AQYA 1NOJA 5IYCO 4UTZA 4QYMA 2YHUA 4WESA 1XRQA 4OYYA 5G41A 3OMWA 2Q5LA 2IC5A 1M75A 3U7JA 1UJWB 2ZBQA 3CLRC 5F98A 5JR3A 4EY3A 2FX3A 5P21A 1RI5A 3W7UA 2ZEJA 2FF7A 4RUKA 1W46A 2JBWA 3GFQA 1JIQA 5CD9A 3BHPA 3IBYA 3TNDA 4C03A 4EG7A 3SDLA 2J4DA 4BAZA 3U31A 5HJEA 2D2CB 3DDCA 3FMIA 5KVVA 2FW7A 1CCWA 4KUGA 3U3XA 3K0SA 2V45A 1V3QE 2EFCB 2XYPA 1AJPA 3RSZA 4YT2A 4Q39A 1KH3A 2V7EA 1QIHA 4WUTA 1C3XA 3NCTA 1WUKS 2ZSHA 1LSJA 3TSWA 4HDKB 2MJLA 1NRIA 3R3ZA 5DM1A 1G17A 4YWJA 2AI1A 5DGCA 1BWQA 2QGZA 4D6XA 1V1MB 3S02A 4OSOA 4W7IA 1AZSC 4ZU6X 3T7DA 4BX3A 3SJUA 1Z4LA 3EZFA 5JSFA 1S96A 3UH0A 4LY3A 3G6WA 5GVRA 4C0QC 3ER9A 2Z2ZA 2Q6AA 3JWPA 2JJ8A 4P98A 1TJ5A 4JR0A 1QRUA 2AE2A 2HEIA 4F1JA 3QA9A 2AG1A 2G0NA 3CSUA 1VCNA 3L7IA 4DZRA 4BLOA 2WU3A 4M54A 1Y4MA 3OF3A 3AESB 2I0FA 1M2VB 4NXNO 3YASA 2ZM6B 2X0IA 5JFGA 2I1WA 5CT5A 3N86A 1PE0A 1C0PA 1W34A 4BVJA 2IBZH 4MWGA 3B7WA 3TAHA 4FLZA 1XDBA 2Q3HA 5JARA 4LF9B 5L95A 2PE5A 3V7YA 4OATA 2GA9A 4WH0A 4NPHA 2WSBA 2Y4OA 3PT9A 4LVNA 3F1LA 1Y8RB 1ZVQA 3T52A 3BVPA 4EI2A 3R7SA 4D43A 5GIPE 4WK4B 2AZ2A 5C51B 5LDGA 3ZLTA 1PZHA 2Z2XA 1L1RA 2VYFA 2Z8YM 4LZOA 1JSRA 2Q8VA 2BZ1A 3B8MA 2IE0A 2KTVA 4LFAO 2H57A 4HQNA 2F55A 3I55V 2BJVA 4GYWA 5K3CA 3DO5A 1U1EA 1PQ4A 2ZW9A 2XTJA 4WKGA 3MBOA 4CCAA 1HE2A 1HYEA 2PRJA 4U3JB 4EPVA 7AT1A 2V7VA 3T7JA 3DFKA 1O94C 5DPMA 1E0AA 3GMSA 4I36A 3KZIZ 5AW5A 1V6CA 2OGZA 4MCHA 1OU4A 3IPCA 2F9FA 1VQOV 3BE8A 5KTKA 1U9CA 1ILEA 4WLUA 3AW9A 2ECFA 4F96A 2HGZA 2R8OA 1ST2A 4RA6B 1NVGA 2R5FA 2BMVA 2B6HA 3JQRA 1ZI6A 4F38A 3KTDA 2OPBA 1FXKB 1U04A 3LT4A 2UU9B 1NY5A 5CNMA 4RE6A 5K1ZA 4LQLA 4TMKA 5JU6A 2ZI5A 3MTGA 2QKSA 2VOJA 3TQHA 4PAWA 3QVVA 2GAAA 1TMYA 3IB6A 3OT1A 1HMPA 3A3KA 3FI9A 2OUKA 3PR3A 4N39A 2EKZA 4XDHA 1SIUA 4RHUA 1QRSA 3ACCA 3S4YA 1TJNA 5LWQA 1XHOA 3ABLC 1AD2A 5ELMA 2XOKD 3NAZA 2PKEA 3P9QA 2CLSA 4F93B 3CR7A 3LKDA 2ODWA 2ZTLA 2G09A 3WYDA 4OAPA 4INOA 4NBVA 1W2GA 1JEDA 3EX7C 2EVWX 3RW9A 3TPCA 5JMWA 4LF4B 3Q0IA 3ZHVA 3CCMF 3VI3B 4L5CA 1P1BA 3R77A 3GLTA 1G9TA 3JU3A 2ZIEA 1KYTA 1JIXA 1RQ2A 2YXBA 2X6BA 1O58A 1DTSA 2W8BA 3U1TA 2YWXA 5KOIA 3FYSA 3K73O 1XDZA 2PGDA 2IXAA 3MWDB 4S1OA 3L82B 2FPLA 4NZZA 5B7GA 3AG3C 5DHAA 5HMLA 3QOXA 2GPJA 1EM8A 1XKQA 5JNWA 4LYHA 1XQYA 3LA8A 3GNTA 4HDMA 1USGA 4B7ZA 2VHQA 3TRIA 3AEQA 4E13A 2XUAA 2ZRDA 2WDPA 4EJ6A 4R40B 3UNXA 4QNRA 4A2QA 5IBCA 3LUBA 1FOEB 2QVCA 4IOMA 5H80A 2LE0A 3NV9A 1JQKA 2VBGA 2VUSA 5TPZD 3E7DA 4BKQA 3N4YA 4Q9AA 2JKYA 3C4JA 4FFBB 4URFA 1U6IA 3IO3A 3ZIUA 2ZRBA 2K87A 4PGAA 4EA6A 2QTCA 5AJWA 1IVYA 2PH3A 4N3BA 1Q0RA 3UHAA 3TFQA 3BHNA 1EP9A 2XDWA 3MINB 3ELDA 2R4UA 1PQPA 2OQ2A 2V3VA 3EVAA 1G41A 1DS6A 2HDHA 3A4TA 3CRRA 1AKVA 3A2KA 3U60B 1J33A 3U0OA 1U2TA 4YRJA 2VWJA 5K3SA 4NCXA 3GDHA 3VPHA 1XDUA 2PRYA 1DWQA 1CLUA 1EFCA 2BR4A 4MB0A 1BQZA 2REOA 4F8EA 1YZQA 4WEQA 5TMPA 1YS6A 1YL5A 1R9NA 1VDMA 2UYGA 1H6AA 1YJ5A 3I72A 3K14A 3IGAC 3QEMB 1D07A 4GH5A 1O4VA 4QYTA 3AUYA 2YW9A 1EFKA 5E0OA 4XPIA 2ZREA 4N6NA 2ZRGA 4GBGA 3W8EA 3ZTYA 2NOAA 1M4UA 5KX5A 3PWZA 3AONB 4BNNA 3WK6A 4DHEA 1XVIA 2DKFA 3DKVA 4BV9A 2OSVA 2JKZA 4KR6A 1BHBA 3PDIB 2XA1A 2Y05A 2ZWOA 3O21A 3WWEA 1VTKA 3LCMA 1XV2A 4TYNA 1Z4KA 3LDAA 1QK3A 1FBTA 3KXIA 4M0CA 1Q43A 5IAGA 3W2IA 3ZHBA 4MS4B 4P81A 1Y4DE 1EFDN 2FSVA 1GG9A 3ANXA 1XMJA 4Z1MG 5HKBA 1X38A 1P8AA 3EHEA 4JI2B 5L7YA 3ZWCA 2VAVA 3VHXA 1I7FA 4ER0A 4ZO4A 3L1UA 1PZFA 3RDPA 1XB2A 4D0GA 5EPOA 5IABA 4CM4B 1U7PA 5T5QA 1GNLA 4K86A 2N1MA 4B3RO 3B89A 4EPXA 2V03A 2BOVA 3ZY6A 3C3TA 1TO2E 3HWSA 5DWQA 4RPCA 3CJRA 2JGDA 1K5SA 4GGMX 5FBQB 3KLPX 3I5XA 2F3TA 2P9BA 2ZJ0A 3ZV6A 4TS3A 3HZZA 5F73A 4G0OA 4F5YA 1IXSB 2A79B 2Z9CA 3U44B 3OZUA 2HRYA 1EJBA 5DLYA 4HUJA 3R0PA 1YTFD 1NVDA 5L4LA 3FFQA 3NG1A 3WMEA 3T7IA 1U2SA 5ITZA 3HO6A 3WKDA 3EODA 5THQA 4KR3A 4IBOA 4Z1MA 4UFOA 2VAWA 1I94O 4U2CA 3FWNA 4JWKA 3WAJA 4N48A 3CXCF 1UOOA 2OO3A 4RAIA 1FX0B 4CODB 3WIBA 1CLIA 3E9DA 3LDDA 1I01A 1HUQA 3GCZA 3CJTA 3BL5A 2QRGA 3FJYA 3BXHA 4E5UA 2DU8A 1ZGCA 1POXA 2QGNA 3EFBA 4BNIA 5D7NA 5GJVC 4BV3A 4DCJA 1J8DA 5CVJA 1FUUA 3HFRA 2WJAA 3F6RA 1HMYA 3MN1A 3LUAA 2QWRB 3WDSA 1PZGA 1W5BA 2FH5B 1CR4A 3G85A 3ISVA 4ZK2A 1HE1C 3F7TA 1UADA 1MR3F 5B4TA 4HX2A 3G68A 3TZKA 4XARA 3E8MA 3A04A 2OYCA 1U11A 1KE2A 3JX9A 3G7SA 4CKBB 4DUGD 2GBFA 4TMXA 3AGPA 3CMAF 3EG5A 4YAJA 1Z9BA 4LH6A 5A03A 4QVGA 4JZYA 4I1SA 1KYOF 2ACEA 3ZS8A 4BO2A 5AJXA 4GSLA 5TV2A 4WK6A 2Y0CA 3PHJA 4BUCA 1MNGA 3QEJA 3DWEX 1NAHA 3HDHA 2CW5A 2VUIB 5JQGF 5HK9A 3FYCA 4Y2PA 4LQ4A 3HYCA 1PKXA 2PY5A 2VN8A 1E3IA 3PLAE 3GJRA 4IZIA 2F7SA 3VR6A 1E5LA 3M84A 1P29A 1V5GA 3CLUD 2FK8A 1DHTA 3QWBA 2ORYA 5JVDB 3ZDRA 4DL9A 2LCAA 4D3XA 3V32A 2X23A 3WDKA 2IQQA 1QHGA 4H0LB 4JI0B 5HRUA 3JYHA 3INTA 5AOAA 2XDQB 5JSUA 2JI4A 5KLVH 4KUHA 1ESMA 4J2HA 3OZCA 3H18A 2ZQYA 4YY3B 3AG1C 1VFNA 1V47A 1I33A 2J08A 1KD1W 3CYOA 4FYJA 3PEYA 1JLHA 4M6WA 3V1YA 1CQPA 1P74A 2A1UA 2VUUA 1XAGA 4NEGA 1JQEA 1EFHA 1GNQA 4CEHA 2RHHA 4C0AC 4II2A 3EC1A 4D6PA 4J7KA 3CR8A 4MI3A 1YB5A 2ZR0A 2QN3A 4AJ1A 5DX8A 2O5CA 1J0EA 3WGHA 1Q1ZA 2VWQA 1YC2A 3ICCA 5DBHX 1YS2X 1CU1A 3BQMB 3SBXA 4NYKA 3CC7V 1UMCA 3GHYA 2FMTA 1E1YA 3MBIA 1NBMD 4LCJA 2QWOB 2WR8A 3N0WA 1B41A 4YLEA 5C32A 3I55F 3IR6A 1JQAA 1W6UA 2ZSDA 5DU2A 2R9VA 1WCV1 1UOPA 2YXNA 4V0RA 4J43A 4MVSA 2LPMA 1LPAB 3T5MA 1KZ1A 2XYRA 4U2EA 4WCVA 1S5HC 1S2DA 1LRLA 5DN9A 2RC5A 3GRZA 3L49A 3GPCA 2DBVO 3EUWA 4E11A 3EE6A 1XILA 1DKUA 1QHEA 2QTZA 2YRXA 3VNSA 1Z5GA 4BIZA 3P20A 4Y2GA 3W8DA 3R66A 5EXTA 4KBGA 1H2HA 1RYZA 2PANA 2JJMA 3B3FA 2PY6A 4B7XA 1NKTA 3DL4A 5BXYA 2P4HX 2ID4A 1BXRA 3UTDA 1HORA 1JUDA 3E3OA 2N9UA 1SXHA 3IUJA 2OCGA 2ZRPA 1KSFX 2B82A 2AZ0A 5KEIA 1MSWD 3K0BA 3WO1A 2YZMA 1JRLA 3CXRA 1A7JA 1N4CA 2NAPA 4C4AA 5BQFA 2PGLA 3REQB 3KQNA 2ZIFA 3TO5A 4CH3A 2I3BA 5ALVA 1WDTA 4LYEA 3OLWA 1KJYA 2FZCA 1OC4A 3D6VA 4XYEA 2OWOA 2VSYA 4TWZA 4C4WC 1R8SA 3EVEA 1G6KA 2A33A 4I5EA 4YRZA 4WGGA 1DX4A 4TT3D 2RHLA 1VH8A 3BRSA 1FYDA 3CIFA 1QRDA 3JYQA 2P91A 5F52A 3K1YA 5KSWB 2BFPA 1B2LA 2HHHO 1H6DA 1OKKD 2Z58A 4MJLA 4MS1A 3A14A 1ONIA 4CR6A 5ESWA 3GD5A 4CU2A 1N0UA 3FTFA 1HT0A 1MV5A 3WLRA 5IFLA 3Q88A 4RDHA 3JVEA 4BWGA 5TGTA 4BX8A 3ESCA 4GC5A 5GWXA 4M0UA 4DREA 2Q3MA 4NQ3A 2XGOA 2CVZA 1MXFA 1GRCA 2XNJA 4KLNA 3VC3A 4ZAWA 4W5JA 1C4WA 2IVFA 4BRWA 2QLBA 4JB8A 5H1YA 5IDVA 1YU6A 5HY0A 4IIGA 1YDWA 4P35A 1YO6A 1CXZA 2YJ6A 3P9KA 2GARA 2QVLA 3T1QA 1KAHA 3CLSC 3EZLA 1QVFU 4U8GA 3JZDA 2ZWMA 2N3ZA 4HAOA 3GJXC 1E6UA 3EA0A 1GYPA 2A67A 5LGTA 5BYJA 3JALB 3RSOA 3CKKA 1THTA 2JVIA 4M3NA 3RN4A 1X80A 1OC2A 1FL9A 4QRIA 3DKIA 1JHAA 1BOOA 2VBCA 1CQJA 1R6KA 1LU9A 3IKJA 2IXGA 3GHHA 3T3MB 1GU1A 3GMDA 3GGOA 3ASZA 4M1OA 4B71A 2X8AA 1RADA 2O1XA 3IXQA 3K5WA 4XM0A 3WLSA 5FLXA 1DBFA 2W0MA 1QGZA 4X90A 3UPTA 3BL8A 5K0EA 1EVKA 1Z6ZA 3LTNC 3C8DA 5GJCA 1MO6A 1UAGA 3QY0A 4WCFA 3NRCA 1F0YA 5AT1A 3PCTA 2A0XA 2EKDA 1UEJA 3UMYA 1OXTA 1ZJYA 1UBFA 2R6HA 1K7SN 2R84A 1HTTA 1QVWA 3UGKA 4F3NA 1SDSA 2O2DA 1ZEMA 1CUSA 1LPOA 2OCCB 1CUJA 3M6LA 3AIMA 5JLAA 1UBMS 2QX4A 4D6TH 5HF5A 4N47A 3FRHA 2DB3A 3WLIA 2ZRFA 3DDZX 1UBOS 4DVJA 1DCTA 1N1DA 1KZ9A 3IVXA 1VSUA 4NF2A 5GTDA 3K05A 2GN0A 4B6RA 3G6EV 1AHHA 5BVGB 1X3SA 2PXCA 3TQQA 5DYWA 1LNZA 4ND2A 5AG2A 2P5OA 2GJAA 1OTXA 1BQEA 1DRUA 2PGXA 3A4MA 1ZH8A 3NNDA 3DOCA 4EJ0A 4JD5A 2CGNA 3A4VA 4UUNA 3FFMA 4EIWA 2H1RA 2VSOA 3SFVA 3ZCQA 3C6BA 1U9YA 1XD8A 5LZ2A 3Q8LA 4JT4A 3F71A 5F7ZA 3KT6A 4UQPA 4EUEA 3BA8A 5AK4A 1PF7E 5TPWB 1ZICA 3WY9A 2ZYVX 1BGYH 3VNVA 1L5OA 1X92A 1X7DA 3NAGA 3MUEA 2QX9A 2BGTA 4NZOA 4JOQA 1M57B 5EAIA 2C4HA 3WOVA 1VA4A 5CUQA 3H5AA 2UZ4A 2X41A 2ZUWA 2PZJA 4E6EA 3AGKA 2R8YA 3BCHA 4YRQA 4CQMB 4IGFA 4EFNA 1ND5A 4J0HA 4O2AF 3ZMUA 4KIFA 1GUBA 1H0SA 3DZIA 1WJGA 4C20A 4BMNA 5CGZA 3M34A 1SCUB 2Y1DA 2IV2X 3KYCA 2C00A 1OLSB 5I7OA 1KI2A 1T8UA 1DPFA 1BKSB 3JZMA 4OKNA 3C1UA 5J47A 1WB4A 4TWAA 2JG3A 2NYRA 1PTKA 4MV8A 5TPZA 3N75A 4EHLA 3RQIA 2UXCO 4WCEV 1UIRA 2GFQA 3H8SA 3DQZA 4CG2A 4CMIA 3F9CA 1K4DC 1LUAA 4QQNA 4R1SA 4YCSA 3WA7A 1YCHA 3QKSA 3AMVA 1O3YA 2ZI3A 2FFRA 2RGCA 1SIWA 4Y2XA 2HJGA 3W1WA 3B48A 3WGMA 4P4NA 4F1KA 2WVGA 4ALNA 2HI0A 3RIHA 3QELB 3OIFA 2JLAA 4WY5A 4H3KB 5T64A 1BH6A 4EABA 1IBCA 1E79G 5ALXA 1Z2OX 3LQKA 4BXOA 2B35A 2Q7XA 4Y18A 3KCXA 1WJZA 1K06A 3DOFA 3AG5A 1BEEA 4Q01A 3ANLA 2G8LA 4PC7A 2O0LA 2HDOA 3NT5A 2PL9A 3BIWA 3S2EA 3R8FA 1MENA 3JAMA 1EA5A 1H42A 3CEIA 1BCSB 4CDGA 4N0PA 1N2EA 2LDXA 2EW2A 3CCRV 2QZZA 5IHPA 4OUKX 2GCEA 1YDMA 1AU9A 5GJWC 3R6WA 3TNLA 1NZDA 3PB3A 3JS5A 3TCUA 1OX5A 2X0NA 1QAOA 4B6SA 5BWOA 2QTRA 1JDUA 4MQLA 1LSUA 3BXZA 5I8WA 3PD1A 3A3NA 2CT8A 2OXIA 3OTQA 2A9VA 2BKLA 2W6JG 3FNFA 3Q4HB 5EXXA 3K0AA 4MQ4A 3ZRWB 3PQDA 2X2EA 3IC5A 1E79A 2PZMA 3VR4D 1UJNA 3BA1A 2GDSA 1NRXA 2IF0A 4LDRA 1MP0A 3SR4A 1IV3A 4EF4A 1ESZA 1QFZA 1CERA 1JXMA 1M2GA 2ZZNA 2CNOA 2BEKA 2FWJA 1QX4A 4PTLA 1SXIA 1EJ6A 2O48X 3FF4A 4DA8A 1M7GA 2MMGA 4G01B 3B2EA 4V1CA 2X1LA 4FJCC 1GN2A 1LZLA 3RSHA 3HPLC 4X8OA 3B8HA 2YFHA 1EGQA 1WSAA 4WN3A 4A7PA 4GOJA 1FRQA 5C1OA 3BGWA 4AKSA 2PLFA 1ML4A 1MABG 3FTDA 4IDPA 4QTUB 3CUTA 1VMGA 1ODFA 5JMPA 4NABA 2QKCA 2PKWA 2CNDA 5IJZA 3VMMA 4EY6A 4RTQA 1N57A 2W6JA 5DYNA 3TE6A 5BN5B 3P2KA 1UKYA 1OT3A 4JI1O 1M34A 4H4EA 3VAZA 2JFUA 2F4VB 2ZJFA 3ESQA 1K5QA 3GJ5A 2R6DA 4AQDA 4FTWA 3C5CA 1KY3A 3ESXA 3PHBE 1Q15A 1V5IA 4G1FA 3MLAA 2OLJA 1JG1A 4ICIA 2DPLA 3OQIA 3CUUA 3U4HA 1V48A 4CLHA 3WJRA 1ZD1A 4B6FA 2H94A 3GRPA 4Q1BA 2Q2WA 4M2LA 3S5JA 1IK6A 1W9MA 1WX1A 4OK3A 2BDEA 2CFOA 2YICA 4YHHO 4ZEXA 5DLPA 3SIVA 2J0QA 4R2JA 3X2FA 2V4UA 3IOYA 3K5NA 1XHFA 4R6ZA 5DM4A 3IV7A 1MABA 1XZGA 3PNKA 3KOWA 4KE7A 3KJXA 1QH1A 1CP2A 2Q0QA 3FIUA 1C7ZA 4LS3A 4IVRA 2F17A 5MHTA 2X8LA 4DR1B 3M6MD 3IAFA 3R3VA 3VAYA 4HH0A 3LU1A 1JG3A 1GM5A 3WSTA 2K2QB 3NHRA 1C9KA 4YK7A 2QAGB 4K9LA 5A3QA 5MDHA 3PZRA 3KSBC 2ZVPX 5TRTA 4LMRA 3H8WA 2PQMA 1IM2A 2YV1A 4ZVLA 3W79A 4ACAA 3DUWA 3GNLA 1YQ9A 5THKA 2PHNA 3UMCA 3N5KA 2XR1A 3G3EA 4QGAA 4TRNA 1SXJB 1M6WA 4CW7A 1FS0G 1NONA 2R85A 3RAJA 3FYUC 3L4BA 3D1LA 3SI7A 3WL4A 3HH8A 1U90A 3EIHA 4KQJA 4HUTA 3HU5A 5E8JA 5MGNA 2OE2A 1X7PA 3MGAA 3SYNA 4MH0R 2V6GA 1V8OA 4NYJQ 4TXJA 3NI2A 1UJMA 1Y76B 4OGLA 3OU6A 1XNJA 4DM3A 3SR2C 3RU9A 1NBMG 2VHCA 1V25A 4DUZB 5CXQA 2JH9A 1T43A 4TQDA 2NNWB 3ZPXA 2HK7A 2IYRA 1W8IA 1SK9A 1QYWA 3ZK7A 4B7AA 4K88A 4I0XA 5BUZA 1E6KA 3I01M 4H7EA 4P58A 4BVQA 1LK5A 4KXNA 1NM5A 3KZNA 2FZEA 3SIWA 3FD8A 1T36A 4IDBA 1Z4OA 4B3GA 4YJDA 4MSWC 1IRIA 5LMNO 2ECOA 5EI5A 4R5HA 5JFOA 1M7HA 4GZ3A 1OZ0A 2VNKA 5DBGA 3ZWXA 3SQLA 1ZI9A 1OV6A 3PFIA 3S28A 1ZPDA 2B0CA 1XIVA 4TZ6A 2QBYA 4OUDB 2JW5A 3AHEA 4KE6A 1LWNA 3CSSA 1QIFA 2BHNA 3NHBA 3B1WA 3B5EA 2O19A 4F4LA 2O50A 3ZDFA 4CMKA 1N2CA 5CIYA 1HDXA 1II8A 4IYRA 2P9TA 1ROPA 3KG2A 1KDYA 3ZD8A 2IXEA 4K9KA 2UXBO 3C4QA 4WNAA 1DKMA 2BLNA 2YY6A 1P1JA 4ROSA 1E8NA 1F7VA 1EK0A 1H1TA 3ZHSA 1WF3A 3PQ6A 4P93A 4KVFA 1QVGF 1VQ5V 5JASA 1M0WA 3HKEB 5DULA 1WVGA 2BONA 3FHTA 3T0GA 3LUDA 3QUCA 2BEWB 4GQIA 1F4MA 4CTJA 4YR7A 4F11A 5EE9A 2K6GA 2Q3EA 3UJ3X 4B84A 4JB3A 3JPWA 2EJ7A 4TT3G 5H0IA 5EIAA 1I3OA 4Q05A 1WCWA 1A9PA 4TTQA 3AVYA 4HDAA 3U6KA 1NM5C 2ZIAA 3BJMA 3KQPA 4YDRA 2XIQA 4AZSA 4D74A 4OPMA 1X8KA 2JFXA 3M5CA 2ZM5A 3TQTA 2J0VA 1O54A 2M6YA 3G13A 2AKYA 1T2VA 1NJIH 2P9FA 3NKFA 5DX0A 2DG2A 2FEMA 5JW6A 4DBZA 3MWEB 2B4YA 1XZPA 4FZJA 4JXZA 3EQ6A 2ZAUA 1JJ2U 4ODIA 4UNRA 1KEEA 3KHSA 5TQVA 4RIGA 2QN2A 3AR9A 4JT2A 1ZQ9A 3W3ZB 1E2QA 1U7WA 2IYSA 1KEZA 3RYIA 1YZYA 1DOZA 5BWMA 2LP7A 3HCBA 3UFXA 4DNFA 3G6EF 3MCWA 2OHWA 1BX3A 3P2IA 2X5JO 7ADHA 5JNVA 1M83A 1IZ3A 1AI4A 4CU5A 3B2EE 2PL5A 4TT3A 1OZAA 3E86A 2JAHA 2EW1A 1XMPA 4MP3A 4NV3A 3JVIA 1BA3A 3KT8A 3D6JA 4QFMA 1OH8A 4YFYA 3FD5A 1VPDA 1ADFA 2OO7A 3TLXA 4LSGA 4TWJA 1JN0A 5FL7D 3ITNA 1ABEA 3C3JA 5DSTA 1PD1A 4IOKA 1SZCA 1WDMA 4C4ZA 3GUCA 2VP9A 4GPIB 3QV1A 1FYWA 3D3EA 5CBKA 1ZA1A 1M34E 3RT7A 1YIJV 1JVBA 2WG2A 2GVNA 3IPAA 4BGVA 1KA9H 3F9RA 3N6VA 4GG1A 2FR8A 4EYQA 3BIOA 3MAQA 3JVVA 1XLTA 2WYOA 2DR0A 3IX7A 3V8BA 4YAGA 3AT1A 1K3TA 2AOTB 2NZWA 4YRGA 4CVNA 1MEEA 2Y68A 5AI4A 4RBNA 3ASYA 1WN7A 1Q7RA 2GYYA 5CEJA 1K3EA 3QTBA 4KO4S 2VDNB 2P5YA 4OBBA 3RS8A 3K2IA 2ZDHA 4PRLA 1MX5A 3F6PA 4F2PA 2XTNA 3A36A 2HMYB 2V7PA 4OGWA 1QHSA 4AY4A 4X6XA 4BFXA 2OBYA 3P0HA 4L6AA 5EJMA 4Z7OB 3PHGA 1VI2A 3LDTA 5CHEA 1V5WA 4K35A 1UKBA 4X41A 3NR7A 4HNRA 3NB0A 3TEJA 4P83A 3T5CA 3OBWA 2W2PA 2NPOA 3IAAA 3D3IA 4D9BA 5KC8A 1M1ZA 1TRHA 2E87A 4A8JB 3EQ9A 3IP6A 1NMXA 1QOPB 4U7DA 3MXTA 2DYRC 2CJXA 1DIBA 4OHCA 3WK8A 1RRGA 2JLWA 3E1YA 4JYBA 3KZKA 2AJ8A 2PPVA 1I7DA 3V1NA 4EO4A 2XWJI 1BGXT 1GL7A 1FSSA 3ONVA 3WLAA 4DV2B 1J2UA 3I23A 1V6SA 2A9FA 4PZPA 1KEKA 2JIBA 4AMYA 1HQYE 3WQRA 3CCRF 1KEUA 3Q8WA 5E6SA 1VL8A 1OJ7A 5K6RA 3HBLA 1W8DA 1WO8A 3SJAA 1D8TA 5JS7A 3BORA 3MCAB 4FFWA 1CR6A 3FSRA 1YQGA 1KOFA 5ERGB 4PLYA 2GM4A 4GZRB 2CUTA 4XDGA 2QGFA 4GMDA 4MS3A 1UDCA 3E20B 4I9HA 3DWGA 2A0FA 5FTMA 5TQ0B 4R1NA 4ASUG 4LRQA 2VQFB 5HE9A 1MHPA 1YCGA 1HPLA 1JFFB 1R15A 2XYGA 3OHPA 2WM9B 3K0FA 1R1DA 5E4FA 2Z30A 4YAOA 4R84A 1UPCA 1CYEA 1DDIA 4V0LA 5PNTA 3I2YX 3WQQA 4OO3A 2XRYA 3L7QA 2C07A 3V1LA 2AC4A 4M8KA 4WNIA 3ZY3A 3KOXA 2FOLA 2JAXA 3AUUA 4OFXA 4GVLA 3VIUA 3M6VA 2ZJ2A 3HC7A 1IHUA 3A6DA 2WTBA 4TN5A 5K6AA 3M0EA 2Q7HA 1NBME 1DPGA 4MRMA 3SZOA 4UUAA 1R5NA 3UK0A 1IN6A 1GTL1 4D3ZA 4AS3A 3ZZ0A 3OFKA 1CUXA 3MJCA 1TVCA 1NY6A 1RHQA 3UQZA 3DZCA 1GGKA 2HHJA 1HDIA 5GIPC 3N8KA 1TYAE 2CK3A 3SJAC 2QJ1A 2RI0A 5AM2A 5I4CA 3R3XA 5E2BA 4ASUA 2ATIA 4HBNA 4LXHA 5EXPA 4H1TA 5G4LA 3NIDB 1ETHA 1KQNA 1PFYA 2LUOA 1NYQA 5AOCA 4A0QA 3MLBA 2R72A 3I9LA 2XMQA 3AKEA 4PZEA 1YZTA 4MA0A 3O5AA 4V0KA 2QG6A 3NEJA 4I9QA 1P5ZB 1FJ2A 1GQOA 2Q9CA 3HADA 3HJFA 1QLHA 4MAMA 3S2IA 4NS1A 3N0TA 2DQKA 3NX4A 2OA0A 3R4CA 1M10A 1YL7A 1JJAA 5CYFA 4X1KB 3U0ZA 5ITVA 1S1MA 3D6UA 4P0PB 1FSFA 2WIAA 2BSKA 3W5JA 2NUBA 2PT5A 1NYLA 2AR0A 3I9JA 5K8TA 2VRZA 2QY9A 4QLOA 4FSDA 5IC6A 4F45A 5IS2A 2XAAA 1JR6A 4DLZA 5BPFA 2WAAA 2FWBA 2XXBA 3SFZA 4QQRA 4TLCA 3UJBA 4IR7A 1BE0A 1UK6A 4O4LA 4H6XA 4JK3A 1OA0A 4NY1A 2G04A 2FW1A 4RS4A 4ZHQF 4AP6A 3FB7C 2MYUA 1AK1A 3B38A 4I14A 3RARA 4Q4AB 3D3JA 1VM6A 1UWVA 4NFHA 1YS9A 3ORFA 1CZRA 2IPMA 3WBBA 1FFYA 1Q8RA 5MN5A 3KOZA 3ICXA 4J10A 1QM5A 1T34A 1NUQA 1YBFA 3JSAA 3ITKA 5G2OA 2IHYA 4HAZA 4ZDKA 4MW1A 4IQ8A 6ABPA 2C2GA 3UANA 4WLVA 5LNK6 1JFVA 2JFVA 1XNRB 4FK8A 4MHOA 3AP2A 4NI5A 3MAJA 4GX2A 1R27A 4Z3KA 3GGCA 3OEED 5HHTA 1NLFA 1ITZA 5JJKA 4TQ9A 2PNJA 4A4DA 2RSLA 5IKXA 5JS6A 3BXPA 4ND8B 3I3FA 3HEAA 1N6KA 2WOJA 3BABA 2WJYA 2CVPA 1CQXA 5K09A 4Q3BA 3TNFA 2HDNB 2QT1A 4CXMA 2OHJA 2HWXA 3H9EO 1M8JA 1KY4A 2C9CA 1WAMA 4YT8A 1RRVA 1PUJA 4BQQA 3VR4A 4YRKA 5KSOA 1T6ZA 4WOCA 2QWNB 2ACWA 2G38A 1AKRA 1I4DD 5AVYA 3OZTA 2EJWA 1G8JA 3LWPC 3FGOA 3FD6A 2FPGA 3ZHZA 3DDOA 4QU0A 2VUTA 4CTNA 4ZYUA 5BRJA 3E2IA 3TGWA 1QDEA 4Q3LA 3U7EB 2Z2JA 3THYB 4L76A 4RCYA 4F9GA 1Z2NX 1UPFA 3KJFA 5L3SB 1C2TA 1KXZA 1T35A 2O0HA 2NUPA 1SQBH 1GU0A 5FUVA 3TOCA 4NU8X 5CTJA 4KLRA 1E1RD 1YKSA 2MSDB 5TSDA 1RS0A 5IHXA 3H0CA 4IQ0A 1WHSB 3WP1B 3P94A 4MW9A 1SKYE 5FI0B 3M7MX 1VIYA 3GG2A 2WSSD 5DNCA 3Q72A 1PEAA 2GBIA 1MB9A 2C99A 3UFBA 2JK0A 5DYTA 1HOTA 1WP7A 1XJ5A 1SETA 4ZPJA 1TVEA 2WNHA 4D99A 4CMEA 4IPTA 1WBJB 4AJEA 3EQ7A 5C8YB 1XMQB 5KUTA 2P22C 2E18A 1ENYA 3FZNA 3IEVA 3MCTA 1UXHA 4N21A 1MT0A 4L95C 4IDFA 1B0PA 5KREA 4WZ6A 4ZVNA 5I01A 2RH4A 3CTMA 3TJTA 3MTBA 4BYMA 4GUNA 5AQEA 1HRDA 4G25A 1JW9B 1G20B 3WL8A 1D2HA 2WD8A 3QV2A 4CRWB 3Q1KA 1PV0A 1S89A 3BSYA 4FFPA 4BT2A 2CH7A 3WKEA 4LEIA 2PS1A 4LC0A 1BYIA 3D6TB 1WEKA 4GICA 3C1OA 5JANA 5T3YA 4D79A 1U97A 3E2EA 2ZGVA 3KUKA 3QM1A 2RGAA 1XSEA 2GXSA 4QOFA 5FLYA 4CMCA 3E05A 4OQFA 1W85B 1QBGA 1SIBE 1JD1A 5KAIZ 3IVCA 4EFLA 4X84A 4ETIA 4RZ2A 1MAHA 3TLYA 3JQQA 3CC4V 2Y93A 3VVMA 1SUFA 4HDRB 2AZ4A 2V96A 1F8YA 4F86A 5J2TA 4MGYR 2EWWA 4N5LA 1TTTA 2DN9A 1RP7A 4H3HB 2HQ1A 3N27A 2HVYD 2DMRA 5F7OA 4IHKA 4CMEC 1XQWA 4AMUA 4RFSB 4R7TA 3QO8A 1MC5A 3E7WA 4AMVA 1UDBA 2HD4A 1CEEA 4ARZA 2G25A 5G3YA 1D2EA 4MKXA 3LSTA 3A1WA 3GJTA 1OXSC 1USIA 3VR4H 2X6RA 2LBXA 4H6PA 1WP4A 2F3QA 1L7AA 2C9MA 3U4QB 5G1OA 4A92A 1W0CA 4S3MA 2DYSB 5AM3A 4LF8O 5LDHA 5TNXA 2Y1LA 2FP4A 2RGBA 5K3EA 1I7QB 2XUDA 2JAOA 1DC4A 3H2BA 2F43B 2BW0A 2FCAA 5ALIA 2VJAA 3OP4A 1QHTA 3UEOA 1NP3A 2HIGA 4KGXA 4AXBA 4A23A 4GKJB 4IFIA 3JQGA 4TL7A 4I55A 1BMTA 4QOSA 3H0EA 1GP2A 3OP1A 5H5JA 2FHSA 2BFDB 1L8OA 1N6LA 4EVSA 4GM1A 1DBVO 4EF5A 1OHHG 5LKRA 4EH1A 1NUUA 4W5HA 5B1AB 5CFQA 2GEBA 2CE4A 1ZA2A 2FSIA 4IXWA 4MRRA 2O8EB 1GZ3A 4H7IA 3WYCA 2B4KA 1YE8A 4Z3OA 1VLQA 4AJ9A 2FLWA 1DT9A 3HZOA 2Y1EA 4JXJA 4CV2A 3URMA 1FMCA 3J81k 4HPJB 2V6FA 2I6GA 1PFWA 3FUXA 2XUKA 2R8PA 4MWOA 2PUHA 2H0RA 5KYUA 3M6UA 3PXXA 2ZCEA 1VXOA 4TLAA 2C8JA 1QV9A 5TR9A 1ZCZA 4I6EA 3TAUA 2LKDA 3AWDA 2HHLA 4CQNA 4HDSB 5HQ3B 3ZGZA 4W8HA 3AVUA 4PZAA 3VZSA 4EG6A 4CC5A 2GN2A 3L8ZA 2NSHA 1TJPB 1VLMA 5B64A 1OHHA 1U28A 3PIRA 4YJHB 3ZTTA 1ZCFA 3SC2A 2QLMA 3RC8A 5A5VA 1RHRA 4WBNF 2PD6A 4FVMA 1W36C 1YDFA 5EWMB 5HEKA 1P7BA 2EULA 3PFNA 4PYQA 3KR9A 4LCUC 1EG2A 3TVTA 3I9V1 1CFZA 1KI3A 3L6CA 3HE3A 4TVSA 1WW8A 5ALLA 4GPBA 4YQFA 5FL7G 2WA2A 4H7DA 3PLAC 3D3NA 4AMGA 5JNRA 2W8BC 1J00A 3VUEA 1YDHA 1KI6A 4EG4A 1XHXA 5KBYA 1FMLA 5KJFA 1ORQC 3UWMA 2WHPA 3B70A 4KGVA 1EESA 2A9JA 3RVPA 3AIKA 3E81A 4ZRNA 4OK5A 4Q4HA 3UWPA 1IN8A 1A1VA 4IUYA 2YWHA 4U7GA 1C50A 1IV2A 5HTOA 2MIIA 4O5AA 4QQ8A 4RSRA 5BN3A 1F9AA 3EBPA 2X9VA 1PKEA 4CGZA 1JLMA 1P3Y1 4ALIA 4G1CA 4G1EB 1VF7A 2WWGA 5C5DA 1U28C 1OH5A 3SQWA 1XRSB 2HMSA 1FNJA 2GPNA 4TYWA 4R2IA 5AJTA 4HGYA 3J81A 5FL7A 1PT7A 1A9QA 1O6FA 1ZAKA 2GXUA 3GUUA 2AX3A 4CV1A 4KP4A 4HAVA 3RWRD 1QZUA 4JASB 1T2AA 1OCZC 5IUJC 1HA3A 5CXXA 3EZ9A 4NZYA 5IN5A 3FPFA 3PPIA 1HV8A 1S2OA 3EGCA 5IWAO 3EGXB 3D43A 3IEUA 4HQ6A 4OI4A 4EVRA 5K1XA 5DJ5A 2FSUA 5HGJA 4QDUA 3X1JA 4DC9A 4FFNA 4RHTA 4QUGA 2VBFA 1I1NA 1T8RA 3RAGA 3GQBB 3CRAA 1HNXO 1Q91A 4XPZA 1CZHA 2RK6A 3K0TA 1R1MA 4KBFA 2YOFA 2NTJA 3SLRA 1L5FA 4JNCA 3K5HA 5J43A 3V8VA 4UE6A 4RULA 3LHSA 2DWEC 1C4KA 5LBUA 1BL8A 5FWYA 3TKAA 3VA7A 2XA9A 4NLLA 2P65A 4PZUA 3N8DA 4DA6A 4RF2A 4CE6A 5FPPA 1Z8NA 5ER6A 2OFWA 2ASEA 4C8IA 1JMKC 1SD5A 1YJNV 1FRNA 3T5TA 4ZQHA 5KYVA 4MVJD 2V9CA 3P2OA 4BFVA 4YMSA 2F2TA 5DI9A 2CLIB 5AIAA 4ENSA 3HPQA 2J3JA 2FSVC 4N12A 4YCJA 1E9BA 4JEIA 1RHUA 3C7DB 2VF8A 2WAXA 2CXHA 1D1TA 4IQFA 3ND8A 1IJKA 2O2ZA 4ESEA 5EYPA 5CA0F 1E20A 1H66A 1RTTA 3SLGA 1E1LA 1JFTA 1TT7A 4BW5A 4HS9A 4FZ3A 3LPNA 3H2SA 1FP7A 1RJ9A 5ALEA 3CVWA 2YQZA 4TWRA 1KU6A 1NVPD 3D7RA 2YL2A 3RROA 2P2LA 4XD2A 4Z4IA 4EAAA 1Z5WA 5FWNA 5DXJA 2Q0OC 4WVFA 1M72A 4PQEA 3KZMA 4R2WA 3F5QA 2H1OA 4EPTA 1DRJA 2O6LA 3CC8A 2RH5A 3C6YA 4F3TA 3ZD7A 2I6SA 4AQYB 1J25A 3KP1A 4UTVA 2XODA 1WCIB 1I7NA 2C7VA 1BQ3A 2EDCA 3M99B 3L0BA 2E4VA 1IXYA 5HCUA 3GGGA 1RWKA 3ADDA 1F3LA 4UASA 4FIZA 2OAQ1 4G36A 3R1IA 3GELA 3NTQA 3IPRA 3RW0A 1JN1A 1FP4A 2W48A 2W6ID 3TCNA 1Z17A 3N2EA 1C3OA 4TWIA 4J11A 5AKLA 1LCIA 5SV2A 1EXWA 2NUAB 3ROQA 5DWDA 1TZBA 3BMQA 4IHJA 4BTVA 1Y8ZA 2BM0A 1FTGA 5CCDA 1Q86H 4R98A 1C7FA 1DG1G 3EGOA 3IDOA 4DSAA 1PFGA 3BMXA 1KAEA 3Q15C 1L5ZA 1ZBDA 2JGJA 3RUAA 3DKKA 2Z5UA 4UOEA 2XBLA 9GPBA 1FA9A 1W0JD 1N8TA 4NMLA 1L3CA 1NVAA 3E22B 4NENB 4YRBA 4WI1A 4O4HA 2BKXA 3K9QO 4CKXA 2DVMA 1G5FA 5I7SA 1RC8A 4NULA 1ST3A 5B5EZ 4L8JA 4H7HA 4FFMA 4IJQA 1XTIA 3I5MA 3KJEA 1QHHB 2Q28A 2Q1XA 1J2EA 2FN4A 3E48A 2ZUFA 4QJIA 5I7AA 4UKDA 4Q21A 2XTZA 3ZS8C 3F0DA 2ZVYA 2GEUA 5LHIA 2C5HA 1X70A 1A8PA 1F0PA 2ICAA 4XKJA 3LC7O 3BXEA 4L8LA 1HFJA 4EG5A 4CH6A 3EXAA 4DLKA 4F60A 4XWYA 4Z0TA 1KY2A 1Z0JA 3HAXD 4ZK7A 4DJDC 1PJSA 5C3MA 5ESRA 4YQEA 3HL0A 4Y7CA 4G1MB 4QTXA 3WJ1A 2NP7A 3O8QB 4LJLA 4PIVA 4OP3A 3H4VA 5BXZA 2JLSA 2ON6A 2P3LA 4Y0NA 4MAFA 4LMPA 3J7AU 2JEZA 3OEEG 1DEOA 4K6KA 3MELA 1OYOA 4A1FA 1VQOF 1XZJA 2IXDA 4M46A 4MUKA 2NSLA 2PF4E 4JEUA 4DO2A 3TSOA 1I13A 3KDAA 1NE2A 2VIIA 3MWGA 3VOUA 2IKQA 4JHXA 1P2UA 5TF0A 2ZR9A 5KDLA 3CSXA 3WDMA 4PV7A 4JCCA 2Q99A 3ZHYA 2AVNA 1SBHA 5LFAA 4G2NA 4UAVA 4TVOA 2HU5A 5LLTA 3HY3A 4WSOA 1M8KA 2Q5OA 3ZG6A 2FGJA 2R48A 4MV7A 1WPBA 1MW9X 1XRPA 1IUKA 3CX3A 3FCCA 4LJYA 1ICEA 3F6YA 4TPKA 2MINA 1DZIA 2BMEA 4YREA 4B4VA 4DF3A 3OEEA 3FI0A 4Q34A 3OTHA 4PDRA 5AR1A 1N3BA 1E1RG 3VPDA 3CEAA 2BH2A 5TMEA 2ZRJA 1PG5A 2A14A 3G8BA 2F9LA 4F84A 2WSSG 4P0TA 4AUNA 4DMFA 1DWUA 3KTAA 5J4KA 3ZJUA 3JD1A 2OZPA 2Z1UA 3O4VA 4PG6A 4Y1EA 4QPDA 1U3GA 5T4EA 2V54A 2GAOA 2ONYA 4YRIA 1AB3A 5EIWA 3ZDYB 3EIUA 2C1XA 4NXMO 3B6JA 5B6JA 2D3WA 2OBMA 5BSGA 4X66O 4Y9DA 2GOYA 1PS9A 1QHIA 4S2EA 4L3OA 4L51A 3A1UA 3FDZA 5AW9A 3UKOA 4X6LA 6Q21A 4PXYA 3HXLA 3EGVA 3EC2A 5HS6A 4KWCA 2FEAA 4YIKA 2VJCA 4AECA 4KJZA 1E1RA 2WFZA 1K7EB 2PBLA 4QXQA 2VHEA 3A10A 3IOCA 3VR1A 4ERNA 3EDQA 2WSSA 1XF9A 5B3SB 3CX6A 1FQJA 4KN5A 4PSCA 4DIDA 2ZDIA 2BP7A 1P1KA 5CX4A 1APBA 1VPVA 1CF9A 1FFCA 2FUNB 2GN1A 3QU7A 1LDGA 4GLXA 1YQDA 3P9CA 2AHOA 4ER6A 1FU4A 1WUIS 4QUDA 1AJNA 5C7YA 4JJGA 2XRMA 1H2EA 5A02A 4F56A 5JATA 4ZTZB 3TN7A 5F1KA 4Z9AA 4Q3NA 2O20A 3BFPA 2AXQA 3MRVA 2ABWA 1R12A 2QDOA 4DDTA 5CD1A 3FOZA 5JMOA 4ZYWA 5IKEA 3IUQA 4Q1EA 1TGYA 4N6OA 4C89A 6REQA 6YASA 1RLMA 3SF8A 3REOA 4GIBA 4P8RA 3G6KA 1L5QA 3U1BA 3PT5A 4D0LB 2ZVZA 3EIXA 1KOLA 3ZLJA 1DTEA 2XOKG 4FDTA 2MW2B 3KELA 1VB5A 3ZQ4A 3ZE8A 3ZEAA 3AKDA 1SZQA 5CVTA 2QSJA 1VLZA 2D1YA 1WL8A 1L4UA 2PT9A 4BMSA 5JBNA 3NLLA 1OWMA 4UBNA 2P6YA 1US6A 2JATA 2PKQO 3FNEA 5ED0A 3GEGA 3HXPA 4D98A 5JSZA 1W30A 2BTEA 5REQA 4N9WA 2QTMA 1L7VC 5T67A 5EE1A 2JNBA 5FWDA 1NN5A 4X88A 1WD5A 2HWUA 2XZLA 3RC7A 2Z1FA 3C39A 4RL4A 1PNLA 3GRAA 3L8MA 1NVWQ 2AOVA 3DBRA 3KE1A 4LC9A 2HA3A 2B25A 2XOKA 3QPDA 4EFBA 1M0SA 1C7IA 2KYRA 1GKUB 4QATA 3N1UA 1ZIPA 1GSIA 2E5WA 1RJDA 3F5SA 3MJTA 4KO1S 3VJRA 4ARCA 3RVZA 3WMXA 1ZEJA 4U00A 4PC2A 4OAQA 1UKEA 5IDQA 4IF4A 1UJ4A 3DVSX 1YFKA 2HCJB 2CMGA 4WCFC 2OG2A 2PVSA 4O0MA 1IEVA 3TECE 2JHPA 4GPAA 3I52A 4F12A 1YB7A 3SDBA 2MSKA 4R1LA 4COKA 5IY5C 1ZL0A 5BVHA 5KA6A 3GWOA 1COZA 4G4SO 4DLYA 3VKUA 5ALFA 1XPRA 1N9GB 3P10A 2NT4A 4BT6A 2AIFA 3ZVNA 2O3SA 4HTFB 5EJIA 5H6QA 2G9UA 1NH2B 1OAOA 2O3RA 3WLPA 3G9QA 3NP7A 3UY4A 1KEWA 2Z1MA 1GD1O 2Q3BA 1TQ8A 1E9CA 2IHNA 2G1UA 1FDTA 1N32O 2M6SA 5COBA 3RU2A 4G1UC 5HTKA 2HXSA 4DW8A 4B3SB 2NLJC 1O2DA 5K8JB 3CZCA 1NU6A 2PL1A 1N8KA 4ALMA 3ICQB 3JQAB 4ZV9A 4BBAA 4ALLA 3B09A 1NL3A 1Z0AA 2HGSA 2BFFB 2OZBA 3GGPA 2D3OW 2WTUA 4F06A 2VKQA 4Z86A 4TKLA 1JEJA 4RK0A 4PO8A 4KQWA 2G5TA 4IDDA 1DJQA 4OQMA 2ZSAA 5EZYB 1XL4A 4LOAA 4MVOA 2AOUB 2XBMA 4PIPA 2LXNA 4B3TO 1IJBA 2XAFA 2Y4TA 2XB4A 4D8UA 4H7KA 2LZ0A 2M32A 1UDRA 5C4MA 2Z08A 4B2IA 1PWZA 1V45E 4HDQB 3O9VA 2CVOA 3OWXA 3Q40A 1ZAUA 2YJNA 4ZJPA 1KC1A 1Q77A 1XZEA 4LGMA 3E83A 1OAOC 3UJ9A 5HFLA 2H59A 4IGIA 4RACA 4CCYA 3DJFA 2G9VA 4LECA 2JFPA 2G36A 2HMUA 4BMXA 3V5NA 5AVKA 4B74A 1PLKA 1CY6A 2GZHA 2W4MA 1SUWA 1O5TA 5CYPA 4CJXA 3FAVB 4K6HA 1Y1KE 3ESBA 4F8YA 3KKPA 3U9LA 1QIEA 3FCYA 3EBLA 3TX2A 3EAFA 2QX7A 3ZBQA 1Q7YW 4DR5B 2WWWA 2BEJA 3A6HA 1KB9F 3VO2A 3ZD9A 2KBEA 3WG7C 1Y37A 3DJYA 4O4IB 2FL4A 4MVJG 5AKKA 5B4VA 1RZVA 3O0TA 3UMMA 4I2NA 1E6LA 1FFWA 4LE0A 8ATCA 5BMVA 4YQZA 1GZ4A 5J2UB 5DTIA 1AM4D 5KYTA 5ALJA 3S5UA 2V7UA 4RVUA 4REQB 5HFJA 3CC7F 3VDRA 4OGKA 4FC7A 5B3LA 5C8VA 2E5LB 2HB6A 5AW2A 4DDKA 2OEPA 1RPOA 4V0SA 3K1TA 1K6EA 3C7TA 2ZJ6A 1SZJG 5KTRA 5CX1B 4LF6O 3KQLA 2PGAA 3P2MA 3PJGA 3GVHA 3IP5A 4ZVTA 2FVYA 4O2RA 2M1ZA 2HMWA 2YZGA 1N6NA 1ISFA 2J85A 3C7AA 4Z54A 2AF3C 3GEDA 5JC1A 2D1FA 2EFHB 2NZVG 1F8FA 5C18A 5KX5F 1KS9A 1U5CA 3CZQA 4FJ0A 5EO3A 4DB2A 1L4NA 3E2PA 2OXTA 2FPPB 3MCUA 2O23A 4R7CA 4RWUA 3SM9A 3QLUA 2QS9A 4MUGA 1PR9A 3QBEA 1X52A 1R6XA 4C05A 1PT9A 4EW1A 2BHTA 3LHDA 2P35A 3KRTA 1E62A 2B37A 4X93A 2WUGA 3IKLA 2GLXA 3ODGA 2W6IG 4LP8A 1JTFA 4NFYA 3NHSA 1WULS 2YV5A 1UDAA 4ZIRB 3MJSA 2SKEA 4CV0A 3HVRA 3MWYW 4I0WB 7MDHA 2BGLA 3CEMA 3RK0A 4JL8A 3T1HB 1O8CA 2ZRHA 2PUWA 1A69A 1XHLA 4E5SA 4KMOA 1RLTA 4QGSA 2NVOA 5JAIA 4N49A 5CCXA 4ZZIA 3DFMA 4N4AA 1W0JG 3H5WA 1E7SA 4DUGA 4BN5A 1EVYA 2XMGA 3S0YA 4BB6A 3QVXA 1AGXA 1RR6A 5B12A 2V0GA 1ID1A 3ZN0A 2O8CA 4L5AA 4KWEA 5FWAA 1QYDA 4CF7A 4RA9B 4DCGA 2INGX 3D8HA 4GDFA 5ESDA 4B62A 2W98A 1J56A 1FFGA 3CNLA 1DEXA 5HCNA 4YV7A 3QLUC 3CNNA 2V7BA 3BN3A 3LFHA 3CW2A 4YP1A 3I56V 1GTVA 2C61A 2AN4A 2RIPA 3ZHQA 3IC9A 1KZHA 4A2PA 1GCOA 4IIVA 1G59A 1YB6A 3OFVA 2DWCA 3EISA 4ZD6A 1IZYA 3UB2A 3SJQC 2QA4V 2AG8A 3IAUA 3QVNA 1SOMA 3HXMA 1W0JA 2YYSA 5AM4A 3TUJC 3VZRA 2MSEB 3WGJA 1PJAA 4AZ0A 3ZW7A 2AXTZ 4QTTB 3TOZA 1CZUA 2D1SA 3G71V 3BXOA 3E9CA 1NJ6A 3ILHA 4QU9A 4YRLA 3P4EA 3L74H 1IEQA 4YCMA 1DFHA 4EENA 5KNLA 3BD6A 4LVCA 1XZAA 3MS2A 2ID9A 4N5DA 3I37X 1HFKA 1I2CA 1YRWA 2FJ0A 5LXTB 1N36B 4G8DA 1FTWA 5B66Z 3T5DA 4NSNA 1BA2A 4CN9A 3BFRA 5LYJA 4ZTBA 1RHKA 1ZCBA 1ISPA 2HCFA 1AIPA 5HOEA 2HPVA 3KB6A 3L4BC 5KYXB 4AY2A 4EGFA 1NBMA 4MVJH 4UBJA 5EMLA 4YRFA 2V6BA 5C80A 3NHLA 2FEOA 3H97A 3UZUA 4KFRA 1EFLA 4BNHA 3CLUC 4RDCA 2R79A 4M1QA 4M1KA 2ZSFA 4ZYYA 3P0ZA 2XZOA 2QV7A 2X6AA 2KKWA 5CDFA 5C1DA 3T4ZA 4O4JA 3C87A 5EFZA 1XEXA 1P4HA 1QYXA 2EG5A 1HNWO 4OF4A 1RXEA 5HKKD 2NZXA 4B4DA 4F5DA 1XK7A 4JI5B 3GEHA 1Z37A 1EG7A 1UFKA 3N28A 1PGNA 3ENZA 4MVXA 2KHZA 4NNPA 2WAOA 5AVZA 1II9A 4W5TA 5I51A 3DE6X 3N59A 4EHDA 1FVFA 1E3WA 3EEYA 4OKIA 2FSFA 5TMDA 4F4UA 4AI8A 4UCOA 1VI5A 5H9CA 2GT1A 4TMFA 3OE5A 1M93A 3RA6A 1VKJA 2ZROA 1TZMA 2G0AA 3FW1A 1Y48E 4EB6B 2PRIA 5KKCA 2F8TA 3G2JA 4F6RA 1JHUA 1TO6A 1IPAA 3GRYA 4QU8A 3ZBTA 1M6HA 1F8UA 3KB2A 4OX9B 2J7PD 4IOJA 1GN9A 3PJFA 1XOIA 3C3KA 4E5NA 3M3HA 2O4UX 1PX2A 1KO7A 1ZUD1 1P75A 2QD2A 4HNVA 1DX6A 2WLIB 1NWHA 2XYHA 5TDHA 2L82A 4DRYA 4FDUA 3HB4X 4G0QA 5ICFA 4BVHA 2QM4A 1BQ4A 3L1IA 1N7GA 4HRXA 4JC4A 3N2KA 1HOXA 1X7OA 2VHZA 2FR0A 2Q3DA 2NVUA 1TJ4A 3EXIA 4L5BA 4YT5A 1OKKA 1Q1QA 1WF6A 2HJVA 3CCUV 3OOEA 2B30A 1WXQA 2A5DA 3OCZA 4I19A 5ECWA 2HF2A 4ZA2A 5LYYA 4E4RA 1E7RA 1E63A 4KDEA 2HU7A 1HGXA 3DFIA 6ADHA 3EYWA 1OXUA 3U13A 3N2GA 2YOGA 3CXHF 3JWEA 2OORA 2UV8A 1FDWA 3NU1A 5CG2A 5LVAA 4QSHA 4CL0A 1NQOA 4M1MA 3DVAB 4MVJE 1CB0A 1GUYA 2IW3A 3AKYA 1UZAA 4JT9A 1U2DA 4KYIB 1EP3B 4URHA 4A8HA 3DEIA 4XOUA 2NXEA 5JAPA 1QG4A 1ZLXA 1GKYA 3DXRB 3AETA 3L0OA 4M99A 3KPVA 2ZQMA 4HLNA 1Y1PA 2QM7A 4ZHVA 4YCNA 3EPJA 4B5CA 2BR5A 4FMTA 3VU9B 3MK31 3K3PA 1JJ7A 3PC6A 3VXKA 3MPUA 2BI7A 3LIPA 2UKDA 2G7ZA 1UBHS 3R6GA 2P8JA 4GR4A 4JI4O 5JLJA 3NUZA 1EWYA 1HNNA 3RV4A 3QXGA 2ENUA 3SE7A 4I7ZB 2P30A 3RYCA 3LYBA 1L7MA 1ISMA 4KJXA 4L8FA 2WIFA 4KC0A 2AR7A 3HUTA 1C0LA 4R0NA 5ADWA 3K8YA 2GF2A 3SICE 3C16C 4M60A 4Z2YA 3ABKC 1PVOA 2XUJA 4GM0A 1UMDB 1YQTA 4V03A 3QGMA 4TV8A 2FR8C 2HRDA 1JXOA 4TT8A 1XLTC 3DV2A 4Q7QA 3F0EA 4MR7A 4XEUA 1U2DC 3SX4A 2FWMX 3AH8A 4EBFA 4FZVA 4MQEB 3MF4A 4WMLA 2VDPB 4FDMA 2PH5A 1E5XA 1KVTA 1U5BB 3NIBA 1KDZA 2OD2A 1FW8A 2I55A 5BOVA 3UH1A 5BY2A 1V4VA 1QGED 5F1PA 1S8FA 3SYOA 4UM9D 5TLSA 1G19A 1DHRA 1V55B 3VVLA 2ZTHA 1FP1D 4E1BA 2QTGA 2XAHA 2VSQA 5CLIA 3D4PA 1RYDA 1U2ZA 2CHSA 4JLVA 2ZWVA 2VF5X 1M74A 2H8EA 3O47A 3AI2A 1GOTA 3EXFB 1PI3A 3DEAA 3EGIA 1E2NA 4JLNA 5E4YA 2UXNA 1AN9A 4UVBA 3F6EX 4C1NA 1Q5PA 1AR4A 3CXUA 5KQGA 2YQ4A 3TB4A 3VX4A 3KT0A 2DTXA 2PX3A 4PZYA 2Z2KA 1LR1A 3VAAA 2YVQA 3EY9A 2QRZA 3E27A 3KYIB 1AZLA 3HYRA 2QLNA 4D8WA 1HSZA 3EARA 4QU5A 3FPKA 3UN1A 3D8UA 1R0BA 1VHWA 5HP4A 1TGOA 1JLSA 1XZCA 3E8SA 1OBFO 3HJTA 2PQ0A 1RM1B 1AMNA 1GTJ1 2YI9A 2IH3C 4ZO8A 5CFNA 1CUUA 4G9BA 2KQUA 1N0NA 4FONA 4JTCB 2YVUA 3GCDA 4QULA 1GPH1 4KFTA 4F3CA 5AHOA 5CDFE 4BVAA 1ZG3A 3V4SA 4BAUA 4TN1A 3DCJA 1JDPA 4TKMA 3FN4A 1X1RA 4IIBA 1Z4QA 3NH6A 1BS1A 3WX0A 3ZCPA 4Z0PA 5LQNA 2Z1TA 3ZVMA 1IOVA 3ZQUA 2J59A 3T06B 1C0KA 4O1MA 2C98A 2NV2B 3GUZA 4OIFA 4XDLA 5IT9A 2H1IA 1P80A 1E4EB 3VGJA 1U96A 1BVRA 4AJ4A 3DH0A 1G6Q1 1JYEA 2EQBA 1X7XA 5IPFA 3C70A 2P79A 4QRDA 3FH0A 4BO7A 2XE4A 2H9IA 4MW4A 4FE4A 3TXXA 4IIHA 4UXIA 1ACJA 2JFGA 1SQFA 1D6NA 3HCAA 3ZHCA 5K6AC 3R5KA 1YZFA 4DV7B 3Q7EA 3U40A 3GCXA 4KHPB 5B36A 1LPNA 4BVRA 2CWDA 1JG4A 2IITA 1MJGM 3NR2A 1LSOA 3KKNA 2JARA 2IXTA 2DHEA 3GRVA 4FX5A 1U31A 1PJ8A 4MA4A 4Z9FA 4Q9NA 1OBHA 1QRRA 3U1VA 5K03A 1P1FA 1VLHA 1MZEA 2WJGA 3ZWNA 2Y1CA 2I2WA 3CBQA 3GLVA 1GDHA 2XGJA 4POAA 3SF0A 3DXXA 2QN8A 1D1QA 2ZI6A 4Y67A 1C7RA 1XZBA 1U0OC 1YUNA 3AOEA 1C4XA 3T38A 3EUFA 5D5HA 1TADA 1Y0BA 9ABPA 1BXZA 1O9BA 2ZKOA 3I56F 3SQMA 1U0TA 4FLWA 5CVUA 3I09A 4UHEA 1Z0FA 2X9GA 3VZDA 4E5PA 5AFSA 4YJFB 3S2UA 3DT9A 2NYVA 4I8DA 1RRCA 1M5TA 1RWWA 1U1IA 3W5BA 3FOAA 2NZ2A 2QA4F 4I9GA 5CW1A 5DK4A 4WKCA 2AEMA 2IDZA 5CTAA 4YPVA 2VJPA 3GIDA 1FNNA 1YMQA 4M98A 3FMOB 2D2FA 4RHCA 3OBBA 4DFDA 1PZXA 4JLJA 3B6NA 4PF1A 1XD9A 3G71F 3IPLA 1L7DA 4NBSA 3KJQA 4YP7A 4A26A 2NSYA 2JGIA 2AG5A 3J80M 2UYPA 4WEOA 2X1VA 2KG4A 1CJVC 1PSZA 2P90A 1CIJA 1LPPA 2XE7A 2WW8A 2L42A 5GADl 3LUHA 1IXMA 2I7XA 3ENNA 4UBLA 4E03A 2J4CA 2E1PA 2B2XA 5FIUA 1CQIB 2YC2C 4XWTA 4ZZ2A 1EZ4A 1W57A 3AOEC 4QNNA 4F4HA 1HETA 4JI8O 5KWIA 2DSNA 4NC9A 3IDZA 3DMHA 3AB8A 3AEUA 3GD7A 1Z2DA 1H4SA 2BKUA 1SD1A 1PT6A 3AM5A 2Y0DA 4PA9A 3RFTA 1VQ5F 4Q1DA 2EW8A 3L07A 1KJ8A 4YAWA 1OTYA 5FV4A 1P0FA 2YDXA 4WZBE 5EMKA 3C1AA 4RD0A 4QTZA 1BE8A 2MMCA 4P4LA 2HRQA 1P9OA 4X1IA 2DUNA 1UT5A 2W2KB 2RC6A 4IUDS 3RSSA 4CUJA 3UYKA 2TYSB 2BE3A 3DOHA 3LBHA 3O3CA 1X86B 3VTAA 4TOIA 1CF4A 4BZQA 3EZGA 3PFHA 1R7RA 3V6MA 4I4NA 5A4FS 2KMLA 4EG8A 4CKEA 4Q3KA 2ZTUA 3I32A 3WYEA 3ETQA 2PYDA 4X6YA 1E8MA 1IBSA 2O8DA 3PSHA 3HY6A 3OPYA 1XWIA 4WLFA 2FMLA 1JDTA 4N18A 5BMVF 4G4WA 3S40A 1KO1A 2W2LD 1FVOA 3IEQA 3PL1A 3I0NA 2CLDX 3T6KA 4B80A 1QCZA 2CJPA 3I4LA 5A7FA 1VKHA 5FLKA 5BYAA 1YC5A 4QPNA 4G56A 4MQFA 4MRSA 4Y6SA 5BV2P 5CBGA 1SM4A 4M83A 4D82A 4PYLA 1S7GA 2A9KA 1STOA 2I6QA 4TX1A 2UYNA 2C9YA 3F2VA 2ORED 3KAPA 2R1UA 1TQ6A 4BX9A 4DV4B 4NOLA 3OZIA 3S7TA 2KSDA 3ED1A 1W96A 3N4ZA 2EP7A 1SIOA 4YUYA 3FNGA 2D0PB 1W29A 3IAS1 1QIIA 3RADC 2JRLA 3BMCB 4M7PA 5JZBA 2EILC 2V4ZA 3BK1A 3ZGVA 1N0HA 1YIJF 3VPAA 3ICPA 1I6WA 2XNSA 1YONA 2V8OA 4CM9D 3PNYA 4IEIA 1UP4A 1RAIA 1XAHA 1Z6YA 2OZVA 4L0DA 2QWQB 1Y9EA 3FOEC 4IG9A 2IBSA 3DZKA 2X6CA 3CSDA 1E2LA 1XNQB 2AHZA 2I1VB 1M56B 3QKWA 4DJAA 4U4AA 1SVIA 1D2MA 4W63A 1P0QA 3FNIA 3QXHA 4FHFA 5KHOC 1K68A 1JEQA 2JJQA 3T3EA 3O93A 2G1JA 5H3CA 2C8KA 1M2JA 4RADA 1JR2A 3NJRA 1OIVA 5ADVA 3CUWA 1XCGB 3GFFA 3LDGA 4GXTA 1V8FA 3VH4A 3KZVA 2YX1A 2VXOA 2J33A 3QPUA 3IV6A 1N5RA 4NCIA 2J9ZB 3FPHA 4EHJA 4R1OA 3DDWA 5A3SA 2HADA 3NTUA 2Y6VA 4O33A 1UXJA 4R8LA 1H2AS 1ULHA 1ZP6A 2P7TC 4MUHA 4M0MA 4FYPA 1BD4A 3LPAA 3NORA 4AMBA 3DMFA 1S01A 5LM3A 3EFOB 1JAXA 1Y89A 3GMTA 1KYZA 1AE1A 4N5HX 4P82A 1M1KW 1T4MA 2VI5A 2GFIA 2DWQA 2Q6VA 4G5OA 4DR6O 2QQGA 1MB4A 3MHSC 1MDFA 4TSFD 4OMUA 3KWMA 5HKKA 3PUJA 1R0YA 5E38A 4BOYA 2A78A 1KRWA 2NO0A 1PDVA 4Z9XA 4PNEA 2OAGA 3VYRB 3K9FC 3F7YC 3PDJA 1IXZA 5A71A 4PNZA 1X7GA 2IHJA 1NT2B 1SR8A 4EATA 3TINA 4BUJA 2JI6A 5KTOA 1GO2A 4NVRA 1CPYA 1G2PA 2ES4A 1VJRA 4PQRA 2H51A 3EVTA 3UBTA 3VYTC 2N1BA 3OFJA 1VG1A 1OWLA 4CLRA 3HKCB 1CRLA 4DR2O 4JDUA 1G8SA 4RTJA 4DT1B 4QZVA 1YOBA 4OLHA 3RRNA 3O3OB 3CUVA 1WS6A 4RJKA 3K15A 1JDBC 3W7AA 1XTJA 1E64A 4J9UE 2M1XA 4JAUA 1CW2B 1SCKA 3KOMA 2J7PA 3B77A 2Y1GA 2Z1NA 4A2WA 5HY1A 4MDEA 1DB3A 4HK4A 4BBJA 3GLHE 1BHSA 2X15A 3ZE1B 1RLIA 3PPYA 2WAYA 1TF5A 3MUOA 3TD2A 2PX2A 3ETNA 3BMNA 2PMBA 2IZ6A 1UPXA 3V4DA 4HSEA 1Z6TA 1VG9B 4IIUA 1QIGA 3K59A 1MIOB 5I3ZA 2IOQA 4P30A 5EJEA 4O4JF 3N8NA 3L8GA 5KTMA 1JA1A 4WLEA 1IZ0A 2XKJE 2XVAA 1GN8A 3EUEA 4CM8B 2PU5A 3HYNA 1CUWA 5MFZA 3ENKA 3L0SA 1KK3A 3RHSA 4P32A 1J7JA 5HR5A 4M87A 5HS4A 3TKLA 5D51S 4QOHA 1YZUA 4IHAA 4X61A 1TCUA 2ZS8A 1XKLA 4NMMA 1JDSA 2DFPA 2GZSA 3PR1A 1XAIA 1ACMA 2C1EA 3DHYA 1Q7GA 2WUFA 3OQ6A 3O85A 4XWAA 1TVKA 2RCYA 1CUBA 1ZOOA 1SUAA 2G4VA 2HZ7A 3KU4A 2H7YA 3AY6A 1XP5A 4YBZA 5C81A 1GSHA 5FULA 1A9TA 1PL8A 3M9LA 5F3WB 1NUHA 2GB4A 2A1TR 3CO5A 4S1PA 1JHXA 3H5IA 1QBKC 3WWYA 2R9AA 3RG2A 1LB1B 1ZC4A 4W5NA 1GLGA 1YE5A 1VQVA 3BC1A 2R6CA 4F71A 4B9AA 1WUHS 1SOVA 1SU7A 1U43A 1F5NA 1CD5A 2EWMA 4J3FA 4W7SA 1FFDA 3UAZA 3WGVA 1WA8A 1A9XA 4NICA 1TAUA 2QL6A 3BYQA 3R2JA 2R7KA 4FFOA 1QH8A 1XCBA 3ZX5A 1LLDA 4XYLA 2VZ0A 2OHGA 3NXKA 1K9MH 2J4FA 2ZBDA 2GF9A 1OCOC 4H3SA 3GT0A 2L19A 4GSKA 2VDQB 2BY4A 1L7EA 4EHNA 4RGQA 4JI6B 3C3WA 2GD0A 4CEIA 2CD7A 3PNQA 5EP3A 2JGEA 4JUCA 5A9SB 4QIHA 4CEJB 4KNVA 3DL2A 2WVJA 5E4JA 1ACLA 2HA0A 3NVMB 5F2NA 3FPCA 4HDCA 1KBOA 3UTCA 3PEUA 5DDIP 4MLZA 4RXTA 3NBXX 1SVMA 2OBNA 1ZK1A 3W5IA 2CNBA 3V3TA 1KYYA 3I6BA 3H9UA 1E1QD 2C29D 2EJRA 2JS7A 4E2LA 2GZAA 2ZU0C 4B82A 1QYRA 3OM3B 2Q62A 1NQ3A 3BA9A 1JECA 2C20A 5JTTA 3EAGA 4DQUA 3CMMA 2RGRA 1CEQA 4G1VA 4NZ9A 3CT6A 1AILA 5ALOA 4XDYA 3K2XA 4MPJA 3SZ3A 1Q14A 1C3LA 4IWYA 3ZGOA 3IVMA 4UFZA 1DC7A 1GQSA 2WKSA 1P5HA 4V3BA 2HQRA 4UXJA 3VR5D 1B8UA 4RVNA 3TTVA 2J3QA 1ULTA 4B3FX 5BUCA 1WE2A 2V8BA 2ZYRA 5K2MA 3EA5A 1W4RA 1DJMA 2N0SA 3IKEA 1G3IA 4MUXA 1H0KA 2Z3YA 3LH5A 2QEQA 5HF9A 4PX2A 3LPMA 4JP3A 2ZUEA 1DINA 4CS2A 2RAUA 3QNUA 4LY0A 1A9OA