4X1KB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
428
structure length
428
Chain Sequence
b'EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 134
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1kB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1kB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1kB01
5EIBD 1W5FA 4YJ3B 4M8IA 2BTQA 4O2AB 4ZI7B 5JCOC 1FFXA 3HKBB 3JALA 4X1IA 3JAWA 2BTQB 3HKCB 5KX5B 5CA1B 2VAPA 4O4IA 5LP6C 3JAKB 5JCOA 4KWEA 2RHJA 4TUYB 4X1KA 1OFUA 5C8YA 4B46A 5JQGA 4O4LB 3N2GA 4X1KB 4I4TA 5J2TA 3RYFB 5JVDA 5JQGB 4LNUB 5LYJB 5LP6B 3N2GB 5ITZA 4O2BB 4YJ2A 3C8LA 5LXTA 3UT5B 4EB6B 5JVDB 4ZHQA 2RHHA 4EI7A 3CB2A 1W5EA 5EYPB 3HKEA 3VO9A 2RHOA 4DRXB 2VXYA 4YJ3A 2Q1XA 4O2AA 5EZYB 5J2UB 1RQ2A 3HKEB 5LA6A 4X1YB 5KX5A 3HKCA 4U39A 3N2KB 5MN5A 4TV8B 5CA1A 5KMGB 1W5BA 3JAKA 3JATB 1W5AA 5LA6B 4TUYA 3M89A 4O4LA 2RHLA 3RYFA 5IJ9B 4LNUA 5LYJA 5LP6A 4DXDA 4O2BA 2VAMA 4U3JB 3WGJA 3UT5A 5M7EA 4EB6A 5IYZB 2BTOA 5BMVB 3WGLA 5EYPA 3V3TA 5CA0B 1JFFB 4DRXA 5FNVB 3R4VA 5EZYA 5J2UA 4I50B 2XKBA 3M8KA 4FFBB 4X1YA 5JH7B 3N2KA 4TV8A 5KMGA 2Q1YA 3JATA 4O4HB 1Z5WA 3WGNA 1TUBB 3HKDB 4IIJB 4TV9B 5CB4B 4O4JB 5IJ9A 3RYIB 4ZOLB 4XCQA 3ZBQA 2R751 4E6EA 1RQ7A 4IHJB 4U3JA 3RB8A 5IYZA 5BMVA 4HNAB 1Z5VA 4I55B 2XKAA 1RLUA 5CA0A 1TVKB 1JFFA 3JASA 5MN4A 5LOVB 5FNVA 3VPAA 5IJ0B 4I50A 3JARB 3JASB 4FFBA 5JH7A 4F6RB 4O4HA 3VOAA 5MN6A 1TUBA 3HKDA 3RYHA 4IIJA 4TV9A 1W59A 5CB4A 1FFXB 4X20A 4O4JA 3RYHB 3WGKA 3RYCA 1FSZA 3JALB 4X1IB 1W581 3JAWB 3RYIA 4ZOLA 1SA0A 2R6R1 3WGMA 4O4IB 4X20B 4IHJA 3RYCB 3ZBPA 3VOBA 1SA0B 5C8YB 5EIBC 4HNAA 3E22A 4I55A 1TVKA 4I4TB 5LOVA 5J2TB 3E22B 4WBNA 5IJ0A 2GVIA 2VAWA 4B45A 3JARA 5GONA 4YJ2B 5ITZB 3VO8A 3ZIDA 4EI9A 4EI8A 5LXTB 4WBNB 4F6RA 4ZHQB 5GONB 4ZI7A 3HKBA
chains in the Genus database with same CATH superfamily
3QQ5A 2X4GA 2EF1A 3UAWA 3DEJA 2DVMA 1GUZA 1EXNA 4XUCA 1C4WA 1CRQA 3IC9A 1N8TA 3IR7A 4GO1A 3RFFA 1GNQA 3CP1A 2IQ5A 1JILA 3KU1A 1WQ3A 1SCJA 3I6MA 4R8SA 1FB5A 5DTIA 3A10A 1VA5A 1T91A 4IH1A 4WJLA 4ZCIA 4KV7A 1HE5A 3JXEA 4HQ6A 2NYAA 4FFPA 4QPPA 3E70C 1FUIA 4LJYA 5K0EA 1R8QA 4M86A 4YHBA 2NUBA 1UQUA 2DLNA 2M7WA 3ZHCA 5E4TA 6REQB 4FFBA 4DEYA 4A9AA 4PLTA 4RCYA 1CETA 1VFNA 4LOHA 5EXSA 4YRAA 4IEEA 2HH9A 1NOIA 2FZLA 4X7BA 4YDQA 2CB0A 1HDOA 4DVGA 1IPAA 3PUJA 4WTOA 2SICE 5KJ1A 2ZSEA 4FYIA 4JY7A 4TSKA 2AC7A 1Q6HA 5DCYA 4ZQHA 3WLKX 3B3JA 5FL7A 3FR7A 2GHYA 1PV4A 5EYPB 2QT1A 2PO7A 3OT1A 3FLEA 5FYDA 1QORA 3WGYA 2Q8NA 5F3WB 2OTLV 2ZIXB 5EXDA 2X41A 5HS6A 4Q4JB 4NENB 2EGGA 4B47A 3D8SA 1UP4A 4W1SA 2CL6X 1YIOA 4PDVA 3DMHA 5GTIZ 1KI4A 2YCLA 4QE3A 3SJBC 2RAPA 5JMOA 4G81A 1E9AA 4H7JA 4FPPA 1AB3A 5I5GA 1IBSA 2Z1NA 1DPFA 1V3UA 3AZOA 1TU3A 1S8AA 2VRNA 4LYEA 2QVYX 3WIUA 1YITV 2QPLA 3L8MA 4ITRC 4ASUA 3BHNA 2GJAA 1X59A 2Q29A 3R75A 3PEVA 4MV8A 3QBDA 4OFBA 4H37A 2CNWD 3VSBA 3ZXXA 1WSBA 3QY9A 1UJ6A 3WGOA 1B0UA 4CCWA 3TR0A 7AT1A 4F04A 1NR1A 5FO1A 2XWQA 4B17A 2QPOA 3IT0A 3HBFA 4YV0A 2GLTA 4FKZA 1KJ8A 3W34A 5TV2A 5GGXA 3A2FA 2HXSA 4XIFA 1FTWA 3VYTB 1RP3B 3T5MA 4MPPA 4QYSA 1IATA 3ZHQA 2A9QA 1XZMA 4HNGA 2PH5A 1DDOA 2F43B 1ZOSA 1AHHA 1MH9A 1V8BA 3FDJA 2INGX 4CKYA 1K7DA 1H4VB 3A9RA 3PYXA 2H8KA 4ZHVA 5HIIA 3TXYA 2YR0A 1ISPA 2HU8A 4C6HA 2O0LA 3ED1A 2NVOA 2W6OA 2JDIG 3RYIA 5K4AA 3MT9A 2WKSA 3BOSA 5K3OA 4M36A 2WU8A 2PI4A 4HYEA 3E5MA 1BVYF 1H2WA 2OG2A 3NUQA 4CTKA 3TZEA 1OWLA 4PZYA 3RWOA 3W3AA 5H8WA 3EZNA 5DK6A 2OWEA 3AUTA 2PGJA 1VEWA 1OWPA 1KEKA 1B0PA 3UEOA 3QNWA 1KFEB 4BVJA 4RIHA 3IS3A 3C1OA 1F6BA 3GJ8A 3RSQA 4R0NA 1S5LZ 2P77A 3WJQA 1EUDB 4BFUA 1ZQ1A 1U81A 4EZBA 5PGMA 4JLNA 4B7XA 3GGCA 4PO1A 3ISVA 3NMUF 1H2LA 1QR9A 3COSA 4DA6A 2E5LB 3LK7A 1Y9AA 4RPJA 4PZZA 2LGWA 2C54A 3H2BA 3LLCA 5A4JA 4KQ6A 2RBGA 3VMFA 3CZRA 3WWEA 4CL3A 3VJLA 2AQHA 1PZNA 3A1VA 3L1IA 4YV2A 3HB4X 3N2LA 2AOWA 3W2IA 2CGNA 4CMCA 2IV2X 2CXPA 1VF6A 1LZKA 4D3SA 2Q49A 1K3TA 3THWA 1ZD1A 4WK4B 4L8FA 3W3ZB 1WXEA 4JK3A 5LDGA 4TQDA 4RL4A 3SR0A 1S2DA 1RNLA 4JB8A 4MVQA 4BLSA 3GT0A 2J6HA 4PDRA 4FDAA 4FGWA 3OCVA 3G6BA 1WJZA 3KVRA 2RGNC 3I2IA 3GLUA 2EEZA 5LCXA 4DLLA 5K2OA 2J41A 2V7BA 3OIYA 3X1DA 2JGLA 3O8BA 1HQDA 4D46A 2I6TA 4K6MA 2JAQA 2Z5LA 4YJHB 2XSZD 4JUIA 4ZKEA 5ESRA 1JZQA 4EGJA 1M6EX 3SPCA 1MG5A 3WRVA 5ULLA 2GPWA 3G23A 4BE4A 4MWSA 4EW2A 4JR1A 2L35A 2JIZA 2VF8A 4XJXA 4L8VA 1J2UA 2D2CB 4U6SA 5JAUA 1X1BA 1YFLA 1L5HA 2DM6A 2VP5A 3I04A 2Q62A 3WQHA 1DDGA 3F97A 1TT7A 4PM4A 2O2YA 5K99A 3W2FA 4D3YA 4R6ZA 4XYEA 5JC1A 1BEEA 3IKFA 4GPAA 2GWHA 5LHGA 4KN5A 4UM9D 3D6MA 3IP3A 3T9AA 3LTNC 1CJCA 2YWHA 1I2DA 1KIFA 1Z68A 3OFNG 3NBYC 2ADQB 2B99A 1GK9A 1U2DC 4LVUA 1H6AA 4LH7A 3GRYA 1WMDA 3CS3A 1HO3A 3ITEA 1ACJA 1M2NA 4WXHA 5AJWA 2J9RA 2HSDA 3LPLA 1UPBA 4OATA 1BRTA 3A9TA 5BMVA 4IW3B 2VQFO 1XD9A 1RWVA 2W4MA 4Q4AA 4BNMA 2BBSA 2CLFB 3RQIA 2P5SA 1TT5B 4HR7A 3V2IA 4AZTA 3D0QA 2QLJA 2UDPA 2IEIA 3RPEA 2PKQP 1G60A 1JT2A 1JR9A 3K12A 1TVKA 2K5UA 1D2AA 3K1AB 2NV6A 3GLIE 3M4SA 4M8IA 2Z3ZA 3IYLW 2E75B 3FTNA 3V4ZA 4UOZA 1QZXA 3LYUA 1OBFO 4B46A 3ZIAA 1QE0A 5DSTA 2GCOA 1PT9A 4TTAA 4BO1A 4A4DA 3I5UA 3H5TA 1ND5A 3U0ZA 2WUEA 1H65A 2AFIB 3LSTA 1RYBA 2CUTA 5A6SB 3KFLA 3KVNA 3T0IA 5DOZA 4ZCRA 1AUOA 4X88A 1R6TA 2AOVA 1B6GA 1FFGA 3OLQA 3SXUA 3DVQX 2J59A 4KAXA 2DPXA 2VEOA 1TA8A 1DIHA 1AMNA 2ZM5A 2WILA 1DUVG 4TTSA 3COYA 5CFQA 1MW8X 2CEAA 1ZK3A 3NI2A 2QEQA 2P4HX 4AROA 3R1IA 3AHEA 4CDRA 1AUQA 4QT4A 4H7EA 5L3CA 4TMYA 5CTAA 2Q5OA 3WLHA 3H2GA 3OT5A 3UANA 1G98A 2JIDA 2BW0A 2VHUA 1F8YA 1OAOC 1IL0A 1AKTA 2I4IA 4J0DA 4R9UC 3OZAA 1X7OA 1P4RA 5BSKA 4YY3B 1BE1A 2XD4A 4KPEC 4NYIR 1F2TA 3K8OE 1KAHA 3A2LA 3R40A 2UXBB 2OA0A 2D7JA 3F6EX 1ZSPA 1WDWB 4YRCA 3W4IA 1P29A 3ET5A 3SQWA 2XVAA 4UU7A 1FYDA 3HN6A 4WGGA 3TPZA 5BURA 4OHPA 4D8VA 3NPAA 5CA0B 4JYYA 1R4ZA 3V3KA 5L6MB 5KMGA 4BB9A 3ZZ1A 2DBQA 1PJ3A 2JVIA 4QOGA 1CQJB 4L76A 4DPKA 2WQZA 2VHJA 2FPPB 3BDIA 3L7AA 1CB7A 2SECE 2ENUA 2W8ZA 4B4DA 4M1OA 2OQIA 3D6TB 5DYGA 5T4EA 1HTBA 4BFYA 3PWSA 3F5FA 5HKKA 3IE0A 2Y1GA 4B5CA 4JP2A 2JF0A 3IDFA 4CCSA 2QRQA 3BCUA 1OLSB 1O57A 5CA0F 1PR4A 2QIPA 3AEUB 4O59O 2QNIA 4ZD6A 5FQNA 1MNQA 1CHDA 1JDPA 4DVJA 3BH0A 4HI0E 1SVNA 1R2QA 4EHAA 1KAGA 2Y67A 4GRDA 2DECA 4TS4A 3PDIB 2DFLA 1XEXB 4ESHA 3VV2A 3PS9A 1JWAB 1Z4KA 4NH4A 3DXRA 3EGIA 1XCPA 3GLFE 1C0KA 2EWVA 2YZ2A 1NKVA 5T5QA 3I7TA 1XGKA 1VL0A 1VLLA 5DGIA 4RTKA 1XCBA 3AM1A 2F1MA 3S3TA 4YUAA 2P4KA 1H4TA 2HPAA 1UMDA 4QNMA 1VKNA 1G8JA 4IDGA 4UD2A 3RBXA 2ZDHA 2WT9A 2R48A 4IDEA 1TIBA 3UO8B 4IZ6A 3H04A 5KOJB 2BMVA 2VHZA 4DILA 2O1XA 1C1DA 2QTFA 1YVUA 1R6NA 4LSWA 3BPZA 1JU3A 5FOSA 5FBQB 5KREA 5KQSA 3MB8A 3AR4A 3SX0A 1WZIA 4PCAA 2WD7B 2I7XA 2H0AA 3AY3A 4TUYB 1K68A 1G3MA 2QM7A 1YJCA 1YS4A 2QOEA 4ZVQA 4WLVA 1S1CA 3TI9A 1U2GC 3BFJA 3GDHA 1DTWA 3VHXB 2WK1A 4OI1A 2KTUA 3S03A 3SIVA 2VJOA 4BV9A 1LC3A 2ZYGA 4Z49A 1JFFB 2WM9B 5DTEA 3L8HA 1GGHA 2HCTA 1I3KA 3MUOA 3LFUA 3T5DA 4TUYF 2W6ZA 1KMNA 2GN9A 2WIKA 1NZ6A 1EE9A 5COQA 2KMLA 1TMOA 1X7DA 3B40A 4RMGA 3HO1A 1DLJA 1EDDA 3G2JA 3BRCA 2O7QA 4NVRA 2PQ2A 5B2ZA 4POOA 3MM4A 4P0QB 1HDJA 1CY7A 1F5SA 5AKYA 2DERA 4EUEA 1R73A 1UC9A 1XHOA 1U7XA 3Q3CA 4EGFA 1NNSA 3QLEA 1TVEA 3AK1A 1G42A 3JRNA 4YX9A 4IUYA 1OJHA 1ZY2A 2FSIA 1E77A 2ATXA 2OHOA 5AW5A 5KDOA 1D5CA 2QMEA 3SSNA 3TLEA 1EFKA 5MN5A 4TV8B 4XUEA 3HVJA 4PINA 2Z9CA 1QUFA 1ZH8A 2IYYA 5FRDA 3K2EA 3ZKWB 1ZH6A 4BIZA 4X95A 4GVPA 4EGSA 2XEDA 4QHSA 3SHQA 1BWPA 3MOIA 4A3SA 3OQPA 3HCAA 4WFGA 1DEHA 1R64A 3RT9A 2ID7A 5KDLA 4GMDA 2QTLA 1VKOA 4AO6A 4Y1FA 1H2EA 1WKBA 1RZVA 1CR0A 1IBKB 2SHKA 4TV8F 2J3QA 1SQBH 4IIHA 4U7JA 1HFJA 5D86A 2P90A 4IG9A 2WINI 3M1XA 5G02A 2A5JA 3EGDA 3GEEA 1MO5A 1E98A 2HKIA 1H1TA 4O4LB 4H1WA 4TVOA 3LVFO 2P2DA 4DC9A 3OR6C 5I9IA 4RA9B 1VQ7V 4RO2A 1FSSA 1TAEA 4ARAA 1BEZA 3Q5GA 3HY4A 1PAUA 4MYCA 3UJHA 3JQ8A 1EIZA 4HAMA 3DGFC 4ROTA 3HJTA 2V7WA 1FXWA 3CLSC 3K0FA 4MRVA 4FM2A 1KA9H 3IEUA 2Q3EA 3PJFA 5AW7A 1NQTA 3RADC 2ZYIA 3QUAA 3OCZA 4DJDC 3OQNA 5B1IA 3FY4A 3DC5A 4DV2B 3W1EA 5CVTA 3T7IA 5BQOA 4DR3O 2PSEA 4O4LF 1UK9A 4L95C 2TYSB 3U3RA 1QG2A 1T24A 2ZJAA 3FZQA 1WB7A 3VBCA 8LDHA 1QLEB 2ZITA 2Q3BA 2V1UA 1YF2A 5D7NA 1KBZA 4EBBA 4FEAA 1SZXA 3M7IA 4NYMR 4WK0B 3E1GA 2Q67A 1H42A 4XKJA 3BCHA 2HJRA 3ZYCA 3HKBA 4QYIB 1HI9A 4Q9AA 2PMWB 3RT1A 3MWLA 4UVEA 5HIJA 5E2IA 1DEXA 3IHLA 3ZZTA 1I3OA 1P2UA 1S72V 1XNQB 3CC2V 3BFKA 2EL9A 4BO5A 2F59A 1I9CA 4OKSA 4AI6A 1BFDA 5J59A 3WAJA 1L6RA 4CN8A 4C7JA 4RDHA 1R9JA 4LBYA 4IJ6A 1BDIA 1MDBA 5FJ4C 5IVDA 2H4JA 1A9YA 2J4FA 2BKUA 2ITCC 5TLSA 2AKYA 1R74A 4BNZA 3UAYA 1VKRA 5GM1A 4F97A 2UYYA 1HYHA 1PQWA 1S76D 2FOLA 3ETHA 2YJ4A 4CCYB 5DN6A 4ZYWA 1XL6A 4Y67A 2DYRB 1G21B 5AW6A 2Z01A 1RRPA 2B37A 4PYLA 1JQDA 3AETA 3KZOA 4AJ2A 2JLVA 1ML3A 5THXA 1DRUA 3IUSA 2R66A 1JHPA 2P4VA 1X86B 2EV9A 3SAJA 3DBHB 1RI5A 2C7VA 3VSCA 3WLLA 1CY8A 1UJ5A 2YXZA 2OYCA 1VJ1A 4BLTA 2VXYA 3UB3A 3WJ7A 1EQUA 3FBWA 3AONB 1H9CA 4QD3A 3ZX6A 1FJ2A 5K1ZA 4MJ3A 3BIXA 1GQQA 4YIHA 1NBIA 4BY9D 3FB6C 1W9MA 1P73A 2DUMA 3ZMTA 5DGTA 1KE1A 1AKQA 3RU7A 2JKVA 5BSUA 3C3BA 2F00A 2ODTX 3MWKA 2QU8A 1B0AA 1B3RA 4ED9A 4GPBA 4QNRA 1PQUA 5FORA 4HDKA 4O2LA 2YS8A 3S8EA 3KUUA 4ZP1A 4Q05A 5MF6A 1VZ3A 3K57A 4EHNA 1S2IA 3EVKA 1IV1A 4WKNA 4KJXA 1J25A 3LBYA 2F3SA 3DR5A 4JYMA 1X52A 1RABA 2I1WA 5IM5A 8ATCA 3HRHA 3CIFA 3ZE0B 2F8MA 2AZ0A 5ITZA 5BRJA 3NNSA 1IQPA 3TTWA 2AXPA 4L57A 5LZ5A 4F3NA 2EXXA 1JA8A 2UXBO 1LUVA 3GPIA 3HN7A 2X5KO 2C2BA 1T4CB 2CMKA 1C50A 1RPRA 1IPEA 2A9VA 1I7DA 2FK8A 1Y5MA 5L7YA 4G4YA 4IUCS 1UAYA 5G1NA 5B53A 1EXMA 3NWOA 2I03A 1XZ8A 1LSOA 3VI3B 4H3VA 5BQPA 4KP7A 2NVWA 3MCTA 4ZQCB 3NDJA 2W83A 2XMRA 1GKUB 2I4MA 4EG6A 3T4ZA 1K6JA 2JK1A 4BKMA 5BT8A 3GV0A 4WFBV 1I36A 1UBRS 3VAYA 1ZDMA 2HR3A 1A8PA 3UMCA 3RRXA 4DMHA 2A1TR 1MZEA 1PJLA 3V1KA 4Y9DA 3NJ8A 4BEBA 1M2WA 5K3DA 3IUNA 1OILA 1QK3A 1I7NA 4CMHA 1YB2A 3STVA 3B48A 3F2IA 4TWJA 1PUJA 1NVUQ 4Y2XA 5DJ5A 2PRZA 1MZPA 4U7WA 3RHTA 1H8EA 4ZDIA 1UINA 1YVDA 2ZT8A 4UJ3A 5LKAA 1YQUA 2HSWA 3WGNA 3LWQC 1PFYA 5L6LB 2HK9A 1UBCA 2AQ8A 1DIAA 3W5AA 1TLLA 4A10A 1GUDA 5KYUA 2FPOA 2CE7A 3LOPA 1XA4A 5H83A 1U28A 4ZO9A 4ZOEA 4L8GA 2JLQA 4MVJE 4ER3A 4PFJA 3DEHA 1ABBA 5JXIA 1XNRO 2B2CA 2EARA 2X0EA 1JG3A 1XHXA 1QFMA 5T6MA 1GTMA 3THOA 3VM6A 3ZMUA 5JZSA 5EAIA 3NVMB 2XRYA 4OJTA 3TBFA 1UFIA 4PO9A 4KGVA 5A6VA 4G8BA 4C8EA 3AEQB 1ZHFA 1NC1A 3FFTA 1DUSA 2P6PA 4PTZA 2A35A 2MCFA 4FE4A 3U7FB 3F78A 1BMFG 5J4KA 3WB0A 3JQPA 3HXMA 1IBLO 3U4CA 1TCVA 1F3LA 1W87A 4XPIB 1TL7C 1DC5A 2ZOSA 1RAHA 1GPMA 1O77A 3B78A 2WWHA 3AR2A 1JIIA 1D6NA 4F8EA 2Z6QA 1WXQA 3K8QA 1O6GA 3CYOA 1AF7A 2GPNA 3B1WA 1P91A 3GLTA 1JLLB 2WJHA 4M0KA 2H85A 2AK3A 3A4TA 3IKEA 1DJNA 5BR7A 2MSDB 1OIVA 2GZAA 1RACA 1R5OA 1Y8CA 3GRKA 4N5DA 4D8XA 3OFSA 4ZK6A 2EFEB 1ATIA 4GOKA 4JFRA 5HQJA 1SQFA 1ZD8A 1HGXA 1SVLA 2G9RA 4X24A 1K9MH 2MSNA 1XOIA 3LLVA 3W8NA 3A32A 4BWFB 1VLHA 1USKA 2YASA 4ZVMA 3DJYA 4UCQA 2IJIA 1JEQA 4OFXA 3RH0A 2B2NA 2IOHA 3RTGA 1T6XA 2O3JA 4MWBA 1R18A 5LGUA 2C5SA 2A9PA 2HGSA 4I7ZB 1TI7A 3K30A 3TRIA 1E5LA 5G4VC 4JP8A 3JQQA 3MPOA 2ATEA 1Q5PA 3V1YA 1FRNA 3CVOA 1BWQA 4LWZA 1VIMA 3I34X 4D44A 2Z98A 2XNHA 3C97A 1WHTA 4CKBA 1M8PA 4XCVA 4ZYVA 3LE8A 4AVYA 4CMKA 1XNHA 4FDUA 4BWYA 2HP3A 2D1FA 3D5EA 3FGNA 1K75A 3KLPX 1C4KA 4HZGA 4Z0PA 1U8TA 5A9RA 2X9GA 2G9NA 2EW1A 1Z4MA 3FNEA 4Z2AA 4RMIA 1JDJA 1IXKA 4FC7A 1X1QA 1XCMA 3ED5A 3R3WA 1I5XA 2UUAB 5IX8A 1QIKA 3GJSA 1Z34A 4UXHA 3PX3A 4KQMA 1Y6GA 3TLGB 1KQFA 3Q12A 4P9OA 2GYYA 4HUQA 4PX3A 3HAXD 4JJ6A 1LBEA 1UBMS 3ZGOA 3PEEA 2P7TC 4MGIR 2FX5A 4L08A 4KK3A 3N2EA 2IY8A 2J09A 1L1FA 3HKDB 3UATA 4MT8A 1QX4A 5EGNA 3VTAA 4HZUA 1G1AA 4RENA 4DWJA 1HK7A 5IJXA 4NZYA 4XRRA 1VMDA 3BF7A 4DV2O 1SRRA 1F60A 4GS5A 2HJVA 1RKUA 4A16A 4CM9A 3GEPA 3QMPA 1E1LA 2JFZA 2VUTA 4QGAA 1FX0A 4GSYA 3NM6B 2EWCA 4WXEA 2MWMA 5DNVA 1PZMA 4PGGA 5DEDA 3VI4B 2BEWA 5JDCA 3OZEA 1MB3A 3IKVA 1P0QA 4LBVA 1GR0A 4ZT2A 3LFTA 4KGDA 1Y9ZA 5AXDA 5A3RA 3P4YA 3TIFA 1A95A 1HF3A 1Y4DE 4P22A 1CR2A 2HA2A 3BTVA 2DWOA 2FR0A 3WL8A 2FYTA 3H2IA 3S0JA 2HG5C 1HV8A 2NU6A 2DZDA 2V55B 1QAHA 5E0KB 1BQEA 1BVUA 1ENPA 1RAFA 3EOAI 5DXAA 5A2QM 1HMYA 2H57A 2PY5A 4DIBA 4DM4A 1VP3A 1WB9A 1I13A 2C2YA 3T7KA 3DOOA 1X2EA 1RWKA 1QYDA 4EJSA 3I2KA 4K9KA 1PIWA 2JDIA 2C59A 2Z2KA 3PNVA 5SICE 2I87A 2OP1A 3EDMA 1A77A 1JFRA 2QX4A 1QQTA 3OQ1A 5DNCA 2NO4A 5K3EA 3LVQE 2EBUA 1G2IA 1NT2B 5P8WA 3IMGA 2DWCA 4G9GA 4M49A 1UR5A 2QTMA 4E3WA 2WJWA 3FCEA 4DSZA 4JNCA 2H6EA 3HSYA 3C8UA 4HAUA 1F20A 3PJEA 1BCSA 1GDTA 5HBGA 1NF9A 4JVMA 5DIZA 1MIOB 2YXEA 4YRDA 1CS4C 1F12A 1NBMD 1GA1A 1KEZA 1WABA 2Y0BA 3LDDA 5KYWB 1P39A 3BWDD 3U3ZA 1E4EB 4WINA 3V1LA 3JAKA 4H13B 4CM7A 1CY0A 3CCLF 4NC9A 2G04A 3TOCA 4E32A 4FILA 3IPYA 4TS3A 1TAQA 3UJNA 3HM9A 1W42A 2G9ZA 3G0BA 3A4MA 4X3LA 1YI0A 2AW9A 3EWNA 3W06A 3E3OA 3DTVA 4G4ZA 1TCUA 4KQFA 3R9XA 3KDAA 3CR3C 3M34A 2NZVG 1QBKC 1T1RA 1PHPA 3VR6D 2NMUA 1E1RG 1LDGA 3G5UA 5G1PA 4BO9A 2LO1A 2IDZA 4E5MA 4HHEA 1G20B 2GTPA 4LW8A 1YE5A 3B3QA 2CNBA 4KPFC 1YDWA 1YJAA 1WCIB 3BJZA 1QMPA 2J33A 4EY3A 1WJGA 3WG7B 3PE4A 1W25A 3QI7A 5CXSA 2FMHA 2KBEA 2OL4A 3H18A 3MBOA 2XYHA 3TLKA 2G1PA 3B9RA 1QU3A 1LI5A 5JBIA 3B13B 2PNJA 4E5UA 3I3FA 3VYSC 2OGWA 4IGKA 4YIOA 1PL6A 1KAEA 1Z0SA 3PZBA 1X7ZB 3NHLA 5K6RA 1KO1A 2CVOA 1TKRA 3W6UA 4ONEA 2QSAA 1BJRE 3JWEA 4MRSA 4N0PA 4MP3A 3CX5F 5F3RA 1Q92A 3TRJA 1OMOA 1WQ4A 5J4HA 4G86A 1VQLF 3H97A 4JR2A 4D6TH 4BKOA 3DKKA 1QHSA 4KRFA 5FTKA 2VP9A 1LI4A 3SP1A 1GT6A 5U1PA 2P9QA 4CL8A 1AR4A 2H0QA 4RGQA 3RIYA 3SXPA 2CUKA 3PHBE 1J8FA 3ZMVA 1IOLA 2X40A 3Q7IA 1RJGA 1I3LA 2ZRIA 4DHWA 3A04A 4M87A 1Y0BA 4KAAA 2FDXA 4EJ0A 2YXNA 5A4KA 3LHDA 1VLVA 2O2SA 1KY5A 3GFFA 1ROPA 3K1TA 4IDNA 3EZYA 4J6EA 2B8TA 4O1HA 3TOVA 3P7MA 3WTBA 2UXXA 4CLRA 2Y99A 3WLTA 2NV2B 5JD5A 1G16A 1C4XA 1DNPA 3O91A 2P62A 2IYOA 1C9MA 4FR0A 2Z0AA 4MVXA 4PSVA 1MC4A 1LQ2A 5IZ4A 4I50A 3GA5A 3TPFA 1CYEA 1IH8A 2FTKE 3G4SV 4WXRA 3G2OA 4M7OA 4PSCA 2GESA 2KW5A 3QE2A 2XZPA 2C9CA 4AZWA 3U3JA 4Z4CA 1T2AA 5DGHA 4DG8A 3E2PA 3L01A 3C6XA 5F1YA 1ETHA 2FZGA 3A27A 5CIYA 2JARA 1JXMA 4A7PA 4BFTA 1XEWY 4ZCMA 1PI3A 2H1SA 4REQB 1NVMB 1U7PA 2G5CA 3LUTB 4F12A 1MC8A 1QRTA 4MTXA 3A9SA 3AYXB 4ZVNA 1B8PA 3UCXA 3FYDA 4QFMA 1C7FA 4OXIA 1PCXA 1E1YA 2DKNA 4GX5A 3O6VA 3L7BA 1K7FB 1XZNA 3ZGZA 4BGUA 2IBSA 1RWOA 3C90A 4YFYA 2XUGA 1DQRA 1YAHA 1BHBA 2BBTA 5CB6A 4QDZA 4UCXA 3JASA 3ZV5A 1KDYA 3IE1A 1WTCA 1SMKA 1XQ8A 4LJ4A 4ZT4A 1C2YA 3SC4A 1XDCA 1BDJA 1B74A 4FP9A 1LPBB 4E4YA 1DXQA 3CG4A 1Z4IA 5DNDA 5IZCC 3CINA 4RF3A 4L5YA 2KQUA 2PVCA 2JD0A 4A6EA 2R9AA 1Y7HA 1NTZH 2FKXA 2A5DA 1K3EA 2FWAA 5NLLA 1RMQA 2D2IA 3WG9A 5SYNA 4R9NA 2GHQA 5LP6B 3OPNA 3WMFA 1VJRA 4PO3X 3MFYA 3TGWA 2Z58A 3RARA 4FBMA 1YJ8A 1BVRA 3GZJA 1NFRA 3QGMA 3IEQA 3VDMA 3K0AB 4IDFA 2FFHA 1P4JA 1EVJA 4U2GA 3TZHA 2E48A 1T2VA 3DCIA 1WU8A 3FVVA 5AOCA 1U2QA 4CT4B 2AW3A 5GY7A 1FFTB 5AOBA 4EATA 1G5IA 3KZNA 4FDVA 1YVPA 2W0XA 4KW7A 4E11A 1FDRA 2AS0A 3OZIA 2IHTA 5LP6F 4Q3LA 5AM1A 2Y1FA 4JIMA 2OXCA 2G8LA 3GN2A 3MJHA 4X62O 2X3UA 1XC7A 3LL4A 4JI8B 2P6YA 1EB9A 1EK6A 1I7SB 4RGBA 1MJGA 1VCOA 3S1SA 2HF2A 5B4TA 1LZLA 3GVMA 3G71F 2V4DA 3HCBA 4PX2A 2FB5A 3IURA 3EX7C 4D9HA 3UF0A 3RV3A 1YMUA 3O7MA 2IBTA 2EP7A 2FY8A 4NOJA 1NI8A 3J80N 1ZN7A 4EP1A 3N0VA 3HVHA 7REQB 5EJ7A 2CLCX 5AVYA 1DIGA 4D9IA 5CDFA 1JR6A 2LE0A 3DC6A 2BCGY 2V7EA 4L27A 1KUQA 2J6CA 2Q6KA 4TWIA 4XSVA 3QEBZ 3WIEA 1SOVA 3E84A 1EUCA 3CHYA 1QHNA 1ZVJA 1I4EB 3EISA 1GYPA 2ZIOA 2VWPA 2GBLA 2ASVA 3WA7A 2B30A 3V2HA 4W63A 2V7VA 4OYYA 1R88A 1R9NA 4B6OA 3ZWCA 2NQ2C 4TL6A 1KVRA 5EGSA 1ICIA 3V7NA 1QAMA 5E7QA 3SE7A 3FF4A 3L5OA 4CODB 2GH1A 1LNSA 2OCAA 4IAOA 1SXJB 2IE8A 1U0NA 1VMKA 1EA5A 1FTQA 2WPDD 5CH3A 4MQ4A 1BXRA 3NVKI 4L5AA 1IEQA 1XFAA 4D57A 4O4IA 3M6VA 1S4MA 4YCSA 4WZAE 1KZ9A 3W6OA 2RMKA 4E0BA 5T67A 4H7FA 3M6MD 4ZREA 2ZXUA 2DHDA 4QIWF 1HMPA 3QNMA 2X0IA 3BABA 1B93A 1G3QA 1LC0A 3ROEA 4G07A 3DE5X 4UVDA 4F38A 3K09C 3HL0A 4K35A 2D62A 4GSLA 4RPCA 3MRTA 3RVMA 1TUBB 1XPJA 3TQFA 3D36C 2VDNB 2VPXA 1GFWA 2C7PA 3FJYA 3CCVF 2RI6A 2XTAA 5CBHA 3VR4D 2O06A 4BX0A 2JK5C 2YY5A 3H6GA 4R1TA 4WCEV 1G291 3MCAA 3UJ3X 1Y8AA 1LV8A 4MVZA 1KRXA 3AU8A 3G1WA 1VHTA 3HXKA 2GI4A 3IOMA 3MHPA 1IZ0A 2W43A 3UGTA 2QMOA 1KY3A 1IDOA 4AKIA 3K5MA 4L72A 2VDMB 3SEZA 1A3CA 3TD2A 1WWKA 5DM0A 2MW2B 3K53A 2A1TS 4JPRA 2C5HA 4YRBA 1Z07A 4X1OA 1BOFA 4WD3A 1VQ8V 4U7FA 5F76A 5TEVA 2HN9A 1EX9A 1CKEA 3CJQA 4JN6B 1QVWA 3JX9A 1E20A 3ZGYA 3UK2A 2RKWA 4NBLA 2HM7A 1M3SA 5JCZA 4C89A 5CLHA 4P30A 3DC2A 1WXXA 5JWRA 1KD1W 1J95A 3VFDA 4BNVA 2BRUC 1W88A 2DTEA 3FPAA 2QLNA 4LHYA 3ZDZB 1VPEA 1WY5A 2ZJZA 1EFVB 4A36A 1TO2E 4XM0A 2DMRA 4ZJZA 1GG8A 1BX0A 4H15A 3WL7A 4D74A 3PPVA 2F9ZC 3A25A 3V1TC 4YR9A 4H1HA 2EBFX 1T6BY 4LF6B 4J9VA 2OOSA 1R3KC 1JSLA 3AVUA 2AXTZ 5CHEA 1CP9A 2WW8A 3EVBA 1Z15A 2YJNA 1B6QA 3AG2C 3P4UA 4EI7A 1ORTA 1DO2A 5DT2A 1GN9A 2VTEA 4NJMB 3P0FA 3AJAA 5JSZB 2V0NA 4AIIA 1SB9A 4MJLA 2PL5A 2ZZNA 1Z8DA 4XWAA 5DU2A 2OD9A 3RVYA 2BGRA 4WMLA 2XKJE 5KTNA 2L6LA 2LIVA 4R6XA 3SIPA 1NVWQ 2OOKA 1EFPA 4B2PA 2CZWA 4MQLA 3ZHOA 4GLBA 3PXCX 1XZPA 1OPXA 1VB5A 2GTIA 4DLZA 2YZMA 1KEEA 4QXMA 3P52A 1TM4E 1CLIA 2GQ0A 1QOQB 2QTVB 2QTBA 4OHCA 4AJKA 1NVVR 4TT3D 4PICA 1U9IC 4MUHA 4JTDB 3Q1LA 5CDSA 5EE0A 1QLNA 5B3JC 4UAJA 2CNKA 3E9DA 2X7XA 5CW1A 2CH7B 1A82A 4Y2YA 4X92A 2BONA 4GIBA 4TLBA 2PRIA 3JSAA 1R6KA 2YFQA 2CUGA 3GWOA 2WKRA 1G8HA 3O8QA 4S1NA 1QP0A 1T3ZA 3NAMA 2QXUA 5CYFA 2X2EA 2F7SA 4GYWA 3JATB 1JNXX 1KL7A 3C3CA 2CZQA 2ZUUA 1DAGA 3KKLA 4UE3S 1UXOA 4NMMA 4ZCLA 1T9DA 2IOYA 4Y2UA 1O6FA 4EVIA 1H7MA 3APOA 4EPVA 2FCAA 4NAHA 3DHEA 4A8JC 1E69A 3RWBA 3DVSX 5DEOA 1FLAA 1ORWA 1Y4SA 3GFTA 1J99A 2WP8J 4HEA6 3RB8A 2QTGA 2O2EA 3OQIA 1Y7TA 4FR5A 1BU5A 4P82A 5FA8A 2IPAB 2IIQA 3TLJA 2A6PA 3QKRB 4OXXA 4MCHA 4ND3A 3X1MA 3WFJA 1QJ4A 3ZRVA 5EB1B 4MRPA 5EHNA 2NU8A 4FIDA 3SF8B 2J31A 4YN3A 2JFOA 1IVSA 3KFXA 3L3BA 3TPCA 4UB6Z 3RSCA 4Z9AA 1MABG 5FYQA 4IHAA 1WPGA 1GZ0A 4PAWA 1SUSA 1WEKA 4GOMD 5EJ5A 2QQFA 1P9LA 2Z8XA 4URFA 1M7GA 3N2GB 1VSBA 2Z2JA 4U2BA 1JSZA 5GIPE 1Z0UA 1V4VA 4BNTA 3EGEA 4RAOA 1MB9A 2GPAA 1LU9A 4DRZA 2GPSA 3ZV4A 1N5JA 1F51A 2R5NA 2PX2A 5IJ9B 1H5NA 1TKAA 1TQ4A 1VL8A 2R72A 3DT6A 3R4VA 1K88A 4MW0A 2IV3A 4I4IA 2PZGA 1YJ5A 3EXG2 3KZKA 2YV2A 4RH0A 1ONOA 3TD5A 3WXMB 4MQ5A 2ZI5A 2I8LA 3RFVA 2C61A 4OY3A 4DZZA 4ZYTA 2K7ZA 4P92A 1Z3IX 4RZQA 4EFDA 1CIPA 3ZE9A 3TRHA 1H4SA 1NYRA 3KCXA 3KHSA 4H0LB 2ZYAA 3PXEA 4UTPA 2IRWA 5IT9M 4X60A 3V7YA 3RVPA 4M2LA 4X84A 3OIFA 2HP8A 3ASNB 1WA5A 2I4RA 2W6PA 2QB5A 3S3XA 3A3NA 1LSUA 4DR3B 5KNBH 4DKJA 4WI1A 5KZMB 6LDHA 1KMHB 2IH2A 5KC8A 4YROA 2FSVC 2HQBA 3LX6A 4F45A 4UMDA 4P0PB 4Z51A 4QGSA 1UBSB 3DZCA 4ZOAA 1G3UA 3PGA1 1N2SA 5CJ2A 5BV8A 3R09A 5KWSA 3LRTA 5HMLA 4CLXA 4WWHA 1TAHA 5KTTA 5KKNB 4MH0R 3OC6A 5CPBA 1XOUA 2DOSA 2QUBA 2ZANA 2J5QA 4YBZA 4PF1A 3BAFA 3JD3A 1JALA 1E8MA 5CDYA 3KLOA 1QQ6A 1BH6A 3C3JA 1K8AH 1OBOA 1UPAA 1ECPA 2DUUA 3S2IA 4JI8O 2IV7A 4Z2YA 1ZM9A 3MTBA 2WSYB 2C9OA 5I9MA 2M98A 4G0UA 5DW3A 1NQ3A 4CPDA 2D0PB 2IYEA 4AZ3B 4Q19A 4DG5A 1WCXA 1Y6ZA 1C0IA 1L8AA 3HDTA 4AW9A 2O48X 1X1RA 1INLA 4RJTA 3HVKA 1Q8IA 1XTPA 2IQIA 2ZNIA 2QTPA 3C7CB 4FCTA 3V4FA 3ABLB 3RU2A 2B94A 5GJVC 4AP6A 3IJ5A 5JR3A 2VS0A 3THYB 1MPTA 1Q0LA 3RUAA 2P4EA 1XZCA 4W1PA 2W2PA 4C3UA 4DYDA 3RKUA 1L5VA 3TIIA 2NUPB 1OT3A 1R0XA 5B7PA 4JQYA 3V4PB 5D85A 2QR4A 3BMXA 3G02A 3KIZA 1JTEA 5E1OA 3C6QA 3P0HA 2HHLA 3V8MA 4GL2A 1V4NA 1T5LA 4OI0A 3NATA 2GM9A 3HACA 1E2BA 2NN3C 1SKQA 4UU0A 2GFQA 2BSXA 4DCJA 1D0IA 1VP7A 3MYRA 5HK9A 3KB1A 3VR5A 3F4LA 1OVMA 3D00A 3JVHA 1P44A 3OQMA 3PCRB 1B1CA 5IBRA 1XHZA 2NU9B 3OMWA 2VUIB 1U0LA 3W2EA 1MOFA 4LZAA 3RI3A 2ENWA 4YRSA 2NSHA 2XCUA 1JA0A 3E6AA 2OM2A 4BTEA 4ALMA 4KE9A 2CLHB 2XUJA 4O08A 4X1YA 3HL4A 1JR2A 1YMVA 4NZOA 2C8LA 1W4RA 1OWNA 2IYPA 2IPMA 2XAJA 2MYTA 3BFPA 1T0KB 1EHIA 3CRNA 3K20A 3B52X 3QITA 1ZD4A 1R4MB 3MWDA 1DAPA 2WU4A 1JYFA 1TMYA 3PB3A 4HDSB 3DEZA 1XBIA 3SPXA 1TCCA 4R3WA 4MYSA 4EI9A 2AJCA 2Q0QA 5T3YA 1SBTA 5AW4A 4Y0NA 4JLJA 1S77D 1QYVA 4J7XA 5F33A 5B2FA 1B04A 4RKYA 3AY0A 3EQ8A 4DQLA 1DQZA 4Z4IA 3Q8HA 3B5IA 1C81A 4MQFA 3PQCA 4OHXA 2Q3JA 3JQFC 1SBIA 2AH5A 4Z8YA 1UDCA 2CUZA 4M3NA 3TLCA 4GPD1 5F23A 2R87A 1HZJA 5D6OA 4P80A 1O6CA 4GR9A 3E2EA 3UGQA 3TGPA 2VQEO 4TRMA 3QE0A 1M6YA 5IH3A 3ITDA 4MS3A 5K09A 5TMBA 2A67A 3OTIA 4CUJA 4B2YA 1HE4A 4C7OB 4WN9A 2OILA 4EG1A 3WJRA 2ZNJA 3X2QC 1EDOA 1ZM2A 4Q82A 3IH5A 1AB5A 4XFDA 4EGQA 2P1DA 2FFQA 1P6QA 4KLCA 3Q87B 5B3LA 1JKJB 4HEA1 4ZZ0A 1ENVA 5EEGA 2I7CA 3SX4A 3IB3A 1H2FA 2ZS8A 3QHDA 5JD4A 4ZEVA 2C83A 5JASA 4LF6O 3GD7A 2UXCB 2WYIA 3B6NA 1WMAA 1OVGA 2OGZA 2QMHA 5KX5A 3CEHA 5EE3A 1VPVA 1XK6A 4ARZB 4DSAA 2XA1A 4MR8A 3SR4A 1IN4A 3WBFA 1U4SA 3CLRC 1IXYA 3AFOA 4M4SA 3P9QA 2O5RA 1XNRB 2BMFA 1RRVA 4IG4A 3GPBA 4X9QA 3M6AA 1MOSA 1I0IA 1TMGE 4R40A 4MVWA 1JX6A 3AV0B 2R6JA 3E7DA 4LDQA 2QLBA 4IKOA 5CITA 3CKLA 4P98A 2ZXWC 2LPMA 2PGLA 1NVPD 3BYQA 5K0JA 1PFWA 4ZAYA 2VL7A 1FAFA 4EFLA 1IBLB 1BQZA 4IMPA 2XAGA 3ASOB 3JQGB 1LK7A 4I9UA 1K4YA 1P0MA 2VWHA 2VNSA 3CGWA 3WAGA 3T3GA 3UT5B 4CBCA 2YMLA 3ASZA 5TJ9A 2GV9A 5FJJA 2XUMA 2VBGA 3PNBA 5ALSA 1GV0A 4U02A 1EESA 1Y3BE 1UWCA 2TECE 1YE3A 1K1EA 4LRSB 4Y1GA 2QE7D 3I8OA 4P81A 2IZ5A 4TT8A 4OJQA 5KYYB 1I7PA 3AEZA 4GOJA 5BN4B 3ICQB 6CHYA 5E6UA 4DQUA 4XCQA 5DHUA 1Z4JA 2ZVDA 1BNCA 3OAAD 3CSUA 2PL3A 3IAS6 5E0OA 2O7RA 5JNWA 2D3TA 1V48A 2IIVA 4BCCA 2XGSA 3G9UA 2RH4A 1S3SA 4XD7D 3KUXA 3INTA 4KLNA 4ZGBA 1N8SA 5KNCH 3EZ6A 4RUKA 3AVQA 4RF4A 2YEVB 5JDIC 1M34B 1U5BB 1JFSA 2ZROA 1ZAYA 2PX4A 4UUAA 3L6CA 4ND8B 4CVNA 4FE7A 2X0KA 4J0HA 5JAMA 2I1VB 4C01A 1SCDA 2HS0A 3L06A 1YMQA 4B6PA 2VHQA 4DUGA 3MTQA 3R0PA 1DKNA 4YUXA 1XF1A 1OUMA 4YT4A 1JG2A 1Z0AA 3KJJA 4R5MA 1N33B 4YIPA 1W44A 1ZGCA 3JQ9A 3DLPX 4EW6A 4CQMD 1D3AA 4MLCA 3P9PA 4CJXA 1YCIA 1OTYA 3VKUA 4UEJA 1NUPA 1UMCB 5EKXA 2Y27A 2HWYA 5F9MA 3OJXA 5CG2A 3Q8XB 5CB4A 2WZBA 4ZO8A 1T9GS 2UU9O 1Y5LA 3R3XA 3Q7QA 1ZUWA 2JVJA 4I66A 4IO1A 1JJAA 1O08A 1JQ5A 3UXHA 3JARA 1MX3A 5KC9A 4JI2O 3D8BA 2GVZC 2BTQA 4C07A 1Z8NA 1GZ7A 2QQEA 1WDMA 2WEKA 3ILVA 5A5GA 2YV5A 2WC1A 3EWIA 1O89A 1YQNA 1RQ2A 4ARSA 1QAQA 3CBQA 2C84A 4FZVA 1AHNA 2JAWA 1V37A 1X14A 2VSXA 5IT9A 3SJCA 3VCZA 2ADPA 2XAHA 2OV4A 3W6PA 5BV0A 1A72A 3KUDA 2ODAA 1P1KA 2H2HA 4Q7JB 5JO0A 3H9VA 4ZC8A 4JTAB 5BWNA 1BHAA 1ECFA 2CFCA 4KV9A 4LJ5A 5CVVA 1XHLA 2HU7A 3L6RA 4ER5A 4WCFC 3ZLJA 2DTXA 4L8JA 3WRYC 1DJQA 2HVYD 3HZZA 3KAQA 4OJYA 2ZBFA 3ES9A 3RK4A 4GI2A 1YAJA 1ZWLA 3UAGA 3HYNA 1BQ4A 2CVPA 5JS8A 1SY7A 1ZK2A 3DPUA 1X3LA 4KQCA 3P96A 1GM8A 3TKAA 5B3SC 2EFCB 1E2QA 5B5SA 4P3NA 4FQ5A 4PRLA 2GGSA 2HT6A 4RKRA 5L8VA 1T36B 4F9EA 3OKFA 5LMUB 1GAJA 4AUKA 4OAQA 3H42B 3QPCA 2CD7A 4EDHA 4G4XA 5I4IA 5CCBA 1IU9A 1VSTA 3QHAA 4NH0A 1V26A 1MSDA 2YMMA 4AM8A 5AHOA 1IEXA 2ZXFA 1ZUIA 4U7OA 3SDLA 4RESA 2VWQA 2HRYA 1KRWA 2WT4A 3SYNA 4ZWNA 3TETA 2PRJA 2YHAA 3WQQA 3W79A 3FDFA 4RPLA 1OB2A 3PC8A 2UV8A 3V1MA 9ABPA 5LB2A 4FDLA 4XYBA 4UAUA 4BP8A 3ZP4A 1QFYA 3VUEA 3EAFA 3UICA 5A7FA 4DUYO 4J7KA 3GR6A 3KR0A 3D02A 2PIAA 1IB6A 2Q5QA 1SXPA 3BILA 4GLOA 4JYPA 3R5KA 1S01A 4NMWA 3FW1A 4DNOA 4NX2A 1M57B 1YQGA 3Q7PA 3H1AA 4KNWA 1NI4A 3LUHA 1OGIA 1E63A 1GZHB 4CG1A 4BATA 1JI0A 4N23A 4AFNA 4N3CA 4TWRA 1A9XA 4Q37A 4CMAA 2XYPA 2XT9A 1ZK0A 1U1CA 1XZHA 2ZUEA 1LUWA 1E59A 3PUWA 4KPGA 4CEJA 2Y69C 2N3ZA 3I76A 3T3OA 4OQFA 1C1YA 2PRYA 2W2LA 1PFVA 1L8OA 1DMSA 5EJMA 4FK8A 1HYGA 5B58T 2BGWA 2AMVA 4L22A 3QTBA 4L9WA 3MAQA 2C2KA 3FNIA 2LP7A 2FWIA 2UYOA 2FSUA 5KNDA 4JI6B 2PBFA 3FAKA 3SFZA 2AIZP 5LP1A 3AGKA 1AA9A 4ZT7A 3GOQA 2G09A 1W93A 5CNJA 1ISIA 1JPJA 3JQAD 4IGAA 1EZZA 2RHBA 5JVDA 4A91A 3UJCA 4GEKA 3A7DA 4FCCA 3U80A 2ZTSA 2D5IA 1KC8W 2PUJA 1GTJ1 1V3TA 3TL3A 1YZGA 4JMLA 4F46A 1L9KA 4QXQA 4RDIA 4NEGA 4C81A 1WW3A 4D9GA 4J0JA 5D3MB 1L7VC 1FS0G 4F3KA 1W85A 5LN1A 2DCUA 3OEHG 4QJIA 4AMVA 4FOOA 3E9RA 4AY5A 2POQX 2PVPA 4HJRA 3FUUA 2WA1A 4G0OA 1ZA1A 3REQB 1AV6A 3ZE7A 2HXGA 3L7YA 4ON9A 1YS6A 4BX2A 1X8KA 3G6EV 1QU7A 1EE2A 5DSXA 5HTOA 4DTIA 4PGFA 4R1NA 4PWZA 3HMKA 1QFZA 3IAS1 3PLNA 1G8GA 3AG4C 3ESYA 4ZHSA 3OY2A 3E8SA 3KG2A 1C1XB 2I2BA 5GZ1A 3UMRA 3OF2A 3MGGA 1FMTA 2W9XA 5IHXA 1Q43A 2QKCA 2C3PA 3WWDA 3HJAA 1YQEA 4G0XA 3QBJA 2UXCO 4M0EA 1U11A 5DISB 2N74A 4FFSA 4JWKA 1CR1A 4BMXA 3UWPA 1N1MA 3AM4A 3DB1A 4QVGA 1GGEA 4A5UB 5I51A 1UBJS 4B6RA 3PR3A 4D4GA 1XRSB 4G6ZA 5CT6A 3DO5A 4IR7A 2ZR7A 2W6MA 1N8KA 3U0BA 1UKYA 1VE1A 2BOCC 4K3UA 1ZXBA 2SBTA 4QEKA 3HU1A 1IOZA 3EIWA 1VF5B 1P1BA 2YS7A 5LOVA 3C3MA 3CNQS 1Y6RA 2EIKB 5BN3A 3KT3A 5B2EA 5C1BA 5H9CA 4LZLA 5KTSA 5JCOA 1D2CA 5CFMA 1PW7A 2PX5A 2GJKA 4KQ9A 4UDYX 2DFNA 5HOQA 1FK8A 5C81A 4P5PA 1W48A 3U16A 4DJFC 4ENUA 2H48A 3T3MB 1SU6A 2BHSA 1WNTA 4W7HA 2PF4E 3UJ9A 1DGQA 5TMPA 3P9RA 4LZWA 5HDQA 1T1JA 3TW8A 1Q2XA 1R50A 1KQSF 5T4FA 3RYFA 4WFEA 3S02A 3DXFA 3T54A 5AI9A 3H5WA 3AOEA 3K0BA 1TW3A 3RE1A 4YYEA 1GU7A 3PU6A 5K0CA 2I2DA 5HIAA 2I6GA 4EFBA 3LYHA 5AJZA 3WR5A 5K7SA 1KTVA 4I14A 1MGOA 2QTNA 3W7SA 3ZDDA 4AZ0A 3S0HA 3UBTA 5K0LA 5TNXA 2QN2A 5F7XA 4JBNA 2GBGA 1HSOA 1MAHA 3ETEA 4PAQA 4FJ0A 3HI6A 4RA6A 3DOHA 1SKMA 1OYVA 1Z4QA 4JUCA 1PPJH 4KRYA 2QWRB 1FPOA 1GEGA 5KJCA 3QELA 1XL1A 4J7UA 1V45E 4AJ1A 4R9SA 2LTAA 1P7WA 4PVCA 5F4BA 2BGUA 2BGMA 1XA3A 2A7QA 1UXGA 4DOMA 2GR9A 3CMAV 4QQNA 3ZQKA 2A7WA 4UPEA 1V8OA 4V0OA 4HGPA 3EJ6A 4LPSA 4TMTA 2H00A 1VDMA 4QTYA 3TOXA 1MJGM 4QPJA 3JWPA 4MVRA 1PQ4A 3HUUA 1FNMA 4CKEB 4X62B 1C7RA 3GFBA 4F06A 4BBPA 3VTKA 5EZYA 2CFRA 4NFLA 4PYKA 5IBQA 4PCLA 3VTIC 4ENWA 1N33O 1M75A 3L6BA 5AI5A 5KWJA 2GN4A 1XUQA 4R2JA 2EBHX 2FDRA 4J7AA 3W8FA 2BYTA 1EG7A 3M2TA 4YAGA 5DNYB 5FEMA 1QE3A 4F92B 4N03A 3CCEV 2GUZA 4UVGA 1KZ4A 4LQ4A 4QT0A 4MINA 1NH2D 3PITA 2HUNA 4DLYA 1QHFA 1SEPA 4RSRA 4HUJA 3JSNA 1CZNA 1AQYA 5LD2B 4D26A 3RYCB 3GH3A 2VHYA 5AUOB 2GN6A 1M8FA 3IESA 1C9KA 5FR1A 1X74A 4ZVOA 5LBQA 4NICA 2WU1A 4KOEC 1JECA 1JIUA 2EFHB 3FLMA 2GNPA 1A5ZA 4X7RA 2C07A 4CF5A 1MKYA 1Z0ZA 2BE3A 1SZDA 5K3CA 5CTJA 4QBHA 2H2DA 3EPLA 3AU9A 3UMYA 3JV7A 2OTJF 3OVMA 2FH5B 2CW4A 4MEJA 3HO8A 4G36A 2PT7A 3U37A 5DBOA 2UZ1A 4UNPA 3UAXA 5E6SB 2C0QA 3OCJA 3BGOS 1TK2A 3A6ZA 4B6EA 3L82B 3T35A 2YXDA 2XQIA 3DULA 1I8TA 2BLNA 3IR5A 4EBFA 4OU4A 4K9SA 4CCAA 1VI5A 1E3WA 1GR1A 3QLTA 3IA2A 1A76A 1XD2B 3B89A 2BCJQ 3B8MA 4MV3A 3I4LA 1Z8HA 5ITSA 1FUEA 3T3NA 4DMUB 1R1BA 3KYBA 3L7JA 1X7WA 1UUFA 3CSXA 1PVDA 3HBJA 3QBEA 3RHZA 1CUIA 3UUFA 3QKIA 1J0EA 1NNEA 5LL6Y 4OAOA 3R66A 3NANA 4NHOA 2AI3A 3G9QA 5K0BA 3RU9A 5G2OA 1NJGA 5H6QA 1KFKB 1SOWA 3VR3A 5DNAA 3CN7A 3BFRA 1H05A 2XWBF 4F4HA 3QVNA 2VCHA 4CV2A 4HP8A 5LMUO 1JIQA 4LXXA 1HE1C 2W8BA 1HC7A 4KITB 4UCWA 2TSYB 4J9YB 2V5UA 4RY8A 2R00A 4TVBA 4OPHA 2CZGA 3EFBA 2FN9A 2D5LA 1N2EA 2IYWA 3DXXA 3LGSA 1OFVA 3ELUA 4F4UA 1MABA 4JOQA 4E1AA 3JYCA 3A8TA 4YRRA 3H9QA 1GL7A 2XDAA 3R6LA 3I62A 3O74A 1PNRA 2MK3A 3ZK7A 1GNRA 1XBLA 1PG5A 3QWHA 5HKOA 2QUAA 3I8XA 5TB5A 3DTTA 3WMRA 1KQGA 2QTTA 2Y6UA 5I9TA 3P9ZA 1UEIA 1QQCA 1FYJA 3PRYA 4B85A 4CYMA 3GIWA 3N9IA 3OX2A 3V7EA 3MJVA 1IHPA 3SJZA 2P67A 3QIVA 4PDMA 1K73H 5BW4A 2IPOA 2GZDA 1KY2A 4ARUA 3HJCA 3QJYA 5IAKA 3ICWA 2QENA 5BUSA 4ZYLA 3Q9SA 5K1PA 5E8JA 3LYBA 3TNFA 3AW8A 3A1EA 2FFBA 4IYRA 4DLNA 2BFFA 3ZEDA 4FW8A 3PENA 4OQDA 3LSQA 2BY4A 1Q0PA 1B16A 5DMXA 1AE1A 3UYLA 2DWPA 1VF7A 4L7VA 2PUCA 1E1DA 3EDRA 4H44B 4HWSA 3BMQB 4FONA 3CYFA 1ZICA 2H7YA 2EX0A 1EJ2A 3HI4A 3DT8A 1NW7A 4I4CA 3MVEA 4LGMA 1S5PA 4JI6O 3AZQA 2ZIFA 2NGRA 1KSJA 1WMBA 4QRDA 4KXYA 1E0SA 4E5PA 1Y98A 2Z95A 4J3JA 3V8BA 4O2AA 3DAOA 3GBPA 3B7PA 3TCXB 5EXPA 5JV5A 3AG7A 1MNGA 2FC3A 2BMAA 2QTSA 3WX0A 1EP3B 2M1ZA 4PZUA 2VJMA 2EYQA 3KNZA 2ZB3A 4EA8A 4I1OA 5J63A 1NZJA 1KXZA 4AUEA 4J9ZB 5CR9A 4DS3A 3VX4A 4WX2B 4GPZA 3K4HA 4ABYA 2R7MA 2GN1A 5CM9C 3LH5A 1AQLA 4DSOA 5C2JB 3FIUA 1UIMA 3IEKA 3U7QB 1OY1A 4Y2VA 3OFNA 3TVYA 1VE7A 1P4GA 4GE0A 4EEQA 2R60A 1UDBA 3WFZA 4QDXA 1QC5A 3SPGA 2JS3A 1WOYA 3HVIA 3F1KA 4DIUA 1MRNA 4DQKA 3H3XA 3HDVA 5B36A 2F9LA 2ERCA 1CZUA 3PC4A 2C7GA 3BXHA 1BJKA 4Y1RA 1G6Q1 1XZJA 1W35A 4C43A 2XB6A 4CS3A 2KBFA 1YGYA 4UUBA 1QGUA 1WBJB 2PZ8A 4KWHA 2YC0A 1OLXB 2VATA 2ZGVA 3BERA 5JS7A 3GDFA 2JI8A 1YBHA 3T94A 3TM5A 2XB4A 1IRIA 1DTEA 3M81A 4C6TA 4ZFNA 2HSEA 2ISCA 4JEMA 1WXHA 3ZNOA 1GSOA 3WYAA 2P79A 3E18A 4ER7A 1VYTA 2L17A 2HA5A 3G8YA 3BRWA 3QX3A 4CM3A 5F64A 2BN4A 3C16C 4B62A 1GSAA 1ULZA 1QYXA 2MJLA 1LSSA 4TPKA 5I9NA 1QBGA 4I19A 2JGFA 1RPJA 4OFWA 4X8LA 2EKZA 1XJQA 1EK1A 3EGCA 1LVGA 3NUGA 1FPMA 3TLBA 2E4WA 4BMCA 1SXGA 5BR1A 4E2ZA 3RSSA 2A5YB 3B7GA 4C88A 3P0ZA 3WRXA 1M10A 3EXHA 3BWVA 4RUEA 4F85A 3C6YA 2J0EA 4BC0A 3RGGA 2IH3C 1DZIA 3IIMA 2WYUA 2BFBA 1GKKA 2JFUA 4XVHA 1KMQA 1EVZA 3ZBTA 3O8LA 4TTPA 4UULA 1SRQA 3DKPA 1DV2A 5FPOA 4EMBA 4CV0A 1D9XA 3SPHA 5AXBA 5LMCA 4AILC 3CH6A 1ADYA 1MUUA 4N0QA 2ZAMA 3AVWA 3RC1A 2HWWA 2Q6TA 4WOPA 4Y2GA 2CLSA 2QBYA 3U48A 1HYQA 3ZU3A 2TS1A 2H4ZA 4QOHA 3QWFA 4RZIA 1JHRA 4F0JA 1BDMA 5L95A 1E2PA 4P3PA 2R68A 4L5CA 1YS7A 2EEPA 4PD4F 1L8XA 4GMKA 1VIYA 3IC7A 1RRCA 3TH5A 1JWBB 4EHJA 4O8CA 2ZJ4A 1W29A 4KR6A 1H2MA 1SHTX 1W0KD 5JNSA 2YMPA 4TTJA 3A6EA 5D84A 1DWOA 3ZD8A 1DKLA 1TOAA 3NHSA 2XGGA 5ARCA 3CZ4A 4Q3BA 5A0FA 2P9HA 5JNTA 2PMBA 1H2BA 1FZTA 5I4BA 1FPQA 2WG2A 1OYYA 3EZXA 3K5OA 3KWJA 5DECA 3NHFA 3GGGA 5HMMA 3EFHA 3N6RA 2PKWA 4B7AA 1ATZA 3FG9A 4FLMA 4PONA 2QS9A 2CJXA 2YIJA 3TUIC 5ADVA 3FHTA 4YWJA 4IFIA 1L1RA 2P8SA 4DADA 3QQPA 3ORRA 2HO5A 3ZY6A 4LNHA 1SQQH 1NSTA 5K0ZA 4JLDA 2OLKA 4QM7A 3DSQA 4P86A 1Y42X 1KQNA 3AEIA 1U8UA 5E38A 4U8GA 1R5NA 2X3YA 1DEOA 1GILA 2REOA 4E2XA 2QR3A 2PUAA 4HYTA 3HKEB 3X2FA 2H08A 4F4LA 3R0IA 3HKCA 3C2QA 1PYGA 4PPGA 2YXPX 2J07A 3T38A 1WAZA 4AMBA 1JY8A 4HRXA 4MWCA 1RRGA 4NUTA 4EUFA 1BROA 2ZR2A 4A82A 3IQEA 4A0SA 4F4JA 1O87A 2O8CB 2UZAA 4PHGA 1GJRA 2FLVA 2RSLA 2QAGA 3O8NA 3WYCA 1T0UA 1X8JA 1CLEA 3SKXA 1K9SA 3CXCF 1BD4A 1JDUA 1VH8A 2C8JA 1CSEE 5KAMA 2GAAA 3EXIA 3KU4A 4PE5B 4F5DA 4JT9A 4WY8A 3OZCA 3K6SB 2A06H 5JFGA 5LXTB 4EG3A 2QVZX 2G9QA 2I2CA 2FRVA 2OUIA 4GWKA 3H8VA 3LUPA 2CXRA 2YJ6A 4QEDA 1A5SB 1Q7TA 4FLUA 3NWJA 5U4QA 4LF8B 1SQ6A 2IUFA 3H7AA 1Z74A 5CNKA 1P61B 4TVSA 4Z7OB 4HSEA 2UXNA 2W2QA 1JPNA 4MPDA 3L18A 4BNDB 1N1DA 5K0FA 4V03A 2DQKA 3O1LA 2Q8QA 5HKBA 3AHHA 3L0OA 2A1UB 2B9VA 1L7NA 2WB2A 5LXTF 4NXNB 1E3TA 1R27A 4FFLA 1U8ZA 5H5JA 3A4NA 2NO9A 1IBCA 3ND5A 2YDXA 1RAGA 1J97A 2JLXA 3D43A 1C7IA 3SC2B 1FTNA 4H18A 3NIBA 2XKAA 1V9PA 1CQPA 2IZ6A 4TXHA 2B25A 3A1TA 3ZE6A 4LFCO 4K8XA 3GYBA 1NA5A 3NEAA 4Z4GA 2E37A 1RYFA 3IQGX 1LFDB 1U02A 1FMJA 1DEAA 1NUAA 3DEIA 1Z5ZA 2GRAA 3OKPA 1NVEA 5ALOA 3BS4A 3L92A 1YZKA 4IRXA 3U5ZB 2I22A 4ZQGA 1YZFA 4M1MA 2RIPA 4RF5A 1N78A 4U9IS 2VQEB 1LY1A 4PFSA 3A6DA 5KOHB 2VP4A 4K6CA 3D3NA 3IELA 1JU4A 2Y1OA 2HUPA 3R0XA 5AW1A 3RAEC 2V4MA 4JCOA 1YZHA 4KIFA 4OX9Y 3HXLA 1V9LA 2A9OA 2YUTA 4HX5A 4ECAA 4NOLA 1GGMA 3NIGB 2O7NA 2HV8A 2OYQA 1YXMA 1XCOA 2OVBA 5EQTA 2R1TB 2O8FB 4UZFA 3KZIZ 1JKFA 2ACKA 4MGHA 1A4UA 2HQ1A 4XX1A 3RW0A 4Y6LA 3HZRA 1QO0A 2F2TA 4MKHA 4DT1A 4YMUA 4HD8A 3KWMA 1T5SA 4DPMA 3S1LA 5JJEB 3TUZC 1BWSA 2UYNB 3IV7A 3C3DA 1K8YB 1YJWF 5AVSA 2DF8A 1GGKA 1M0WA 3BMNA 5I7VA 3CCQV 4ZI7B 1LDYA 4WFIA 4MWDA 4A15A 4TQ9A 2PA3A 4WY2A 2RG1A 3QUTA 4YAOA 1XYVA 1ZD9A 3PICA 5AKEA 2PMFA 2PI5A 2PL1A 5BSMA 2R84A 2CNWA 2UZ4A 1VQPF 3H0CA 4XVQA 4BMPB 4UZSA 3LWPC 1JHUA 3F3MA 2XGMA 4N3NA 5JXJA 3Q4GA 1GDHA 5JCXA 2RHWA 2W90A 1B14A 5E7JA 4CDNA 2AFHA 5FNVB 4J0GA 3MJDA 1YA4A 1CQWA 4OMDA 4ZI7F 2GCEA 1II8B 2DBZA 1SJ9A 2D4AA 4F5YA 2YJ5A 1Z5VA 3PUXA 1LTHR 4D97A 5HF6A 4XVCA 1GD1O 4HGOA 5IUJC 2KQXA 3ZTWA 2VWGA 1SKAA 3GFQA 4OL9A 1MC1A 1DAHA 2WF6A 1EVIA 3CWCA 3SKVA 4WBNB 2BGTA 4Q4LA 5ECGC 3HUDA 4MWGA 5FNVF 5CG1A 1L4KA 4KDCA 3KELA 3MRXA 5F3DA 2B98A 2XDYA 1OQAA 2EZTA 3CCMF 3BD8A 5KBYA 1Q5OA 2DQSA 4HAWA 2W37A 1AX9A 2X9LA 3MRSA 4HGNA 4JV5O 3IXLA 4ZEWA 5CBFA 5CEFA 1GZ4A 3L9WA 2J3KA 1WN7A 2JRIA 4FGZA 3ZO8A 2NMVA 3WGLA 4NCJA 1TRHA 4X8MA 1C3EA 4KB5A 4WBNF 1XTRA 3LO5A 1GPDG 4S12A 1HY3A 3CPEA 2Q7XA 1NBMG 3QG5A 2GT1A 2CUNA 3ZWWA 4XFKA 2IYFA 3ZVKA 1JDVA 1J0DA 3EIHA 3GEHA 4O4JA 3E3AA 1D03A 4BVHA 1WB6A 2A0YA 2XMCA 3OCYA 4FE3A 1EHYA 2AZ4A 3GT3A 1JNYA 5NULA 4HDNA 2QQGA 2QJOA 2RGRA 1U31A 2ZRPA 1NSYA 2BMEA 4N21A 1M0EA 1NQWA 1MGPA 2Q6AA 5K45A 2EFGA 3QNEA 1O96A 2ZJ8A 1TM1E 2OBBA 1WUTA 3I9KA 5FBKA 3DBLB 1NFFA 3G2KA 4B3MB 4MDYA 4KEAA 5CP8A 3B4SA 2IZOA 2H63A 5LR6A 3S2SA 1E6MA 3GK3A 3TK1A 3KAJA 1ORDA 3B12A 3TZKA 4QJFB 4YAFA 1I1QB 3GMIA 3KKQA 3W4KA 3HA2A 4G5OA 2UU9B 4UHJA 3L77A 3QVUA 3OH8A 3E86A 4RY0A 4PU0A 1JHZA 1MV8A 4LHXA 1S4QA 5DSZA 5BRAA 4H08A 4JI2B 1SS3A 1TCBA 1XDSA 4G1MB 3GH1A 1UKEA 3DMPA 5KYXA 1Y76A 4AXBA 3C5VA 4QSMA 1D6MA 1PSDA 3E9QA 1GOTA 4K9DA 1QS0A 3FOFC 3UNXA 4PR3A 3T52A 4PZPA 4CF7A 4QODA 3G8CA 1CCWA 2WWXA 3CEIA 3GAMA 4FI3F 4IINA 5JWOA 4RFSA 4I08A 1FC0A 1TRKA 3CZPA 3PC3A 4JSYA 2C5AA 3UUGA 4HLNA 2DLDA 2VJDA 4KQJA 1PGJA 3DE0X 3SYMA 2I1LA 3QHQA 5BOVA 4FHFA 1I32A 3IJRA 5K6AA 1RHRA 1NDQA 3OEHA 5AVWA 4Z4EA 3W5JA 2J7PA 1GCAA 2POCA 4O2BA 4KRXA 2V7GA 3BD6A 3THXB 4AO7A 1TADA 3WP0A 3DWGA 1P77A 4Y2JA 3BQ9A 1D2DA 1M1YB 1G7SA 4NR0A 3U26A 1S3IA 2B7CA 4J07A 4QUEA 4LIPD 1SQPH 1WMSA 2JJ1D 2NO7A 3B53X 4GMGA 1VQOF 4HNTA 3NTOA 1YIAA 1VBNA 1DIBA 3SEFA 1U28C 3WK7A 4R69A 3R8CA 4DDMA 3DBRB 3D1VA 2QMYA 4BV8A 2D1YA 2ETXA 1WZUA 4F11A 4J41A 3AQ4A 4Z54A 3DXYA 3ZV6A 1YJNV 1WF3A 5AOAA 3U9TA 2P6MA 5EP1A 3CE2A 2YN2A 1ZXLA 5I4KA 4DK1A 5AKHA 5FL3A 1AKYA 4AMUA 3LA6A 3L93A 1KZGB 4Q18A 4LI0A 1XTSA 4DSUA 3FCXA 2PGIA 3FDZB 1BO6A 4BQQA 4DDKA 1O95D 2PUSA 3PE3A 3W7BA 2I3GA 2VT7A 1OBVA 2IXBA 3O31A 4GGPA 5A7HA 1M2VB 3HFJA 4IDBA 2I4LA 1AILA 2V4ZA 4GZ6A 3OP1A 1EBBA 1JIKA 1YIJV 2W0FC 1ZRSA 4BX8A 5ELXA 2ZIMA 4PA4A 4DUYB 3G5AA 2ZSDA 1U3TA 1U8FO 4PC2A 2FSSA 1CRLA 4N7RA 3FNGA 2GBFA 3DE7X 2ZUWA 4ERNA 4L07A 4GXTA 1U7WA 2HV9A 2IFTA 4NOMA 1F0NA 2FQYA 1JDBC 1BMFA 3O84A 4NVPA 4RY9A 4RABA 5B7GA 2IOFK 1I2AA 4XI9A 3K3PA 2GYUA 1BGYH 2I2WA 4KUMA 3QEOA 4R16A 4ZDJA 1K7EB 3MRVA 1OCOC 2Q69A 3AH8A 1RFGE 4KI7A 2R9IA 3HNRA 4RPIA 3T9DA 4ZHQA 3IALA 1UQTA 4I0WB 3HCWA 1VKZA 2QLLA 3FBGA 3OM9A 1E6UA 1LPSA 2AV6A 1MG0A 2H8EA 4WY5A 1OH6A 4LF8O 4LMRA 3V8PA 1OXTA 1T4DA 4QAJA 2C92A 4QDUA 1EWRA 3MCVA 1JVMA 2GSWA 5F1PA 4EEXA 1F0PA 1OTHA 4H59A 1KORA 1YBAA 1ZUQA 1TNDA 3ORQA 2GJSA 3DNPA 4PYMA 2ZIGA 1FY2A 4NXNO 3PSHA 2J3HA 3IMFA 3PWZA 2JH8A 3U6KA 3NDPA 3V4LA 3DBVO 1NZFA 4LP8A 3FCUB 2Z2XA 2ZIZA 5IJWA 4L02A 2RAVA 4U6NA 3K4PA 2FZCA 2G77B 1JGTA 3L4BA 5I3ZA 1Q81W 1S0UA 2Z3WA 3L0YA 3ONEA 1YK0A 3L2OB 1PFUA 3KOWA 3SMQA 3L43A 1F51E 1K89A 1OKKA 3OETA 3WNVA 2IIPA 1NRXA 3IDAA 2DWEC 4RQEA 1OV4A 2YIVX 3RD5A 5LU9A 3KWLA 2RBKA 1BGVA 2R6GA 2QW0X 4HZIA 4KFRA 1TJ3A 3W5DA 2A1IA 1ISFA 5BN5A 2NAFA 4M54A 3U60B 3HA7A 4OREX 4D4HA 2P2GA 1SVUA 3KCYA 4Y2RA 1X9HA 4JNKA 1P6XA 1JLMA 2W6ID 3EY4A 3CW8X 1CXZA 2GAJA 2R25B 4YRKA 3PUHA 4AJ9A 4OP3A 2BL4A 2GM5A 1QV7A 1GT91 3S3WA 1HETA 1PT8A 2WTMA 5EZSA 5FBVB 1BEUB 3ZZMA 2RB5A 3RVRA 4IIJA 1YVWA 5JDCC 3HRIA 4O02B 4OA8A 3ICVA 4BXOB 1QHHB 1XV5A 1DX9A 1SGWA 1SKBA 1ESCA 3T6KA 4TRNA 2B3DA 4MTGA 1QH1A 4ZRNA 5KAIZ 5FPRA 2V6JA 2AYXA 5B1SA 2IKSA 2W71A 4ZV7A 2DW4A 3JCMM 3RUFA 2QYOA 1RYYA 2RBEA 3HP7A 2OENG 4JLMA 2JFWA 3D6NB 3UT6A 1TJPB 2Q2WA 2WKWA 5F98A 4YK7A 4PZDA 3NJ4A 5E4FA 4XARA 3PL5A 1TFRA 2QY6A 4L0DA 1WA8A 1UWKA 5K5EA 5ESDA 3DFZA 4EJSC 4B84A 2WF8A 1H69A 2WPDG 4XIYA 3GFGA 5D5QA 3VVMA 5FPKA 2Q5ZA 3HSKA 2X58A 3ZS9A 3TSAA 1NP3A 4MP6A 3OMIB 2ZIWB 4FZRA 1WE2A 5IJAA 3FB4A 2YVUA 1U2PA 4U8HA 4MYDA 3TB4A 1C7ZA 3MOSA 4EYQA 1NR7A 2ZTUA 2PFGA 4HRVA 3DZJA 2BFCA 3RBZA 2Z1DA 1KK3A 1S3FA 2NTYC 4DV0B 1JMKC 2B1GA 1UK8A 2I4OA 1ZI6A 3K59A 3E1KA 4G97A 1XREA 3OZSA 3GZ4A 3UO2A 3GT7A 1YR2A 3O9VA 4FGUA 2G07A 3ER6A 3GIDA 2O19A 1H47A 1VJ0A 5FO0A 4C2AA 2ZI6A 3LO8A 1VQNF 3HRKA 3H86A 5L3EA 3Q9LA 4FQ7A 3UH1A 1ZN8A 1E3JA 1P2TA 3TSOA 5DYYA 1AO0A 1P75A 4WOBA 3NKVA 2E82A 5HP8A 1NNI1 5CEJA 1GG5A 3V4VB 3DPIA 1WHSB 4J90A 4R2MA 2BOBC 4YAUA 3H1BA 2WKPA 1XO1A 3H1HH 4AQ7A 1ECLA 1N2CB 5T7BA 1ELOA 2R8PA 6Q21A 1RE1A 4QOFA 3M4XA 4ZU1X 3AERA 4RXTA 1SG9A 4TMXA 1NDUA 4EW1A 1RJ9B 1ZFNA 1QHTA 5IC5A 4C5BA 3L79A 3QVGB 2QX7A 4G3XA 4AJLA 5TE9A 1OIXA 5C1IA 4IH9A 2OGUA 3O0TA 1KYVA 1DVRA 3ZOKA 5KJFA 1JQBA 3IVAA 1J0CA 4ZXPA 1HFEL 2NAPA 4KPUA 2WHQA 4BVAA 1M72A 3D6AA 2OD7A 5IEJA 3ADDA 4B3MO 1E1RA 3RQSA 2AUNA 2BEVA 3MJRA 3I30X 1V7ZA 2FW1A 3QX7A 121PA 5JCJA 1NJIW 4OBXA 3P27A 5KINB 1OCZC 1X25A 2YYEA 4V24A 3EUEA 1ODLA 5H16A 1IDN1 5DX8A 1IEVA 4IBOA 4I4NA 6AT1A 3DMTA 2Q1TA 2YRWA 4RORA 3PEUA 3U62A 4CTNA 1UKAA 5JZ9A 2EFYA 5BO5A 1FLNA 3DGEA 5FF9A 1PV0A 3M8AA 2QEXF 4L4SA 3D4LA 2B3TA 2JW5A 2CE2X 1S2GA 5E9JA 3H8JA 4C22A 2NO1A 4AX4A 2QSZA 3BHIA 3CUYA 5EJAA 4L4YA 5JQGB 2PMCA 2KI5A 3LMKA 2HMTA 3K0TA 3ZWNA 5HWEA 4TT3G 2HCRA 4N18A 3VYWA 3O92A 4G1EB 1P49A 2OHFA 4Q24A 1KJQA 1LVHA 3FR8A 4MV5A 2G1KA 3K73O 1IYZA 1E3LA 4J4TA 5I9SA 5EBWC 4UTVA 3QE3A 4HNSA 1UPXA 2DQYA 3WBBA 1P9OA 2IUSA 2Y0IA 1E1CB 3Q88A 1RM0A 5KWIA 3MW8A 4DMKA 2PGAA 1IY2A 1DRKA 2RKBA 3HTNA 1USGA 4F3CA 2OAQ1 1T2UA 1KJZA 2HQOA 2DPHA 2XBMA 4A26A 1RI3A 5GGYA 2YIBA 1I33A 5D2CA 6ADHA 1PXWA 4DDUA 1VMIA 4MIOA 1ZITA 3LBAA 3EC7A 5BXQC 4OGLA 1XKQA 1KI8A 621PA 4MHTA 3FROA 5EA2A 1R6UA 4BT2A 3FM9A 3AO0B 1NKTA 4ES6A 5FLXN 3MHHC 1DQPA 1GG9A 4HVTA 1ZZGA 5CJJA 4MUJA 2QVBA 3STHA 3CCJV 3JTEA 1OOEA 5CDUA 4KIUA 3TD9A 4M99A 3T99A 5EHGA 5T41A 3S2FA 1J0XO 1SQXH 3VPDA 1XYGA 1EP9A 3VR1A 1XUOA 4ZGGA 1QLWA 5K03A 2ZTMA 1R00A 1LPOA 4X64O 2I99A 2SKCA 1ULSA 5FBWB 5FTMA 4F6RB 4TXJA 4AECA 5IDXA 4UVBA 3CEJA 2FEKA 4CN9A 5JNRA 3EG9A 2FR8A 2H1CA 3RS5A 4Q3EA 1LJUA 3GCWA 3E27A 4DTCA 4YAIA 4FOPA 3HPRA 1G4UR 2RGCA 4MQEA 3G0IA 3C8DA 4X1KB 3OU2A 3KC2A 2NZYA 2JS5A 1ZR4A 2WPNA 2P9CA 2VJAA 4Y0AA 1U2TA 5U4XA 5KIAA 3SGLA 4N0MA 1J8YF 1KYIA 1RM1C 3C3PA 5JSYA 3MQWA 4J3NA 2FJ0A 3TD6A 2G08A 7ADHA 2RHLA 3H8SA 1YO6A 1JU9A 1C80A 2K7FA 1CRZA 3ZCVA 5EJGA 2EIJC 5JQWA 4FTWA 5CVJA 1GU0A 3DMGA 4B7EA 4ZAVA 4F84A 4FLYA 1QVRA 1TUEB 1AMOA 4XEHA 1B15A 2XMZA 3SFVA 2XNJA 1G7RA 2JIBA 3EYWA 1QXSA 1SN7A 4E03A 1H8HD 4FBGA 2E4VA 4F3RA 1XQ6A 5DTJA 2HJDA 1QQBA 4QSHA 5CIWA 4NPAA 4KQWA 4BT4A 3FTCA 1ODTC 3OURA 2GWRA 1USVA 5IAEA 4LTNA 1GZUA 4IWYA 3N59A 3V33A 1UH5A 5IABA 1T3LA 1N3LA 3LWDA 4Y2SA 5GTDA 2AHZA 4Q01A 3RG2A 4X3MA 3IQIX 2BDTA 3OICA 2VTVA 4P54A 5A5DA 2CDYA 4HDMA 3NBUA 4KXMA 1DLBA 1A7UA 1KXJA 1QZUA 3LD9A 1EX7A 5LM3A 2P5OA 2GBLC 4C2UA 1VYHA 3ZZUA 3CCUF 4JAAA 3CONA 4U7DA 1F48A 3CJHB 1H85A 1B1AA 4Y7DA 3HP1A 2X77A 3DD1A 4KX3A 1V16A 3VXKA 2O8DA 3EXFB 2XXAB 4PWTA 2X0FA 4FJCC 2EQ5A 3KHNA 1ZVMA 2J08A 5JSQA 3MUFA 4LQDA 4NJEB 1QNLA 1NM5C 2ZYTX 4Q21A 1Q86W 3IQFA 3OD4A 1LLFA 4G5RA 2YL2A 3UMVA 4ZYUA 3STZC 2A8YA 4CM4B 1JA9A 1H0HA 4OI4A 5GIPC 3O2QB 2O0KA 2BFDB 4Q9JA 1TQ6A 3M5DA 5DM4A 2TMYA 3HEAA 1ICEA 1F06A 2Q0AA 3AY6A 4GT1A 5SZIA 3PXUA 3B3GA 1WULS 4TYQA 2R1VA 4C0JA 3D01A 3OFJA 1QTQA 1WY7A 1O54A 4PC3A 4PEVA 1H5UA 3RIHA 3WLAA 3MDSA 2V74B 4BO3A 3EQZA 1SUBA 3MCUA 4H6VA 3S5UA 1HDXA 3F49S 3OOYA 4YJ2B 5A1JA 1FW8A 2P9JA 3UJDA 3UHOA 2G0TA 3AXSA 1HL7A 1YTFB 3VI6A 2D1TA 2VAXA 4DV0O 1NUSA 4N41A 3EVDA 3U56A 2F95B 2YQ4A 1PO7A 1E8NA 2ZIAA 3BFXA 4N0DA 4DBZA 2BI7A 5LC1A 3QFHA 2G36A 1R3LC 4FXPA 1K98A 1SC4A 4P7FA 1AP5A 4UHEA 4YJ2F 2ID9A 1VQ4V 3PRHA 2GHIA 3IPXA 5FPSA 2VSNA 5LHIA 2Y05A 3CVXA 1JPXA 2JEXA 1M1KW 4M46A 4GKKB 3PD7A 3BQNB 1G5RA 1K7YA 1ZU4A 3CXRA 4YRJA 2VYFA 4OUKX 4Y7CA 2PR2A 3JZMA 2C2ZA 1FYWA 1IK4A 3OO1A 2WHPB 5EJ6A 4S24A 4Q9KA 2YJTD 1LF5A 2G4VA 4EYSA 1LDNA 3K9CA 1Q0HA 3EDOA 1QBZA 3H1EA 2GD2A 5CDTA 1J7KA 2JLZA 3CVYA 1R10A 2OSVA 1ADBA 4KUGA 1Q11A 5DM1A 2ORVA 3A1NA 2X6BA 1DWQA 4Q0MA 3E7PA 1P9RA 2QAJA 2C8VA 1V9SA 3FFQA 1G66A 2WUVA 3PHCA 3P9IA 1NT4A 3AFMA 3ILHA 4Q9IA 2O4UX 1RKVA 2C98A 2A94A 2OG1A 4H7HA 3O4GA 4HJXA 5HZGA 3PQ2A 4KR3A 3N2KB 4I1RA 1T0AA 4E21A 4YJFA 1OCRB 3GLIB 2VTBA 1B23P 3O4FA 1BW9A 4GX1A 4KXXA 2EP8A 2D00A 1Y9EA 1KVTA 4BRZA 1LQUA 5GZ6A 3MQ2A 1T9CA 1KE2A 1B43A 3CZCA 4HO1X 5EWRA 5E8RA 5FOTA 1U5AA 3RFCA 3CRQA 1VXOA 2XE6A 3PDWA 2BFOA 4RVGA 2JGIA 5L3VA 4ZDWA 5JPDA 3ZIDA 5CAEA 4DUPA 3SNKA 1UK7A 2ZYVX 2I76A 2XDQA 4M0PA 3QF4A 4OG2A 5F5LA 3OU7A 4QELA 1QRRA 1M56C 3GBSA 5GVRA 4CEIA 1YKSA 3V9PA 1VJTA 5LQSA 4RD3A 3SBOA 3ZHVA 4UPVA 3FOEC 4MVSA 4V0LA 2CT8A 3ANYB 2ZPTX 3T7JA 4MVYA 5FUYA 1V96A 1DCFA 1GKIA 1MAAA 4R05A 1XILA 4O29A 1C9YA 4PZ9A 2OESA 2H65A 3O2SB 1YCGA 3T95A 4EECA 2OV2A 3CD6F 3G2IA 2YFKA 4Z4FA 5KVSA 1E61A 1JR4A 3ZEIA 1SIWA 4GPTA 3P2IA 5FP0A 1EINA 1J39A 2QE7G 3ILXA 4Q6GA 3BL5A 3JY6A 1MQ9A 1N77A 4D56A 1AS3A 3EK2A 1X8LA 4CIDA 4ZKIA 4G0WA 5CMUA 4XGQA 4AZVA 2ZULA 5FA5A 2F6RA 2NUAB 1GPNA 4WLFA 3ZRWA 3B38A 5ALVA 3LKDA 4DA4A 1XMJA 1NXOA 2BH9A 3HR0A 4LFCB 1NIPA 2RDMA 1V1MB 1IZ8A 4U7NA 1V5FA 3DE6X 7GPBA 2Z57A 2QTOA 3PDJA 4BPRA 5MFPA 1H4QA 3E3NA 3ZOPA 2ZRJA 3I05A 1QCEA 4FYJA 4FHGA 3TNJA 5ALIA 4BLWA 1X9IA 1VF6C 1ZOIA 3EW9A 1JFVA 2ZINA 4LA4A 3TFWA 1PNOA 2JBAA 3VU3A 3RYHA 2AK2A 4CC5A 3NR7A 1M5TA 4NAUA 2ODQA 4JXJA 4UDOA 2F66C 4HF7A 4O0MA 5F1KA 3ROTA 1VG0B 1J20A 2FCRA 5EIBD 1RMTA 4QATA 4TMKA 1E94E 2ZT7A 5GJCA 1UJNA 4TQAA 1U1DA 2Z8ZA