4X1KB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 134
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1kB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1kB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1kB01
4O4IA 3E22A 1RQ2A 4ZI7A 5MN4A 1W581 4O4IB 3HKEB 4FFBA 3WGLA 3HKCB 4X20B 3HKBB 4O2AB 4TV8B 5EYPA 4I4TB 4TV9A 4O2AA 4O4LB 5MN5A 1W59A 4TUYA 4LNUB 5LYJA 4O4LA 1Z5WA 3JALA 5IYZB 3HKDB 5J2UB 2RHHA 3VOBA 3RYCA 5C8YB 3CB2A 4F6RA 5BMVA 2Q1YA 4EI8A 1JFFA 5IJ9B 5C8YA 3E22B 3JASA 5CB4A 3ZIDA 4X1IB 4O4JA 3JASB 5GONB 4EB6A 4WBNB 5MN6A 3VPAA 4TV8A 5KMGA 4O4JB 4IHJB 5GONA 5IJ0A 2RHOA 4I50A 3RYFB 1Z5VA 2XKAA 3JAWB 4E6EA 4O4HB 3V3TA 3WGKA 4EI7A 4HNAB 4U3JB 5ITZA 3HKDA 4HNAA 4U3JA 5JVDB 3RYHA 3WGJA 1RLUA 4ZI7B 1FSZA 5JVDA 4O2BA 3C8LA 5LOVA 4X20A 5EYPB 4YJ2B 5LXTB 4ZHQB 5J2TA 3ZBQA 1TVKB 5KMGB 3HKEA 4ZHQA 2RHJA 4YJ3B 3R4VA 1OFUA 3JARB 1W5AA 4B45A 1SA0B 5LP6A 1W5BA 4YJ3A 2VAMA 2VXYA 4IIJB 5BMVB 5LA6B 4TUYB 3M89A 4IIJA 1TUBB 5CA0A 5IJ9A 2GVIA 3N2KB 5J2UA 5LA6A 3JAKA 4O2BB 5EZYA 5FNVA 4KWEA 3M8KA 2BTQB 5M7EA 5JCOC 3JATA 4F6RB 5CA1A 4FFBB 5LXTA 3ZBPA 2Q1XA 4I4TA 5CA1B 5CB4B 1W5FA 5JQGB 2BTOA 2RHLA 4WBNA 5LP6C 4U39A 3VO8A 4XCQA 3RB8A 5JH7B 3HKCA 2XKBA 5EIBC 5JH7A 3VOAA 4O4HA 4X1YB 4TV9B 4ZOLB 3UT5A 3WGMA 4DXDA 5KX5B 5LOVB 1TUBA 4X1YA 4ZOLA 3UT5B 5CA0B 3N2KA 5KX5A 2VAWA 4LNUA 1JFFB 1FFXB 4I55B 5FNVB 5JCOA 3RYHB 1W5EA 3WGNA 3RYIB 4EI9A 2BTQA 1TVKA 3N2GB 4X1KB 4X1IA 4DRXA 3RYIA 3VO9A 3RYCB 3N2GA 4X1KA 4IHJA 4DRXB 5IJ0B 3HKBA 5J2TB 2VAPA 5EIBD 4EB6B 3JARA 4B46A 1SA0A 5LP6B 5LYJB 5EZYB 4I50B 3RYFA 3JALB 5IYZA 3JAWA 3JATB 5ITZB 1FFXA 4I55A 4M8IA 1RQ7A 2R751 2R6R1 4YJ2A 5JQGA 3JAKB
chains in the Genus database with same CATH superfamily
1O89A 3A1FA 5LCXA 3L8MA 4FFVA 4UBNA 1VSQA 2O5EA 1GKIA 1XTJA 2FWIA 3DWGA 1MZEA 2PD4A 4EJSB 2BR5A 2F1HA 4ZI3A 1NR5A 3SYPA 1M2OB 3OPNA 4L4UA 2XCOA 4Z9YA 1WJZA 4AJHA 3LZCA 2NUPB 2YIBA 1IVSA 1NXTA 2LCFA 3N0VA 2IPAB 4MGHA 1GCIA 2OORA 2ZT8A 3RC1A 2J33A 2EW1A 4H4CA 3ABOB 4RYDA 1XTTA 2QMYA 1X39A 2KW5A 1FPMA 4EG5A 3BE6A 1FTWA 4UZSA 3ZCCA 4MW2A 2OTCA 5E4YA 4YMUA 1DARA 2H0RA 2XWPA 3KVOA 4FS8A 5ALKA 4KZKA 3NTUA 3UCSC 4DG9A 1QTQA 1C9EA 3GLIA 1X19A 4RLHA 2A0XA 3S7TA 2RE8A 4Q24A 1FXUA 3GJ4A 3IGFA 4V0ME 1WQ1R 4AJ9A 3K06A 2BMFA 4NK4A 3G68A 2Q1SA 2GFIA 5T57A 1NA5A 1Z4OA 4B7EA 3KYIB 4IMRA 4REOA 5EKSA 3OEYA 1M83A 2GCIA 2Y1CA 5GVSA 2GZ3A 2Y77A 3T95A 1OH6A 3KXIA 1QRRA 3MTIA 4RJ2A 5J3JA 3I72A 5C8DA 1XROA 4ABTA 1RLGA 1JEAA 1HZJA 1FSZA 1H0SA 2JAXA 3DTYA 3C43A 4MYTA 5HMLA 5IXJA 2UZHA 5EPUA 1RRGA 5EBMC 1RABA 1Y8AA 5DSZA 5ALXA 1DC7A 4L2IA 1RZRA 2W37A 4IWXA 1K27A 2H16A 3AUSA 1YASA 2ZRKA 4RL6A 2IZ0A 1H2MA 3R7DA 3GDHA 1P7YA 1XHLA 4GUDA 1P72A 1BTOA 3NTVA 4RMHA 1XL4A 1RHRA 1G1XB 1JHQA 1UZMA 1ZJZA 2O2DA 2P4QA 2WD9A 3O83A 3DH0A 2ZUVA 4PV7A 4XX1A 4EYOA 3A2KA 1G64A 1QM5A 1V35A 4QM6A 3CH5A 3FPSA 3ET4A 3G8AA 1WZNA 5JTTA 3KPWA 1KBQA 2A6PA 1BFKA 1I9GA 1G4AE 2VDWB 1X1SA 5DLEA 1JDUA 4E2XA 5FAKA 1SZQA 1J07A 2VQFO 2IZ6A 1HNWO 2ZRAA 2G1PA 1XD9A 2OZKA 1JSZA 4B40A 3BAFA 1AK9A 5K8LA 1YAJA 2Q0QA 1KBZA 3LDUA 2JIMA 3EARA 5H0IA 4ITUA 1FDVA 3I9LA 1N5DA 4IIYA 2O3SA 2D59A 4L15A 5FBKA 1E18A 2EXXA 5F35A 1Z7GA 1FUUA 2CL6X 2JHPA 3QEOA 1B76A 2QP3A 2UYHA 2G71A 4ECAA 4HQ6A 2ATKC 4BO6A 3CXHF 3TD3A 1PJCA 3G9TA 3K9HA 2XTNA 1ZMXA 3NDBB 3E61A 5KQSA 2B1GA 2YS7A 2NPOA 5F3DA 4B83A 3K6SA 1GL6A 4KH1A 5J9FA 1PX2A 1D6SA 2E6UX 1IJBA 3PV0A 5REQB 4KOEC 4MS2A 4EB3A 1XZIA 1GN6A 3UMBA 2C57A 2I7CA 1YS2X 5B37A 4E15A 4DXWA 2JJ1A 4P7JA 5JJCA 3CLHA 1H2NA 3U9TA 3QBEA 3TTXA 4MNTA 4CT4B 2X8JB 2ZVYA 4NAUA 1MORA 3UNXA 4DNOA 3U61B 3ZNPA 1T9BA 1TM4E 1UFRA 2QSUA 4E08A 1VQVA 4Q02A 1IBKB 4CF5A 1ZOIA 2RCYA 1Z5NA 2AMTA 5HY0A 3TR5A 2AMVA 3N0WA 4N0DA 3VZBA 1Q3TA 4UCWA 1IV3A 4MVUA 1CR1A 4LJ4A 5BVHA 4UB8Z 5TQ2B 3A6LA 1HR0O 3M1YA 2YH2A 3CC8A 2EBOA 3HKBB 4FBMA 3NK6A 2XAQA 1W40A 1H0RA 4H16A 1R6AA 1ZRMA 1GITA 1XN4A 4X6UA 4EFDA 5C1DA 3ZDBA 2ISSD 2FU5C 3DO6A 1KU6A 1Z0FA 3VDMA 3JQFC 4NYJR 3T6KA 3U6KA 2YZKA 3NBXX 2L19A 3U37A 1RMYA 5DM6V 2CD9A 2C58A 1Y1TA 2ZXWB 3A9UA 4BX0A 4KNWA 3TE7A 1BEUB 3FVQA 9GPBA 2OT3B 2R5NA 2K87A 2ZTMA 3NOXA 5EKDA 4N7MA 2PUVA 4D8WA 1YKSA 1I36A 2HCBA 5A1TA 2VHQA 1UINA 4ZJUA 3GNTA 5TIIA 3PAFA 1G7TA 2QV0A 4JB3A 3A4YA 5F5XA 5JHHB 3EIEA 5K8CA 2H2FA 1VQKF 3JVEA 3V6MA 1Z2EA 1AUXA 3HYRA 3F78A 4XVCA 2WSSG 4MJ3A 1I0ZA 4OFXA 1S5JA 4M0EA 4D26A 3ZDYB 2JJ2G 1GLGA 1EQUA 2QVBA 3A7EA 1Y4SA 3LPCA 3T3GA 3QPBA 3NHYA 1KI4A 4AJ4A 2Z4SA 2GCNA 1TA4A 1EX7A 1DF5A 4GOLD 5AH0A 5H81A 1EZVH 3T7EA 1E1DA 5HZHA 2RIPA 4P84A 2YHSA 4BP1A 3G71F 3NHRA 2QJWA 1VKHA 5DI3B 1QV7A 4ENQA 2H18A 2UVQA 3IIMA 4J7AA 2PLFA 2GHQA 1V8BA 2O0KA 3MCTA 3SHWA 2A1TS 2RJNA 4JEMA 2HI0A 1UK9A 2G25A 4RMGA 2G1UA 2HPVA 2QQ0A 2P8SA 4ZVLA 3L82B 1J39A 1W5AA 5AXAA 4JI3O 3I3FA 1G2QA 2DJIA 4LH6A 1L7XA 2POQX 1F2DA 2Y05A 2RHMA 3PHHA 2DWUA 4MDHA 4NPCA 2O54A 1SQVH 1QFMA 1RJ9A 2E6KA 4FJ1A 3CF4A 2AZTA 4QU0A 1V7PC 2W11A 3U0VA 1AX9A 1PD1A 1XN1A 1J33A 3UJBA 3HACA 5M3BA 1PFKA 1PQWA 3B1KA 3FFXA 4KIWA 5DM60 4DC0A 3H5TA 5IT0A 1S0UA 3WMFA 1E60A 1L5NA 1FXKA 3B2EE 2WDZA 2DBVO 1JVMA 1VHJA 5K8UA 4WINA 5I4BA 2ADMA 1UC9A 1Z2NX 1BJTA 2JA1A 1NUSA 2CGOA 2F00A 3CLSD 4PZPA 3G02A 1KE1A 5JDCA 4R9UC 1QHGA 3IS3A 4DXDA 2W8ZA 2VNHA 1GQ2A 4X3MA 1D7OA 3LS2A 2WIKA 2QTHA 5TX7A 1N6NA 3W8FA 3ZN1A 1L4GA 4NBKA 4DNXA 1E9FA 4GBED 4L8JA 3ROQA 3W3AH 1ACLA 1KKMA 2ZAUA 4NQRA 1UDXA 3LWOC 1K5QA 2FCRA 2QVGA 1S8FA 3HWX1 5DDIP 3RYIA 1QWOA 4N3BA 1UR5A 5AP9A 1U0GA 2XMSA 3N2GA 4YIKA 3PGXA 4I3HA 1P77A 2BHTA 2CL5A 1F17A 2QSYA 2WFLA 3ONNA 3DE1X 4LOAA 4YR7A 1QQBA 1UM8A 1S72F 3DEAA 3OT4A 2OAEA 4IHKA 6PFKA 2BGNA 3C4QA 1GA4A 2OTLV 4CQLB 4CQNA 4B3TB 2NV6A 4LDZA 2CCKA 1F4MA 2D5AA 2L18A 3TXQA 2O1SA 1LK5A 3U48A 2CKDA 1DEXA 1F1BA 4BB9A 3C6BA 5H6RA 1U3GA 2I80A 3ANNA 1E2PA 3JQGB 2MSWA 5DNVA 4X8LA 4ZFNA 3KQKA 1RQ7A 1ZISA 2C2BA 1CQXA 1Y4UA 2O2IA 2WQZA 3F9RA 4DV6O 1SUIA 1X3SA 2K2QB 4N01A 5K6TA 3I0MA 2IEBA 2OO7A 1EU1A 2PIDA 3TLYA 3WSVA 3LTEA 4L9WA 2EKBA 2XRFA 3A70A 3CMAF 2V7BA 4KQMA 1EG2A 1AD2A 2H54A 2XDQA 4FOSA 2CH7A 3NHBA 4P0QB 2PQMA 1IBSA 4U9IS 2G82A 4FZ3A 3NG1A 1ENOA 1VZ3A 4GSLA 3U56A 2QMZA 3NIGB 2PPVA 4HDKA 1GDHA 3A1TA 5AHOA 5AW7A 3SBDA 1H9BA 4GP9A 1CJSA 3EVBA 3EWSA 3ZTWA 2GHIA 1WPBA 4F4DA 1NPTO 5TPWB 2O8BB 1OBVA 4YRAA 5LMUO 1SVNA 4JMLA 2BDEA 3QQPA 4R5MA 4Q4CA 1FJXA 1P17A 3CLTD 4DV2O 5BW4A 3VHXA 5JSZA 2HM7A 1U7UA 5LZ5A 1H1LB 4AY2A 4FLFA 3F73A 1XXHB 1I7QB 2GLXA 1WXEA 4IGEA 3BPZA 3GU3A 5JD6A 1UJMA 4L6CA 2BFNA 3K4QA 3LMKA 1DCKA 3QNMA 2V5VA 4GKJB 1WQ3A 3QMPA 4V0NA 3PI7A 1WSDA 1RJDA 4TL8A 1O5OA 3D4LA 4YJFA 4LY9A 5HBRA 3F97A 2RK3A 3MWLA 2CMFA 4FJ0A 1P7BA 4ZO8A 1R3LC 3CLTC 3N27A 1PJSA 1I94B 2BWJA 2FCAA 3E8BA 1VCOA 3WRYC 5LXTB 1L2TA 3OLYA 5JLJA 3R7LA 4I4LA 4FN4A 3FGNA 3KUDA 4PY2A 4IHJF 5IUNC 4B35A 1TAGA 1S3JA 2NSHA 3QNWA 3SJCA 1XZQA 1G5FA 2WHPA 3QU2A 4BVHA 3CUEF 4YJ3A 1WPXA 2F3UA 4RPCA 4N41A 1OH8A 4U2DA 4MZDA 4WFQA 1W2WB 1P61B 1DHRA 4LH7A 1GU7A 1ZXLA 1KVTA 3GFTA 3O9ZA 1G20B 3HA7A 3FPBA 3HHPA 4P4LA 3JTEA 1DEHA 2OYSA 1P2VA 4F86A 4IDOA 5K6AC 3RC8A 1W4BA 2QMOA 3SM9A 1NJ2A 1RXWA 4E5YA 1ECJA 9ABPA 2VTKA 4YV2A 1N36O 1NBWB 3U44A 4PG6A 2NZYA 1BKDR 1Q7RA 5KWSA 4UC0A 2YVUA 3SJAC 1UDWA 1U0NA 3PEFA 3K5OA 2C3OA 4MHOA 1A04A 1RS0A 3GRPA 3L43A 2X7RB 3AUTA 4B9EA 2WFMA 3NV7A 4W4KA 3OQ6A 1E2JA 4JI0B 3WLEA 1CKEA 3LSQA 2FSSA 2OE2A 1T6YA 2P75A 2XXJA 3PG5A 2FUCA 1DT9A 3VDXA 1HYGA 1NX6A 2M32A 3MD0A 2B1JA 1FB5A 2VCHA 3PXXA 4LECA 4PHCA 3IX7A 4DPLA 5AVSA 1AXEA 4QJ3A 4UBIA 5ALRA 4JELA 1PDOA 2OZLB 5EIWA 3RTAA 1MF7A 1I4LD 2AFHE 2LCIA 2PJDA 4PGAA 5E2IA 3WRXC 2ODPA 1MR3F 4J6FA 5DYGA 3RJZA 4C43A 5LDDC 4OGFA 3QA3E 5JEDA 1KQFA 1IXMA 1G7CA 1QKIA 2W6QA 2V6JA 3FMIA 2WI8A 4H7JA 1B6RA 3H01A 3W5UA 3ZR4B 2FWMX 4IGFA 1NVPB 5CP8A 1VQOV 1RM5A 1ZVQA 2PAFA 3AEKB 3QVVA 4UJ3A 1BMTA 1VLHA 4CV1A 4YMHA 1F8FA 2Y93A 4OYHA 3ZRSA 3E9EA 1XVAA 3PUXA 1VSVA 2ODTX 4HAXA 3USZA 2AOUB 2PS0A 4WBNF 2IEGA 1J1IA 2VK4A 3H4TA 4CM7A 2XUPA 1Z63A 4ZI7F 2QVLA 3SD7A 2OD2A 1D9XA 1R3IC 1RHMA 3WL3A 2WKPA 2RI0A 1X8XA 5KYUA 5DN6G 4DY6A 1X38A 3CPSA 3LIPA 3MTJA 4D9CA 1SOAA 3LYBA 1OVGA 1EFKA 4HQLA 3SBXA 5I47A 2OZVA 3O3MB 4I2NA 2C4UA 3IIEA 3FPEA 2IF2A 1JEYA 5F1PA 5F5NA 3QHDA 1K9MW 4FFBA 1OFGA 4LYYA 3I2HA 5G1PA 4WKBA 1YUMA 1E2MA 1JWLA 1ZZEA 3OIFA 3C3EA 2X42A 1WG8A 3NVMB 3SY8A 2WKSA 2KGWA 1I1NA 1PT7A 4HEA1 4LNUB 2PD3A 3BDVA 3BXXA 4YCAA 1KI7A 1M66A 1JQ0A 3UUGA 4B6GA 2PQ2A 3NS7A 3RJ5A 3RSGA 4CKXA 1NQ5A 2VHJA 4LAFA 4TZKA 4ZJYA 2BY4A 2C9CA 1Y6QA 5BMVF 1DUSA 4XWOA 3FPHA 2BFPA 1DBRA 3NOQA 3GHZA 3JD4A 3RVJA 1X1QA 2AWNA 4M0LA 1SKVA 3DBLA 4FGSA 3RHFA 3SEAA 1GRVA 1WS6A 5EKXA 3JYCA 3CURA 5DHQA 5A5FA 2H7VA 1NBMA 3NYWA 5IJ0A 1A1SA 2G1JA 1QK3A 4ZZ2A 1XNJA 3KQLA 5E9WA 4HYQA 4Z0NA 2DHEA 4CPDA 1J1ZA 2ADPA 2QJRA 2ZBDA 3TSCA 2WYVA 1ISRA 4XPIA 5FPSA 4JC0A 3T1OA 5CDGA 1CY2A 1VB5A 2BCGY 4QPKA 5TISZ 1JXQA 4MR7B 4R69A 1K2VN 2RGBA 4JSTA 5AK5A 3FY4A 4C0WA 4J0JA 2PYIA 2EZPA 3IURA 4HLNA 3TRJA 1E3TA 4Q7JB 2E4AA 1XZJA 5TNXA 2AHRA 5CH5A 4KUGA 3F6YA 1SHLA 1C0IA 2O7SA 5L3BA 1DCMA 5T6MA 1VPLA 5DN6D 1GNVA 2WMNB 4O59O 4OP2A 4R81A 4OHPA 1AHIA 1G4HA 4YT4A 4KO2S 2NUTA 2ZRHA 1E4EB 3WLLA 3ADBA 2A35A 1C3XA 1C8BA 3IAM1 3L18A 4BY9E 5F9MA 3ZJTA 1N0HA 2XODA 3KAKA 1VJ0A 3UK1A 3DZGA 2GN1A 1EQ2A 2PUWA 1NQ3A 2PGGA 1CNMA 5FNVA 2ZK7A 4U7OA 3SF8A 3UJ8A 3T8YA 4C03A 2I6GA 1U0HC 5CLGA 1CP3A 3EH1A 2KG7A 1VA4A 2BE9A 4NCHA 4LYGA 4YIPA 2HJFC 2YFQA 2RHLA 3HL0A 4OF4A 4RFSA 4ZKEA 4GI2A 3PCXA 4QC2A 3C70A 1UMBA 3K35A 5IYBO 4Z1MA 3TLMA 3V1KA 5JASA 2FZEA 3B6EA 3N0RA 4ES6A 4AJPA 2OMEA 4C4TA 1IDN1 1DINA 2H2HA 2ZQZA 2UUAB 2ZIUB 1II8B 3ZOKA 2DWCA 3NXSA 3OZIA 4M87A 2I4OA 3B1FA 4BGEA 5LPNA 2VHEA 4FR5A 2YRWA 1PRYA 3P3PA 1M34A 1X1BA 3EDOA 5BUSA 5K0ZA 1JEDA 3E3AA 1OI3A 1GGEA 2SNIE 4BUCA 1ZL8A 1XTZA 3ZZ1A 3IOEA 4KSYA 3MBOA 3SXUB 1RI3A 3FWYA 2EIJB 2F95B 4LY6A 1AKTA 4Q9HA 4Z0HO 4YDQA 5HY2A 2IH5A 2P67A 3DMHA 2QRVB 4UFNA 1SK8A 1QH8A 4FGLA 1BRTA 3QP9A 1HDXA 2FW1A 5ALQA 1AHPA 2Y0CA 3C8ZA 3R3UA 2NSYA 5BR8O 2FE4A 2NQ8A 4TYNA 3HSYA 1Y6GA 1C0PA 1T29A 4NCXA 3DTVA 2XNSA 2DM6A 3ODPA 4IFTA 2AJBA 4TXLA 2GDSA 1F6DA 1T5BA 2JBHA 3N8DA 3G1UA 3ABKB 4C0LA 4CTMA 3NBAA 3AG3C 5FDFA 2XXAA 4NHOA 1JALA 3O3CA 3Q87B 4RVDA 2J5KA 2RSLA 1KSFX 3DOCA 1SR8A 3R6DA 4QDZA 3W7WA 3T0FA 3F7TA 2B5VA 3QXGA 4H3VA 4PBRA 3UC5A 3IUBA 1G2OA 3OIYA 5LP6F 1CZHA 1OOEA 1VJDA 1Y63A 1P5RA 2C31A 3B48A 4INAA 5D6NA 2L0XA 5C32A 2GUZA 3HMKA 1YGYA 1A9RA 2IU4A 2PBFA 1Y7TA 2FSVA 2WZQA 3COPA 4EO7A 1SG6A 3VPSA 2PCLA 2DYRC 1H42A 3MWGA 5CFRA 1B8OA 4EI8A 4F9TA 4RIEA 1BMFD 5GZ3A 2NUAA 4JVSB 5K5EA 5DNCA 4O1MA 4DOMA 2TSYB 3A14A 4MS3A 3UT0A 2AEFA 4S1WA 3TUIC 3TLGB 4E31A 4OJKA 3AGKA 4LWZA 4GKKB 5JSKA 1Z0JA 3K1TA 2GBGA 4HWTA 4B3TO 4ZDIA 4C04A 3E3OA 4NNJA 4C08A 3CCSF 3EPKA 3CX8A 4TT8A 4KHPB 4IRMA 5JXHA 4ISCA 2NTNA 4LZNA 3IMCA 4PYIA 4RLQA 1V16B 3FYUB 2GK4A 4Z2WA 1ZWZA 3R6TA 4WZAB 1KYVA 2ZYWX 3GJXC 1XBTA 4RY2A 3THXB 4KC0A 4IJ5A 3SZGA 3T3OA 3HXPA 2DECA 1OXKB 3KJXA 4I4IA 4R05A 4AILC 3E8HA 1VE5A 2PPLA 4ROSA 4WBXC 5DXFA 1H3NA 3ZQ4A 1AI6A 2EF1A 1BW9B 2G5CA 1WRBA 2GPJA 1E2NA 2NXWA 1G8YA 4FHGA 4M4SA 4CM4A 3D0KA 1DRJA 4OJMX 3W34A 1IG0A 2BRUA 1A3CA 1JV2B 4GLJA 3KYJB 3K2QA 4BKMA 4F5WA 3T80A 1NLZA 1NU8A 4MVRA 4IIJB 4NZPA 1L5OA 4J0HA 3QE4A 2E37A 4MS1A 1XLTC 1KI2A 3CWCA 3RE1A 3B1WA 4B71A 3BA6A 4JTAB 3H84A 3RVZA 1HNNA 4BO1A 4MQFA 3UUWA 1BXGA 3VU9A 2W2KA 5FF9A 3M9XA 5K4HA 2IQIA 2MSDB 5T3UA 5F7OA 2C5AA 4Q4JB 1PR6A 4ZQGA 4DJ5X 1DXHA 4BBPA 4L75A 1YR2A 4MQMA 3G6EV 4G5XA 5A9SA 1S7GA 2FUG6 1U40A 1G6KA 2QXTA 1WL8A 4RKEA 2D54A 3PNSA 1NRJB 1S2OA 1UK7A 3F46A 1FSPA 2KJQA 1YBHA 2VQ6A 2GZ2A 2VL7A 1V5GA 1GTG1 4JZ2A 4JAVC 2WVAA 2WSYB 1DG9A 3HP4A 3EPHA 3K2XA 3O38A 3U39A 1TJYA 3QPAA 1N7HA 1GGHA 2CLHB 3U9LA 2LPMA 2V6FA 3R6WA 4OQQA 5ALYA 5I4KA 3MPOA 2AXTZ 4JJFA 3KOUA 2H2AA 3E6AA 5ICFA 4DBZA 2JLAA 1U8UA 1PYDA 2WD7B 3UO8B 3CVWA 4ER3A 3BQNB 3QLUA 3R74A 3IO3A 1ZSYA 1BD4A 4QIHA 4Q7MB 4DJFC 1QZXA 5JJNB 4KSCA 2NXEA 4C3ZA 3FCOA 5AUNB 1CP9A 1SKBA 4CUJA 5IVKA 4DV6B 1D0IA 3CHYA 4I1RA 4JT4A 3F2IA 3PDJA 1R3KC 1YJ5A 4H60A 4YJ2A 3WB9A 3GPBA 5JQGF 1NW7A 4FFOA 16PKA 2Q3LA 1L5GB 3S2ZA 3FDJA 1WF3A 2NO9A 3DEKA 5ALIA 4FNOA 4JLDA 3DTNA 1PNKA 4EHBA 1IIRA 3VYUB 5JW6A 3VXKA 3VU0A 3WA7A 3ADDA 2N05A 4I4TB 2BCEA 2VNJA 1S96A 3BIJA 3OWHA 4E3WA 3HJFA 3IKJA 3WB1A 2NR5A 1L1EA 2ZT5A 2ETXA 4C6TB 5ENZA 4G4WA 3HADA 4AURA 4L27A 3LW8A 5E4TA 2YJGA 3JQ9C 4QPCA 5EJ7A 3DL7A 1A97A 3AJAA 3F9IA 4L6AA 4F1WA 4DMHA 2F8LA 3DO8A 4GQBA 4HNUA 3HDTA 1F6BA 5TT1A 3LHIA 3O65A 2AUTA 2L35A 1E2BA 2NXNA 4X1IB 4O4JA 2YJ3A 1XTUA 3SGIA 1OCRB 3CCMV 1C81A 2Q4OA 2Z30A 3NBYC 4HWRA 4OD0A 2PA0A 1M4UA 4NH4A 3W7UA 3TD5A 3C48A 3FCUB 1NURA 4CXMA 4OYLA 3WJ7A 2QTMA 1T26A 4KMOA 4L0DA 1U90A 1MRNA 4S0XA 3TLBA 4NZZA 2IS6A 4HDSB 5JS8A 2YXHA 5BR7A 4B32A 5BWBA 5EJ4A 1R8SA 1VJCA 1DRKA 3IBTA 1O87A 5A06A 3NH6A 4QG7A 1LUAA 1SHUX 3KV3O 2I1VB 4CL0A 1K1EA 2JDIA 4KO1S 3HA5A 3V8NA 1PFQA 2X13A 1X7ZB 3BH6A 4HAOA 1UKAA 4NFSA 2WV7A 1OV9A 3DE0X 4ILKA 1TVKB 1KU0A 1TMOA 4U7GA 3TPCA 4DDVA 3CMAV 1T6ZA 1K7FB 4BMYA 3AKZA 4MVJD 2YV3A 4Y1GA 2A5JA 5JNVA 3R09A 2XQKA 1GTVA 3AR7A 2IP4A 3ILSA 3N2IA 5GQSA 2HDWA 3CMMA 5KNDA 3ZWDA 5B5EZ 1B41A 3U2QA 1ZG3A 1OY1A 3L0ZA 4OHZA 3UHOA 2I1WA 3R23A 2OLJA 3AILA 4UBMA 4DDWA 3IPCA 4M9ZA 4HFJA 3U7FB 2GS9A 2G5GX 5FHQA 2H1LA 3LD9A 3SQXA 3D2LA 2GAJA 2GKGA 3EIWA 1GAEO 3AY7A 5H6QA 2QGFA 1UQRA 1T0JB 3WWOA 3WG7B 3D8UA 4DSAA 1CXZA 4ND2A 1DWUA 5I4CA 5IS2A 1N34B 3W0LB 3KB8A 3OX2A 4DNFA 4GR4A 4ZARA 1XOIA 2M1ZA 1WLYA 4ZEXA 3H2YA 2V3VA 3C98A 3L93A 1Y8QA 4G86A 5CA0B 4KE8A 5JCPA 2NO4A 1DKLA 1HF3A 2IW5A 2DE0X 3MHPA 4K3AA 3RS0A 3LK6A 1GV0A 3RO7A 3ZLVA 2YWHA 3EG5A 2Q5CA 2PUAA 3EDQA 5DHAA 2LDBA 4UEJA 3V8PA 2JFZA 3IEQA 4QEKA 3TJRA 3AVQA 3TSZA 1F2UB 4LP8A 1G21E 2VUTA 2O0JA 5FL7G 2VAPA 3TVDA 4IMPA 5KJFA 1G38A 1D5WA 3O1HB 5LP6B 2VDNB 4OV6B 3PYMA 4B5LA 1W57A 1M5UA 2BSXA 5EWMA 4FQ8A 4YUZA 5KNBA 1BROA 1K7XB 2ZE6A 3ABLC 3MWKA 4KGDA 3GLTA 2TMDA 4BVAA 4BN4A 1VECA 3KQQA 5CA1F 4J75A 1GFZA 4KBGA 4YRFA 3WNDA 2PLNA 5CXQA 2COEA 1VQ5V 1CLEA 1XJQA 1RKUA 5LZ7A 1QIJA 1WA5A 3HKCB 1YI8A 3G9ZA 1VQMF 1G9SA 3EBOA 1FX0A 3LDAA 4Y3UA 2P9EA 3COVA 2J9FB 4IV8A 1VRWA 3ABMC 3WWEA 3EY4A 2X8WA 3KKEA 4KI7A 2ZBGA 4DV5B 1HDIA 4E6PA 4QUEA 2GXSA 1AB6A 2OENG 3CF2A 2R8EA 3LECA 1QU7A 4WNAB 4LBVA 4LKOA 5TVGA 4DCSA 4HEJA 2M9MA 2Q3BA 2VBFA 3OZWA 4FGUA 1E1YA 4HVCA 4LXTA 1VJ5A 4ZOCA 4B6SA 5C8YA 1U8TA 1YFKA 1BD3A 3N28A 2DPLA 4DCNA 5HIKA 3OTWA 4FXOA 3A0RA 1RYFA 4TTTS 5IZCA 3FG9A 2OUIA 4CR8A 1DAMA 5CFPA 1NSFA 4CIXA 4D4JA 2NTVA 3BB1A 4KB5A 1XTVA 4O08A 1BYUA 1U8ZA 4X94A 1GHTA 3C1TA 4JUIA 2O19A 4EG6A 4MQ6A 3D3WB 3Q3JB 4HNAB 4FE7A 2BP7B 1YZLA 1WBJB 3P19A 3NC0C 4AZ3B 1BDMA 1RJWA 1W0KD 3MLEA 5JAPA 4O2BF 3TX2A 4QPPA 4JNCA 3ER9A 5LOVA 2OAQ1 4HAVA 3I53A 5J47A 3VC7A 1QBKC 1WN7A 3BJMA 1NTMH 4BB0A 1UBKS 4JJEA 1WX1A 5B58C 1EFPA 1S8NA 3VTKA 3FKQA 1JMKC 1NIJA 2CUZA 3DNMA 1Y7IA 4HTFA 1OFUA 3NHMA 4UXJA 1ZVMA 4WW0A 1PZFA 3W8DA 2A58A 2UYGA 4B3IA 4NFLA 2FHPA 3NHJA 4EJ2A 4MVCA 3B6JA 3FOAA 2ZE5A 4HH4A 1PKXA 1UXOA 1LX6A 1JLMA 2W2NA 4NHEA 4CCYA 5LQJA 1A5BB 1YHZA 2I33A 2IODA 5EL0A 4BEWA 5K51A 5C2JB 3U0ZA 3ZXXA 2SBTA 1F8UA 4YP0A 5B2ZA 2BTUA 5IFKA 3RVDA 4YAGA 1Y3IA 1IYZA 1F51E 3VKGA 5J4LA 4J11A 2PWBA 3F3YA 4RZHA 3V8VA 1BT8A 4C1NA 1K6JA 2HF9A 4FMCF 3P9YA 5JH7B 1W47A 4JITA 1JAXA 4NULA 4NVRA 5BSRA 3T4UA 3ZLBA 4YHBA 2QX6A 4MYHA 3AERB 1QE3A 1WA8B 4G8JA 3LX8A 3G4SF 3BREA 3TZCA 1NN3A 5C8YF 2QVCA 4MP3A 1SB8A 3G2MA 4MW0A 1CNEA 4Y2GA 3U3ZA 3WR5A 1C29B 4B8WA 4B5CA 1KFJB 4BO2A 1VL6A 2ZWPA 3QWHA 5HM6A 4N49A 1VP7A 3OLQA 5FYDA 4TLLB 2XTAA 1QLEB 2J0UA 5F1KA 4XWGA 3L06A 1OXTA 1GV1A 2GKOA 2V8OA 4DMFA 2IJKA 1OAPA 1V41E 2PHZA 3VR6A 3PJRA 1F3LA 3KPJA 4UCQA 1Z88A 2WA4A 3D6MA 4G1BA 1MD9A 4UFOA 1W2GA 5F51A 4RPLA 4BMZA 4DSUA 1PVDA 1CVIA 2V4UA 4I50B 4EI2A 2X0LA 5HX7A 3R9KA 1KMMA 4ND4A 2F93B 5FAXA 2QM8A 2AZ0A 3M1XA 1SULA 1YQ9A 3H6GA 1XKTA 3PFHA 4YN3A 2RH8A 1SCUA 5HFMA 1T10A 2OCKA 4MJXA 5IARA 3H3FA 1QR6A 2Y3IA 1Z3IX 3SBOA 1QUEA 2P5TB 3A4MA 3KHKA 5E6UB 4X8AA 5FR1A 5KAIZ 2PX5A 4H4DA 3ZCRA 4JBLA 2VTDA 4DEVA 5HDQA 1B0AA 4MR8A 2CE4A 2QU8A 3ICCA 2IV7A 2QW8A 1C8VB 4JX8A 2PT6A 2JS5A 4W9NC 2R8BA 4XVUA 4OLAA 1K92A 2FB5A 1W2HA 3GGJA 3GPCA 3L01A 3U4DA 4DB4A 4LNHA 1D6NA 1TZJA 4RETA 6GPBA 4RTJA 1XCGB 4FKZA 3T5BA 4R2WA 1M2KA 2Q6TA 5L3EA 1MJGM 1H9CA 1RHJA 4CDRA 1JFFA 1YQGA 1HDCA 3HJRA 4U7TB 5BSWA 1NXOA 2Q4DA 1Z47A 1R64A 3UTDA 5JY1A 1C9KA 1X7XB 2ID7A 2VZLA 3ORYA 2ACWA 3VU1A 3TIGA 4F8EA 5JI3E 2UZIR 1LEHA 4LMPA 5DIZA 5GONA 3IUQA 5CYGA 2C5LA 5CLQA 5A4FS 1BCRA 4EL5A 4OXXA 2A0WA 5CYOA 5BQ5A 3ZK9A 4LZOA 4M1ZA 3R7BA 1GFSA 3DT8A 4E5UA 2Y4OA 1AKWA 1I6MA 1DG1G 1WU7A 3MUNA 4J90A 3VBBA 2UXDO 4ZVQA 5IJAA 4B80A 1V0JA 2VP3A 1TLLA 1M2VB 2I3DA 5DCUA 2SKDA 3DNPA 3JPYA 3N39C 5HZMA 2DEUA 2XTZA 4YT2A 4RZ2A 4E4RA 4MMYB 1AI7A 2UYPA 1UBMS 2Y67A 4W1QA 5HF5A 4FGJA 2NU8B 2CWWA 4L28A 2OCYC 3OFND 5MGBA 4PQYA 1Z5UA 1EVKA 1GZUA 1V5IA 3FFAA 3R0XA 2HEPA 2PS9A 5FWAA 1WY5A 3RS4A 4OGWA 4Q6BA 5EXPA 3ZKWA 1VHAA 2DWEC 1BEEA 3IT1A 4QDJA 5IFLA 1AMNA 3HBFA 4J7XA 3UG7A 1SA0B 3PYLA 1NI5A 3A2LA 3ZHCA 4DLBA 3V4DA 1P7WA 2P6MA 2PU7A 1MT0A 1Z6ZA 3IP3A 1G59A 4B9AA 3G2KA 4QUIA 3PEYA 4IDPA 4OBBA 3BZBA 2CHVA 3F47A 4QIWF 4KVFA 4OAOA 4CU2A 1YFJA 1GT91 2Z57A 1AN0A 1GPYA 1N5KA 1MIHA 2V54A 2Q29A 2JGFA 4P58A 5CT4A 1JVNA 4MUFA 1X70A 2ZDGA 3NM5A 3W5HA 4CH6A 1PAUA 1GM8A 4G4XA 2GBCA 3MJDA 4RD6A 3OTOO 2ZKIA 2Z98A 4EP1A 3TLJA 3TRDA 4TMKA 3P52A 1PR4A 1DJOA 1H2WA 2GKSA 3GHHA 2ZZKA 2ZYVX 5G40A 3W3ZB 5H3LA 1IN7A 1PZMA 4DJAA 5LBQA 1XDDA 2W6ID 4JT2A 3C8MA 1PPJH 2E76B 4GMGA 4HXGA 3PKZA 4BEJA 4EYQA 4EFLA 4PLTA 1RM1C 2IZ7A 2YZGA 1KZ4A 3IO5A 1JX6A 2ZJFA 4LVNA 4C8EA 2ZJZA 4LR3A 1VLVA 1XVVA 2H4FA 2NYAA 4OVKA 4DT1B 1MAHA 1RWMA 4DCPA 1C2YA 1NMEA 1KO8A 1NJFA 2ZETA 3KKNA 1QK5A 2YOFA 3PFGA 3FDFA 1W6UA 3Q9SA 3ZCUA 1NNLA 3KFVA 5ELLA 6CHYA 5DK6A 4ER6A 3REOA 3DV0A 1V8PA 4OGKA 3AEUA 3SJCC 4IHAA 1XRGA 1EX6A 2ZIWB 4XUDA 4ESOA 2G1AA 3UJPA 3JALB 1N2EA 4KACA 5H68A 1RKVA 2QWOB 2YICA 2BHRA 4EHFA 4K9OA 4MO9A 2C4WA 3F96A 1FFXA 4FEAA 2VF7A 3LA6A 3N6RA 4H7HA 4MGZR 1VKZA 2P0EA 4MV6A 3I5XA 1MX1A 2R1TB 3F6EX 4LVUA 1ZH6A 3KC2A 1F23A 4O4IB 3ECSA 2CTRA 1M76A 5AQEA 3RA5A 1FJ2A 2HRBA 4WFFA 3DNFA 3T1TA 5LQSA 1QP8A 3VR3D 3ETGA 3WFZA 1XYGA 3IDQA 1W52X 3O4FA 3TOCA 1E2DA 2AZ2A 1HQKA 3AR5A 4X91A 1SQGA 1J0XO 2X6RA 1U5BA 2V7WA 2DP4E 3K8QA 1XZAA 3BA1A 3KPYA 4KR0A 3W6UA 2EEZA 3N0TA 3WK5A 4EARA 1Q0PA 1GH6A 2VRZA 3BSSA 3KOMA 3UICA 3JAMA 3EOBI 2IBMA 4AKTA 2R9RB 4YDSA 4DIFA 1QQAA 4D0GA 1WD5A 2P5SA 5DYTA 3SGLA 3ER6A 2G36A 2QN1A 3PD1A 1M56B 2YWXA 2FR8A 1K2WA 1AIPA 1OAAA 2XAHA 4KXLA 3SFZA 4UEQA 2P41A 2PBLA 4DR4O 1I2BA 3F8WA 3ZHSA 4JCCA 4ZAWA 3OEHG 1KEUA 2OPHA 3BD7A 3CX5F 4RVOA 1TUGA 1JIXA 2WE7A 3G5AA 4FONA 1WXQA 4H31A 1DDOA 4MUBA 4PHHA 5AICA 5CD9A 1Y4ZA 2VNAA 2PTGA 4F1JA 3AL0C 5B36A 3IQDB 3QWBA 4N0MA 1UXJA 4FZVA 1JEYB 3K58A 1L7MA 1AQIA 4MUKA 3B3GA 4JVOA 4B6RA 3S55A 3GVHA 3WZLA 2VAVA 5BO5A 1U5CA 3UZUA 3EVFA 1B6SA 3LLMA 3LPAA 4CKCB 2QGNA 2X2FA 3TTSA 5CDTA 2OCGA 1T24A 5A03A 2ZBUA 1FOEB 2G07A 2IQ5A 2O2SA 1M1UA 3MINB 1N2CE 3O8NA 4PWYA 2R8YA 1WAZA 2VPYA 1OKKD 4MWGA 4M7PA 2BMWA 1G41A 1KORA 3IR5A 2H00A 2YN2A 3RSZA 4QO7A 2W70A 4B47A 4BMVA 3RJ9A 4E2WA 3GYQA 1AKUA 2G8NA 1XPUA 4F6LA 4N5DA 2E5LB 3O92A 4MWSA 5JYDA 2QLFA 1LR1A 2FYTA 3RAPR 2O8CB 1DQSA 3PLNA 2XB9A 2OILA 2WIAA 3CNBA 5IDVA 5A3QA 4LRYA 1I01A 2IE8A 5HK9A 1VKJA 5DGHA 3CG4A 2KSQA 1MN6A 4MQBA 4Y9DA 5K3OA 2C1EA 2VZEA 3M9WA 4NK5A 3QEMA 3P0RA 1I7SB 3ETLA 3PC4A 2JHGA 4XIYA 1NUTA 2RAPA 2C4HA 2X1MA 1I3KA 4QRIA 5JFOA 5ALFA 1ADYA 1VRVA 3MRVA 4MR7A 3DE5X 4YPVA 4DM7A 4EYGA 1W0JD 1TQ4A 3LUFA 1KQSU 1P0FA 3ADKA 4X6LA 2C92A 1VHLA 2FPLA 4JGBA 2QS9A 3GHYA 2W6MA 5HA5A 2D7JA 3WLJA 1H2EA 4WXYB 1P3Y1 4KN6A 4AUEA 1IQUA 4P32A 1XOUA 4OB6A 3OOWA 1YCGA 5DK4A 1QIKA 2IUEA 1Y4DE 2ZS9A 1E4EA 4P83A 5KTTA 3C9SA 2N75A 4GMFA 2EZ8A 3HE3A 2VOEA 5C1IA 3BXZA 1VBNA 5LLDA 4KQHA 1YXBA 2CLIB 3PZBA 3U5ZB 4GLOA 1UZNA 4CT5A 5LYJB 1S7CA 1K4YA 1ORTA 1WKVA 5IYZA 1YR6A 2X23A 2I29A 4YIOA 1B0PA 3DFIA 2ZUBA 4NJMA 3BEOA 5B1YA 1IATA 4EVQA 1AK2A 3V2UA 2QJ1A 3H7AA 1XMOO 1QYCA 2WB2A 2Q46A 5B12A 1XF9A 3GT7A 3PITA 1Q43A 1AUVA 2VRCD 1V6CA 2QE7A 4UASA 3R8XA 3SPXA 3A6DA 3FBAA 3WGTA 5BYJA 2GLZA 2F64A 1CCWA 4O1IA 4TSFD 3VR5A 4O63O 1QXSA 1K0FA 2J7PD 3ESZA 5KUMA 3FPJA 5AVKA 2WVGA 5ALTA 1SJ9A 2WLTA 1VI6A 4PXAA 2EJTA 1FSSA 5BXYA 3OU7A 3QXXA 1JX9A 4Z3OA 2X5NA 4D9NA 4AMBA 2PQ6A 3QE2A 1Z3CA 4F56A 3NM6B 3LO5A 3M83A 3EISA 5K7SA 3IERA 4Q19A 3CLUC 5BSEA 5IVPA 2EJUA 4A1FA 2VF5X 4DHWA 4DLRA 2Q49A 2WWTA 3LUGA 3NX4A 4DXAA 4HI0E 1DUIA 3AQ4A 1ZN9A 2Z1EA 2HHCA 4P7KA 1QH8B 2J4CA 4GOND 4Q3BA 2V7XA 4UVHA 1EEXB 1QV9A 2DXIA 2J3QA 1I1QB 2ECFA 1EI9A 2G28A 5KYYA 3O9MA 3A06A 2D1TA 4ZT6A 3S2FA 4BMCA 4ZYWA 4G67A 2H94A 1E89A 1RZRD 3AR2A 4UATA 3ON1A 1TF7A 1D04A 1JU4A 4TQAA 1YQTA 1TMGE 2JHFA 5MHTA 5AXDA 3QO8A 5A3RA 4BEVA 1YK1A 1DEKA 1PT8A 3ONWA 4R1TA 1N4AA 4LVCA 1KJZA 2VR1A 3MCQA 4DSTA 5J1SB 5EHXA 5DBEX 1Z38A 4INZA 2VJPA 2VF4X 3RVOA 1O6CA 2CLSA 2DTDA 1FFYA 3D7KA 1EGHA 5EK0A 1VQ1A 3CXUA 3HDVA 1ZK3A 2QXYA 2YOHA 3X2EA 2WABA 4KR2A 1RFYA 2GUZB 4PC1A 2ID8A 2JCBA 4IX9A 4NMLA 4YI3A 3SYKA 2G9QA 1ZN7A 3FD6A 4AJIA 3D4NA 4ZZ1A 3SQOA 4M9CA 2P2ZA 1IV1A 4GMKA 4X8MA 2NUAB 3HGTA 3OMIB 4CTKA 1TUEB 2XCLA 4L4SA 1OWPA 3ELWA 4RVGA 4MS3B 4CKBB 2NTEA 3PRJA 5BW8A 3H7IA 1LDNA 1JG2A 2OHFA 3K09A 2IP2A 2WLLB 1RA4A 1U9JA 4DPMA 1BH6A 1YL6A 2EHJA 2TMKA 5BVHB 5I7WA 2BMVA 4HAUA 2X0KA 3KKZA 4C89A 1SU4A 4UUMA 1G8HA 2NOAA 3T2MA 3QO7A 1MV5A 3ROZA 4ZZIA 2P7HA 5EIBC 3AP2A 1E8NA 4DLSA 1YBVA 5GJBA 3VYTB 3FNBA 3TNDA 3QENA 2BD0A 4J29A 4M6WA 2EIMB 3RAEC 3CUVA 4F5EA 1XD8A 4UVBA 1J0DA 2B82A 2A0FA 3UOWA 1SC3A 3KSAC 1ND6A 3OLCX 1UM9B 2DFVA 2DR3A 1BWQA 5L6LB 4J9YB 1EM1A 1JQAA 2ZXEA 3HU3A 3QUTA 1KP3A 4AIRA 1WZUA 3U3OA 4BO4A 1F38A 3K59A 2CJWB 3LCMA 3BEDA 4QOHA 1KEEA 1G3UA 3BH0A 4KTTE 4WLVA 5CCEA 2CDCA 1F4VA 3IAYA 3OIWA 4Z53A 5G0UA 1B16A 4IQGA 4K5QA 3JCZA 3VI3B 4PPQA 4RPKA 3STVA 2VYCA 1J8QA 1SB9A 1IJKA 3VX3A 3WADA 1UOOA 5IYZF 4P4NA 3RNOA 2ZDIC 3BDAA 5J23A 5F1OA 3UHPA 2HNAA 1CEYA 3UW1A 5KQPA 4GT1A 2IELA 1MQSA 4M46A 2YN0A 1SNYA 4C0AC 4DQKA 5AJWA 2WAAA 3NDRA 4WKNA 1FDOA 4BLUA 2QLMA 1QYXA 1ZN2A 2JLYA 2EZOA 3L92A 4EJ6A 5EGNA 2PH7A 1Z18A 4DBLE 1UMCB 1RJGA 4G8CA 3OD5A 2DPXA 3WNQA 2PXCA 4LY0A 2HX0A 3KL2A 4JYZA 2MU1A 1LLUA 1A7AA 5FQNA 1P2GA 5JNUA 2K4MA 2OVFA 1NT4A 3UAZA 5AVTA 5FJIA 1PJ3A 4TWJA 3TW0A 2DUNA 5DSTA 1XP8A 2BFDA 1ZW6A 3BGIA 3AR3A 3IP5A 3WHKA 4I4TF 2AZXA 4HDRB 4Q9NA 2VRNA 3TUJC 1NJGA 2FI1A 2C3YA 3GUHA 4MKIA 4PO9A 4DLTA 3CCRF 3EVNA 1J42A 4DV4O 1KJIA 4NEQA 3DXRB 4JI5B 3CXCF 121PA 3ND6A 3K4HA 5EFOA 2WTUA 1GRCA 2W2QA 4YAWA 1JG6A 2LWIA 1PTKA 1SRRA 2W6JD 3I73A 1E7WA 4BB6A 2BGMA 3STZC 4BNVA 1RJEA 1GY8A 1XCBA 2JHCA 2WNSA 3TTWA 3AVVA 4Y2HA 1RZ3A 4EL0A 3SI7A 2CXPA 1KBOA 3SHQA 3AETB 3G0BA 4KPGA 2NMUA 1P2UA 5C35A 3DZCA 2YDEA 4JLUA 1VL1A 2Q0HA 4X62B 4X63A 4BWVA 2R8OA 4KPYA 1K3UB 1XL1A 2FMTA 2DJ5A 4NABA 1WB7A 3I6MA 2XOKA 2QM0A 3KTFA 1IN1A 2AT1A 3QXJA 3HJAA 2PTHA 1QPZA 1JAIA 1KA9H 5ALMA 4IVQA 3VMFA 2F8SA 3FDZB 1K7DA 4O0MA 1J2YA 4UCSA 1YS9A 1CZNA 2IC5A 4NMMA 3REFA 3SKXA 2XASA 1DC6A 4BVJA 4R7TA 4GOJA 4W82A 2Z58A 1CVLA 3M6LA 4BFSA 4F9EA 2XUZA 4CIYA 3WWZA 4UE2A 3V3KA 2C2WA 3X1XA 2GM3A 3PFKA 4NECA 2SHKA 5L3QB 4FINA 2QUIA 4BV8A 1UPTA 5T4EA 1YIAA 4CI0B 1QHTA 1QNFA 1IB6A 4GPZA 1BO6A 2A1UA 2CXUA 1J21A 3RUHA 3RUDA 5AM2A 1ZD8A 3CCEV 1IEQA 2PKYX 1II9A 2XAUA 3D3JA 4YWJA 3T54A 4TQDA 2P9TA 3LT2A 1QDLB 2XNDA 2P9QA 3BZUA 4J49A 3VR2D 1NAHA 2BV3A 3RADC 3H5VA 5AW1A 4LFCB 2FZLA 4ID9A 5FFMA 4CUZA 4TWIA 3J7AC 4EQ6B 1T3GA 4E5NA 1PFYA 4MH0R 4QUJA 2IBZH 3OETA 4PZLA 1JDZA 1Z0ZA 3D8TA 1T9AA 2BKUA 3QY0A 9LDBA 3UAOA 5EB1B 1EK5A 4HMQA 1E7RA 1GCAA 1P1BA 3FKJA 4YLEA 1CIPA 3QKTA 4J0KA 3LKZA 3KQMA 4MCHA 1WMEA 1WHSA 3NVKE 1X8JA 5K8JB 4FDLA 4CM9A 3N4ZA 2I2AA 4NBLA 9LDTA 1NWHA 4ZEWA 3DMYA 1OMOA 2B94A 3IC7A 1OLUA 1Z5ZA 3JR3A 2QPAA 1LPSA 3QA9A 3RS7A 2RH9B 4XWKA 3P97A 2FLVA 3FCCA 2HNBA 3DFZA 4G5FA 2PSEA 1H5QA 5A3SA 3HUDA 3ZU2A 5F7ZA 2XMZA 3WHIA 3WV4A 4RE6A 2OZEA 2AA3A 3B51X 3LUBA 1Z2AA 3IVGA 1YOBA 2IG8A 4YS6A 1OIVA 4D3XA 1UOPA 1E1RG 2C5SA 3H9JA 1DQRA 3IQFA 4CIDA 4E70A 3AO0B 3NKLA 4KXWA 4D8XA 1RYNA 2FW6A 2QTAA 5JIBA 4HZUA 1E7QA 3DLAA 4GNRA 3TTVA 3PT5A 2ZU0C 1QQ5A 3BXFA 3LFHA 4G4VA 4JBNA 2IAFA 3IB6A 3SVZA 2H51A 2J5BA 1YU6A 1HE1C 1LBTA 3ISJA 1DIAA 3UMSA 5KYTA 3TIFA 1ZMOA 2FFQA 1OLXA 3P71T 5JXJA 4FGWA 4YDHB 2XDWA 4K1LA 5CB4F 2R1VB 1IOWA 3BVPA 1K97A 4NXMB 1Q1ZA 2HDHA 2ZIEA 3GNLA 3O03A 1PKEA 1Z5WA 1MNAA 1T9ZA 1LV8A 1MW8X 2GXUA 4C21A 3H17A 4RCZA 1O95D 2FSPA 1RXIA 4JUCA 2FZCA 5CCXA 3I2JA 1ZA1A 2I0FA 4BCDA 3GAFA 4K28A 2Q6AA 1E98A 2VJQA 4JI1O 1K0UA 1UDAA 3CH7A 3L7OA 1SHKA 3ZDEA 4NOKA 5KPDA 2AD5A 4ZV4A 4UUJC 4Q1AA 5ECDA 2GX6A 2CSLA 1XLUA 1IXSB 1ICEA 3OQVA 3SIWA 4MAFA 3WLRA 1LBEA 3EULA 1IM5A 4XH9B 1WUYA 4OHRA 2REBA 4BN0A 3F8SA 3PP8A 2D2CB 2N3ZA 2WSSD 1V9CA 2OYRA 3AUKA 2XWBF 4HXYA 2B61A 4OJTA 1H2RS 3HXKA 1JPXA 1TEVA 2I6XA 1RQPA 2FR8C 3K6RA 2HCFA 3FB4A 2LKCA 1KRHA 3EW9A 4IIVA 4PCLA 5E0KB 2BEKA 5E3HA 1WBBA 2Z5GA 4U7WA 1XKXA 4R51A 1CUSA 3ESQA 4G8DA 1E0SA 4QPZA 5SV2A 2TMYA 1HWYA 2J9FA 5FD8A 4D3ZA 2G9VA 5BP7A 4QJFB 1KD1W 2I78A 5H5JA 4L3WA 3IJEB 4D44A 3AIKA 3W5CA 1MOZA 5F4ZA 1L5HB 1NKVA 1OD6A 1U3CA 4G9EA 4GOXA 4KQCA 3FFMA 2O8VA 5EXSA 3SFVA 4WNAA 3DL0A 2I8AA 3IFSA 1RBZA 1OILA 4O6VA 4XLTA 4FZ1A 5FWXA 1SC5B 2QNIA 3GI1A 4AMZA 3FVRA 2HMUA 4YHHO 2VIIA 3ANLA 3R3JA 4GC5A 2JGAA 4IHQA 4MYSA 4BNIA 4FOTA 2NWQA 1LDYA 2VF8A 4RK5A 3F49S 5H2FZ 3MMPA 1TTPB 5JANA 4O29A 4JC8A 4ZYYA 3AVYA 3QBDA 2UDPA 5LHIA 1FRFS 1G4UR 2R7AA 2FDCA 3IKEA 4HD8A 2EWWA 1EHYA 4QBHA 3D3WA 2WUWE 4JLMA 3BE4A 3KZNA 5AVRA 1ZQ9A 4FFSA 1P3JA 4NMWA 1RP1A 3TB4A 2FTKA 1H2HA 3R65A 3RIGA 2IS1A 3SHTA 3EGCA 2HLPA 4LF7B 3LDTA 4FUTA 1YHQF 4DC1A 4GU5A 4XGRA 3NAQA 1JNXX 3SWWA 4XDJA 4LWSB 3FETA 1G5HA 3FHCB 5B1IA 1RXCA 2HRRA 2G9NA 3PVSA 3VQVA 1Q6IA 3RWRD 1VIDA 4DVJA 3K92A 4G41A 5B3SB 2F3TA 5EJEA 2PMFA 5B1BC 4B08A 1V6AA 1VF7A 4U63A 4RAQA 2V45A 3PGMA 1AU9A 1Q3HA 5LLTA 2X5OA 1FS6A 3HPRA 4UQLA 4EA7A 4XWWA 1EUYA 1A7JA 3HUEA 3JQ6A 4KG7A 2UZ3A 1LVGA 1KO1A 2BVNA 5AHKA 4WF9V 3WX0A 3JARA 1T25A 4J0EA 1TJ4A 1O4VA 3VR5D 4E07A 1EUCB 1EZ4A 2LTAA 2VSQA 2H63A 1H7MA 1UUFA 1C7ZA 5AM4A 1Q15A 4HXEB 4ZVOA 1U28A 4MWCA 3VOTA 2IUSA 3W7BA 4N65A 1ZHHA 2DLDA 3CBQA 3RK1A 1W9HA 2VJOA 1BGVA 1XDUA 4DDHA 1FBTA 2WYIA 2H11A 3OZSA 4TLCA 4DABA 1K3EA 3DOOA 4CLDA 2ARKA 3VCZA 1WA8A 2YNMC 4NR0A 3PR1A 4ZHQF 2HJ9A 2JIPA 1SD5A 3MQWA 4U9UA 3UC9A 2O20A 4MKFA 2MWMA 3MWEA 4NYMQ 4TUYA 1C9NA 1YQWA 3I12A 3IDAA 1EX9A 1IWBB 3ZU5A 4HGZA 3SG0A 1DNPA 2XWQA 3AHEA 4I6GA 1WBDA 1KDOA 1ZGZA 4NBTA 1FDIA 2D2VA 1S72V 3KSDO 1TTHA 1PT5A 1FUIA 4HWGA 2ONKA 3C6XA 1NJIW 3ZDXB 3U4GA 2UUBO 1VLZA 4WFJA 3UWPA 4DMCA 3G5TA 3WHPA 3FPFA 4R8CA 1B3BA 3OBBA 3RPEA 2EL7A 4FR0A 4ZDJA 3OLZA 5HP7A 1WDKA 3I56F 2QQGA 4ZZ3A 3ANSA 1LQ2A 3H5LA 3QV1A 2IGTA 3I9MA 3IAS6 3SSMA 2B3TA 5E6SB 1WHTB 1I3CA 5KU7A 1ZIPA 1USIA 2REQA 3R4CA 3LSSA 1OWMA 1SCUB 2EX4A 4KO3S 4OQPA 4PX9A 1KMQA 3MHTA 2IYVA 2Z3ZA 3EXFA 1P2DA 3I9KA 3MJ4A 2AHYA 2VP6A 1SCBA 1N5MA 4K35A 5E6UA 4ZC8A 3KLNA 4ETIA 5CU7A 4M99A 2P9HA 4BKRA 3M99B 3HFRA 3B1ZA 1YOVB 1MPTA 5FULA 1RRCA 3HZOA 4ZHQB 3WLPA 1CDDA 4CKYA 5BOSA 3EFHA 3A4VA 1GR0A 1QVRA 1L5QA 3W7XA 1JDBC 2POCA 4WDQA 4FWTA 2RGUA 4FI3C 4FLTA 1PYGA 1L7EA 1SPXA 1R15A 3V80A 5A4DA 2YS8A 5DM2A 1PI3A 1KOGA 1SFRA 3GVXA 2QYHA 4AYWA 3HUTA 1C3VA 2REXB 4YUYA 1V2HE 2XIQA 3SYMA 3E23A 5CB8A 1T0PA 3WU2Z 2H31A 2JI9A 4KODA 3VZRA 2I55A 5KOHB 1BXRA 1QORA 4PI0A 1PD0A 2BEJA 3B5EA 4HDMA 4IDEA 3NNNA 3E7WA 3PQ5A 3UMCA 4A82A 4CFYA 3ZI4A 4RIIA 1HM5A 4YRZA 1M1XB 4ZEMA 2I7TA 1G8PA 1GAQA 2XB8A 4N12A 1NQVA 2ZIAA 3R0QA 5GM2A 2WWWA 3UT5A 1EK1A 4I6EA 5HKOA 2QV7A 3AF0A 4HB2A 4IV5A 3CRMA 3CF4G 2PE5A 4XGIA 4CEIB 4C7BA 3LKVA 5A1JA 3GAZA 1DF4A 1EE9A 3QYPA 4FPXA 4BLTA 4E4YA 1K4MA 3JQBC 2H0AA 3QVTA 1P2SA 4L76A 3JSXA 4RCVA 5CVEA 5DB4A 3CYPB 3EGDA 1P44A 3HFGA 4QU5A 1Q20A 1T2DA 3DR5A 1W46A 1ZGCA 2EKPA 3PKIA 2W4IA 5TQJA 1E2GA 1PSZA 2IY9A 1N75A 2W0MA 4R3WA 2C07A 1Q7TA 1JR9A 3NYRA 1QWSA 2YWJA 1O7JA 5DTJA 4YP7A 3ZDZB 4TM7A 2HF8A 4YMVA 2XAAA 4FQ7A 3WG7C 1XCMA 4BO9A 1U0RA 4Z7JA 4GHWA 4J1SA 4AMGA 1ZM3A 2HQ1A 3OZVA 4E1VA 2C8KA 4FB4A 4EG0A 4P30A 2MIIA 5FTJA 1QHSA 3NXKA 1Q7BA 2YIVX 1OU0A 3GEPA 1V11B 4NBRA 4S1PA 5AKJA 2NTYC 3IKLA 2OXCA 3OQJA 4KXVA 5J43A 4CEJA 1CRZA 1ZK4A 4CL3A 4JBIA 1WE2A 5HIJA 2ZSKA 1VJTA 1RXVA 4IIEA 2UYNA 3REQB 3HEBA 1HT3A 3FNQA 4AG3A 1SELA 3X1JA 2ZCJA 4AKEA 4WD3A 3GRAA 4BE4A 1FVOA 3J81k 3G88A 3N59A 3RE3A 5IK2D 3KWMA 2JLUA 1N3IA 1CD5A 3OE7A 1R9GA 4QODA 5HE8A 2OC4A 1QVFF 5I8PA 3L8HA 2CZQA 4MWZA 1UP4A 2PKWA 1GNTA 4Z2YA 1B2RA 4DCGA 3QSYA 1RKBA 2E5WA 2I71A 4FHZA 4PZZA 3FUTA 3U7EB 4DT1A 2Y68A 4BLSA 3CRW1 1XU4A 5GTIZ 1E1NA 1P7VA 3TD2A 1AGNA 3CPQA 1M67A 4RSHA 2XOXA 4GPIB 3HN6A 4RHCA 3E2PA 4ARSA 1ZA2A 5ES3A 2NACA 821PA 4RIFA 5MN6A 4UNSA 4B3DA 1JYFA 3HCCA 5AMXA 2F4VB 2QJTA 4A2PA 4EW2A 3RS9A 2H4HA 5KYUB 1ZGJA 1LDGA 2CLDX 2Y2UA 3UMGA 4QRHA 1KNXA 2IK8A 2VDMB 2VUUA 2XMDA 2OZBA 3F4KA 2RDMA 3H1AA 4NKRA 4OGQB 4I9QA 2KTUA 2NSJA 2W6CX 5BV8A 3ZVRA 2ZKOA 2ZVPX 2JCSA 4AMVA 1MOQA 2X3YA 2PKQO 3INGA 4UV8A 3X2QB 2FUNB 3PF8A 4FIDA 4KXMA 4K03A 4LJKA 2MCFA 2DQYA 3HY4A 4URVR 5HIAA 3UMMA 2RIRA 4HV4A 1X25A 3K5PA 4H0LB 2FG7C 3F71A 1JJBA 1XPRA 2NZUG 4YREA 3WE7A 4EX7A 4UCTA 1ZD3A 3JYLA 4ZOBA 3MD9A 2YIJA 4YMTA 1LRJA 2AZMA 1QFSA 4XFKA 4URYR 1M7HA 2WHXA 4XVRA 5K0EA 2O8BA 2XNDD 1UWKA 3P0HA 4E09A 1WOYA 1ZM9A 2BSKB 1D1QA 1ETHA 1JL3A 1L8LA 3OUFA 2QB5A 2ZTLA 3EC1A 1NXWA 1WDWB 2VYVD 4GRDA 3OCYA 3KSRA 4XUCA 3NB0A 1HUQA 4G5YA 4WXRA 3UIEA 4GPBA 2G0AA 5JDIC 3HBMA 4F6RB 2VPPA 4XE5A 2ZM5A 1GNRA 2LFSA 1T9GR 3CO0S 3GNSA 2DWQA 4IJ6A 2AK3A 3FI0A 4CMBA 2OTJV 1WZ2A 1D4ZA 4JC4A 3E84A 3LBYA 4OREX 2JRIA 3LWRC 3WMGA 2OY0A 3FGZA 4V1CB 5HXUA 4U9HS 4KGVA 2P6YA 2AX3A 2H9AA 3MJTA 4BVQA 4N8EA 4Y2RA 1A32A 2JFVA 3OQIA 3BXGA 4BVTA 3M84A 3GRZA 3GJ6A 1C7EA 2XUQA 4LJSA 1E6MA 5AOAA 2IHBA 3NBQA 5DGCA 3CNQS 3WK6A 1A8HA 1NQWA 2CDAA 1NJ8A 3WGNA 3HB0A 4RDCA 2R25B 4U02A 4TZTA 4FHDA 3VVLA 4QG3A 2Q28A 1US8A 3BYZA 3PNLA 1V6SA 4GZ5A 2GMWA 3G13A 4L8WB 4PXSA 1ZOPA 1XQWA 3JQAB 4IG9A 2NPFA 3OJFA 2YYZA 1A50B 1Z0IA 2OBLA 4II7A 1YTUA 2V9YA 3BA8A 2ZVZA 3ZXIA 3LHFA 4RJTA 3U26A 2FFBA 1BCSA 2P0YA 1AA6A 1R0ZA 2WWGA 4XUGB 1P7PA 5EIBD 1QGUA 3GN1A 3KAPA 4KLNA 4O3MA 2HRQA 3T34A 3ZJ4A 1KKDA 1EVIA 5FPPA 7MDHA 3QTYA 1B6GA 3S5JA 3C41J 3TK1A 4GZRB 2COUA 2I7VA 3K9WA 1ZSPA 3RROA 4R1NA 1F0NA 2YHUA 2RHBA 2ZDIA 1SZJG 3KJFA 4GMHA 3UOGA 4D99A 1F7UA 3ZWPA 1FNKA 3Q88A 3ABRB 2ONYA 4JKIA 4TKZA 1WR8A 2QOEA 5AKZA 5AFSA 3K0CA 4RUKA 2A33A 2EHDA 1KF0A 4EKNB 4QU9A 1DAGA 3V7QA 1P45A 4FSXA 4TLEA 1DWOA 3HGQA 1GFWA 4IO0A 1V9PA 1W59A 3P9CA 2BHSA 1AP5A 5TMEA 4D9BA 5L4LA 4K26A 2PX4A 3V2IA 1IJFA 1X94A 4B4OA 5HY1A 2J8ZA 3JPWA 1M56C 2AHZA 3TBFA 4L9AA 3V2GA 5AKEA 2RHHA 4D9JA 3S81A 3GT4A 4EF5A 1LNZA 4MPJA 1XR3A 4EKEA 5LA6F 4LFAO 3DLBA 1FK8A 4EUFA 1L4NA 3L7YA 2GPYA 3OOSA 1ZAKA 1G5RA 3DBHB 3QJ5A 2CNDA 4UV9A 2OB2A 3LWQC 4NJOA 3UBTA 1SS3A 4C30A 3EOZA 4DV7O 1DRVA 3JQEA 4IG4A 5CEFA 4WLOA 5TARA 1NNEA 1NBMG 1P6QA 2BZ1A 3WDLA 5GAJA 4LF8O 2OPBA 4DB2A 3KB6A 5AUOB 3TRFA 4NB5A 2R70A 4M9RA 5H4HA 1KQNA 5ED4A 4NCKA 1YB1A 2H3HA 2TYSB 1WB4A 3R77A 4PSVA 2XOKG 3PJGA 1M54A 1MNQA 1HXHA 1XZEA 4YCBA 4EGQA 2QTTA 4L4ZA 2I7DA 1V5EA 4WE3A 3CRZA 1KD1H 1KMHA 4QBKA 4FMTA 1V3VA 5AQ1A 1LLDA 1IX9A 1AQUA 1JLLB 2ITCC 3LL7A 4P3XA 4HQOA 3ZK8A 1U2EA 3I04A 3N58A 5EMLA 1P4SA 4CODB 1US6A 4DFDA 4HVTA 3U4CA 1EGQA 4JIMA 3WNBA 2Z2XA 4NU6A 4ANFA 1A9OA 2IHUA 2PYZA 1JBQA 2WKQA 1BOOA 2ZJ5A 4HH1A 4LOJA 4UU7A 1YZGA 4TWAA 3T3HA 3TR6A 3EODA 1X13A 5YASA 3UA3A 2PLWA 3AY0A 3WSWA 2FDXA 3DBRA 4L73A 5EMNA 3ZWNA 2AE2A 3ZW8A 5LA6A 4MIKA 3TX6A 2PVCA 2PKCA 4RV5A 2IEDA 2HU2A 2IZOA 4MZXA 4YAEA 3ASOB 5IASA 1GO1A 3ABKC 2BKLA 4DUZO 1EWVA 2IYZA 2OHGA 3LX5A 4LHWA 2PHNA 1Q1EA 2A0YA 1FFEA 3M1AA 4MOWA 4G0XA 4XBFA 4MUMA 4MHTA 3VDQA 1K5DA 1JR2A 4WBNA 3ZZTA 4KL8S 3WGQA 4B2LA 3WMWA 5JSYA 3NW9A 3RS8A 1YJNF 1W49A 1F8YA 1P49A 3D36A 3DC6A 4PLVA 4TWBA 2WU4A 3MN1A 2Y4UA 5U4QA 1P0PA 4ZOLA 4KYVA 5KSYA 2EULA 4I1YA 1WW3A 4FLMA 1P1JA 1IG3A 1SVSA 1Z26A 4K46A 1QTIA 4MV5A 5GM1A 3KM0A 1FDRA 1T2UA 4IL6Z 2V7QG 3RYCB 3IEWA 2H1HA 2VZ0A 2MINA 3DTTA 3LOPA 4FDTA 2CV0A 4MB2A 4YPFA 4AO8A 5IE9A 3QTCA 1G3MA 2JD0A 3S8EA 1AF4A 2QD3A 3LKDA 2ZITA 4MDYA 4PZ0A 5AKXA 1FNJA 3RAFC 2N04A 1RPOA 1BGWA 4KK3A 4TV9F 3B2NA 5DCWA 1GEGA 1DTWB 4IFIA 1QLHA 3KZKA 3OUZA 4J7CA 4OHMA 3T5MA 2UVPA 2Y66A 3TCXB 2OV2A 2BMJA 2D1FA 3V34A 1P0CA 3VPCA 1CRPA 2QRLA 1RM0A 2Z1UA 1OAOA 5TEVA 4UAVA 2IJIA 2AOXA 4OQ4A 2VSFA 3MZ0A 3E22A 5DH9A 2GBIA 4PCUA 3H0CA 1KI3A 3HVUA 5HIMA 5K01A 1AURA 3L7LA 3NT2A 3C1UA 5EHGA 7ADHA 2VOJA 3RANA 3WMRA 5CMUA 2BMEA 3TUZC 4BT4A 4C01A 1DV2A 3EQ9A 5JJKA 1IMJA 3ASZA 3IIIA 3WYCA 4JJGA 2YVKA 1G5PA 4ZQFA 2AUMA 1GGFA 3RSCA 2PUHA 3OR7C 4JQZA 5IM5A 2VDWA 2ZSUA 4YJHB 3CZ4A 2ZJYA 2ZUWA 4GP6A 1ZSNA 2O05A 4LWOA 2UKDA 3WQRA 4JYMA 3K5LA 4MUNA 2R60A 3DAGA 1HK7A 4JTDB 3VQWA 4HP8A 1UKBA 2IYNA 2JAUA 3LPLA 4RSRA 1H0KA 2CE2X 1ZIYA 1LNQA 4HNRA 3FB7C 3KEFA 3MAGA 2BH9A 1FZTA 3L7MA 4FCWA 2JGJA 2KMLA 3VTZA 4PG5A 3R40A 5HF8A 3NGXA 2AR7A 3I34X 3ERNA 1BRMA 4BFYA 3HY3A 3QF7A 3L1KA 4AC9A 1NYRA 1O0SA 3INYA 1GZDA 1LNSA 2XVZA 3DEZA 3HRKA 5D3MB 1PJ8A 2R87A 4URFA 5B3JC 3CCQV 1QIEA 1YJXA 1NW5A 2VT6A 1LXCA 1NR7A 4KZPA 3QWIA 1G17A 3ROGA 1USGA 2FHSA 3VR6H 3ZBQA 4LPKA 4A2WA 1U2GC 4ARVA 1IRXA 5BVGB 2VJCA 2PA3A 1AS3A 1KZYC 3LU1A 2BFDB 3NNDA 3MDOA 3EQ6A 3NIBA 2CFOA 4MYDA 2P9ZA 2Q9UA 1YUBA 5T3YA 3X44A 3A8TA 1QPBA 3D3IA 2VK8A 1G42A 2DERA 2Y48A 1KXZA 2IOQA 1Q7YW 1E9RA 1QLEC 2G7ZA 2JLSA 2VH5R 4CYMA 3CRCA 2HXSA 4IL5A 4MCIA 3VVCA 4EMBA 5BV2P 2OCXA 3PTZA 1GUBA 5WRFA 5J59A 3V4VB 3NEJA 5FOTA 3GJ3A 1MB3A 5EIXA 1DCTA 2IYEA 2CB9A 2WUGA 5IAOA 4K8ZA 2IIPA 1QV6A 1LLFA 2XHBA 2E1PA 2IFTA 3IVCA 1UBRS 5BR4A 4EPXA 2XQGA 2HPHA 3VPXA 1TM3E 3U7HB 4DR6O 2YBDA 1M8JA 1BS3A 3CYQA 5EB0A 3PNKA 3E3LA 4GPD1 3G2LA 5HGJA 3ZN2A 5JAUA 3QTTA 1YMUA 2QL9A 4ALIA 1YQQA 1R16A 1UAYA 4ZTUB 4ZO7A 2PUJA 4UCXA 1VMAA 4B3SO 4WI1A 4WL0A 3K0DA 1Z2PX 2PLAA 3SDZA 1XEXB 2FN8A 4TSRA 4MI6A 3L1IA 4O5OA 1WUIS 1XEWY 4GUAA 3LAWA 5BSMA 4DMUB 4FKBA 1U0LA 3ORFA 3RTGA 2FLKA 3MA0A 4MV9A 2OFWA 4UNNA 3ZHUA 2OTJF 3R0JA 5F23A 1TOAA 1IE3A 1LDEA 2YASA 4G5QA 1CRQA 5CVCA 3D54D 1EA7A 2C7BA 4JLWA 1J24A 1E94E 2HLDA 3QU4A 4LRQA 5KVAA 3C3AA 4RU1A 4F9GA 4HY3A 1W0KG 1RDFA 3FRIA 4J9VA 5IXSA 5IAEA 4BMSA 3BCRA 2GQ0A 1DG3A 3HJGA 2C2MA 1OKKA 5DGTA 3A4TA 3BE8A 1L7PA 4FZ0A 3CUTA 1PJ2A 2G77B 4K0RA 1V3QE 3SC6A 1JXOA 1K8QA 5K3CA 3WXBA 2KSDA 1PT6A 3MTEA 4BVGA 2XBMA 4B62A 4HSGA 3ZCXA 4FOOA 1C1YA 1ZD9A 3DA8A 3FTCA 5IF9A 2PRIA 4J9UE 4B7CA 4MVSA 1LS1A 4LQ4A 1E79A 2VCEA 5ESWA 2FN9A 2ZBPA 2CHSA 1WHSB 4RZIA 3HVHA 4Y2JA 2KM1A 1OI2A 1AUQA 3WK8A 5HZGA 1K73H 5AVZA 4XIJA 1C5KA 4BNZA 1M6VA 1NUHA 2O0LA 3CCLV 2JH9A 2B0JA 1CUBA 3N7UA 5ENVA 1W0JA 3IHKA 2FEOA 1GYPA 1ODTC 3FW1A 2A30A 3L70H 3ILHA 1C9JA 5FADA 1ONNA 1RRFA 5EQJB 3HLYA 2P35A 3AFOA 2HWXA 3H1IH 1MJ5A 4JI6B 3Q10A 5CD1A 2I1LA 1Z29A 3EFOB 4QTXA 4TXMA 2O59A 2QN3A 2WFAA 4CZ2A 2ZIXB 2JPDA 1UBSB 4P2ZA 2Q3FA 3NHPA 3PLAC 2HTEA 1KFKB 1UEIA 2Q1UA 1BWSA 3EDRA 4JV5O 4HRXA 4BNGA 2J41A 1IY0A 2CHQA 2IU3A 1P33A 4D45A 3J80M 1KVSA 1H8EA 1KZ9A 4FC7A 4MGYR 5F76A 1ISIA 3O8RA 2A0KA 4M1YA 3EMDA 1K8AW 1KETA 4PC2A 3MAAC 4OM7A 2GN8A 4LV8B 1W34A 1E1MA 3AHIA 3LWBA 1EFVA 4DCTA 4CTJA 1U2DA 2GZLA 4OXSA 2O8DB 1H8HA 1CJTC 2J6CA 4TM8A 3VVBA 3U11A 1F2VA 1Y89A 3KR2A 2ZIZA 4L85A 1DX9A 2R9IA 2OHXA 4HOYA 1R18A 1MVLA 1UKZA 1IAVA 2YQ4A 4YXWA 3PIRA 4IXTA 4BNDB 5LDHA 3D02A 3DUWA 3GO4A 4G65A 5D1HA 5EXXA 3ZWCA 1AP6A 3ICWA 4JIGA 5KINB 1G20E 1L1QA 2EVWX 2PKEA 4XCXA 1I14A 4EY8A 3PFFA 1TAEA 3B8NA 3H0EA 3QJGA 4YUWA 1JWBB 1KI1A 3E1GA 4WXHA 4AJEA 1QAQA 4WK0B 4OQLA 2EQBA 1YA8A 1O6FA 5EWJB 1X52A 4K8OA 4NBSA 1S77D 3RNLA 2JIDA 4LYJA 3AH8A 3VC2A 4E33A 1C3JA 3EAGA 2JNBA 4WOKA 4F2GA 5EC8A 2OQIA 2QT0A 2XHZA 3O75A 2WJHA 2NYRA 1KTIA 3MMXA 1WJGA 1JEQA 5JZ9A 5IWAB 4EI9A 2Q5OA 3QVGB 5FPQA 1TVKA 2CK3A 1N0UA 1Z4MA 1ZGAA 2QN7A 2VXBA 1ZESA 1ENVA 2CL0X 2Z3WA 1B8PA 3FHLA 3KJKA 4E1BA 3Q9NA 3KHSA 2XE4A 4H13B 2BFOA 5MFZA 1A9XA 4KGXA 4LF8B 1O9HA 4PA7A 1N2SA 4PZYA 5KKCA 1Z15A 4DA0A 3WGUA 3JVUA 1P0QA 4CM8B 4BECA 3U1BA 4YT8A 2K7ZA 1Y9AA 3RLIA 2ISCA 1PG0A 4NZNA 2HLDD 4X65O 3S68A 4CV3A 1U8XX 3A9VA 5K0NA 1SKUA 3EUEA 2RHCA 2YXPX 1HTBA 4JI7B 3FFTA 5DI9A 1N4CA 4RESA 2B6NA 3LMEA 1ZK0A 3WLKX 1Y76B 4AQ7A 5EO3A 3MILA 3LFTA 2EYQA 4FVMA 3D6VA 2PS1A 4RUEA 3R6GA 1MB4A 1THTA 5CVUA 5L7YA 4J7KA 1QIMA 2BOBC 4TQGA 2PK3A 4LBWA 1BYIA 1SXJB 2XMRA 2AWOA 4DMGA 5JZOA 3BVOA 2RC6A 5FI5A 4A8JC 1I4WA 1N34O 1H2BA 1S1MA 2QX7A 2UXCB 4XCVA 3SHVA 5ALWA 2QHXA 3O2SB 1N6LA 4D9IA 4E3ZA 4MW6A 1CUYA 2WJVA 2ANCA 1E79D 2QY9A 3AKCA 1FRQA 4RADA 1SHZA 3LIIA 2OG1A 3TRKA 1JG1A 1V1MA 4K3VA 4B87A 3LX6A 1VBMA 5GOZA 3IXMA 5KTKA 5C9ZA 2CJYA 3MCVA 1KC1A 4H1VA 4U2GA 1PIWA 4PNEA 1P60A 2YINC 2X4LA 3U1VA 1NJ5A 2QWQB 1JJ7A 3NFRA 4J1NA 5TB5A 1ZUD1 4E2YA 5HUJA 2PLRA 2WINI 1U2DC 4CQMD 1CG6A 1DXQA 5ALLA 2J3LA 1WVIA 4CLOB 1HE2A 3PPVA 3W77A 2HS0A 4YDRA 1WKBA 4DLPA 2OK8A 1GX1A 2JJMA 1LV7A 1JCHA 2Q1WA 2YZ7A 3KEMA 1YZTA 1FXWA 1N8RW 1I30A 1PR9A 2DOSA 1FQJA 1Y66A 2ETVA 2JANA 2O52A 1EDBA 3STTA 2GFHA 4A3SA 1X7PA 1E69A 1MBZA 3AEKA 1U28C 3HCRA 3AG5A 3ASVA 4ZAFA 4LQCA 3GTZA 1HMYA 2EOAA 3SZ3A 3ZGLA 4BTLA 4DJTA 1AZWA 3ILYA 4GM0A 1V3TA 4AS3A 4CM4B 4C4WC 3I2GA 1Y8CA 3U4AA 2ERCA 3RBAA 2W6ZA 2G09A 4YXWG 2WU1A 3KT0A 3FHTA 3C87A 4GVLA 1N92A 4N5LA 3BHPA 1UP7A 4MYCA 4S3MA 3SJAA 4ZCSA 1QANA 1ZR4A 3KCYA 1X86B 1XTIA 3HCBA 2I5PO 3Q1LA 4GXRA 4PYLA 1PVOA 5FKJA 2DYSB 4JI4B 4AN0A 3UJ6A 3IJ5A 3KE8A 1J99A 2IGBA 5BORA 3EB9A 3JYQA 3TDMA 3PWZA 3QUWA 2REQB 2ZPTX 3CC2V 2HR3A 4FW8A 1XIVA 1FYDA 2I4NA 1MRSA 4XDZA 3LP8A 1H5UA 4CNBA 1B0ZA 4HC4A 4P4GA 2Q3MA 4YC7A 2RJZA 4YRCA 1UDBA 5LOVB 1R4MA 3PHGA 2Z8YA 4GFDA 3TPFA 4CTNA 2AIRA 2J3EA 4D2IA 1ZMTA 2DGDA 3GUYA 3AOEC 3V8BA 3LWVC 3GEBA 1TQ6A 3QOFA 2XYQA 4HTFB 4ZT7A 2HB6A 1UZAA 1ZL0A 2OAP1 1V47A 3DSRA 3LBIA 4O4HF 5EVJA 3TEMA 4JZKA 4W5QA 3L1UA 1UP6A 5DMHA 2I8LA 2D0DA 1Y6ZA 4LZPA 3QX7A 1I0HA 1MA0A 1N7IA 4JR0A 4YJDA 3VISA 5JV5A 5LQRA 4KI0A 2BFAA 2ZS7A 4WLUA 3ZBHA 1O4WA 2ZQMA 4LIPD 4O1HA 1RU3A 1WO8A 2P68A 1HTTA 2IYQA 4XX0A 4D43A 1AGPA 1NYTA 2X7HA 4DK1A 1R3DA 4JLKA 5E6RB 4C8GA 1YO6A 4TXNA 2JS7A 4ARUA 1T36B 2XD9A 2E18A 3DB1A 3TMAA 4R1OA 1XU7A 2GI4A 1WDLA 2QORA 3H19A 3K1AA 3QRWA 4C5AA 3STUA 4F9FA 3ZVKA 1E5DA 2RKOA 4H7KA 1YSCA 4UFZA 3T1HB 1YZFA 3ELUA 3K4PA 4P80A 5J40A 4BJ6A 4BO3A 4CEIA 3VAYA 2JZOA 3ES9A 3O8CA 5JSUA 5FEMA 4BJHB 4DR7O 3GC6A 4UCUA 2N47A 2JLZA 4V02A 3B6NA 1E3WA 4ER5A 4P9OA 2VTVA 3BT7A 3O8QB 3UWDA 3R3ZA 5CN0A 1DOAA 4DA4A 4Y6QA 4ALNA 4R2XA 1SY7A 1I2MA 2KG7B 2FF5A 1J20A 4HYEA 2B20A 5MGNA 1G8AA 3D4PA 3L4KA 1P1CA 2OQ2A 2D5LA 1G66A 2V58A 4GR5A 4ZC1A 4B3BA 3QYAA 1YS6A 4D8YA 3WRVA 2JFOA 3EHBB 4ZCPA 1D4FA 2GTIA 2WTEA 3Q8WA 4DSZA 4IH9A 2OMKA 4I50A 1MP0A 1SEPA 1TKCA 2JB9A 1MO4A 1YCFA 2WKWA 1AKYA 1RE1A 1LSUA 1U2GA 5AJYA 3RDPA 3UQYS 3V7FA 3R7SA 1T8UA 1PWYE 1VMGA 1FP7A 4G0UA 2H1RA 1AQ6A 2HW8A 1HG0A 4ENTA 4IP0A 1YIJV 5CA3A 1O58A 1XMVA 2RG7A 3QE3A 3QE9Y 1DPGA 1ZN8A 2WM2A 2VSYA 3I6IA 4FCTA 3REQA 4NZMA 1ZL8B 4DMRA 4MR9A 3GDGA 2EJ7A 3HWWA 1G63A 4IDNA 3NC1C 4HADA 1JMYA 5DVZA 4IDQA 1KSGA 1K63A 1JDBB 3IEIA 1HL7A 3ZP4A 4JVMA 4YQZA 4DIUA 3HSKA 1O96A 4M54A 4JQSA 2CDBA 4RX1A 2GJ9A 3SQNA 5EJ8A 4MA4A 1TU4A 2R6CA 1OTYA 1R3JC 4AWXA 3WJPA 1DKUA 1D9ZA 1W48A 4Y6GB 4ZI2A 3MOIA 3H2HA 2Y9PB 1WNSA 3WICA 2OYQA 2O3JA 3CKYA 4GM1A 3U4QB 1O94D 2QTPA 3VPHA 2WF5A 4F91B 1AV6A 5HIIA 2WLSA 4PX2A 2Q6VA 3CE6A 3NIDB 3E86A 4A9AA 1SIWA 4BTVA 1W2BU 3F67A 4DA7A 4RDXA 1K8ZB 4C3VA 2Q4PA 3IE2A 3OT5A 3ICXA 4UFPA 3C6YA 1K5HA 3OE5A 3DB2A 2Q4RA 5CB4B 3I7TA 3CVJA 3BD9A 5AVVA 3K20A 5JNWA 3NALA 5FWDA 3R20A 1AT1A 1JBKA 1NXQA 4B3RB 4PRZA 1U81A 4X3OA 3BB4A 4XJTA 1TYBE 1EFUA 4KR6A 1HT0A 2H65A 1AI4A 3W78A 1IHPA 3PD7A 2WVJA 4NENB 2FSHA 3EDMA 4YRNA 4I99A 3OQPA 5BPFA 5K0JA 2VN8A 4XSHA 4BO8A 1OUMA 4YYEA 1BQ3A 1YRLA 2Q9BA 2WJZB 5CK4A 5F78A 1T2CA 2ORWA 4I55B 3PE4A 1RCFA 2CD7A 1EGMB 2CVQA 2ROQA 3FWZA 4HQRA 3V46A 5KYWA 2EGUA 3OOEA 1CQIA 1RWVA 2QUHA 3BCUA 3M4YA 4OOEA 1AJNA 1XNQO 3OWXA 4NU0A 4ZT3A 2RMKB 1YS7A 1SZPA 1W29A 1ZGGA 4LRSB 421PA 5LL6P 2GNAA 2Y0IA 4ND7A 1NMSA 1V48A 1UXIA 4KFMA 3T4EA 4CBVA 3K73O 1KQOA 1P9WA 2QJOA 3H2JA 3KVRA 3Q2IA 4QLOA 2AEEA 4XJXA 4CETA 2Z01A 5EZ6B 5IF3A 3UGJA 3UATA 2G9IA 3GFVA 1CJBA 4MVWA 4LC1A 4QUHA 2IRWA 1CK4A 5C4GB 3MXOA 4OMFG 3I4LA 1PK7A 2FEMA 3C5VA 1KEEB 1MRZA 3KVVA 1FXHA 4FUQA 1M8KA 4GCZA 3FPCA