4X1KB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 134
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1kB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1kB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1kB01
4FFBA 4LNUA 1RQ2A 5KMGA 1RQ7A 1TVKA 5LOVA 2RHHA 3N2GB 4EI8A 3JALA 4O2AA 3N2KA 2R6R1 2RHLA 4DXDA 4O4IA 4X20B 4YJ2B 3VOBA 3JAKA 4I55B 1JFFB 5FNVA 3RYFA 3JASA 4O2BA 3ZIDA 2BTQA 5EIBC 4YJ3B 5LXTB 2VAWA 5JQGB 2RHOA 1W5EA 5LP6C 4TUYB 4U3JA 3RYHA 4EB6A 3HKDB 4WBNB 4TV9B 4X1KB 2XKAA 4U3JB 3ZBPA 3UT5A 5J2UA 5CA1B 2VAMA 2VAPA 2VXYA 4DRXA 5KX5A 4HNAB 3HKEB 5IYZA 4X20A 4IHJA 3HKBB 5ITZB 5LOVB 5LA6B 4IIJA 5EYPB 4ZHQB 4EI7A 3C8LA 3CB2A 5JQGA 3WGMA 3RYFB 1Z5WA 4I55A 1W59A 3JASB 4O2BB 4TV8A 5M7EA 4X1IB 2BTOA 3VO9A 4TUYA 1OFUA 4DRXB 5KX5B 4O4JA 4X1KA 4EB6B 2Q1XA 1TVKB 1W5AA 3WGLA 5KMGB 3M89A 3N2GA 4U39A 5JH7B 5JVDB 3RYIB 3HKCB 3JARB 4LNUB 5JH7A 3JALB 3M8KA 4I4TA 3JATB 4ZI7A 1FSZA 5FNVB 1Z5VA 3HKCA 3JARA 4B45A 4O4HB 4X1YB 5CA0A 5LP6A 4ZI7B 1RLUA 3WGKA 4O2AB 4ZOLA 5IJ9B 5CB4A 4E6EA 5EIBD 3E22B 1TUBA 4I50A 4O4LA 5GONB 5C8YA 3RB8A 5MN5A 1W581 4HNAA 3RYCB 5ITZA 5CA1A 2Q1YA 3RYIA 3JAWB 3HKDA 2XKBA 3HKBA 4IIJB 5EYPA 4ZHQA 5MN6A 5IJ0B 4YJ3A 5LA6A 5LXTA 1W5FA 1FFXA 5BMVA 4KWEA 3VOAA 4TV8B 4B46A 1SA0B 5BMVB 2GVIA 3JAKB 4X1IA 4EI9A 3V3TA 3WGNA 3HKEA 4WBNA 3RYHB 5JCOC 5J2UB 4TV9A 5IYZB 5J2TB 3ZBQA 4IHJB 3UT5B 4I4TB 5IJ0A 3N2KB 4FFBB 3JAWA 4YJ2A 4M8IA 5LP6B 3VPAA 1SA0A 1FFXB 1JFFA 5LYJB 5MN4A 1TUBB 4I50B 2BTQB 4O4LB 5GONA 4O4HA 4O4IB 4X1YA 5C8YB 5EZYA 5LYJA 3E22A 5CA0B 5JVDA 3JATA 4O4JB 5CB4B 3R4VA 5EZYB 5JCOA 2RHJA 4F6RB 4ZOLB 5IJ9A 3RYCA 1W5BA 4F6RA 3VO8A 5J2TA 4XCQA 2R751 3WGJA
chains in the Genus database with same CATH superfamily
1NDUA 4I4NA 3BIXA 5KMGA 5IM4A 1FXWF 3GLUA 3VR3A 2AMJA 1DEHA 2J7KA 3PITA 5ER9A 3BTVA 3AZOA 3BTSA 3HEMA 3PF8A 1GRVA 4R2MA 3PCXA 1RLIA 4ZVQA 4CMIB 4RFLA 3DE6X 1EUDB 3GBVA 2VTKA 4OB7A 1CF4A 5HZMA 1COWD 1AOXA 2QQFA 2D59A 2WT4A 3UCXA 4GDFA 1S5LZ 4IEIA 2J9YB 2WWHA 2ZRAA 3PNOA 2WF9A 3IA7A 2VOJA 1OLUA 4NMMA 1T4CA 2IEDA 4LFBB 2DYYA 4BY9D 3UT5A 1AGXA 2LBWA 4MAAA 1SBTA 5G3ZA 1TM3E 5EP2A 1EG2A 4UMFA 2FF7A 2VQDA 4PN3A 4KR3A 4GQBA 3JCUZ 3RUCA 1IXYA 3EDOA 2YRWA 1CJTC 1WRBA 4X61A 1CQJA 4LUCA 4WY8A 1A97A 3BGSA 3WHLA 5IN4A 1CIPA 1N2EA 3OLXA 4TMZA 4LFAB 4FB4A 5JYCA 2Y05A 3E03A 3MGAA 3HYRA 2JLCA 2WR8A 5K51A 3VDQA 4BV2A 1AUPA 1QF6A 3RA5A 1PK7A 2QORA 4D92A 4B2IA 4QXOA 3WGUA 2GPBA 1J21A 4AM8A 1SIBE 2HEGA 3SBOA 1SY7A 3R9XA 3WKBA 1N5MA 3GFSA 4EKDA 1K5QA 1Y4DE 3ESYA 5SZJA 4JUIA 4LWQA 4PYNA 2E37A 4KZPA 2BEJA 4YRMA 3T3HA 4M1SA 7REQA 1RRPA 4Y7DA 4KQGA 4C78A 4YT4A 2BI4A 1Z3IX 5BXYA 4GBJA 4TLEA 3CG4A 4GMXA 1P33A 4PDLA 1I9CA 2X4LA 1SM4A 2VAXA 4DLNA 1RYDA 3GFOA 1CQXA 1PAUA 4G86A 1P1JA 4D41A 3AUJB 3PAFA 4QGHA 5EQJB 2J3QA 4RTNA 4B3RB 2R6FA 4PWTA 2W6OA 2NUPB 4QATA 4Y2RA 4ZJZA 3WG7B 3GEGA 4IO1A 1YL7A 2G7ZA 3FN4A 3H4IA 1NZFA 3E84A 4H4EA 2WVJA 1R6XA 2ZM6O 2PWBA 1RBZA 4EVQA 1SWVA 3ENVA 3TFWA 1EFTA 4A0RA 3G6EF 2C1ZA 2UZHA 2Q69A 5KHIA 3CPWF 1Y8QA 2I4MA 3FNEA 4G4JA 1A77A 1K68A 2JARA 2R5NA 1ENYA 4XVRA 3VXKA 1ARZA 4BCCA 4J8PA 4AKTA 4HDNB 4PYOA 5KS2A 4TT3A 3F3KA 1EHCA 4Z4QA 3AG2C 2HF8A 4NJOA 4QBHA 3OEEG 3CH5A 1SZTA 3M70A 2H4JA 1KJIA 4G8DA 2HYDA 3H2KA 1NVAA 4CI9A 1SELA 2JI6A 1SDSA 1OH5A 2BFDA 1E5VA 1QNLA 2PWAA 1FC0A 4ZP1A 1W44A 3ZBUA 4R54A 4RGVA 5CVDA 2EF1A 4FFVA 4RHAA 5ELMA 3U13A 4TV9F 2K7ZA 3V00A 5IWAB 1EWQA 1KOJA 3BULA 3RG2A 4A5OA 1XHLA 3IP6A 2WJYA 1N2CA 4IH4A 2GJ8A 2EXXA 4DUZO 4FYVA 3NFYA 3DCYA 3TNLA 1DFGA 3QITA 1CUUA 1NU8A 1IBMB 4S3MA 3VZBA 5GTIZ 2QLNA 4RH0A 5K8VA 1N92A 2Z1MA 2E21A 4LCJA 3MTAA 3OW2F 1Q7BA 2DBVO 2BEUA 4JH0A 4LY6A 1PT6A 1N0WA 3OPQA 5DO9A 2QVXX 3SYTA 5LNK6 2GD6A 1CR0A 1ECGA 5EC2C 1G19A 3FWHA 4EQ6B 2DT5A 3V7QA 2YIMA 2FPMA 1PJBA 3FPAA 2DYSC 4I1PA 3SQNA 2EX3A 1C4XA 2P4UA 3BQNB 4FEAA 1ZG3A 2V7PA 1DHTA 1GY8A 1GPBA 4FINA 1MOPA 3OUZA 3RW0A 1YZFA 5AVZA 4EW1A 1N8KA 3AI3A 2Z9DA 4B5LA 3LW8A 5JANA 1WD5A 3E8BA 3RYHA 1YRAA 4WLVA 2PHZA 1FD9A 2Q9UA 2DPXA 2EERA 1O9GA 2ZYVX 1PV4A 4O33A 1QG6A 4X6YA 4W5RA 3RC8A 3S2YA 4J7KA 2ZT6A 3TCNA 2ZETA 4BX0A 1Q7YW 1QX4A 3DAHA 5HZHA 1RPTA 1E2DA 4J10A 1TMOA 4NDAA 4NFHA 5EBMC 2WWRA 2XNCA 3KTAA 2WICA 4WY5A 2IU0A 3JU3A 4JYAO 2OOSA 4TKUB 2Y1WA 4YFVA 2RJNA 4KPEC 3NBAA 2IH4A 5FOWA 1K33A 1P45A 3PQ5A 1Y3AA 1OGJA 3T4UA 3UHFA 1A2KC 2BRUC 1YB4A 2FK8A 1NQVA 4ALKA 4H3SA 1J07A 3HDHA 3QFFA 3VR5D 3GQBA 2I9KA 1JJBA 2WZCA 4XYEA 2IPOA 4MQBA 3ZCTA 1VLQA 5KJFA 3PE4A 3D0KA 4BW5A 2ZBQA 5C51B 1XAIA 1B6SA 2D1TA 2QYHA 2R6CA 2ZB2A 2J4DA 4WCFC 5FPSA 4W4TA 2EIMB 1YZ3A 3PT9A 4FLWA 3K92A 4DCPA 4BWYA 3LLVA 2RG1A 4YT8A 3RC9A 4UCUA 5K1PA 1IPAA 1OXSC 3JD0A 3OJFA 5GJVC 2WF5A 4NHEA 1VQ5F 4AS1A 1S5PA 2XE6A 2QWNB 3ANYB 2PFGA 3AKYA 4P08A 1I7NA 1Q20A 2WM2A 5G0TA 3RO7A 4R8LA 1FFWA 1HYEA 2BGKA 5G0UA 5LZ7A 2FW7A 3TN7A 3VVMA 1AKNA 1L7BA 3M81A 4AY2A 1DDIA 1YOBA 1HQDA 1HL7A 2CK3G 1HLDA 4Q3CA 4XAQA 5LQMA 4JNCA 5JY6A 1B8OA 5FI0B 4GHWA 3TUZC 2CFOA 3FOBA 1N2SA 5ANRB 5H5JA 1UBRS 2QPTA 3TPFA 4EY5A 4L16A 1QVWA 4DJAA 5AOVA 1KH2A 1TJ5A 2IP1A 4G37A 2B4QA 2VQEB 3E8MA 4H31A 3ZWXA 4BRSA 2NZVG 5BN1A 5KOHB 3QNEA 1PUIA 3ZKWB 5HYVA 3K7EA 3CNHA 4IH1A 3ZXUB 3LH5A 3SYLA 3J81N 1CUAA 2CXRA 3H1PA 4RVHA 3OCJA 5B7QA 1G9SA 4DLTA 2YOGA 3P94A 2I1QA 5F2VO 4D43A 2BFFB 3ED5A 5FPYA 3LFOA 4TXJA 3KPJA 1DWUA 2CDCA 3OCVA 2YI8A 2VH1A 5WRFA 3PTAA 1U04A 2GN2A 3JR7A 3O4JA 1VLJA 1ZHHA 3D3JA 3IHWA 4M7RA 4B4UA 5BMVF 2BBTA 4WEOA 2PUWA 3SS8A 5D87A 2QX6A 3BCRA 3MELA 3ABLC 1FFGA 3ZRSA 3N7TA 1I14A 2YMPA 5FTWA 4TQDA 2GOYA 2QIPA 2WUVA 2PANA 3G9XA 4ZI2A 1NVKA 2QLFA 4D9MA 4F6RB 4JGGA 3TD9A 2AI3A 2OGWA 2V6GA 4PC6A 4IFIA 4BW9A 2JIQA 5ALLA 3D0OA 3WE7A 4CQMD 4HHEA 2VT7A 4H60A 3PXBA 1Q86H 2IUFA 4TMTA 1XAJA 1QORA 2UKDA 2V7QG 2ZWAA 3ORHA 4US1R 4ZXFA 3USES 1GFSA 3CVJA 1MQSA 4GX0A 1Z0UA 1VGQA 1YC5A 1IJEA 1JVSA 1QCYA 2YOFA 3BWYA 4M1OA 3ZZUA 1J00A 3KPVA 5TPZD 1PVDA 3TK1A 5BT9A 1Z13A 1SG0A 2O2ZA 4NVRA 2IQQA 2DT8A 7ADHA 5H8WA 1MC4A 2R8PA 5KNCD 4MUIA 1SXHA 2VXCA 2Z04A 5FUWA 4KRYA 1SKQA 4PG5A 4WAUA 4X8OA 5FUYA 5B58T 3VSDA 3PEWA 3VMFB 1H38A 3UF0A 1MO4A 2PUHA 3L7LA 3EODA 4YP6A 3AKDA 1XEAA 1O7JA 1YJXA 2VUHB 3G02A 4PQFA 3APQA 1DG1G 3HKEB 2H8GA 2R6AA 4Q0MA 4DJTA 3OTFA 2SBTA 1U2TA 5CDFE 2X0RA 1C2YA 1TFUA 3R8FA 3DSQA 1ZGBA 3BMOA 4Q3NA 5KYUA 2PUEA 4H17A 2Q28A 4BTEA 4TQ9A 2UYNA 3ZHZA 4DV1O 1P1KA 1VQ4F 4MVWA 3OOYA 2HFJA 2HX0A 2ZRKA 2FJ0A 5JPCA 4G24A 4MSWC 1RCUA 4FZ1A 1G3MA 4TZTA 2H2FA 1F20A 3QVJA 3MG9A 3W6NA 1R3JC 5DB4A 1P1HA 3ORQA 1N9ZA 2QM8A 4NU8X 4IINA 3VKWA 5HIAA 4BIIA 2D1RA 2FWBA 2WQ7A 1ESCA 3F73A 1IVNA 3RS4A 2Q5EA 3U4HA 4RETA 2BZSA 4RCVA 1Y5RA 2ZUWA 5K20A 3OTIA 4PYRA 3SF0A 5BRJA 3MHSC 4NIMA 3ZDFA 5C8DA 1JXAA 5CH8A 1VQNF 2PQ2A 2E1RA 2NACA 2ZJOA 4UEKA 4TWJA 3NNNA 1K7EB 3BD7A 3NEJA 3DWIA 5FBVB 3AHJA 3WQHA 1BVHA 4QNRA 1CB7A 3M5DA 4V2UA 4EOGA 4B3GA 1ZD3A 2FPPB 2I3BA 4MYSA 1WP7A 3AEKA 3A7EA 3ELCA 3EXFA 3T1HO 3HLTA 3IUQA 1M8KA 2H1VA 3CZ5A 2Q1YA 1DG3A 4Z1VA 3IL2A 4ZOCA 3TSAA 2IW1A 2OAGA 2QN7A 4CMHA 1T5OA 2YZNA 3OQNA 1B7GO 1EX9A 3UFXA 3QUQA 4ZZIA 5FOXA 4Z3OA 2B98A 1EJ2A 2ISQA 2G1KA 4UHBA 2JGUA 3DOIA 3EZYA 2F9LA 4ARZA 2Z01A 3FG9A 3K58A 2DQKA 2UYOA 3IMKA 4LXIA 1E18A 2W2KB 3DAOA 2PX8A 4RCYA 1P3DA 5HTOA 3RFUA 1BWQA 4C2AA 1Y80A 2YIDA 1LFDB 1RABA 2C5BA 3K59A 3EN0A 3KHUA 1U8CB 1J06A 4DIMA 1HDGO 2QRKA 3KTDA 5TDHA 1JLMA 2G9UA 4HGPA 1NF3A 3G3EA 4RQEA 1HM5A 1WZUA 2IXEA 5KU7A 5ECGC 2Q5FA 3K14A 5GMOA 3ZDBA 1NI5A 2P2ZA 1JY8A 4GRDA 4F1KA 2OGZA 2CCKA 2VIIA 4XGQA 1L5OA 2H8KA 5GONA 1GCGA 3M7MX 2RGYA 3QJYA 1Y37A 4INOA 1SVUA 1TUGA 4ZHVA 3FB5C 1D2RA 1U28C 2CYCA 1TOAA 3FMOB 3P5SA 1EFPB 4AK9A 4FI3F 4PG6A 1ZNZA 1KHTA 4ZAGA 3HU1A 1NQOA 4J41A 3R65A 2DQ4A 2P9HA 5ALDA 5JS6A 3BN3A 1M2FA 4NS4A 2WC1A 2EIJC 4QBIA 2FSFA 4WASA 1K5PA 2MDTA 1NW4A 2EYQA 3ORYA 4OFZA 3BE4A 5F76A 5CDFA 5JYDA 2CVHA 1AB6A 3C3SA 4IJUA 3S2EA 5IH7A 3L4KA 1THGA 2XE8A 4OAQA 3NQ41 2WU0A 4YAJA 2AFIB 3EIHA 4OH1A 1XLVA 3TJZA 3JAKA 5BW8A 1I80A 3RQSA 2NMUA 3CKYA 1N0HA 1ZWKA 2G8LA 2AOTB 3AOEC 4FU0A 4UAGA 2ZTUA 2G9RA 1QBZA 2YZ7A 3MRVA 4PFQA 5HF8A 2ZSEA 4P0TA 3R7DA 1YMVA 2F9FA 2YOHA 5ITVA 2QN6A 2DY1A 2CSXA 1SVSA 1IEWA 2FN7A 2Z09A 4V1CB 3E81A 3SLRA 1YD7A 4U7OA 4CIYA 3P4XA 4K0RA 2A9HA 3LPCA 3KP1A 4P30A 4GPZA 3T7AA 4GICA 3OO1A 4BQFA 1LPAB 2UZAA 3G6WA 1XMIA 4X0EA 5D2CA 2YYZA 1EZ4A 1R00A 2I6GA 3GAZA 5CB4F 1EJ0A 3THYB 4OOEA 5DGDA 3UFBA 4JI5B 2CHEA 1WM1A 5ESDA 1ZNQO 4G0QA 1O6ZA 1C7ZA 1YCFA 5C34B 2QTOA 1QGYA 3RT9A 5M2QA 4KH0A 1B8UA 1IB0A 1UEJA 2FWIA 1OJHA 5IBCA 3EXHA 3H3FA 1T9CA 2AF3C 4RH1A 1P3Y1 4LK3A 1AS0A 3KVVA 5NLLA 1Z7EA 3EZLA 2YMMA 3ONNA 2HP0B 1F6BA 3GHZA 5G2OA 1F12A 2WAYA 5KC9A 1SQ5A 3GLHB 4MV0A 4PSAA 4LQDA 5LGUA 1A4IA 1UFVA 2PKEA 2WFLB 4RJLA 2NUAA 2H5EA 4QL3A 1KVTA 1QIFA 1CCWA 1XMQO 1XEFA 4BL5A 1VC2A 3FNRA 1PL4A 4V0OA 4E08A 2X8JA 1IG0A 1JHQA 5BOVA 4D7AA 1DXQA 2PX2A 1P3JA 3EXEB 3IJRA 5FH9A 2P0EA 3LL4A 1N7HA 3JQAD 4PLGA 3REQA 2K87A 2NU7B 4PX5A 1KC8W 3AY7A 5DBGA 4AZVA 8MHTA 1E1QA 2Q8QA 1IY8A 1ORWA 3F46A 2EBHX 5CVEA 4PAWA 5A4DA 3O8QB 4LOHA 1Z63A 4DCCA 2WKPA 3CZ4A 2Q5IA 3BOSA 4QUDA 3D31A 3LQFA 2BGRA 3DP9A 2OIEA 4L7VA 4KAFA 4TYMA 5D86A 1QDUA 3IOYA 3HR8A 1PS8A 3JQ7B 2Q3DA 4C8EA 4C81A 4KXFB 4GX2A 2FXIA 4NBSA 5HG0A 1KEEA 2Q0OC 5I7HA 5E4TA 4BVGA 5L6LB 2ZBUA 4GRAA 2O1WA 4IVQA 4LSZA 5CHEA 5A3QA 5IDVA 1VPDA 1NW6A 4XWTA 3EW7A 4Q9JA 1FP4A 2CNWD 3WB1A 2YTZA 3RN4A 3OLCX 1VGVA 2FMFA 3OZAA 4PF1A 3FLBA 4JC5A 3ZE6A 3EUEA 1CLUA 3GUUA 1PQPA 2D2CB 1E1MA 1RYBA 1GDDA 1S4MA 3LUCA 3Q6NA 3HQ4O 1JQEA 2EG5A 1TT5A 2J6IA 2ZBDA 4QU0A 1TAEA 4Y2JA 5EXDA 3DWEX 3CC2F 1KVRA 4LPKA 3BRCA 5HW0A 4Q3AA 2FJPA 3ZEAA 3PHGA 1RKVA 2HQOA 3CIOA 3MOIA 4KV9A 3T06B 4WCVA 3RJMA 3UHJA 1PUXA 1ZCFA 4D8YA 4MAFA 5K0EA 4NV0A 3DF7A 2EIKC 3LOQA 1JSXA 2DLDA 3HNRA 2ECKA 2RGNC 3OWHA 3MK31 4H3VA 4HQNA 4LX8A 3ZD7A 1JHPA 1L7VC 5K4GA 1H9CA 1A9SA 3SLGA 4HDMA 4BFCA 3FCYA 4LXGA 4N3GA 3JQ6A 1PV1A 2B69A 1ADFA 4KG7A 4E03A 1MABB 2CCGA 3R7SA 5GQSA 2BKXA 3KOWA 3HFRA 5FOTA 4PW0A 1QXSA 2IA5A 4U7NA 3DMNA 5J4VA 2Z6AA 2G25A 2ZJ4A 3IESA 1OGIA 4WBXC 4ZQFA 4V02A 4MLZA 5GOTA 3AG3B 3OE7A 4BVSA 3EVDA 1PGNA 2PRIA 4DSZA 2Q0SA 4EY6A 1I7PA 1NN5A 1PR1A 1XTVA 3KT0A 4UMDA 4QKQA 2NQTA 1ZONA 4KP4A 1XTIA 4F5DA 2JDID 3EVGA 4R7GA 2P90A 2Q6IA 4LX0A 4DAOA 2MQEA 1S4QA 1SBIA 4IEEA 3HWWA 4JOQA 5A1TA 4RE5A 2WV7A 3TLXA 3AVWA 3ZHTA 1QWSA 3MOSA 3PXDA 2M32A 1E6UA 4RU1A 4DNPA 1L4BA 1Y5LA 4I55F 1N8RW 1UPTA 2IY8A 1AJPA 5L3BA 2J0UA 4EFBA 2UZ1A 5C2JB 2Z5GA 3FVWA 3JW8A 3CCUV 2XHEA 3OECA 1TQDA 2N04A 3A1FA 3R41A 4Q1FA 2ZR2A 1X1CA 4TKVA 1IN1A 1YQDA 3TQTA 1EK0A 1YS9A 5DM4A 5EOVA 1N2OA 3W9UA 2QYSA 1OBCA 4EI2A 2HP8A 2O8NA 1WXXA 2BMFA 2XCOA 3QA9A 4G25A 3AF3A 4RANA 1Q95A 1SD5A 2PRJA 3K4HA 4BO7A 5T3YA 1J8MF 3VVLA 3N9IA 3K71B 3H6GA 1E7SA 2OC9A 4PLPA 1W42A 1DJLA 1JJFA 4DABA 1Y9JA 3PEFA 1JIIA 1S5JA 5DHFA 1Y4SA 2C83A 3L7KA 5EJ5A 5JCPA 2JLVA 1OYYA 1H2GA 1E6EA 1P6XA 3H2IA 3N0TA 4LYAA 2P7TC 1J8DA 4AI6A 2HF7A 4B85A 3ABMB 6NULA 1RR6A 2FPIB 1RLJA 4BIUA 2AXQA 1P2FA 3GGPA 1RNLA 2VWHA 3HV0A 3OTQA 4QPDA 1Z7GA 2P2CA 4LISA 4P2GA 3K20A 1IXBA 2HJSA 1GL9B 1Q19A 1W581 2QV0A 4HNVA 4TS3A 3H97A 3G8YA 3DMHA 1XVIA 1BGXT 2WKQA 3FOCA 1B0PA 1E1CB 1SPBS 3KJNA 3PT5A 3HN7A 3R5HA 1GFIA 4UUMA 2XCIA 3O38A 1N6PA 2VP5A 3FX2A 4Q6WA 1VIYA 4QUGA 3UKDA 3WL3A 5JISA 4ML3A 1AE1A 2WALA 3AGKA 1VQPV 3NC1C 1Z34A 3DMYA 3VNVA 3KOMA 4D9JA 4J0CA 4AMGA 3WJQA 1CIVA 4C7VA 1A9XA 2IT1A 1J56A 1EE1A 1L8OA 5A4IS 2HRRA 1ECPA 2Y77A 4N6NA 1S9HA 2QTGA 4FLYA 1G7SA 3PUIA 1QAOA 2H5LA 3IBSA 2RE8A 3ZGZA 2FDXA 3KS9A 4KYVA 2Z0AA 3P9NA 3ZPXA 1DGQA 4MITA 1MENA 2FPUA 3N8IA 3AFIA 3RR2A 5BSRA 5BP7A 3DBHA 2B0JA 3DPSA 4X8LA 3WA6A 3ZQJA 3DXRB 4Z0HO 3N2KB 1L5VA 2O23A 3VYSC 3EEOA 4D02A 4KQ6A 1PBNA 2NO7A 4EB0A 3ZJUA 1ZYUA 3DGEA 1ICEA 1PR0A 4LF4O 2J87A 3GMTA 4NOJA 4P54A 2WZBA 2PWYA 4FE3A 3O94A 2FZCA 3EFHA 2PYIA 1VE1A 3ESZA 2IOHA 2AN9A 4P34A 4XOUA 3DDSA 2WPDG 4XEUA 3FJ1A 3L6RA 2QAGA 3ZXIA 5A0VA 3UENA 3LWQC 1RQ7A 1HE2A 2YASA 1UBFA 1TU0A 2N0SA 3FYDA 1GAJA 2NT4A 1FFTB 2E1PA 4OQPA 2I29A 1PJAA 1TDJA 1XBTA 3G2NA 4CR7A 3PDHA 2R0QC 3ZOZA 2Y4UA 4URZR 5HRAA 3MTDA 3LCVB 3SJQC 3KQHA 4JI2O 2HOQA 4FGSA 3VC1A 2EKPA 4YRFA 5JQGB 2JGIA 3IRVA 2PUCA 3WQRA 3ROFA 2HO5A 2ISSD 2J3DA 2ZJ1A 1QKKA 4AILC 4GD3Q 4YMSA 1UJ6A 3REGA 3LWNA 3I7TA 2QX4A 3RS5A 2HRYA 3DOUA 2IITA 3LUGA 4I8XA 2JB9A 2C2AA 2XA2A 1YHNA 2FFHA 1JD1A 1IOZA 3LQKA 4TXNA 5FQOA 1GZVA 1WY5A 2GILA 1C0LA 3BIOA 4C43A 1SKBA 4S12A 3Q7EA 3M7IA 2OQIA 1SC5B 2H65A 2Q4EA 2YVQA 3UH1A 1Q6IA 2AYXA 3UM9A 3RVLA 4I2VA 2PCLA 2WHPB 5G1OA 4D42A 1FS6A 3UHOA 1JHZA 4IKPA 1XBIA 3CEAA 2NO9A 2O2SA 2PSJA 1U81A 4HZGA 5CM8B 3WLEA 4EYGA 1HDZA 4IL5A 4AKHA 3DLAA 3HI6A 5EZ6B 4YYZA 2V45A 2CHUA 4NBTA 3SC6A 4EFMA 4HQKA 3EDYA 1W1WA 1NE7A 5AI6A 1DV1A 5J2UF 2O7VA 5BUZA 4M9ZA 1NSFA 3FMIA 4NH4A 5LA6F 3W0LB 4ZC8A 4QECA 2JLUA 4A1FA 4C8GA 3OQBA 4OHXA 3B13B 1UBMS 4B4VA 1Z5UA 4HB3A 3LX4A 4JI0B 2R47A 2HMVA 1Q8IA 3ROMA 2Q3EA 1QHXA 1EVZA 3HB1A 1XD2A 2I4LA 2TMYA 5LQDA 1MKYA 3BB1A 1RJFA 4G67A 5BY1A 2CLOB 2P2YA 4OI2A 4Q4AB 5TEWA 5THKA 1APBA 4H33A 2K4MA 5JY1A 3IO5A 3K6KA 1KDOA 2CWWA 3RK1A 2C94A 2OILA 1SVKA 2Q3HA 1IXRC 1GAQA 3LXXA 3RRYA 4L5IA 1XV2A 5F52A 2NV2B 4TTIA 3RNLA 5EPOA 4EVRA 2LPMA 2PO5A 3TUJC 2BGGA 1EEHA 4WT7A 1Z22A 4J3FA 3OCWA 1HURA 4EAAA 2QEXV 1O9BA 2DG2A 1IUPA 3LDDA 2AZDA 3VOAA 3Q3IA 1GCUA 3E7PA 1PZEA 3KYBA 4HYOA 1QAHA 2X3UA 4QBFA 3VPFA 3WJ1A 2XCTB 4OQ4A 3NBXX 1NJ1A 2NSJA 1PG2A 5PNTA 1OI2A 2F17A 1XF1A 3R3JA 3WXMA 1U0LA 4I9UA 3FLMA 2V7BA 4FNAA 4TTAA 4ZRMA 4NXNB 2A78A 1TCCA 2QX8A 2JNBA 1BO6A 2F00A 1P72A 2EJWA 2VLBA 3N7AA 3I01M 4R9SA 2FPGB 1W30A 1EAMA 5DU2A 5LBIA 1O95D 1PK8A 1RM0A 2OVBA 5JDCC 4CWAA 4RPIA 1Q1EA 2WIBA 3B2NA 3OPVA 1QAMA 4ZU1X 3FYIB 1JDBB 3EWSA 4EGCB 2JKVA 2OT5A 4K05A 4M87A 5AQEA 4HRYA 4J0HA 4J7XA 4LDAA 4FFKA 3TSZA 1BMFD 4J1QA 4BT5A 3RC7A 4X1YA 1US6A 2ALEA 2BELA 4IYJA 5FCDA 4NXNO 1NVFA 4EPVA 2ZJ0A 3LVFO 4Z9YA 3NPMA 3GOQA 5TX7A 4NNJA 1GIAA 3QBVA 4OP2A 4XPIA 4TYWA 3GRAA 2DQZA 3PFNA 4MVCA 5JZSA 2M1XA 4E15A 2HCFA 2IHNA 5BV7A 4EL5A 1PZNA 2LV8A 2HFKA 1LSJA 3CR3C 1GQRA 2BCCH 1Y5MA 3RS7A 4MVSA 4CM6A 2YFYA 4U8HA 5LD2C 3M3HA 1W87A 1V35A 2YHBA 3ZKAA 4FVTA 4RZHA 1MZEA 4DMUB 3OQOA 3CC7F 3HAXD 3WAKA 2PZJA 4QVGA 4OGGA 5ALVA 3U09A 2YY7A 5E38A 2ZYTX 4LXXA 2BJWA 1AKWA 1JU4A 4WCFB 4A0SA 1QK3A 1HYGA 3RU9A 4LVUA 4Z1MD 2FB5A 1J0EA 2UDPA 4MIYA 3GQBB 1B04A 4X88A 1SN7A 1T9BA 5IMSA 3HKDB 3E0XA 1Z07A 2OE2A 3H7AA 5F78A 3IFSA 4HH0A 4HFJA 4DEYA 3W2HA 2AXPA 2YVUA 4PHCA 1CEXA 3OUSA 1YJ8A 4FOSA 3U3DA 3A31A 2L26A 1CDEA 3LT0A 2HJGA 3MWGA 1M72A 3RLFA 1F1JA 3KWLA 4OJMX 4TQAA 2PUSA 5DRTA 4BOYA 4L02A 2V4UA 3D5TA 3NJ4A 3BILA 2C9YA 1REQA 3QHQA 8ADHA 3ICQB 4GG1A 2NSYA 2WJVA 1Y6JA 5BNZA 1PO7A 4KPUB 1I6KA 3EFOA 5LM3A 3G7NA 4JV5O 2PPLA 3E9MA 3JVEA 3OM9A 4RKFA 3CH6A 3IAS1 2YY6A 3HUUA 1VJCA 2QUBA 3DV0A 3FB4A 4XFDA 2ZOVA 5H80A 3WO0A 3QVGA 5KQMA 1L4MA 1BG6A 3AR8A 4QDTA 4EA9A 2IUTA 1TX4B 1QANA 1WMDA 1XAHA 2Y0IA 3QEJA 1PG5A 3FX7A 1D3AA 5DN6G 4OXXA 4DV1B 1D2AA 1P39A 4QQFA 1NM5A 3BWEA 1SXGA 1CP2A 2ZJ2A 4NE7A 2PEYA 2WUFA 2DYSB 4B62A 3LSYA 2W2OA 4EJSB 3T1OA 3A28A 2ZZNA 3L4JA 3IP5A 5ICCA 3QUAA 2VL7A 5E1DA 3CLHA 1AG9A 1Z83A 2GN9A 5AO9A 3E18A 3W6PA 3QK7A 4RE6A 5IKPA 4E7PA 4IICA 2PYDA 3IKVA 4HTAA 1Z7WA 1FVFA 1TNDA 2GEUA 4B83A 3GFPA 1NP6A 4RHEA 4DSNA 1B0AA 3VFDA 1KEWA 4GL2A 1XZAA 2XT0A 1ZGGA 2QYOA 3IERA 5ISMA 4HI0E 3OC0A 1CR4A 1TQ6A 3CJQA 3E8HA 1PWXA 1JQJC 1CG6A 2GR9A 1UFOA 3VDMA 1J42A 4CL2A 3IOBA 4TM8A 3CCRF 2G0AA 2ONCA 4IUDS 3TG2A 3DBRB 1YONA 3G1WA 5DK6A 2OV6A 3H8JA 5ALNA 5TPZA 4GEKA 4AO7A 2MTBA 4WL0A 3RKRA 1EP3B 1P0QA 5I7RA 1H2ZA 4I19A 4EA7A 2GLUA 2RGGA 1EP9A 1T2VA 1J7KA 2B7LA 3HBMA 2VAVA 2PZGA 9ABPA 5FV4A 3C9TA 4XDJA 1JS1X 2HQ1A 3CZQA 3OTOO 3NK6A 2BEKA 1GLGA 3K0HA 2A88A 3EASA 3FDXA 1XZKA 1G4AE 1NR1A 1Y66A 1L1RA 1Q50A 2BEVA 3R3XA 5SYMA 2X8AA 5FEUA 1Z4NA 1VE6A 1X42A 2AFRA 5CYPA 4B87A 3L7BA 1RADA 3WC4A 1UM9B 3ADBA 5FPQA 5TMDA 3HCFA 4AKGA 1S3JA 2O8BB 1ZUNB 2MR5A 3G71V 2VNSA 5B1OA 4J76A 4RNCA 3L93A 4I1VA 2IS1A 2F62A 1V5GA 2GHIA 1SZCA 5J5AA 1UZNA 1C3JA 4J42A 4BNLA 6REQA 5L3QA 4OSOA 3BTOA 5B57C 4QTUB 3PLAC 4UHHA 1UXIA 5DV9A 3SFTA 5HP8A 1XRPA 2PD4A 4TVSA 3B7PA 3RPEA 4I9GA 1VRWA 4TMFA 4PYMA 4EHFA 3KM0A 5JSKA 4DYLA 3EY9A 5ERXA 3UK2A 4LNUA 3AJDA 1TF5A 1AQYA 4LWZA 5EA2A 3SU8A 2G7MC 2MMCA 4YPFA 2BONA 2OP1A 4GFDA 1TMGE 3C5VA 3AKZA 5C18A 5A4KA 3EAQA 2HCRA 4BFXA 4IIFA 1QTQA 3DAYA 3UHPA 2V6IA 4ON9A 3UMGA 2I2WA 1C1DB 4YQYA 5GZ1A 4FDAA 1JWLA 2PY5A 4FR2A 1IZ7A 2I99A 5CMUA 3ITEA 4YRZA 3GLIB 2HL6A 5ILOA 1VQPF 3B52X 2RSLA 3B3FA 1GL6A 3QPBA 3EPLA 2X3FA 4WUVA 1LGYA 3ET5A 4HO1X 4PU0A 1HNXB 4M8SA 2H0RA 4TRMA 4MHTA 3MBKA 3CRMA 2NO1A 2GAAA 1YSCA 4O5OA 2ZYDA 1U2DC 2WSIA 5AOBA 4OHFA 1FUEA 2HK9A 4WOPA 3GT0A 1WCWA 3A2KA 3H18A 4Q4DA 2ZS8A 5I7AA 1EA7A 4QQNA 3E2EA 4E32A 1VE7A 2H94A 3DB1A 2GNAA 5IK2A 2ZUVA 3L0IB 2ZR8A 2TYSB 3H65A 1I1HA 4G4GA 2PI5A 5BQXA 1V7QA 1FJGO 4Y2QA 3QF4B 4HLDA 5EE9A 5JAUA 1BZYA 1WD7A 2FHSA 2P06A 4YRBA 3TTSA 1K75A 3DO5A 1TLFA 4BIZA 2ZWIA 4IMPA 4LOIA 4EGFA 2NZ2A 3CS3A 1CZRA 3K5HA 5IRCD 1KQOA 3K70B 1NZ6A 1I3KA 1AQLA 4DV3B 3A0RB 2AUMA 2GYWA 2QV7A 2XNSA 2HV9A 3AERA 3VR5A 3EPHA 4YASA 2XXJA 3C1AA 2QP9X 5DN6A 1PN3A 4E5MA 2JEUA 1U9ZA 5I4KA 3CCEV 1G60A 4LF4B 3FB8C 2UYKA 1RI1A 2O05A 2P27A 1L5MA 2IV7A 4JTDB 1U0JA 3A6LA 4ENRA 2ORYA 1G8KA 4QTXA 3SYNA 4U5XA 4XWAA 5CDSA 2QMHA 3GGJA 4URVR 4OKNA 2VQFB 4ASUA 4DWOA 2OFWA 4WZBA 4QOEA 1P7PA 3ZZ1A 1FRVA 2CNLA 4RZIA 2OLEA 3GNTA 2NXCA 2XD4A 1FDUA 1NF9A 3S1AA 1T6XA 2Q5LA 3D8NA 4J91A 3DBIA 1VPVA 3DBVO 3DO6A 2Q3LA 1AZWA 4J6FA 5EUBA 1B23P 4M1KA 2ETXA 4CM9D 4JC0A 2CH7A 1U1IA 1KETA 2LTAA 3HUDA 1VTKA 4J7UA 1JAYA 4CV0A 4DG5A 4B3CA 1E1RA 3WLIA 1AK9A 3QKWA 3D0RA 3W1WA 1O5IA 1G66A 1YOVB 3CRAA 5HKLA 4BBZA 4CCYA 4WFAV 4OF4A 2ES4A 2J9GA 4P4UA 1O95C 4DY6A 3ZVNA 4XARA 5I7EA 4FHDA 3P5BA 1JCHA 3K0AB 3BL5A 3AQ4A 1ZY2A 5JAOA 1E9FA 2OQ2A 2Q5CA 3IKLA 4K3VA 2P7IA 2HRDA 1PJQA 2Q7OE 3UK1A 4LF6B 3CCUF 3SQXA 1B41A 3F49S 3SJBC 4CBVA 1E6MA 1I33A 3TLKA 4II2A 4ZOBA 3WKAA 3DA8A 1HOTA 2CCJA 4B6SA 3AU9A 1SQQH 4FPPA 2GQ0A 4G5YA 2A5FA 2AOTA 4Q21A 4W7HA 2NVOA 5CBKA 2DM6A 4JGIA 3BMQB 3TIIA 1ONOA 1FFDA 1TK9A 3X1MA 4A8JB 1MGOA 1KI1A 4P98A 2FV8A 3ZE1B 1V1MA 3QBTA 1GA1A 1SBYA 3CINA 4ES6A 2MSNA 4QXMA 1OB2A 4RL4A 1E1YA 1FBNA 1MUUA 1ACMA 3DT6A 2OCDA 3AK4A 5EC8A 4HUQB 2R7NA 3MT8A 2XTAA 3N59A 3GPIA 3PR2B 3RS2A 4AZWA 2HXYA 1OH8A 4JUDX 4BNGA 2X2PA 2W8BB 1P2BA 4DPLA 4M0UA 1WG8A 1QQAA 3BD8A 3USCS 3GLGE 4H6XA 4WECA 4D79A 1ILEA 1HNWO 3L8YA 3NYWA 2P7HA 3GARA 3NM6B 3DGFC 4RUKA 5C35A 3ZI0A 4JX8A 4BUCA 3ZP7A 1JDNA 2R70A 1OXKB 2E82A 2GEDA 2J3KA 3I3SR 4OQDA 4B6RA 2R79A 4DR7B 5A7GA 3AIOA 1QH8B 3H3XA 1J9GA 1IQPA 3CC4F 2GN4A 4TRRA 1Y1RA 4EF5A 4BFUA 2QVZX 5U9CA 2VSXA 1MG0A 3C14C 4F6CA 4K9NA 3RCBA 4AJ4A 4HWPA 4IIYA 4XW2A 4QEDA 1FQWA 2VDWA 5TF0A 4CUKA 2AJ8A 1MMFB 2PS1A 1SHJA 3QTTA 1EDZA 4XASA 4BC0A 1MVNA 4NYKA 3VPGA 3WLMA 3BFRA 2XVMA 4WERA 3HY3A 3ZQUA 2O7SA 4D0NA 1P1IA 4JJ4A 2A86A 3R0QA 1X86B 4JL8A 4BATA 2R44A 1ZKMA 2VWJA 4ND1A 4CFSA 1ZM2A 1DSSG 1F6WA 1Q7TA 2X4IA 2GS9A 1TPZA 4EPXA 1O8BA 3QVXA 4TM7A 1I2AA 4MVJE 2W6CX 1N7JA 4B3TO 1JEOA 2CT8A 1A9RA 3CCVF 1Z3CA 2FB9A 3T7CA 3I61A 4ZAWA 1FFYA 1LS6A 1IZZA 1Y9EA 2OORA 2GEBA 2A0WA 4MVJG 3MLEA 4IV0A 1J2TA 5DBOA 5K1ZA 3WP0A 1AS3A 3MUEA 1BX0A 1RC1A 2BMJA 2A1UA 5M29A 4Q3OA 1KK3A 4G26A 5AI8A 3IT2A 1CQIB 3OE7G 3BC1A 3GAAA 2HNAA 3HHPA 3WWCA 4DCTA 1ECJA 3QVTA 1IATA 5BWNA 2VF7A 2JJQA 3I4LA 1KI8A 3ASUA 3CF0A 5C1OA 3SG0A 3NIFB 2A9KA 4X9XA 1TYDE 2VZ0A 3BVOA 4GYCB 3VIUA 2GKGA 2PSEA 1MB3A 3X2QB 1NMXA 3GZNA 1ZH8A 2AMVA 1L7NA 3PA6A 2OHGA 3KSAC 3HBLA 1CNMA 3OOHA 3BL8A 2G8NA 4MKZA 1M2OB 4RY2A 1L5KA 2OKGA 3BF7A 5E2BA 4TWKA 1ZXLA 3HJFA 4K5QA 2YWFA 3B6KA 2OHJA 2O5CA 4KXLA 5I4CA 2WLMA 1UK9A 2B5VA 5I7WA 2QUAA 4U6QA 4IOMA 3MAQA 5JW6A 3EHDA 2B7CA 1VE9A 2O8EB 2PT7A 4C4WC 2HK8A 1C30A 2OO3A 5F33A 2JGDB 5FYQA 3D54A 4JPRA 5FOQA 4MI1A 3I9MA 2G80A 1AKYA 1MABA 4PA6A 1YR8A 3DHEA 5B1HA 5T41A 2RGDA 3JWGA 4EQZA 4DEVA 5LP6B 1OFGA 1E3QA 3QELA 5K0FA 1DZ3A 1OWOA 3RJ9A 1WW8A 4XJTA 2XSZD 2XAAA 4ZAZA 5CCEA 2BAGA 4QLOA 5TLSA 1VA4A 1R9NA 4FPXA 3E5HA 4MVJA 4JLJA 4HDSA 2XYVA 2MYPA 4C6RA 2X77A 4FSXA 2PKRA 3T94A 4UXIA 3E8GA 4BO1A 5KAPA 3VO8A 5LQAA 3ABKB 3TQSA 2KE5A 4AXBA 2ZJ6A 1KHHA 2PUAA 1PVOA 1RIIA 5JNWA 1FXWA 3SHWA 3D8SA 3PBKA 1SESA 1I13A 3LA8A 4BP9A 3FTFA 1WB7A 1XC7A 1ZIYA 1RM1B 4U7HA 4NUTA 2R5FA 2AXTZ 4N21A 1SIOA 6LDHA 4YV0A 2WWGA 3PPIA 3QU5A 1NLUA 4IWXA 1KIMA 3IT3A 3L1HA 2LIPA 2XXAA 1HWYA 2PI4A 2C9OA 2FFQA 1AKQA 1WABA 4GX1A 3LXMA 1K8AH 4YAOA 3T9DA 3ZIDA 2XGJA 3WSTA 2WJJA 3HVHA 1F8XA 3PWSA 1JVBA 4X24A 4YXWA 4A1OA 3E3MA 1Q17A 4WBNB 1GR0A 2H07A 2CHTA 2W0MA 3K06A 3CHXA 2G28A 2YHUA 4OHOA 2H9AA 3LP8A 3VJKA 5EMJA 1ZAYA 1ISGA 1U8EA 1C3EA 3AJRA 4LYFA 4MVJM 3N6RA 1W6UA 2XBUA 4MS3A 3I4FA 4RVOA 3W8FA 1SRRA 1RKXA 4N41A 3H5AA 2VJNA 4U7PB 4FFLA 5FDFA 3O82A 1MX3A 2JAQA 5F7XA 1NY6A 1ZISA 2GZHA 4G4IA 2GLXA 2YDYA 1KBHA 4GM1A 2YS8A 2G9ZA 2PU7A 3I9OA 3MS7A 4JVMA 2X7HA 1X0VA 2CEKA 4D57A 1Q1AA 2PGNA 4KO3S 4JI5O 1PFWA 4KVZA 1VMDA 3SM3A 2RGRA 2L6LA 3DKVA 1V11B 4GBGA 3UQZA 1TVKB 1QF9A 2VWGA 4AWAA 2JD0A 3NX4A 4FXOA 4OJKA 1Z75A 5KMGB 2RGAA 1U0RA 1ZM7A 4ZTUB 4LYEA 1JI3A 1AZLA 1K97A 1H3NA 1SHUX 1V8DA 1E9EA 1VKNA 1XQ9A 2AFVA 3NRCA 3ZIAA 4BYGA 5LN1A 1UMBB 4WPGA 4U2DA 1V37A 3OZDA 3SZLA 4FYJA 3K5NA 1PXWA 5LWHA 3DKPA 3DLPX 3YASA 1PD1A 3K32A 3E22B 1K66A 4M98A 4Q4JA 3FFMA 1X8XA 4ZGGA 2A0UA 2V8OA 4EDHA 2Q4RA 3LFTA 4UEWA 5ICEA 1IB6A 3GDOA 1C80A 3H05A 1PM9A 4D7SA 1VQLV 5CXXA 3GLFE 4AMZA 4WCEV 4MQUA 4EFEA 1BE6A 1E0KA 1G0OA 3AVOA 3VKGA 2AC7A 4MR9A 3KU4A 3EQ2A 5EY5B 5IT0A 1G0NA 1X77A 2X40A 3OU7A 1RWNA 4RC9A 1AGNA 5DLEA 5KNCA 1BMFA 1UBKS 3HE3A 2XOKA 5JCJD 4IQGA 3CNBA 5IVDA 5LDHA 4LOAA 5KAFZ 4KK3A 1UXKA 1EVLA 3L7JA 3CV3A 1E7KA 4U6SA 1GTL1 2VT6A 5DWDA 3QE9Y 1QWOA 4OA5A 1FP7A 3Q8MA 2G9NA 3W2EA 1Z2AA 3HGTA 1H0RA 3IALA 1M1NA 4KXYA 1S3FA 4XJSA 1WXIA 1O94D 4KK4A 3SEZA 3WMGA 4E3WA 5JJIA 4RS4A 3ECSA 1Q82W 3RJZA 1FRNA 2FWAA 1GTVA 3BDIA 1P8AA 3IQXA 2HA5A 1J49A 1X9HA 2ZKLA 4UVHA 2WWVD 4OQEA 1JEJA 3RHSA 5ITSA 1P4RA 2WD9A 4LF6O 3H84A 4WXEA 4V0NA 4Z7OB 4XRRA 1WDWB 5IDWA 1AXRA 1G41A 5MN4A 1G8FA 4OXYA 1SJ9A 1E0JA 1RE0A 2AFHA 2BF4A 1NBMD 3I6QA 1DK1A 4PFKA 1ECCA 5GZ6A 3FTEA 1TK3A 1ZGHA 4LXQA 1POXA 1NU1H 1D1PA 2WNHA 3Q87B 4WF9V 2G1JA 3LW7A 3OZVA 4R69A 4DIFA 4DMMA 3A6FA 5CH3A 3I5DA 2P9CA 3TI9A 3D54D 2CMKA 5BR4A 1ITZA 1OLSB 3CVYA 1JDVA 1KEPA 3OEHG 1IM2A 4PS1A 3CCEF 4BLTA 4KIUA 3L04A 3G4SV 4M37A 1NTRA 2XNKA 2UXBO 2E87A 3U4AA 4BCBA 3ASNC 1FRZA 3WGIA 3AEUA 3FM9A 2VZ9A 4HEJA 4JB8A 2NTEA 1TYAE 3MLBA 3URMA 4BN5A 2XJ4A 4CTNA 2FN8A 3IQWA 1W36D 4PO3X 1CVLA 2QWQB 2XWBF 1O6FA 4I4LA 3L6EA 2L17A 3EA4A 4OKSA 2OFFA 4YREA 2DECA 5TQ0A 5C80A 2O8DB 5FBKA 3E58A 1GL3A 2ZXFA 1U5AA 2FSPA 4LSWA 3IEMA 4MA5A 4N48A 1YQTA 5JE8A 1UKCA 2PTMA 2VAPA 2BYTA 5F2KA 1JZQA 5A6SA 1JMKC 3THOA 3SIVA 1OV4A 5HGJA 3HCEA 3QSYA 3C48A 1JEAA 1VIBA 1EVQA 4FILA 4OMFG 4WQMA 2HHLA 2Q6TA 3ZJTA 1SEPA 5ELLA 4HB0A 5CA3A 4IIJF 4LJYA 1SQBH 1Q6HA 2QE7A 1JA8A 1VL8A 3NM4A 2G36A 3FNFA 4Q15A 5JPDA 1PNLA 1RYMA 2Y68A 1SQVH 4IIUA 2BEUB 4YRRA 2IYOA 3G0BA 4UHCA 5AVVA 1IPEA 1HXHA 2CJFA 4FZJA 4Z99A 1QIEA 3SMVA 4RTJA 4OD0A 1NVVQ 3PFIA 5K01A 1T5SA 3RUHA 1RQXA 4BEBA 4FWIB 5KUMA 4LGVA 1RVDA 5AVXA 3HM9A 1QG2A 4P38A 5DEOA 4PO1A 4BCDA 3PWZA 3P3PA 4GPTA 1Z2CA 3P2JA 4V0QA 1UMDA 2P2DA 4B2PA 4DCMA 5MF6A 1ZLYA 2FRVA 3RSOA 4JT8A 4BFZA 3P0RA 3N1UA 4E2WA 2HW8A 5EB0A 3H4VA 4IQFA 1R9GA 1IX9A 3TOZA 1KFEB 1JKJA 4IJKA 3WRXC 5I48A 4OK3A 1IE3A 4MW5A 4NYJQ 3QE0A 3HXKA 1XMOB 3CXCF 4EVIA 2QL5A 1QVFF 5EJ9A 5ALQA 2BKVA 5E7IA 5ICFA 4J16A 2XUIA 4PZUA 4JXXA 2COKA 1TQ8A 1QR9A 3C15C 1V1RA 1G6Q1 3FVTA 1LS1A 4P4NA 1MCZA 1PFUA 2HP3A 1Q7EA 1DQYA 1ORQC 1IN7A 4G1UC 5EYPA 4H1TA 3KELA 4R8KA 4PVCA 4DVGA 3AIKA 3U44A 1U6JA 1UDBA 2C5SA 1FTYA 3PJSK 1TW3A 5E0KB 2HHJA 3KUDA 3VC7A 4XLZA 5E4YA 4G4VA 1RAAA 2EFYA 5U4XA 1ZVVA 1V4NA 3ZO8A 4GH5A 5AOAA 2Y66A 1U2GC 4UZSA 3F5WC 2CHQA 1N2JA 1S9DA 2PTGA 5GGYA 3D1JA 2BP7A 4EL0A 4JROA 2FUNB 1UAAA 1T5BA 3LQQA 2FRDC 5D3QA 3GJXC 5JH7F 3S4YA 4XJVA 3N86A 3ZBQA 1A9OA 2Q62A 2A0FA 2G82A 4CCAA 3SSOA 4CMIA 3HB5X 4GUAA 1G21E 2SECE 4JLWA 4QRDA 1YTUA 2FEAA 2GK3A 1VQ6V 1U7XA 2BM9A 4ECAA 1FNKA 5CA0B 1Z26A 2VCEA 1YJ9V 4UQOA 4AX4A 5HRCA 2QJ1A 1WXDA 2VXOA 1KU6A 3PGMA 1RACA 4YJGA 3W06A 3RRMA 3GEEA 1HQYE 1RQRA 1W0JA 2A8YA 3DQQA 1RHKA 4ZOLB 1L3CA 1RWWA 2BGMA 4KDEA 1KE1A 1F2UA 3LWRC 2UVPA 4BQIA 1EJ6A 5ILGA 4EUEA 3ROGA 1XPUA 3O85A 2YYSA 2ODWA 5F4ZA 4FBGA 4J0QA 3A6PC 4BZZA 1N2HA 1XN1A 1KJYA 1JYFA 1TM1E 4D1YA 2Q3CA 3UHAA 3ZE0B 5FUBA 2DVMA 5KNCH 3Q12A 3CE9A 3ICEA 1RLMA 1N5RA 2QQEA 4TTRA 2E3JA 4B6PA 3T15A 3N39C 4FS8A 1XZCA 2D2IA 2BHLA 2H85A 2E48A 3R24A 2FSHA 4LDQA 1XTBA 4KPUA 3L1VA 4E51A 2OZLA 4ZI7F 1KA9H 3F0EA 1QB8A 3FDFA 4URXR 4N23A 4QNHB 3D8UA 4ZV7A 5LP1A 2A79B 3LUAA 3ANLA 1UPUA 4F5ZA 1Y8ZA 2RD2A 3R9XB 2PMCA 2BFBA 2Y1KA 3FB6C 3MCAA 3PEUA 3LDTA 4DW0A 3OPYI 1SCJA 4HDOB 3PGLA 4J4BA 4KLZA 4XYGA 4D4LA 2ZJZA 1AKMA 1NQWA 3ETDA 1XQ8A 4JYBA 1R0LA 3NPAA 2CD7A 4NJEA 4F4JA 2Y9PB 4XQ0A 4ZVKA 3THWA 2DRIA 4Q1EA 4Z4CA 1OSNA 3RSFA 2R1TA 2QBYA 2F48A 5G0VA 1N6IA 2ZAMA 3FHLA 3WOHA 2FSSA 3I28A 1W1IA 3FCUB 1SZJG 1XZDA 3GT4A 5CNJA 1DQNA 5MHTA 1Z5WA 2VNAA 5TGTA 2CL0X 3SX4A 4LBVA 1V43A 3AU8A 4OXQA 1QGOA 1NNUA 1XLTC 3BJIC 2P69A 1UPBA 1TIPA 3VSEA 4IIHA 1L4FA 2I03A 3MS4A 4LRXA 4CDNA 4GPIB 5LR6A 1DTWB 1XK6A 4I0XB 2Q6LA 4H1VA 4OREX 4MWSA 4DV3O 2EQ5A 3S8EA 1F48A 5DM2A 4UTZA 5B37A 3JQAB 1C4OA 4G1BA 2OECA 1MSDA 1I4EB 3LUBA 4MW3A 4B6OA 2F67A 3DXZA 1D0VA 2IHVA 1OREA 3FH0A 3PB3A 5AK3A 4E33A 5JBIA 1EFVB 3PUXA 2HREA 2B5UA 3TO5A 2AGVA 2ZS9A 1E2IA 2CKDA 3VZDA 4BE4A 4EUSA 1T2NA 4X3CA 5A03A 3ZDDA 4KR2A 2KB0A 1M33A 4IXWA 4RLFA 2CHFA 3KPWA 3N8KA 2BFDB 1OPRA 3RV4A 3SFZA 1OIWA 2EJ7A 3AM3A 3RH0A 1RYZA 3UGQA 4ABMA 2A1TR 4CMEA 1QQBA 5C5DA 3PHJA 3H1FA 4KI0A 3EVAA 3OTGA 1MEOA 3H4TA 4EPTA 1CVRA 2AR0A 2JFVA 3NHZA 1BMQA 2BBOA 4CR6A 1SUCA 3QA3E 1H0HA 1L5YA 1MX1A 1I0LA 2QD4A 3C5EA 3BWBA 6ADHA 3G2OA 5HQ3A 3M9WA 5EE0A 4ZMRA 5KHOC 1ZMRA 3PX7A 2V3VA 1R8QA 4Q16A 1MB4A 4U7WA 1QHIA 5DYWA 1G3RA 2XZOA 2EL7A 4MW1A 3R40A 2DWOA 2HJWA 2IJGX 1NJGA 4WJLA 1YIAA 1ZVJA 1R0BA 4BKUA 4YAGA 3RGGA 1W6RA 2J85A 1GKIA 4TVKA 1ID8A 1VLMA 3MB8A 1K7SN 3HBNA 5CX1A 5F1KA 1OAAA 3HO6A 4QTTB 3R7WB 2AYYA 3KJKA 3U4QB 5DTIA 1NYRA 2WMDA 4AAYA 4Q3BA 1SXQA 3JAWA 1M0TA 2HHHO 3NHWA 4N12A 1WA8A 3WLOA 2C1XA 3EA0A 1E9DA 3GVHA 4L15A 4D7TA 2VQEO 4TSKA 5C4MA 1LQ2A 3P9QA 4Q01A 3W5JA 2ZTSA 5IJ0A 4B32A 1HGXA 2O3SA 2VS1A 5AQ1A 1OKKD 2UYYA 1H48A 4TUYF 1CB0A 1OXBB 3RS8A 3CXHF 5DNUA 1F06A 5ALIA 2HYIC 3OKAA 3QIVA 1Z7YA 3DOEA 5E1BA 3F6BX 2YJ3A 1NU6A 5DISB 1ZK3A 4D56A 2EGUA 4J3NA 2D1SA 3OQ1A 1KAMA 1I3NA 3ZVRA 2OBXA 4MGIR 3AUYA 1NQ3A 1R50A 3OETA 2BBWA 5EP3A 4KIJA 4N3NA 2VGMA 3EEBA 1NONA 4QGBA 4Q1VA 3OGCC 3TTWA 4N03A 4ANFA 4CM8A 1XF9A 1KQSF 1DGSA 2VJQA 1V54C 3GROA 1C3OB 2ZYIA 4Q9NA 2N48A 4HLNA 3O2SB 1WB4A 3E9EA 3OOJA 5ALZA 2QJOA 2I91A 2ZXEA 3I42A 2HQSA 1SVIA 2HK6A 1DKPA 2YXZA 3L0CA 1EINA 2OQRA 4TGLA 3OGIB 3HUFA 5DP2A 3ZW7A 1OBHA 3REFA 4YCDA 3D4BA 5ECWA 2IEBA 2TS1A 2EOAA 3C3AA 3KKZA 4G0UA 4YCJA 1DMRA 2AW5A 1U6IA 3KUXA 3MMSA 1B15A 5D6NA 3EGVA 1OWLA 5B1BB 2GEFA 3VNBA 1KVUA 2X14A 4YQFA 4DV0O 2C95A 2YQZA 1VHDA 1TF2A 3KFVA 5DCLA 3TM4A 3H5LA 3WY9A 4BU0A 1Z6QA 1ZAUA 1RI3A 2UXDB 4F3YA 4G01B 1A8QA 5JYEA 4L6AA 1QJ4A 1K7CA 1RXWA 1SU8A 3F6YA 2NYAA 2NU8B 1JHYA 2EFCB 4JXJA 1Y1SA 5LP6F 1IVSA 4ZCTA 3SR2C 1LBEA 1XB2A 1WUKS 1W4CA 2GN0A 1KFKB 4Q1BA 5FHRA 5G0SA 4MV7A 5IN5A 1KDYA 2LWIA 4ROTA 5BR8B 5HQTA 5FWXA 2ZAGA 4S1OA 1G8YA 3SOPA 2HFEC 1DTOA 2PT6A 2JZNA 3P1JA 4YRLA 2F8LA 3G5LA 2X4GA 1EQAA 3FB1A 1ONNA 1D4AA 1JEEA 2CN1A 3P4YA 5JAPA 5CXSA 4Q34A 3PC2A 3CSXA 1GAWA 3IPAA 3LWDA 4EIWA 3CCMF 4KXRA 3ABLB 2LBTA 1K8XB 1ZQ1A 5BRNA 4F71A 5F98A 1UOOA 2ZUCA 2OWOA 1SKAA 4RIHA 1UZUA 2DWDC 3RFRA 3OQIA 2ILVA 1V4VA 3KR0A 3D00A 5EFZA 1DQZA 4GVLA 5DVZA 1EE9A 2C8JA 2L18A 3CD6V 1V16A 5KDOA 2V9ZA 4WNCA 2W4MA 1AP6A 1KZ9A 1SXJC 5H0IA 2YWHA 5KWVA 3QTYA 1A5SB 5EMLA 3WNDA 1OCZB 1NW5A 1WCXA 1Q77A 1YZGA 4OI0A 2QI2A 1HO3A 2ZSKA 3CNEA 1RHUA 1B74A 4CGZA 4EYKA 3QVSA 4KAXA 4MRSA 1ULUA 2IYLD 4HH3C 5KBYA 3W7SA 2B2XA 4GWLA 4LK2A 3VKFA 4X66O 3ZDXB 1DHRA 2RGUA 3TE7A 4QGPA 2WYWA 4LDRA 5JDCA 3BXGA 2R11A 3SZRA 1RM4A 2JCGA 2V5AA 4N0QA 3Q4GA 3LF2A 1ZW6A 1JFSA 4KQCA 1YZQA 3E9RA 5IAKA 1RRFA 1L1EA 3HJNA 5DNWA 1NE2A 5CDTA 1I7LA 3JVVA 4RZ2A 3H01A 3N8GA 1L4UA 5JHGB 1QNMA 1CE8A 3BREA 3K70C 1KSGA 1U96A 4UV8A 3K9QO 3LC7O 3C4VA 4OQLA 3HACA 4FGWA 3UT6A 3QENA 1LNSA 4X94A 3SF8B 4WNAA 4C08A 4JBIA 3WIVA 1UP4A 4C0WA 5LMCA 2L69A 2PNFA 3PVSA 5G1PA 2CYBA 3ZX4A 4RQAA 5C31A 5JWPA 4J9ZB 2YWCA 1OBVA 3BH6A 3QI7A 1N6KA 1QK5A 3ICCA 4KWHA 1S2LA 2XZTA 3THYA 2QAIA 5GINE 5B66Z 2QQ0A 1XOIA 5K3OA 4CLDA 2C2MA 4UARA 4HGYA 1CLIA 3RVSA 4GYJA 3BMOB 5AHXA 3WLRA 4ESHA 1QNFA 3BE5A 2B99A 5KYUB 3W7TA 1YFJA 1M0SA 2CXOA 4EVSA 4LIPD 5E6RA 2OY0A 3TRFA 3U7FB 2UUOA 1DC8A 1VECA 2RHCA 5C1IA 1ULZA 4BGIA 1Y48E 1D4FA 1SXJB 1TQ4A 3C1UA 2GO7A 2J09A 4QYWA 1UEIA 5HIJA 3DCJA 4E5NA 5CYOA 4E4YA 1NDHA 4CN8A 2ZRFA 2GUWA 4LI3X 3JYLA 1BGYH 1QHNA 4QOIA 3T41A 3D2CA 1YE8A 3VAAA 3WQQA 1Q6ZA 2FZ5A 3VH1A 1A69A 2PWPA 2PXCA 3A0UA 3HJAA 5BXQC 2C1EA 3FZNA 1YDHA 5JAMA 2JLSA 1ENZA 4Q9LA 2X2OA 3O0DA 4AT1A 1EUQA 3SHOA 3IIKA 3RS9A 3WV4A 1G5HA 2GCGA 2G9QA 3DT8A 1DQRA 1I2MA 1F6DA 5IT9N 3I76A 3PRHA 5CA0F 1JX9A 2A4KA 2AN4A 4FDUA 4JVSB 3NASA 4XD2A 3CRW1 5EJGA 5EXSA 4BQRA 4CQNA 4CMAA 1CUXA 4J9YB 2O5RA 1J5XA 2KX7A 5GM1A 1FQOA 4F1WA 1IC6A 3IFXA 3FETA 2TMKA 2XMPA 3NOVA 1XHOA 1T3LA 1VFPA 4P58A 4L08A 1ND6A 4KE8A 3ZY3A 2P4KA 4LCBA 2F6RA 3KO8A 2AN1A 5CT9A 5ICSA 1Q81W 5LLDA 1MVLA 1JH9A 5CA1F 2WDPA 5ALTA 4AURA 3BAFA 3RLIA 4PYQA 1BVYF 4BB6A 5TQVA 1K8YB 4C6TA 4LJSA 1T0BA 4RK6A 3HKCA 4JI4O 3E86A 1W47A 2AMFA 2JIZD 1CTQA 3WHKA 5CGQB 1R8JA 3DZJA 2OCPA 3WNZA 5AESA 1A8PA 2YZKA 2H7VA 5HFNA 4HNTA 5HF9A 5K1XA 4UOQA 2RCVA 1SKMA 2GBLC 5JXHA 1PJTA 1H2KA 1V6CA 2AJCA 2O8EA 4Y1RB 3ZNPA 3MAJA 1V8BA 2NV0A 3EVEA 3ETCA 1WZNA 4RVNA 3MQFA 2NSDA 5KYXB 1G2PA 2JCVA 4MO9A 1ISFA 1QRDA 2JLWA 3R8CA 3JQ8B 3WGTA 2KG7A 2PUTA 4QQ8A 2OXCA 2ZRDA 1A4UA 4KIGA 2FFAA 1DQPA 2RB9A 1F8FA 1G7RA 2DTEA 3FZYA 3F8SA 3F5SA 1PJSA 1K06A 1RRGA 3HDVA 3K9HA 4FBMA 4I7EA 4WZZA 5BVHB 1WMEA 3RD5A 3ZD8A 5DNYB 2YV2A 4P35A 1HF3A 1RAHA 4MRVA 3E2IA 1XZQA 3FY4A 2YV4A 5EBLC 3NBUA 4JQSA 1GTG1 1L8AA 4JYPA 4PX2A 3IDOA 2XDQA 3PKIA 4LDZA 4M1WA 4G0ZA 2FGJA 1Q83A 3HSYA 4KRXA 5H6RA 3UGKA 1E2MA 1IURA 1NT2A 5BR8O 1YI8A 1NJSA 1FPQA 1ZIXA 3IEUA 3NTVA 1KZYC 2NU6B 2XRYA 4WFJA 2EINB 3NNSA 4RVSA 4KKVA 1FKAO 2GFHA 1JVNA 3R09A 1RLGA 2ANCA 4ALLA 4Z4FA 4B8WA 2YBDA 3EDRA 3FROA 1EU1A 3IQZA 4KJXA 4EHDA 3ROEA 4CL3A 1FSPA 1TUBB 4A5UB 1RD4A 1N2CE 5K99A 3ZG6A 2VSYA 3VDXA 2FPIA 4XIJA 3WMXA 5C1PA 1USGA 2JBWA 5DSXA 1HPLA 5CLIA 3EG9A 3WJ2A 4M8KA 1M6VB 2FKNA 2OL4A 3UWPA 2ECOA 3L06A 4B76A 1LI7A 4UCWA 1TQ2A 4BEVA 2PIAA 4B1FA 1YR2A 1YK0A 4FZVA 4DBLE 5KTYA 2CVOA 3JX9A 4XE5A 4E6PA 5LKAA 2ZWPA 1TPYA 3CFYA 2JEYA 2ZAYA 3BEDA 3C90A 2YIJA 5C8ZA 3RANA 1E5QA 4BT4A 1PRYA 1E1NA 2HRQA 3UJAA 5MGNA 1YB1A 5ALEA 2CTPA 1LU9A 2DHEA 4IQ4A 4UMEA 5FTJA 1VPWA 1CFJA 2BSAA 2PBRA 3EQZA 3QKIA 4DR3O 3DE7X 3F9RA 3LK7A 4HMOA 4JJAA 4MW2A 5AJYA 2LIVA 3W8EA 4D98A 4M22A 5JDIA 4KVFA 3MWYW 3TCKA 3STLC 1IUKA 1DCFA 1JI0A 1R0SA 2I7TA 1U9CA 5IM5A 3K1AB 4Q48A 3FAVB 1YHQF 1I3OA 4KUHA 2QDKA 3LKDA 4WY2A 3WS7A 1V6SA 3SPGA 1IHDA 2WTAA 2CMGA 4RJTA 3ZXXA 2EWWA 3AESB 5G4LA 5LQNA 2HT1A 1U3CA 3SK0A 2H1HA 4U7GA 3ENZA 4BO9A 1CQPA 1PJZA 5T5QA 3UAYA 1YASA 3RAFC 5DHPA 3UUFA 3HNPA 1TECE 4MI9A 3LPLA 4OP3A 4QA9A 2VTDA 3AP2A 1LZLA 1VPLA 2GPYA 4TL6A 4HF7A 4LYDA 2QM0A 3IVRA 2RAUA 4C22A 4ZYTA 2E0IA 2NO6A 3JASB 3TX6A 4ZCIA 4YIPA 2VFAA 4RK7A 5BV0A 4X1IB 1IRIA 1D4OA 4WSOA 5CAEB 1P49A 2RGWA 4CV2A 1YA4A 5G4UC 1IHXA 3BTUA 3BXZA 3ZY6A 4DR2B 1BHQ1 1LBIA 3HJGA 4LHVA 5DHAA 5B2ZA 4J9VA 1QF7A 3SVLA 1U2ZA 4DA6A 3SIWA 2HUPA 3RIHA 3GJZA 3V9PA 2R97A 2X8BA 5A62A 2NZUG 5T64A 2ATKC 2A7XA 2CLHB 5HNKA 4WKOA 5KYYB 4X41A 4A9AA 3VSBA 5JSZB 1CUGA 3MMNA 4ZVPA 1RM1C 2P4EA 4IFBA 5E4JA 1HT3A 3UJ8A 1A82A 3HZRA 3Q7RA 3B12A 2GUZA 5GAJA 1VHQA 1JJ2F 2WU8A 1G5TA 2NXNA 3FNIA 4ZEMA 1R64A 5A6VA 3V6MA 2UXCO 3J7AU 1FK8A 3N53A 3G13A 3PUHA 4JENA 5EMMA 2F2TA 4H7FA 2EHJA 4BX3A 3E1SA 2WKWA 1Z2EA 4K0KB 3OCCA 3MD9A 4OY3A 3CJTA 1A9ZA 2OTLV 1NVMB 2OZPA 4H9GA 5E9QA 2H8EA 4J1SA 4FMDB 4M46A 4RD2A 3TQQA 3A1EA 3CMMA 2QD2A 2ZRGA 4CMKA 1FX0B 5AW0A 1W7AA 1NQXA 1NXTA 2G70A 2NPOA 2QN3A 1HFWA 3NTRA 1E9AA 3VR0A 3LWVC 1T5DX 4JWTA 3U3JA 5IKOA 3P7MA 3VH3A 4DDWA 4EI9A 4TWIA 4X45A 1W5TA 3KQWA 4QPZA 4JUCA 1SNYA 10MHA 1BE0A 2Q27A 4G27B 2XAFA 4R16A 1Q3EA 4CH4A 1WB5A 2JLAA 2JK0A 1RM3A 2D5LA 4GPBA 3I04A 3T1YB 1WEKA 3IHKA 3OO0A 1IV2A 2BI7A 3WMFA 4D82A 1NRXA 3JTMA 2ZXWB 3K31A 1ENVA 1GX1A 3R6TA 4D45A 5IXJA 4DWVA 4EH1A 2ZDHA 4LR3A 3B8HA 3NLLA 3UMFA 2JFWA 4BVJA 4F3RA 3S0JA 4B6EA 1AI4A 4AJ2A 5EHIA 1B42A 2PX0A 1SC3A 1DADA 3TSWA 4DLVA 4W82A 1UCFA 2IV2X 4ZALA 3F97A 4BTVA 1B26A 2GEKA 1PQUA 5FQNA 2I34A 1KC3A 3UJ6A 1R0RE 4MPRA 1EFRG 1R3LC 2C2XA 1HDXA 2NTNA 5JCOA 5G40A 1XZLA 3CLSD 4CTJA 3AXSA 5CW1A 3ZV5A 5JD5A 3LVBA 4L4ZA 1PR4A 5CIWA 4DB2A 1EM1A 1VKRA 3BUSA 5CEJA 3ZOKA 3L75H 1VDMA 1OLXB 1THTA 2BFPA 4LJ6A 2Y1XA 1T35A 4XFJA 3Q40A 4Q66C 4ZTZB 5DXJA 1Q82H 4EKGA 1KQSU 1DJNA 3U5TA 1QZUA 4N5MA 1QO0D 3WFVA 2PKYX 4GCZA 1VKJA 3PQ8A 4GMKA 2RBGA 3C9UA 2DF8A 2R6DA 2V55B 3D9QX 4H6WA 4NPHA 3T99A 1MH9A 1KY2A 3AF0A 4HAIA 2PH7A 3W5DA 3CRZA 1SD1A 2XOKG 2NR5A 4YRNA 5JS8A 3S8YA 4AICA 3INTA 3KV1A 5JOQA 1KO5A 4BBJA 1CUDA 4XDZA 5DM6V 3H86A 4ESEA 1AI6A 2Z1TA 1DC3A 1P60A 5HF6A 1NX6A 4BUZA 1FLDA 1THMA 3T5CA 5KLVH 2OXFA 4RK1A 2J3JA 4XYBA 3X3HA 1QU9A 4KVGA 4EMBA 3HNOA 2OFOA 1C50A 2Z1NA 3L3BA 3GRRA 2XAGA 1TM4E 5ECDA 5IP5A 3N6VA 3PNKA 4TLBA 5ADWA 2DAPA 2PV0A 3GJRA 4PS0A 1WTCA 1WDKA 1P5JA 2J6HA 3HBFA 5EINA 3OJOA 4PIPA 4MDFA 1KMIZ 1UZLA 4UMVA 4DRXB 3VTIC 1A5TA 1KYWA 2INGX 2R1VB 4MQLA 4X6LA 3OCZA 3FNHA 3NHRA 3LRPA 2Q1XA 4KGVA 3SHFA 1ZRNA 4UVAA 4IG9A 1P7YA 4CM4A 1TE2A 5F1PA 4C01A 3LVQE 5TS2A 1UPGA 1QIIA 1Y4MA 3RF7A 1XJCA 4YR9A 1FZTA 4YC7A 3COPA 2YXNA 2JD2A 3U7EB 3JATB 1FLNA 3CCLF 4OATA 1H66A 3RJTA 1SUIA 1EUDA 1NPDA 2RJ3A 4RFSB 4O2AB 2EILB 2QZ4A 1ESZA 4E6EA 3CCSF 1WE2A 3IQIX 1ZUHA 2LFSA 1S1CA 2GYUA 3FGPA 5C8YA 4FLEA 4JT2A 1IQ0A 2O2JA 4Q18A 4BKPA 3EVNA 2PF4E 4J43A 3P9YA 3OWOA 2BGWA 2VHZA 5CBPA 3QFHA 1BTOA 2BHSA 4RGBA 1YJWV 4OM8A 3IHLA 5AK0A 1VQ9F 4FTWA 5DM1A 3L8ZA 3IOCA 4QOFA 3QYAA 1XCGB 2H31A 3FUWA 1E61A 3EH1A 1IVYA 1PSDA 1XV5A 3L0SA 3LDAA 3O4RA 1YVRA 2V7TA 3ERCA 3PSHA 3U0ZA 2EKDA 1E64A 3K09A 2XLBA 3NBMA 1H5QA 3RK4A 4X3MA 3AXTA 3L2OB 3FPGA 2QD5A 4RFVA 4RVGA 5AVKA 4KGZA 3UXMA 5L8VA 1WBBA 2X6AA 2D3OW 4I5FA 3F98A 4Y2VA 3TFQA 2Z5FA 4BBAA 4Q12A 1YULA 3DE2X 1S01A 2GHQA 2O2XA 5JLJA 3K08A 1J2JA 2ILTA 3LX8A 3TZ6A 3JXEA 3RYHB 1HORA 1Z5PA 2UZ0A 5D3ZA 2WVHA 1NVBA 2ZIUB 4ZREA 2JRCA 3PUKA 4MGHA 4URUR 2IKSA 2JH8A 1A5AB 4HVCA 3JQCA 2B4TO 2QDXA 9GPBA 4F3KA 5LQCA 2QWOB 4MUGA 1MA0A 5IY5B 1G6OA 3ADOA 3TRHA 1PSWA 5I4IA 3OAAA 3CURA 4YJFB 3WQBA 2DR3A 1KKCA 4I08A 5BV1A 2Q1UA 3TOXA 3TTXA 2OOKA 3A9TA 3IOEA 3LCCA 1AO3A 1SBHA 4MINA 4YJ2F 4UUAA 3QX3A 1VKZA 3KC2A 2HDNB 4MS1B 3I1IA 1K5GA 4MGYR 1W5BA 2NP6A 3GJ8A 3IODA 5AKZA 2HRCA 5E9AA 4EA8A 4ZO4A 4Y2UA 1U0BB 1SF9A 2Q99A 4YAKA 4QJ5A 3H2JA 1HLPA 2QM3A 4DA9A 2X0DA 1XNRB 4J94A 1Y9AA 3CY6A 4LXUA 1D1QA 1NSYA 2AIRA 3TKAA 2LNDA 3B5EA 2K9PA 5HZKA 3R5KA 4RMNA 3EC1A 1PR5A 2P4SA 3TL2A 4C5BA 4B44A 1G8AA 2QBYB 1H2FA 4XR4A 4A82A 3ML0A 4N9QA 4XVUA 4KMSA 4S35A 4WMLA 2C82A 3Q41A 1T8TA 1QRRA 3H4MA 4V0SA 4MAMA 1IDN1 2O0JA 3ANMA 3DFZA 3SC2B 2G1AA 4W1PA 3A06A 4DYVA 2HEIA 3VA7A 1QU2A 1NXSA 2GESA 3ZS8C 4RA6A 1L3BA 3FSRA 4MRMB 1FFBA 1VJTA 3TS1A 2WAOA 4XIYA 2CF6A 3AUSA 1ZSVA 3ZY2A 4CQMB 2CV0A 2ZSBA 3O31A 1J2YA 3EZ2A 2D2EA 3GJQA 1Z62A 2BPOA 3CPHA 3QYPA 4DF3A 1OCOC 4MOWA 2A06H 3FTNA 4CKEA 4HBGA 1JW9B 5FD8A 3K6SB 3TRIA 1H8HD 4PPFA 2ZIZA 3KQVA 4UDXX 3GLGB 4CCSA 3CR8A 1CSEE 2AEEA 8AT1A 4YCMA 1I0HA 2Y6UA 3VYRB 4JJZA 5ALJA 4CIXA 5I4BA 2CSUA 2WMOB 4ZVUA 4LH7A 1KEZA 1T34A 2PBFA 2YWBA 5ALKA 5LQJA 3HABA 2WTUA 3UA4A 2PGXA 5HUQA 2R3SA 3OLVA 4GR9A 1QU7A 3DE1X 1F7YA 1E0DA 3ELBA 3QKSA 2A5JA 3KHTA 1Y3HA 1VQLF 3NO4A 4ZCSA 3CH7A 2GTSA 1L5NA 2CGOA 1PV0A 4ERXA 5B3JC 2AI1A 3FD9A 1EX6A 2GPWA 2E76B 4MVRA 3LUDA 4TYYA 2EW1A 4R50A 2V4DA 2VOEA 4HAXA 4HN2A 2XBMA 5FPOA 2I7VA 1IJBA 2YHIB 5A5EA 3DVAB 2GM4A 3HA7A 4PGGA 3X1KA 4ZTBA 1VP3A 3KWJA 2GF9A 2XGSA 1E9RA 2ACVA 3EXIA 4JOCA 1SUPA 5DM60 4PZYA 4A36A 4TL9A 1W4AA 4YRJA 2AK2A 4GL4A 1RAGA 3LC1O 4HY3A 1M7BA 1OJ7A 3B1WA 5F1OA 1AGRA 2IYEA 5LDGA 4ISBA 1X7WB 2C5AA 4BKQA 1SK8A 1Y7TA 2EAUA 2ZVYA 2IYZA 3VR6A 4JB0A 2G38A 2OCBA 2YNMA 3FDIA 3LO8A 4YCBA 4UTRA 4TKUA 2BISA 3QOXA 3LUJA 2XWSA 1M67A 1G6HA 2FA9A 4KAAA 4A10A 2JFYA 2ZODA 1Q86W 1BEZA 1U3GA 3LGXA 4JP2A 5EXTA 3TR5A 4FIPC 4AXXA 2DYRB 1BYIA 3OLZA 3W79A 3OT4A 3QNMA 5K05A 5EWMA 4HNUA 3NT5A 4ZK7A 3NGLA 2M6KA 3ZDEA 3VJRA 3RVPA 1LRLA 4MW8A 1MX9A 2QTSA 1CY7A 2XNDA 4L74A 3X1ZA 1HYBA 3TWOA 1NNEA 3J81A 1OW3B 2WYUA 4R4JA 3T7TA 5M5BA 3MB5A 4PLCA 4WZAE 1BCSB 3UMCA 4V0LA 1YA6A 4F38A 2OZBA 1RHMA 2CE2X 1E79G 4XCQA 1W85A 1CWUA 2CJWB 3DXFA 3H16A 2DBYA 2G5TA 3HCDA 2DZDA 4JB2A 4MP3A 2YWJA 4DKXA 4E2LA 4MDYA 5C0OE 4YDHB 3CEJA 3H2BA 4E1VA 4TROA 4C2BA 1R0WA 1Y74A 2AR9A 5K9ZA 1D7OA 2QTLA 4JC8A 1SUAA 2WTEA 1V8PA 1DE0A 1K4KA 3DZ8A 4WZBB 1YKGA 5DTJA 3OBYA 1YCHA 3IAM6 2WM3A 4GOXA 4CIVA 4TWZA 2PL9A 1HFJA 5JZMA 4HL6A 1D2EA 1KJWA 3CGGA 5HM8A 5EUCA 3TNJA 4EJSC 5FOSA 1RFYA 2J3MA 3CNNA 4KFRA 4MK4A 2Y6VA 4M88A 4OTZA 1YEWA 4W5HA 1Z0AA 2IOQA 3KSRA 4MLPA 3UMVA 1YNSA 3M1LA 3MZ0A 2NU8A 1M73E 2ILMA 4TSFG 5I7FA 4L27A 1YOVA 1ZH2A 4NEQA 1Y3IA 4C89A 3RE3A 2IHBA 2I78A 1YO6A 3UWKA 1SC6A 3LLSA 1X14A 2VPWA 5AUPB 2G1PA 3NFRA 1NVDA 3BD9A 2UUPA 1QQCA 1HDYA 2F4VB 1NUHA 3COVA 3GH3A 1R3KC 4L2IA 3DZHA 2VHVA 3S2GA 1SK9A 1U1GA 2PSHA 3A9VA 2XX3A 3P2MA 3CPSA 1N33B 1BS3A 1RWKA 1LNZA 3OJCA 2DFKB 3A3KA 4NARA 2JGNA 3GLSA 3WYNA 1NLFA 1SCUA 3KLMX 3UUWA 1UDAA 2XLCA 5H9VA 1XCLA 3S3XA 2W98A 2N1BA 1H05A 4O4JA 4EEKA 3ETGA 4ZOAA 2YEVB 3B9PA 3CCBA 3K6RA 4CODB 5AFSA 4NG4A 3LKVA 3EXHB 3KDPA 4NZMA 4ESOA 2PLWA 1EXVA 4K9RA 2WPNA 1EWKA 1P7VA 5JH7B 3DDNA 1AXGA 1FB5A 4KX3A 1ND5A 2WF7A 5JVDB 4WXHA 4X54A 3NDBB 4RKYA 3V4VB 4QXRA 3U26A 4TQUS 1PF5A 3KKEA 2GHYA 4JJ7A 5KTKA 3HL4A 1T1GA 1M34A 3R9KA 3NWOA 2PTHA 4LFAO 3GWKC 4C4YA 1G18A 3WYCA 4IJ5A 3W2FA 1SHTX 2GZMA 2XYRA 4CTOA 3GFBA 4FZ3A 4JYZA 2R6HA 1L5RA 4JOBA 3ENKA 3FBWA 2V1XA 3RTBA 4OUKX 3TAHA 1I08A 1Z12A 2BEVB 2JFBA 3BBLA 1ZMBA 5A02A 2WJAA 1SZQA 1DLIA 3LPAA 5D8DA 3L8CA 1WNSA 4KP7A 1JDTA 1MFPA 5J9FA 1E6WA 1UM9A 4FUTA 2VDNB 4ND8A 1ABFA 1UKZA 5EVCA 3I9V1 3IPLA 2R1ZA 3WV5A 1T8UA 2NXWA 1PP4A 3M5WA 1QFXA 3HYSA 5BMVB 5DZSA 4YPOA 4EB3A 5KTRA 1P18A 3AR3A 1U0SY 2ASEA 4UM5A 4Z9FA 1TO6A 3QUCA 3UWOA 3I56V 3PC8C 4XFKA 2VDUE 3TLAA 3KBBA 2RHDA 4Y18A 3ZU5A 5AW1A 3PICA 5I45A 2PL1A 3S2ZA 3QU2A 1RJEA 4Y1FA 1O03A 4TWBA 4Y2GA 3LCRA 5BSTA 4CLOA 3OFND 3ASOC 3NHYA 4TYPA 3RFCA 4DLXA 3FYTA 2P2NA 5FADA 2SCUB 3SWWA 2GBLA 3NOQA 4IRMA 3ZI7A 4C0JA 3H2SA 4DV2B 2I22A 1OMOA 1ZD9A 3AG5A 1MQ8B 4FYPA 1X7ZA 2R72A 1H2RS 1IEXA 1K2WA 2A14A 1CN7A 1PLLA 1T9ZA 2A1IA 2PGDA 3OE5A 3CWBH 2ZJYA 5DNAA 2OFPA 3U3OA 3I23A 1JKXA 3X2EA 2YXYA 2NQ2C 4Q9DA 5E95A 1H2LA 5FORA 2ZDIC 2F90A 3GU3A 5JVDF 1E7WA 2O1XA 1UF9A 2V7WA 1XQ1A 2OHOA 4YUVA 1EMDA 3VZQA 3SVTA 4AN1A 1WDTA 1GV1A 2RH5A 1WU7A 1NH2B 1P84F 1PIWA 4B80A 3WB0A 3CZRA 2PRKA 1A1SA 4HQOA 4Y98A 4NXMO 1GPWB 3JPYA 1VQ1A 4MIOA 9LDBA 1AR5A 4ZV9A 4J90A 4I3FA 1W93A 4YJ2B 1VQKF 1IN4A 3M8AA 4MV6A 5AKXA 1M57B 2O5VA 4LCKA 3TW4A 1N4DA 2HPAA 4MWGA 2B5WA 4TT3D 4R71A 1AGYA 1X8JA 3EA5A 1TGOA 2ZB3A 3KZCA 3A6KA 2O20A 4L8VA 1WA5A 2XZPA 3CLRD 1VM6A 1JDPA 1RXIA 1PSZA 2ZI4A 3DYVA 3ILVA 4C14A 4C6HA 1WP4A 9ATCA 4LBEC 2FP4B 5H3LA 5KPJA 2X1LA 3ZVKA 2P6MA 4O25A 3UC5A 5I9MA 5AOCA 3Q7SA 1ISMA 1XDCA 2J33A 4YP1A 3E9QA 3CBQA 3EGIA 3CCJV 3KQTA 1JT9A 1YQEA 3LIIA 3OZIA 4BNWA 4DUZB 1R4MA 1H8HA 1BS1A 4EHJA 1OXTA 3VO1A 4KNYA 3JQ7A 2DYKA 3GC6A 5LL6P 2A58A 4TXHA 3W3AH 4LECA 2J08A 1ZI8A 3NCTA 4NZYA 1KQ3A 4UBOA 1VE5A 1QFJA 4IZOA 5BPFA 1Z25A 3KQOA 3KSZO 2Y69C 2Q0QA 3Q3CA 1E7MA 2BDUA 3LFHA 2ABWA 4XGIA 2H7YA 1USIA 3KSMA 1MDFA 2HVYD 2VHCA 2Z8XA 4H35A 2Q7XA 2WP0A 4HX5A 3RQIA 5KAIZ 5CYFA 3BGIA 2IZZA 2KTVA 1OYWA 1Q0LA 2LP4Y 4MR7A 3ZU6A 4M1EA 1JR9A 1RSOB 2CW4A 4I66A 4LRSB 4QGGA 3WLLA 4EARA 2FUKA 4EUKA 4I5IA 1LLQA 5BUSA 1DP4A 1E2KA 3B51X 4ARSA 4DSOA 4KGXA 1R73A 3K05A 4B6FA 2O06A 2Z08A 3OTWA 4HUJA 4JJ8A 3RBZA 4UUBA 2HRBA 5CM2Z 3ZGLA 1DBFA 4YMWA 3U2QA 1YI2V 1E4YA 1II8B 2DWEC