4X1KB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 134
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1kB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1kB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1kB01
5JVDA 5GONA 1W5FA 4DRXB 1JFFA 2XKAA 1W581 4LNUA 3JALA 5FNVA 4HNAA 4O4HA 2Q1YA 3CB2A 3C8LA 4E6EA 5LOVA 4EI9A 1FSZA 3RYFB 3HKEA 5EIBD 3RYCB 5CB4A 4YJ3A 4EB6B 4O4JB 5J2TB 3WGKA 4ZI7A 4FFBA 4B46A 4X20B 3M8KA 4O2BB 3RB8A 2RHJA 4I50B 4O4IA 1W59A 4IIJB 3JARA 4I4TA 1RQ7A 4X1YA 4ZOLA 4ZHQA 2GVIA 1FFXA 4TUYA 5CA0A 5ITZB 4M8IA 3WGNA 3ZIDA 4X1KB 5KX5A 1TVKA 4U3JA 5EZYB 3HKBA 2Q1XA 5BMVB 5JVDB 3WGLA 1JFFB 4X1IA 3HKDA 5C8YA 4LNUB 1RLUA 5EZYA 2VXYA 3JALB 5FNVB 4HNAB 3VOAA 5JQGB 3ZBPA 4O2AA 1SA0A 5LOVB 3HKEB 3JAKA 4IHJB 5CB4B 5IYZA 5IJ0A 4FFBB 2BTQA 3JAWA 5JCOC 3VO8A 2R6R1 2RHHA 4O4IB 4O4LB 3JARB 4I4TB 4X1YB 4ZOLB 2BTOA 4ZHQB 1FFXB 3RYHB 3E22B 4KWEA 3VOBA 4U3JB 3HKCA 2R751 4B45A 5MN6A 4YJ2B 3HKBB 3UT5B 3RYIA 5LXTB 3JATA 4X1IB 5LP6A 3HKDB 5C8YB 3VO9A 3M89A 5LA6A 2RHLA 4EI7A 5GONB 4O2AB 4I55A 1TUBA 5KMGA 1W5EA 2VAMA 5LYJA 3JAKB 5LP6C 5IYZB 5CA1A 5IJ0B 5EYPA 4O4HB 3JAWB 5J2UA 1W5BA 5M7EA 4DRXA 4F6RA 5IJ9A 4YJ3B 5JH7A 1RQ2A 4ZI7B 3R4VA 5MN4A 3N2KA 4EB6A 4O4JA 3HKCB 3JASA 4TUYB 5CA0B 3RYIB 3JATB 4U39A 5KX5B 5LP6B 1TVKB 4TV9A 4EI8A 5EIBC 5MN5A 5ITZA 4TV8A 5LA6B 1W5AA 4WBNA 4I55B 1TUBB 1Z5WA 1Z5VA 5KMGB 5LYJB 5CA1B 5EYPB 5J2UB 1SA0B 4F6RB 3VPAA 5IJ9B 3N2GA 5JH7B 5JQGA 2BTQB 4DXDA 2RHOA 3N2KB 4IHJA 3JASB 4XCQA 3WGJA 4O4LA 3RYFA 2VAPA 3RYCA 4TV9B 5J2TA 4X20A 3RYHA 4O2BA 3E22A 4TV8B 4I50A 4WBNB 4IIJA 2XKBA 1OFUA 3ZBQA 4YJ2A 2VAWA 3UT5A 5LXTA 4X1KA 3WGMA 3N2GB 5JCOA 3V3TA 5BMVA
chains in the Genus database with same CATH superfamily
4HHEA 5LA6F 2FP4B 3D0OA 4EFBA 3P0IA 4LYYA 3FNFA 3PJEA 3BWVA 1J22A 4TZ0A 3H5LA 4HAZA 1UH5A 3ZWQA 3HNRA 1JECA 1FRQA 1R6BX 2P6RA 4BJ6A 2BGJA 2Q8PA 1CQJA 4COKA 2E49A 3DQQA 1PEKE 3C16C 5TQ0A 2D5CA 2A8YA 1UK7A 4YRZA 2B5UA 3EOAI 2H54A 3EYAA 3ZDBA 1NMZA 4TZKA 2ZXUA 1CZLA 2EKLA 4AMUA 4IDHA 1F4MA 2RGRA 3D7MA 4QBHA 1W5BA 4ATNA 2NZYA 3PHCA 3P30A 3NK6A 3I1FA 3WDMA 3I6MA 3OTQA 5FA8A 1KVRA 1RQLA 2H6LA 1RWKA 2Z4SA 4DW8A 4H7IA 2ITCC 4RULA 4XJVA 4CQMA 4F5EA 1JQEA 4PINA 3A0RB 3V7QA 2VDOB 4EH1A 3M2PA 5J4YA 3RTAA 2EIMC 4XQEA 1YK0A 5ADHA 2E4AA 2PUCA 4KODA 4X7BA 1WPRA 2J0UB 3S44A 4XX0A 3Q3EA 4OB7A 5EWLB 1ZD5A 4NYJQ 1HDOA 2VBGA 4KFUA 3FKSA 4HDCA 2B6HA 2QVGA 1B2RA 5K45A 5BYJA 2D3TA 3MWGA 3WWCA 4B3MO 2XE4A 3AUXA 1NNUA 4FWIB 4G9EA 5B6JA 4JASB 4AG5A 2AOTA 4KP4A 4X8OA 4CGYA 4XDYA 3V33A 3CXHF 4KDEA 3W90A 3EGDA 1VG1A 3TTVA 1VQLF 4HFRA 4QOHA 4YS6A 5IT9M 1HE3A 3ORHA 4JQZA 4DBLE 3F0FA 2NO6A 2IL1A 3E3AA 1NN5A 5EC1C 1QVGU 3OM8A 1A8UA 1FX0A 1XV2A 2EIJC 1DWPA 2A9QA 4GX5A 3FX2A 1GSIA 2Z1EA 1K68A 4CM8B 4H2DA 1TM1E 1KP2A 2ZEJA 1FXWF 3WMRA 5EMHA 5TIIA 2MIIA 3BSFA 4JAVA 4XM2A 2ZWOA 4LVUA 5G4KB 3VR0A 3DDZX 5JSKA 3LYHA 3GLIB 4X1YA 2Z04A 3ND6A 1JPVA 3OQIB 4LDZA 4DSNA 2X5OA 3ZU2A 2EJUA 3R6TA 4UBLA 1L4MA 4R7ZA 2IYPA 3P9RA 5DO9A 1R3JC 2XMSA 4NBKA 4UCWA 4AFNA 3JVVA 3SZ3A 1HKHA 3MINB 5IZ4A 2FYTA 1MB0A 2RHMA 2CHVA 2HLHA 4M60A 2G17A 5EKUA 3IAM6 3L1HA 1BWSA 1SEPA 3A2KA 3FJOA 4KQEA 1W93A 3FWKA 3AG6A 2W6PA 4EHKA 3W5VA 3TE7A 3DE3X 4HDRB 4UFNA 4YDHB 3QNMA 4FMTA 3G6KA 2I6TA 4PDRA 1F2DA 2W2QA 1M1NB 3UMMA 4K6MA 3D00A 3Q5DA 3MWDB 3SPCA 1TJ5A 2OLJA 2F1OA 1H1LA 2ZBEA 2XF8A 2B4KA 4JI2O 1CERA 3K5NA 2I1QA 4DJFC 2PU5A 1X52A 3QM1A 4N40A 3OCWA 4I6JA 1V8FA 3I6QA 1K9MW 3UO8B 2EW8A 3IBTA 5EPEA 1BHBA 2QX8A 5IBCA 1R88A 5H3HA 5IAJA 4HZGA 3U17A 2YQZA 2Q6KA 1QG4A 3MWEA 3L4KA 4J7UA 4KKVA 4DBVO 1KMQA 1ZAKA 2BZ1A 4S24A 1Q43A 4J7KA 5CXSA 1US8A 3W3ZB 9MHTA 2XXAA 3GV0A 2QRJA 3L9XA 5CX1A 2ZT5A 2BHLA 3K5OA 3WG7B 5K5EA 3HUDA 4P2GA 5DTIA 4FGLA 4MSUA 2G71A 4K6HA 4NZOA 4ZQBA 4LF5O 1T1IA 2PYZA 3U44A 4R31A 5AVUA 3KKZA 4RA9B 5DTJA 4OJMX 5EWJB 2QRMA 3S0HA 1W9HA 3GW8A 2ZXEA 5KNDH 1TJNA 4DYVA 1Q16A 1JN1A 4YPFA 3V4OA 4GH5A 4MWSA 4WNIA 1UFQA 3ADPA 5BVGB 4BTLA 3EQ9A 1OLUA 1TVCA 3C1AA 3G4SF 2DGDA 4JI6B 1JH8A 4W5WA 2GKGA 5GP1A 1IXBA 4DT1B 3T1HO 5B1HA 3ZHSA 2VQFO 5E95A 3KKMA 3O1JC 2RJOA 4OI2A 4HXEB 5ADUS 4UCTA 2CD7A 3WFZA 1RIFA 3ONWA 1N32B 1UBFA 2Z3YA 1XTRA 4OAPA 5JC1A 1NVMB 3QGMA 5AP9A 4MQEB 3EAGA 5AXAA 3H5VA 4GQIA 4D82A 4DQUA 1BHO1 5AJWA 4ZEXA 1GA4A 1QGDA 3T0FA 3U6BA 3ZIDA 1D2HA 4D6TH 3OPQA 4CF3A 2O7SA 1V37A 2VCEA 3KZOA 4HDNA 4DR2B 3A6HA 4Q9AA 2DQ4A 4DCTA 3BHPA 2OBNA 4OY3A 1PVDA 1VQ6V 3IPYA 4G9GA 4RSMA 1MMMA 3DJYA 3ZDYB 1Q3KA 4UC0A 3H01A 3WISA 3K16A 1CY6A 1PGPA 1GNTA 2V7GA 5DHTA 1IMJA 1KRXA 1XNJA 4LC1A 2NU9A 4OXXA 1FFYA 2GAFA 2WZCA 3B6IA 2O19A 1L8DA 1ZD8A 4L4UA 4K28A 1L5VA 2VJMA 3FOBA 4MVCA 1W4AA 1J09A 3R5KA 1W73A 2JH8A 3TLCA 1CDZA 1XJ5A 3LUPA 3EMKA 2BFDA 2FQWA 3NDPA 4PICA 2JS5A 2RIPA 1C3LA 2Q1SA 4X8LA 1ZSPA 1N5KA 3E89A 3SXJA 2P9TA 1JEYB 2FPWA 1K9SA 5HFNA 1UMCB 1D03A 3CCSF 4XIJA 4RD2A 2KQUA 2DBVO 2C5BA 1KARA 1RC1A 3C0KA 1S1CA 1KQGA 4LZLA 2BGMA 1CF9A 4JUAA 2NSJA 1MZPA 1SB8A 1Y1KE 4K40A 4H7EA 1EGVB 2LXNA 1MQ9A 3KR9A 1G8MA 4MMZB 1LPSA 3E9QA 3HDVA 3IEKA 3BCSA 4FHEA 4HNUA 1D0VA 3BFRA 2ZSIA 2O3SA 1ZRMA 3HRHA 4PLCA 3LWVC 3G2NA 3HKCB 4M76B 4FT4A 4DA8A 4U0JA 5MN5A 1HMPA 3CT4A 3L7CA 3A0RA 4CV0A 5LZ2A 1GCUA 2PHZA 4DYDA 3A1UA 5FA6A 4RJTA 3P3NA 1SCNE 4HB2A 2EBUA 2J0UA 4DM3A 2ST1A 3CCRF 5HIJA 3PFWO 4AS1A 2ILVA 3PIDA 1EGAA 3M6UA 4P8RA 3PZRA 1GM5A 3N75A 4MMYB 2XNKA 5IRCD 3M1XA 5AOVA 3DL7A 3IHWA 1CWUA 3PVZA 2A6PA 6REQB 4PYJA 1YHNA 2VSFA 4MVUA 3IUMA 5HUJA 4RHTA 3DHWC 5TARA 2IEBA 4R3UC 3CMEV 4JASA 2Q3DA 5BNIA 2GPTA 1JEAA 3ONNA 4LUCA 1IU9A 1RLOA 3H2BA 3I12A 3V4ZA 1KBHA 4W9NC 2PO7A 4XW2A 2MT9A 4J0FA 2HDWA 3S55A 5JEDA 2H8GA 5DZSA 3AK2A 1RCTE 4RIHA 5LQJA 2Q9CA 2X86A 3MCWA 1OT3A 5DSZA 2FSVA 1CZNA 4MSWC 4AT1A 4MW5A 2GF9A 2PYDA 5EE9A 4LF6O 4E1AA 1J06A 1PZMA 2VJCA 1H69A 2L82A 2R70A 4BMPB 4E14A 4FD3A 4CM8A 3ZMZA 5BWOA 4MUNA 3A1NA 4MR7B 3ETQA 1XIVA 1PKXA 4YJ2F 2VP2A 3GHZA 3VPAA 1ZX3A 2W4QA 4PE5B 3LHSA 3AIMA 5K8VA 5G4KA 1AE1A 3GLIA 4D4KA 2QQ0A 3L9DA 5AKGA 1CV2A 3RVLA 3HA5A 4CIAA 3OW2F 4LFBO 2ZK7A 3U3DA 5C2JB 5EUMA 1O0SA 4RTQA 3EIXA 1JU3A 4MDHA 4CM7A 2DR3A 2H16A 3FD6A 4HRVA 1P8JA 2QVZX 5J5CA 1GPAA 1ZUHA 2Q1UA 3ZXXA 3HPLC 1NL3A 3F4LA 3MINA 4R8KA 1QHNA 4HH3C 2IPAB 2JJ2A 1H6DA 4TMTA 1H4VB 4J0EA 2ZOSA 2PMEA 3EA4A 4W5NA 1UJBA 4LEIA 3K12A 2O6LA 3G9QA 1OXUA 1IOLA 3TQTA 2YW2A 4UHDA 4JPRA 1W75A 5CIYA 4QUBA 4CW7A 5F3RA 1B0PA 1XPUA 4HDRA 3P2MA 2HT6A 1EVLA 3MOSA 4Q82A 2KYRA 4IWXA 1DV1A 2P1DA 1M1NA 5JI2E 3MWDA 4B4UA 4RHFA 2H1SA 1NQXA 1U9IA 2A5JA 1T2DA 4JIMA 5CG1A 1E2BA 3D43A 1DAEA 4YUAA 2I1VB 4AN4A 4PG5A 3W78A 3WMWA 4ZDWA 4OHZA 2AZ4A 4PS1A 1A04A 4QPKA 2Q6AA 3HVHA 3CX4A 4IXWA 2HADA 2VA9A 3BIFA 4QHTA 2QWOB 2V6IA 4RKRA 4PQEA 3SSAA 2HWYA 1DELA 4DTCA 3VR2A 3T80A 1XEQA 2GV9A 3OFNA 4H6PA 5TGTA 3NHJA 1O6FA 2XCOA 2ZKIA 3WJPA 2HLPA 3GLHB 1XTQA 3DD1A 1YZLA 5SY6A 5LP6C 3L41A 3NYWA 1KNKA 4DDTA 4M0MA 5LMUO 5F76A 2MHCA 2KBFA 3R8CA 1WAMA 3IMCA 4US2R 1JU4A 3NO4A 4WXYB 1ZGJA 3U4CA 3ANYB 5I8ZA 2PX6A 3HTNA 5ECGC 4TYWA 1ZINA 1P7WA 1IONA 3RUDA 2FDXA 4ZOAA 3QPBA 1HE1C 3ZZ1A 3U9LA 4UCSA 2B4QA 2IYFA 3AHDA 5FOVA 5GQSA 1Z73A 2V4UA 1NC1A 4E22A 4RA9A 1NJ8A 4WFJA 4LXUA 2JGNA 2NO1A 2TECE 5A9TA 1PGOA 3RNLA 4MV7A 4PSCA 1FJ2A 3ZHCA 4FUTA 3ERCA 1LQTA 5BVGA 3ZWWA 2ZI5A 1YQ9A 4ND6A 4L08A 2FETA 4J7CA 1XR3A 3VR4D 2C77A 3PAFA 1UIMA 3F5WC 4YBRA 1PZNA 2EARA 1V5FA 1T2EA 3H5OA 4HV4A 4PGHA 4FB4A 3KJIA 1OSNA 3TLXA 2IT1A 3W6UA 5IMSA 3JQFC 5DM60 2C7RA 2I2CA 1SZTA 2RONA 1OBCA 1Z0UA 4I55B 4L95C 2WKWA 1VBFA 2OTCA 4MQEA 3BY6A 3HU2A 4IHJA 5F77A 4LBYA 1ZHHA 3OW2U 4BBAA 1MJ5A 3FAKA 1YZNA 3R09A 4OGQB 3CJRA 4W9RA 1TTQB 3DTUB 1JALA 4L9WA 3HFRA 2VP3A 4A03A 5CA1F 1UOPA 3KYDB 4LF7O 1IX9A 3E8HA 4L28A 4JC4A 4UXNA 4NB5A 1W2BF 2NXEA 4HN2A 4WNAA 3NAGA 1PGNA 4K9OA 1D04A 1U4NA 1IN8A 3TLYA 1I4LD 3AESA 4R9NA 5HA5A 2G0AA 1XCGB 4QPNA 3CH5A 2YXHA 1KL7A 1ZXXA 5L3DA 2QZJA 2H7YA 4RX1A 2AT1A 1MSWD 1RR6A 1RQNA 1LFAA 2H0AA 3OFSA 5HX7A 4DR3B 2P0AA 3UEOA 1UC8A 4MW6A 2EX4A 1JIIA 3O2SB 1Y42X 2HRZA 2B9VA 2XDYA 2YYYA 3DDCA 4RPHA 2MK3A 3UJHA 5DHPA 2YDEA 4PA7A 3LUBA 2VJBA 1JEYA 3KPUA 2QN1A 4DSZA 2EJRA 5A2QA 4JYPA 3S2ZA 4B4VA 1BROA 2QE6A 5AHWA 2AG5A 1GIAA 4RVDA 1T9HA 4FLFA 4X45A 3ASOB 4JI5B 1L7DA 2HJVA 4EQZA 1OY1A 3C6KA 3P9QA 1BO6A 1DKLA 4OQLA 4HAXA 3OU6A 1Z68A 1AY0A 3MB8A 1NE2A 2M6RA 5I9NA 3H2HA 1SS3A 3JQEA 3BGSA 3D6HA 3DGEC 3M99B 5EBMC 3FOZA 3QXJA 3HKCA 4LSZA 4CEIB 2V6FA 2M1XA 2NP7A 1J1IA 5JASA 3DVRX 1EDOA 1YCDA 4CS2A 1T9GR 4FX2A 4NQRA 1A5SB 2GN1A 1N5LA 3SN6A 3ICPA 4OFWA 1NH2D 2X0KA 4WBSA 4MVRA 2VHEA 4MEAA 4UNQA 3EAFA 1RWPA 2PZBA 2C96A 2X77A 1G3RA 4DMHA 5KKCA 3LXUX 4NWOB 3UWOA 2I34A 6REQA 3TNLA 2OZLA 1OCOB 2ZT6A 2EIKC 3RS8A 2XAGA 1M72A 5HVNA 1JIKA 2ATIA 2BR3A 2NZ8A 2FDCA 3AG4B 2LIVA 1E1KA 2BHTA 1AC5A 5DLDA 3LMKA 4FSHA 1MC4A 4HX2A 2GZMA 3PWTA 1OLOA 1IDOA 4YC7A 3Q8MA 3TFWA 2JARA 3AUTA 1ZNWA 5KNBD 4JI7B 3IIKA 4KXYA 3E9DA 1WXEA 5CB4B 1E1RA 5F12A 2DYKA 5L7WA 1SKYE 4PBRA 1N4CA 1OD6A 1L5RA 2WTBA 3WE7A 4MR7A 2GSMB 2KLHA 4RDHA 1U2DC 4ZVNA 1KI9A 1UQTA 2YVAA 3H0EA 2PGIA 1RWQA 4M0LA 4GZ3A 2OKCA 1R8XA 1SG9A 5K0SA 2W2OA 3A1FA 3N2LA 3LDDA 4MVJE 1LDEA 1XMVA 2GLXA 4KQHA 2G80A 4IIDA 5KCZA 4H13B 4Q01A 3DUFB 4YP7A 5IBQA 5L9AA 1W2BU 1HKUA 3C8DA 3CCLF 4MULA 1TQ6A 2X4IA 2WLMA 4BFLA 1QLHA 4NRDA 3APQA 1ZM4A 4BU0A 3LKDA 1OA0A 2IOFK 3VOAA 3QV2A 3EGVA 4NJEA 1T2AA 2KJQA 1DOZA 1FSFA 4PSDA 3NTOA 4IQGA 5HHTA 2JFZA 1IOVA 1CRPA 5DCVA 3W4IA 1LPBB 1Z6XA 4LJ4A 5D00A 1ZUWA 1EPUA 5HMMA 4F04A 5AHOA 2DECA 4KO2S 4KBGA 2I8LA 3KOXA 2PFSA 1B06A 2ZXWB 4PDLA 4Z9AA 4UMDA 4I99A 3V4RA 1R3UA 3MOGA 4G5HA 3TOZA 4D5GA 1PFQA 1FSPA 3LKBA 1A7AA 3R5JA 3F8WA 5HTKA 3ROQA 1LLUA 3N59A 5E4JA 2BM9A 4ZMSA 5LR6A 1N34B 4M38A 2G36A 1VL6A 2IHTA 5IYZF 4NCBA 3NZEA 4H7DA 4HWKA 4YP6A 1UFRA 1CHDA 1FE8A 1NLYA 5T4BA 2CFRA 2A1TR 3B3QA 4G4JA 2WQ6A 2CHTA 5KHJA 1V5IA 4RJIA 3L0DA 3FCAA 1W0JA 3W7WA 4F5DA 3GLHA 1P2BA 2YNMC 4HK4A 3IIEA 1TZMA 1TMKA 2J9ZB 1EFDN 4S3MA 1NOJA 4HXGA 3S8MA 4RA6A 4L87A 4Z5XA 5KJ6A 3AG2B 1ZLXA 4KPGA 5K3FA 4GMKA 1GLVA 3ZK8A 4KZPA 5HXAA 1ESDA 5LBTA 5DEDA 4YQYA 3LU1A 4OOEA 2RSLA 4B85A 3PQ4A 1VCIA 2YUTA 4IJ6A 5DBGA 4F4CA 4KSBA 3H9QA 1Y4ZA 3RHSA 4DV4B 2YBDA 2ZI4A 4PSAA 3N2KB 3GFSA 2D1RA 2QNIA 2P3SA 1H9BA 1XVTA 1SKAA 1I33A 3RVOA 5L45A 5ALIA 3OBIA 3BE6A 1V11A 3MELA 2HJHA 1I10A 4L5AA 2Q68A 1XVVA 3L7OA 1G7RA 1WQ1R 3QLVA 1RBZA 3F49S 4CDNA 4WCFC 4GDFA 2GEUA 2BHRA 5JADA 3MUFA 5KHLB 4MARA 1UPGA 2GCNA 1M2HA 4M8KA 3FMIA 4MA5A 2GNOA 2JZCA 5ESDA 1GZHB 3IUJA 1CBUA 1SKQA 1RYFA 3ZEDA 2AS0A 1D1SA 2Q0AA 1PZHA 3UJ9A 4Y1RB 3K2QA 2Z2XA 4I55A 2GZ1A 4ZHVA 5LHGA 1D5AA 4Z9YA 4BATA 4G8BA 1VLVA 1N33B 2B0CA 2JW5A 2E4XA 1VPDA 2I4NA 3EDMA 7MDHA 3CIOA 3WWPA 4CETA 3TLMA 1FDOA 3V48A 3D3QA 5J1TB 1XNQB 2NSHA 1H2AS 3KYDA 4LISA 1NJ5A 4R6ZA 4JFAA 1J5PA 2ZWAA 2ZRBA 5ENVA 2P2LA 3WK7A 1CUWA 4BQNA 4NOKA 3L8EA 2X6TA 4HDSB 2PGLA 4GS5A 2OTJV 3OOWA 1WL8A 1IWBB 2H1CA 3D01A 3P9IA 1XG5A 1ESNA 1R6DA 1GRCA 2VDUE 1QIDA 5CDGA 2OVBA 1AKNA 2QRLA 1QHTA 1R5JA 2RH5A 3STHA 2W0SA 1T9AA 5G4UC 5KHIA 5D3MA 1JAXA 1B6SA 2VZEA 1QZXA 3M3PA 5EJAA 2L35A 4MWGA 1HK7A 1QAHA 1ZL0A 4BEBA 3RG2A 5EI5A 2ZYWX 4HXYA 3PXUA 4U7FA 3AWIA 2IHYA 1AB6A 5KJ1A 3AM1A 4MH0R 3TCNA 3L92A 5JDIC 1BE0A 2EL7A 2W6IG 4BMZA 4JDPA 5AJYA 4TS3A 4D8TA 5IAEA 1TGOA 4Q3CA 2O07A 2OAQ1 4R2KA 3VYTC 3TLBA 4KSYA 1NUQA 2Q50A 2EYUA 4NXNO 1F5SA 3UJAA 1RYDA 5I7HA 1J7HA 4NIMA 2C7VA 4Y2VA 4MKIA 1Z0IA 2EP8A 1L5LA 4KFSA 4XWWA 4CEIA 1U2ZA 3F4KA 4BNFA 4X7PA 3PC3A 4KH1A 4P34A 2E6KA 4BC1A 3SZUA 1PQYA 2OUKA 1JKMA 5A06A 5BSVA 5FIUA 5HNKA 3OX3A 2A9KA 4PS0A 1SQ6A 2BF4A 2VI5A 3TRKA 4PO3X 4HUTA 5CCDA 1LPMA 4QJIA 3UO3A 3P97A 2XVZA 2M2IA 1WMDA 2MDTA 3F7TA 1O9HA 2HK7A 1XYGA 2A0KA 1XDWA 5K0GA 2G67A 3K08A 3CRMA 4NCKA 2B69A 1VL1A 2JHPA 3R3XA 2QWNB 4BNZA 2WTNA 3W5HA 2Z3VA 1YGPA 1NP6A 1N3BA 3B8HA 2BCEA 5FWXB 1BOFA 1YL7A 4OMCA 5CURA 4JMLA 1NLFA 1MX9A 5CB4A 4PWZA 4B7CA 3TIVA 5T3YA 4XI9A 4UHKA 5DN6A 4OSOA 3E8XA 4RY8A 5FUXA 4D2IA 4OXSA 1VHLA 2RHHA 1XCPA 1FFDA 3FOWA 2XEXA 3VBCA 3N74A 4EW2A 4H17A 3TCXB 3SJAC 3AFNA 2ECOA 4YV7A 4YHHO 2AQHA 2ZATA 2TMGA 1U9ZA 3W7TA 4NHEA 1JEOA 3PUKA 1W48A 1T15A 2PO5A 3C8UA 4QELA 4C3OB 5LZ8A 2UZ4A 2EFJA 5MGNA 4UDOA 4GGOA 5BUCA 3VGJA 4J1TA 3I32A 4C78A 2PKXA 4JLBA 1YJBA 3QVJA 1YJCA 2MYNA 2YYSA 1DX4A 4LTMA 2ZB3A 4LTDA 4DV2B 3GH3A 2HKOA 3AFHA 3KL2A 2P62A 2EP5A 4PTLA 4K81B 1E6MA 1E2UA 4JITA 1AV6A 1P1CA 4JZYA 3AOEC 4KXFB 2X40A 4KE6A 1MZEA 2H1LA 4R68A 2NPFA 1GY8A 2ORED 3MRVA 4FOSA 3SS9X 3IR9A 2O8CB 4NZZA 1KBOA 3FPCA 1SF9A 4TYQA 1LBEA 1XSEA 2HR1A 2HHHO 2P79A 4M7PA 3LHKA 1Q57A 1V6SA 4TMVA 1RPJA 2YZKA 3LUKA 4HEA6 3RFRA 1WKBA 4PIPA 1QP4A 1KC8H 4E5KA 3JY6A 2IZ7A 1URFA 3X1DA 4HAUA 1Q91A 1XD9A 2AUNA 2W00A 4WE3A 4U5QA 2UUPA 1US6A 4JVOA 1JIQA 3O7MA 3W1EA 2VYND 1HC7A 3ZDCA 4G97A 4ZHWA 1IY1A 5BQPA 4HMQA 1ZSNA 4ZKDA 4ZVUA 2COUA 2ZYRA 5MGBA 4IIFA 4AG3A 4DR7O 3P5SA 1N0IA 2VG8A 3CRNA 4JEHA 3QWAA 2JS7A 1IQPA 1JHPA 5LMCA 3FKJA 4IGIA 4DDKA 5JAZA 2R6GA 4MPPA 3GU3A 1EDBA 1JI0A 2OGSA 3WB9A 4Z4FA 3EZ7A 1J23A 2Q4BA 2CH7B 5DMXA 2JANA 1DRVA 3DL2A 2BZSA 4G24A 5TJ9A 2VT3A 3N2KA 1XEFA 1NBME 1U31A 1JFRA 1KH2A 2QLFA 3ZVNA 4RK1A 3ZZNA 1FD9A 1OFTA 3L1IA 1JXQA 3R9XA 1QQ5A 4C4ZA 1LPAB 1MJNA 1GZ7A 2YUIA 1V5GA 3ZJTA 5IY5B 2LCIA 2AA3A 2H65A 3OE7G 2OG2A 2CWWA 4ZQGA 3ESYA 3RJ9A 5FTJA 2PRZA 3TSWA 1P7CA 1SCUB 2NR5A 2B9ZA 1VCOA 3CVUA 4IDDA 2ACWA 1CVLA 2IH5A 1XZBA 2VJAA 3PNYA 1FMJA 2P5UA 1P4HA 2I87A 4B3XA 2R97A 2PLAA 4M7WA 1QVRA 5K8UA 5A5DA 3ZBPA 4P32A 4Y1RA 2B83A 1PV2A 2Y1LA 3PC6A 2LV8A 2X2EA 4AROA 2YIBD 2D2FA 6YASA 3OM1A 1PV4A 1JCHA 4C81A 1XBTA 5AVQA 5CBGA 2C4NA 4RS3A 1KVTA 1W35A 3NHMA 1ID8A 2YDYA 2R7LA 4P80A 1EK1A 1SCDA 2IBTA 3OTGA 3CZRA 1LV8A 5T8KC 2II6A 1PVVA 4HDSA 5JSUA 3COWA 3R5HA 5FV7A 3RLFA 5BO5A 1IRXA 1GPLA 3MMXA 2C0QA 2FG5A 5DU2A 3C4QA 5AM0A 4QO8A 3C3SA 5HJ5A 4LOJA 1FY2A 1VG9B 2WF9A 5BN1A 1UMBB 1MB3A 1VDZA 4EGFA 3IQXA 4YK7A 5EHZA 1AJEA 2E76B 5TNXA 3U6KA 5HS4A 3ZX6A 1P3DA 3DMFA 2FN8A 1A9ZA 3JZAA 5JS1A 1BVRA 1XROA 3PFIA 3EZ6A 4J1NA 3IEIA 3NWBA 5LKAA 4RCYA 2ZSUA 2NMUA 2XOXA 3Q88A 1LK7A 3B1FA 3BYQA 2H1FA 4FSXA 1JJ2F 3IXLA 1OPXA 3RU2A 1Z16A 3TSAA 5IKMA 3QG1A 2VYCA 2VPTA 4DANA 2CY0A 3JRWA 4EKNB 2PVCA 1B8PA 4RFSB 1GUBA 4CMEA 2A78A 1QD9A 4GE0A 1ZGBA 3RQIA 4H3VA 4O1HA 5ADWA 4EABA 5EE1A 5KJFA 2DQ3A 3NUGA 1W4ZA 2C1EA 5AUPB 1AQJA 1TU4A 1C7RA 2SKCA 3EMVA 4UNIA 3HFGA 3V8VA 1SFRA 4PEVA 2IA5A 4ENRA 2CDYA 5GTHZ 3L71H 4FC7A 1G4YB 1PFUA 2CJWA 3ASZA 1E7KA 3OFJA 2Y0IA 4NYIR 1O5IA 1PNRA 5A9GA 3ZDAA 3E15A 3TQCA 2DMRA 4IIVA 3LPNA 3C6BA 3G2PA 3C5HA 5CXUA 4FDUA 4FFRA 4IDCA 5IEBA 3TL2A 1L7PA 2JFPA 4HEHA 1VKJA 1LRLA 3SX4A 1KPIA 5DHAA 1R50A 2GVDC 3PL5A 3F9IA 2ZRJA 2A4MA 2ODPA 4RPIA 5HDQA 4KGDA 3ZK7A 5FWXA 1CUCA 3DKKA 2CYBA 1S8OA 4U3FH 4AQYO 4WLUA 5CITA 2OZEA 4FN5A 3LUCA 2PEZA 5BORA 1DEKA 1MBZA 3WRXA 3QITA 4GCZA 4AJLA 2R79A 4YRFA 3OGCC 1ZD3A 1VQ6F 1KYZA 1B76A 2PZ8A 3JRXA 4R8SA 3TOCA 4ENWA 2R47A 4ENPA 1VPVA 3ED5A 4C2BA 4JT2A 1OHHA 2BJWA 4MROA 5C51B 5HMLA 2Z8YA 2WA4A 1M33A 4AXBA 2DFKB 3RRBA 2RGBA 3EXAA 3W2FA 3B20A 2BTQA 5C5EA 2IIPA 2C5EA 3F98A 1CUUA 4WHMA 1M74A 3ZJYA 3C39A 2UYOA 3KD2A 4IMPA 4DS3A 5BPFA 4F4UA 5BNFA 1LR1A 2OXEA 1SBIA 2XKJE 1I3LA 2CXSA 4XYMA 4YQFA 4YB8A 1KJQA 4KJXA 4ABMA 1UPFA 3AUUA 2FW8A 1W5AA 4ZRMA 1I0HA 5LMNO 5EEGA 3R77A 2GXSA 3E9EA 3W3AA 4RPGA 4MW0A 3P9YA 4OX9Y 4EG1A 2DUNA 2XMRA 3LCUA 2QUAA 2ZJ3A 3NB0A 3W7AA 4MW8A 3QLJA 4I9FA 3LUGA 2DFDA 3O83A 5CHEA 4Z7JA 2YFHA 1ONSA 5C80A 4UBJA 1G55A 3I0ZA 3AJDA 2ZVYA 3DOJA 4Q3DA 4X3PA 4DV3B 1GN2A 2IYWA 5BWCA 2O8CA 1JIUA 3E5NA 521PA 2ALJA 2R8YA 5FQOA 4WX2B 2O1WA 1VGQA 2VTVA 4G86A 3NUZA 2GPBA 1X74A 4Z2AA 2QW0X 1N2EA 5KB3A 3FTFA 3OZEA 4UDXX 1YJNF 1F0PA 1JQ5A 5A2QN 3KLBA 2PWAA 3GWGA 4CT4B 1DL5A 4U0KA 3AU9A 2ZUEA 3CCMV 2P2ZA 5KAMA 2D00A 3VDNB 3N87A 3GPBA 4IKEA 2MYTA 3RC1A 3SVZA 4W4LA 2JRLA 3IELA 1QMPA 3T94A 4OG2A 2Q2OA 3UV3A 4UOQA 3MMSA 2V03A 4G27B 3ZNQA 4KGVA 1JEEA 1U7XA 1ZRNA 5BUZA 1KOGA 3T52A 3NW9A 1WPXA 4KLNA 2V96A 1DIAA 1E3TA 1YZQA 2QTAA 3O3CA 4FLWA 3HZHA 2CH7A 1HNZB 1ZLYA 4UATA 4FBGA 2OEPA 3CEIA 3UGQA 1D8AA 1JZSA 2AVDA 4C04A 3P0FA 3H1IH 4G0PA 4LXTA 4NU5A 4U9IS 2VRWA 3J81A 4XB2A 1U0OC 2PCLA 1YOVB 2QZ4A 1YFJA 2VSYA 1WUTA 4BT4A 2YMPA 2CMHA 3CD6F 3DLAA 4RZQA 2WF8A 5F7XA 3OT7A 3DE4X 1RPRA 3DV2A 3Q7PA 4LBVA 3MCTA 1ZYUA 2BGWA 1IHOA 1K5PA 3ZDEA 3QXHA 3MUNA 2F7SA 1SCUA 4NMHA 4KAFA 5EUCA 2B1IA 3L6EA 1I1NA 1YI0A 4DWJA 5CCBA 3SXUB 1HW7A 3CVWA 1E2NA 1DAOA 1ECBA 5L40A 2BT4A 2C5LA 4Y6PA 2ZFUA 1WP4A 2QEQA 4FW9A 3I72A 2B98A 1JT2A 2EZ9A 5SY9A 4WZAB 1M2FA 3B77A 1AZSC 1EK2A 3WJ2A 4XVUA 5FJIA 2HO5A 3WWDA 3IDQA 3ZTYA 5ADVA 4LC0A 4J9YB 4LYEA 1KY4A 2R9VA 3R7NA 2P9BA 1PWHA 2JLYA 3P52A 2C8VA 3NR7A 4LY9A 1S96A 5KAFZ 1T2UA 5KINB 3TETA 3OAAG 1B2LA 4GOLD 2NYUA 4QVGA 5B37A 4UULA 2FX2A 4NFYA 1H5NA 1UMDA 2E74B 3EPHA 1ZJJA 2AIRA 2NZVG 2ZE6A 1I2ZA 5D84A 1R1DA 3FWHA 1RC0A 1U8TA 2MQEA 2I7CA 1VQ4V 1WZEA 1HDXA 4A3SA 3QVSA 3CZAA 1UMBA 1PCXA 1VMKA 1VJTA 2A5DA 5AFSA 3AI2A 5K01A 1Y1LA 3E9ZA 1Y4DE 1OV9A 1EVYA 5GM1A 4DKXA 5AW5A 4EZBA 4OFXA 3V1MA 1Y5NA 1GNPA 3C7DB 4NU6A 1P7GA 3O9MA 5CG2A 3BZBA 1TVKA 4B3JA 4WFBV 4IM7A 2DKFA 1G8AA 4B6SA 5F3DA 4L8JA 3CR3C 3VKFA 5CT6A 1QCYA 2R7MA 5EK0A 2QWQB 3GRRA 5ELLA 5K0TA 5CIQA 2VAMA 1Z06A 4LJKA 2P9GA 1H8HG 2NSDA 4YRQA 3OC0A 3B4SA 3OWXA 3DHVA 3BRCA 3K9BA 2V65A 2JGJA 4RFSA 4QXPA 2I2FA 5CEFA 3BBPA 1FJGB 5GGYA 4GUDA 2I67A 3FCUB 4M9SA 3QTTA 1M7GA 3JYHA 4I7ZB 2BI4A 3N2YA 1J00A 1HDZA 1A7JA 5F51A 2X6BA 2V8BA 2C3UA 3KUCA 3PRYA 1RXCA 1P7YA 1Y1SA 1PT7A 3FCEA 4R2WA 2NT3A 4WSOA 3GLIE 2HJGA 1DT5A 3ZMVA 4F5ZA 3TSOA 2B94A 4FQ8A 3TTXA 5BVHB 2NV0A 5B1BB 1XMQO 1YASA 4NY1A 3G0BA 3RUCA 1NVGA 3ZKAA 4TZTA 3ZW8A 2V7VA 3ZI7A 2HKIA 4G0MA 2FZWA 3C74A 5JS2A 5LC1A 5B3LA 4GL4A 5AKYA 1ZOOA 2WA3A 3PPWA 4BNUA 4M1YA 3L77A 2JH3A 5GTIZ 1YRBA 3VQVA 2WWHA 4BTEA 4N6OA 2IZ1A 1LU9A 4UASA 2VJOA 3O2JA 2IH3C 1TCVA 1G4UR 4RS4A 3EC2A 2FXVA 2P69A 3Q6IA 2DYSB 4BZXA 3MDOA 3SNKA 4LFAO 2PBFA 2ZS8A 2PSFA 1XHZA 1SHZA 4AIRA 2Z9CA 2QP3A 5ULLA 3CMMA 1HNWB 4KQKA 4GKJO 3OIDA 1I0IA 4O3MA 2V1UA 1SN7A 4L5IA 4P4GA 3G6WA 4B74A 3WYGA 4G5OA 3PSHA 1DZ3A 4ZVKA 3Q8KA 3UHPA 5DNCA 2OCDA 3FFXA 4L0DA 1HNXO 1C0EA 3FGPA 3OLQA 3A6ZA 3FBGA 3UWSA 4O2BB 3UV6A 3G7UA 1VE1A 4TROA 4DRZA 1U11A 4C05A 2PNJA 4H35A 5ALGA 4JODA 5A6SB 4RCZA 3SJZA 4YUZA 2QDXA 1W30A 4GI1A 2ZSFA 1E79G 1XTTA 2GF2A 1QQ7A 5JTTA 1YKFA 1E94E 1OAAA 2H4ZA 2RHLA 1ZGGA 1GKIA 4CQLB 1PL4A 3U7HB 2D5AA 4JJ8A 4B7KA 1IJKA 3EHBB 3W3AH 2HIMA 2BFOA 3V1KA 1XDBA 2WW8A 3JW8A 4CL2A 4QD3A 3C3XA 4FB5A 3IT0A 3IUPA 5T6BA 3BS4A 3C2QA 3S27A 4DMKA 1T91A 1DJMA 1OMOA 2DULA 1IURA 3UA4A 1SZQA 1SOUA 2G6TA 1UJMA 5CTAA 4B7EA 3SLRA 1AKVA 2AI2A 3V32A 2QQEA 2W8BC 2JFWA 3WTCA 3K31A 5BW5A 2I65A 4J6EA 5J4LA 1DAMA 2GZLA 4IFEA 5KO2A 3EFOB 1F0KA 2J3HA 4I9UA 1N5JA 5BSWA 1GPUA 2GMWA 4G8JA 2J1LA 1C3VA 5TR9A 2WYIA 1EVQA 2DJ5A 2JRCA 4RTKA 1U9CA 1OW3B 1YJWV 1QIFA 2P5TB 1LS1A 4ZZ2A 2FP4A 3O21A 1ZK2A 5D5QA 3GAZA 4V0RA 4LK3A 3KJKA 1EX9A 1U3FA 2OCGA 4KQCA 2JJ1A 1DLIA 1OGYA 1PJQA 1VQPV 4YN3A 1IV1A 4NCAA 4LSMA 2O52A 4HMOA 3CCEV 1B3RA 1QCEA 3ND7A 1SESA 2E2WA 3H18A 4O29A 3ZNOA 4N0EA 1IY2A 1CVRA 5ALUA 1EWRA 2ZTLA 3U4AA 4ND3A 3I83A 4CKBB 4ALLA 2PMPA 2QUKA 3H86A 1O95D 2WUWE 2CKMA 3F6BX 4PLTA 2R6AA 3OURA 3H4IA 4RQAA 3O75A 4MPDA 2FEMA 2W2VA 4QYSA 1YOVA 4FFDA 1K4KA 5HBGA 2AZ0A 3O3MB 3M6LA 2LKCA 5CNJA 3A6FA 4RETA 2CMDA 4ZPXA 3VZQA 4DXWA 1Y8CA 4HGYA 1NGSA 3LBAA 5CXXA 4TXJA 4J2HA 5FNVF 2VL7A 4II2A 1YRQA 5EWLA 1I14A 3LTEA 2ATVA 3V97A 1CUDA 3GN1A 4H6XA 4QGFA 3L5KA 2AL7A 3UA3A 1N36O 2HMYB 5CFPA 3EG5A 3ZIAG 1PL0A 3WGYA 4JFRA 1RIIA 1II8B 4EIWA 4V0SA 4MWTA 1K1EA 4TT3A 3I2IA 2CMGA 1A1VA 2O3JA 5CA0F 1B6QA 3G6BA 4QYXA 4WZAA 2M6LA 3I3OA 4PX5A 3OD1A 5AO9A 3J80A 1YT5A 3RVQA 2I80A 4JP3A 2P67A 1QUFA 3FHCB 4KWCA 3URMA 2BSAA 2G88A 1TYAE 4ZVQA 4TL6A 2R25B 1OYYA 1ZM3A 4EY6A 3HVIA 1NJ6A 1C1XB 1OVMA 3ROFA 2XYRA 1G2IA 4FK5C 5EBLC 4JJ7A 2H85A 1OX5A 2OV3A 5CDFA 3CO0S 3NETA 1A2KC 3MBMA 3ASVA 5IW8A 1PFKA 3DSRA 3Q4HB 4PDVA 4DR5B 3V6LA 4XDGA 3AF5A 2WPDA 3U40A 2JCGA 2J59A 2VGNA 2VATA 3WDLA 2AJTA 3MLBA 3DKPA 3SQXA 2D2CB 3C3CA 1HF3A 2D1TA 3OQIA 2OC9A 4YAFA 4KVZA 1H93A 1G4AE 3UXEA 1PWXA 2A3QA 1VSBA 2O2ZA 2GM3A 4DY6A 4EHIA 1Y6QA 3UGTA 2LBXA 1NURA 3EC7A 3G5UA 3VR4H 1ZH4A 3BXXA 4F6CA 1I7QB 4BBJA 4XUCA 2J3EA 1IK6A 2IEDA 2HJWA 1R5OA 3KE8A 4I9NA 1NONA 2PV0A 5F2KA 2IELA 3LQ4A 2O3TA 1T6YA 2BONA 1HFEL 1QTQA 4TN1A 2O5CA 5A0TA 4MS4B 5KHOC 4OXYA 4FJ1A 2EFEB 4N41A 4OHUA 3V8NA 1PWZA 5DT9A 5UKDA 1JIVA 1CW2B 2B2NA 3ABQB 2H2GA 3ZNPA 4AUEA 2DPGA 3IT2A 4ISCA 4RIEA 3BIXA 3QW4B 3UMBA 2R1TB 3FTNA 5GVSA 3W8DA 1DGSA 3AG1C 3VTFA 5LD2B 4F85A 3HMQA 4ISBA 3H2KA 4PFJA 3CPHA 3OX2A 4OREX 4DN6A 1AJPA 1LQUA 2I4MA 2DUUA 4UE2A 2R87A 5CLHA 3HJBA 4P3PA 5COAA 5A0VA 1MH1A 2W9XA 3OTFA 3ZWNA 3VPGA 4RLSA 1E9SA 5FWNA 5D3QA 4ZT4A 2JJ8A 2FRDC 1K2VN 2VQDA 1N8TA 4F56A 3KQYA 5BVHA 1QLJA 3TNDA 4HB4A 4TYNA 3WHIA 5JS6A 2I9PA 4JUCA 5JT1A 2CVQA 1IDN1 3AHEA 2A58A 3QFTA 5FBVB 5LGTA 1S2IA 1BT8A 2BDUA 3E7DA 2QVXX 1QFSA 2NU7B 2R8RA 1ZHFA 3PGA1 2PH3A 2PUGA 2A86A 4DW0A 2HNBA 1E66A 1QOPB 4WI1A 1WV1A 5JE8A 2OV1A 4IHAA 4MVQA 2JF0A 1GPNA 1U7ZA 2PRYA 3EZYA 2OTJF 4YV2A 3TOSA 3UPDA 5EWJA 1UBGA 3STUA 2ZU0C 1NI8A 1K4CC 4O2BA 1RKQA 4HQKA 1WUJS 4TMKA 1JA0A 1WCXA 1NZFA 5A6SA 4ZP1A 4GLBA 4CZZA 3RGBA 1O94D 4OHRA 4DT1A 4QFCA 5EJFA 1QORA 4TM8A 5BQ5A 1OKKD 3Q72A 3W9UA 1EM8B 4QNRA 2XXBA 3KUKA 1Z6PA 4CQLA 2EWMA 4L1KA 4FIZA 4HI0E 4LCBA 3GLHE 4H44B 1IPAA 2OWOA 4C7KA 3NJ8A 2XDQB 5JAIA 4U2CA 4BCDA 1PFVA 2EGGA 2V9PA 5KWVA 1VI5A 3AG7A 4RXTA 3AVVA 2VAXA 1UK6A 3X1XA 1CP2A 3WWEA 2WJIA 1YITV 2WEKA 3EXHC 1TC2A 4C88A 3A4LA 1W94A 3R7WB 1XRRA 2ZITA 5DGHA 1GN9A 2G09A 4CRWB 2A9RA 3QQPA 1FP1D 4PO1A 5ERYA 3AY0A 2C58A 2OV4A 2V8OA 1CEYA 4EW3A 3GFGA 1R2QA 2NSLA 3TZHA 2W71A 3M5CA 3A8TA 3NGLA 1GYRA 5KNBH 3LWRC 3VTZA 1IZ3A 5M5BA 4RVSA 4S35A 1RRMA 2IGBA 4P6VF 2BEUB 1GN6A 4N5DA 4UD6A 1A5BB 2RHWA 4XUGB 4BV2A 1HYBA 4HLUA 4IDFA 1ZR4A 1LH0A 4MB0A 5G40A 3M6FA 1E3JA 2EVWX 2DU8A 1X86B 1VH8A 3OZFA 2OXTA 1FS6A 4G63A 5J2TF 4IJMA 3P7MA 1XAIA 4EY5A 4HNQA 3BXGA 4JNKA 3IAAA 2DT4A 2X4DA 3K70D 4PZDA 2A1UB 3STZC 1DCMA 1WQ3A 1RAFA 3WBFA 4A2QA 1O5TA 1KK3A 2G4VA 1UMCA 4DREA 1Y9JA 4PC2A 3MHPA 1QPBA 2PSDA 2PX5A 3MLEA 4JB3A 2C4UA 4K86A 1M76A 1X19A 3L43A 1KBZA 2QSJA 3H3JA 5K4GA 4MJLA 4CKBA 2ZE7A 2AB0A 3H9BA 2VTKA 5CB8A 3P94A 3Q9NA 5HWSA 1J8VA 5I9SA 1NQ5A 3SD7A 1NXQA 3RYFB 3VSCA 3U9TA 4N7MA 2QBYB 1BFUA 1UBRS 1JFSA 1W59A 2OZBA 4HAIA 1SRYA 2JEUA 3NWJA 1TA8A 3TX2A 3C3YA 3VHLB 5ALYA 1GITA 1R6KA 1N1MA 4HDOB 2C88A 1W8DA 3WK9A 3AK4A 1MKYA 3OUTA 4PAQA 3LDUA 1YDWA 2DUWA 2X8BA 4PLFA 3H4MA 3I53A 1RHMA 4FDTA 3OHSX 1TIBA 1ECGA 2YC2C 2ZBQA 3DQPA 2JFOA 1II8A 2AW3A 4G85A 4WW0A 4KGXA 1RWWA 1E4VA 5B1NA 4LJSA 3H65A 3W2IA 2O7NA 2WMDA 4EG0A 2Z30A 1A50B 2AN5A 3LBHA 4X3OA 3L6RA 2VSQA 2FEXA 3BJEA 1KI4A 4WNCA 5TY0A 4FFMA 1P91A 3EUFA 3HCWA 4MRSA 4MPJA 3ZZ0A 3IURA 4FC6A 3TI7A 1KJ9A 1X2EA 1GZ3A 2IEAA 2RDMA 2C42A 4US0R 4UVEA 3CSDA 1DHRA 3O8OB 3TXQA 3A70A 1MZVA 4UE3S 1WTAA 2FZVA 3PG5A 3VUFA 4IPTA 2GXUA 2OHJA 4H3KB 5LQMA 4FFWA 3Q4HA 3PCTA 5EQJB 2YFQA 4X5OA 3G02A 2VQ6A 1KNJA 2GA9A 2WU4A 1TGYA 2XUQA 3BHNA 3FGNA 2FSPA 1IQRA 1K6EA 4FNMA 4IIJF 3T7AA 4QJBA 2YYAA 4MUHA 5H16A 1DRJA 4LZAA 4QGSA 4EMSA 1XD2B 4H31A 4PA6A 3N3BC 3CZ5A 4EVRA 2ENUA 1EA5A 2QX4A 3HLTA 3SDBA 3TVYA 1RWVA 4CH5A 1RHJA 2OLEA 2AJDA 1U5BB 4LF4O 3HL4A 1JLLB 5JTUA 3QNUA 2ZBPA 4EX7A 1AN9A 1QR8A 5G1OA 4DQXA 2ZWIA 3LFOA 3KHNA 3T41A 3HXMA 2ZZKA 5C1BA 4MS4A 1M10A 4EG3A 4ON9A 4QUDA 4PQRA 1U43A 2IYYA 2YHIB 3FCSB 2UXDO 3CEHA 5AJHA 2JFBA 2R1TA 2QW1A 1H2LA 3E1KA 3U39A 1KZ7B 2K7FA 3VAZA 4NBVA 1VHAA 1IK4A 5DV9A 3FAVB 1PDWA 2JK1A 3PEUA 1HE8B 2ZVZA 4A2WA 3S2IA 3OUSA 4ENQA 2XTZA 1KVQA 2H1IA 5J9FA 3T3IA 1O4VA 3OF5A 3X3HA 4FMCB 3NEJA 3E48A 3QUBA 1Y5IA 1WMFA 5F9MA 4R71A 1KO8A 4EFDA 1FNCA 5HKLA 3D4LA 3V3KA 3SI7A 1J21A 4FSDA 2GYUA 4MV4A 2AN1A 2NLOA 3K0TA 3QU2A 3JZDA 2WQZA 5DM70 1Y7LA 3J81N 4GPTA 2FEPA 3HY3A 3U1TA 3C7CB 3BIJA 3ZK9A 4DNPA 2NN4A 2NU7A 2PY5A 3K6JA 2ZQMA 3VMFB 3VVLA 1WBDA 1PR2A 5K3DA 2P9HA 3SLGA 1PT8A 1SVKA 4MVOA 4WPGA 4OQZA 3UBTA 1Z4OA 1PJBA 1Z4MA 2AX4A 1T4CB 1AMOA 4IVQA 1QHSA 4MS3B 4TQGA 3EIWA 4OI4A 3LDCA 1GRVA 2Y66A 2YRXA 1LDYA 4BQOA 4ZGWA 1OX4B 5JYBA 4DHEA 2IOYA 4MW7A 2E3JA 1GL3A 3R0QA 1PLLA 2D1FA 4HS4A 3F7YC 1GV0A 1JDBC 4ZOLF 4JX8A 4CDGA 1I7LA 2I4TA 4M1MA 2NZXA 3KPJA 1A77A 3KZMA 3GDHA 4PSUA 1G3IA 2WJWA 4L9AA 3OAAD 4G9BA 4GZ6A 2ZKLA 2WIBA 1NF3A 4XD7A 3EAQA 2WG0A 4RESA 1AK1A 1EM8A 5H4HA 1YZYA 4OUDB 1V25A 4P92A 3ZLJA 1LTQA 1FDVA 3SPXA 2BZGA 4IXTA 3LQ2A 2IU6A 3G23A 2FQ1A 1ABBA 2H4XA 3GAFA 1XRJA 2IBZH 2EZOA 3FMFA 3WYEA 3Q0IA 2RJ3A 1MW8X 4LRTB 1X4TA 3R7WA 5D7BA 4WMLA 2HH9A 1PUIA 4AF8A 1FXVA 2RHDA 4NE2A 4DUZB 4NQZA 3D6UA 2V98A 3E7PA 2QKSA 1H8HD 4QOSA 1WVGA 4OSPA 4R1PA 2BEUA 2EOAA 2EX1A 4WFKA 3NU1A 1W87A 3UN1A 1OU4A 3UJ6A 1VIMA 3QJGA 1HORA 4G1CA 1ZI6A 1OCRB 1H2FA 4BNTA 3RTGA 4B3SB 3HB3B 2XKAA 1PD0A 3UMVA 2BE3A 1XJCA 1NVWQ 1QU2A 2FMTA 4DWOA 2XNDG 4OO3A 5THQA 3OEHG 221PA 4W5HA 5KDDA 3CCUF 4JENA 1G5FA 3FBTA 3OESA 3UF0A 2FH5B 4GKVA 2VDRB 4YDSA 1LB1B 5CBHA 2O2EA 3RBZA 5THXA 5C32A 1OLSB 3DAFA 2A1UA 1CG6A 1WP7A 3PSAA 1BU5A 4BW9A 4LH7A 2CBGA 4G65A 2GPSA 3I2YX 4OMUA 1C14A 1COMA 3RVMA 1M93A 2AJ8A 1XDGA 1N1DA 3RS4A 2F00A 2HF7A 3SEAA 4MB6A 2OORA 3F3SA 3NV7A 1I7DA 5HY1A 2GXQA 1TA4A 1RWOA 5EHQA 3CCJV 2O6HA 4RKWA 4KNVA 2JS3A 1R6VA 2ZYHA 4CLRB 4I1YA 2HN9A 3RYFA 4KRFA 3VTIC 1R74A 3QKWA 4WTOA 2QBYA 3SJCA 1YQXA 2O48X 1VQ5F 1KEKA 5LWHA 2BGTA 1ZRSA 4B6OA 4BFCA 5BNZA 4EB6B 1B04A 5A4IS 3PCRB 2E7ZA 2OFPA 3G0GA 1IIRA 4K6OA 2MYPA 5J58A 5ESWA 1AV7A 1HWYA 4I4NA 2A06H 4LDQA 4LZZA 3ILYA 3TXYA 4FZJA 4JIGA 3WFIA 1ACLA 1DV2A 2A9JA 3SHOA 4GPD1 1KF0A 1E5LA 2X3FA 1W2HA 4RO0A 5JWRA 1PSWA 5WRFA 2FPLA 5B1EA 4DLAA 3NEYA 4CV3A 4ZYZA 2CFTA 1E79D 3V4LA 4CF4A 4MYCA 2UUAB 4NNOA 1Z7YA 5BQOA 1ZMBA 5I4BA 4BFXA 1HQKA 1X38A 1OCCC 1ZBDA 3B40A 3T1YB 4BX0A 3ZHVA 4UMVA 3KQPA 2VPXA 2X1HA 4EUNA 1XRNA 3WLHA 2ETXA 2DKOA 2E87A 2HLDG 2WLSA 3FGOA 3O8OA 3QENA 3AK1A 1XZLA 2ZE8A 1XI1A 3WOVA 3VUEA 1M90W 4FIPC 1EE9A 1A9SA 4BFWA 1Z33A 1OAOC 1MORA 2H1HA 4CF7A 2B3DA 1E5QA 5ESXA 3I01M 4FNOA 5TGZA 1I8TA 3CCMF 4WINA 3D6AA 4YBZA 3I30X 1UXGA 2D6FA 3Q8WA 2YV2A 4HPJB 4AB1A 4INPA 1GRQA 3EUAA 3DUFA 1X0VA 3LGAA 1GPMA 4Z0NA 3TD9A 3B1YA 3Q8XB 1BKDR 4EPXA 1BAPA 2P2CA 2XUFA 5L3RA 2BMJA 4Z3OA 2PSSA 4XE5A 2POCA 2TMYA 5A3VA 1JLLA 5JAOA 1TVMA 4KE7A 1P72A 2ZGVA 4FWBA 4WJKB 4KUEA 5EHGA 3KB6A 2GEBA 3G2KA 1TUBB 2IYQA 5LCXA 2FP3A 4EF5A 2QW8A 3LWPC 1H2XA 1AILA 2G9NA 3TL3A 2XBMA 4TMXA 3UJCA 3NNSA 1U1FA 3K4HA 4BZWA 4UE6A 4Q4CA 3V4SA 1ZNZA 1MEEA 4TUYF 2YHIA 3WZLA 2ATCA 2QD4A 2WV9A 4LYDA 4TYYA 1H0HA 1XFAA 3MQWA 1ANKA 3DZBA 3GVIA 3B3GA 3HYRA 3V7FA 1UKYA 3LXRA 4DA9A 3FAVA 3AERB 3QH4A 1N8RH 1RM1B 1W2WB 3QY9A 1F3LA 1LBIA 4IYJA 2JVJA 3GVPA 3UK1A 3JPYA 5F9FA 5LHHA 1GQYA 2H5IA 5L6MB 3KTFA 1KIAA 2BCCH 1AI4A 2W42A 2XAUA 1P8AA 1RWXA 4K87A 1XA3A 1BIFA 3SF8B 1LLCA 4Z9BA 4BO5A 4NCHA 3L8CA 5I7SA 2HI0A 3BDAA 4TL7A 1WWKA 3C9TA 4BVQA 5DWVA 1IB6A 5J63A 3RJMA 3V8PA 2COKA 1BZYA 2UYYA 4CS4A 1H3NA 4YI3A 5FUYA 5FI0B 4DIMA 3VMFA 4UZEA 1YKSA 3ZIAD 3HCBA 1KU6A 3FIJA 1DJNA 3IP5A 5DKFA 2UUBB 2QLLA 3AHJA 4RF5A 1MH9A 2JGKA 3WB1A 1T4CA 4WH0A 3MGCA 4MS3A 2Y48A 1DT9A 3Q8HA 1OX4A 5ARBA 1NA5A 3Q3VA 1KH1A 3DAYA 1C29B 2CZWA 4RFVA 2VF7A 4QOEA 4NE9A 1DTWB 2EJWA 4DARA 1Z6ZA 1NVFA 1D0IA 3JAWB 1KZ6A 2LE0A 3OIWA 3H1LH 2WU8A 4YMTA 4LHXA 3E6AA 3J80N 5JPCA 3UY4A 4Q7JB 2ZPAA 2Q0HA 3MSCA 3E5MA 1G3MA 1X1RA 1Z47A 2NO9A 3WIOA 3G8CA 2VT6A 3QKSB 3MAQA 4CNQA 1NMSA 5EL0A 2ZTSA 3AGKA 4OUDA 5L3CA 3KYCB 2OFOA 3BIWA 3MZ0A 4ZCMA 1WOYA 4LWOA 4EMUA 3D0QA 4JL5A 3HVJA 3WQBA 1PD3A 3K9AA 5AM5A 5KWJA 4MVWA 4PVDA 1G59A 5BW6B 3GZNB 3DYIA 3EZXA 4EKYA 2JD2A 3JVIA 4QFDA 2IU3A 1ODEA 4BXOB 3DBHB 4TXHA 5L7TA 4C76A 1JQDA 1RKUA 3Q2OA 3QTBA 2DPXA 4WEOA 1XRMA 1CYDA 4RACA 3W2HA 1MQAA 1DOAA 4XKJA 4M21A 4O4JF 1ODCA 1HYEA 4B6PA 1VBKA 2V1DA 2VHTA 2GDZA 2M6SA 1LX7A 3M4XA 1VQNV 4EY7A 4F4HA 2EFHB 1AGYA 4QUAA 4WFQA 3TQHA 4KUMA 4KR2A 4LMBA 1PFWA 4E7OA 1QSGA 4CCYB 3FCCA 1CLEA 5IT0A 2AHZA 4UTOA 1U0EA 1XCOA 1E6UA 1NM5A 3FFBA 4YJ3F 5AI5A 1CUAA 5JWPA 4RLHA 2BJVA 4O2RA 3VCZA 3BXOA 3F6RA 3BWCA 3ZI0A 2B61A 1C41A 1T9ZA 3Q41A 4PA9A 1U96A 4UM7A 3ECAA 2RH9B 4Z3KA 3CXRA 5BMVB 1RBYA 4IEFB 4LFCB 4GWLA 3S3XA 1TJ4A 5KTMA 1RXIA 1YTFD 1P9RA 4WCEV 3B5JA 2DHRA 1PP4A 5JAQA 3VZPA 4QVIA 5AVXA 4KMMA 1N5IA 2JAOA 3AP1A 3OG9A 3SIXA 2H7CA 4WVLA 1Y6XA 5GONB 4HDMB 2AXQA 3SZOA 3DE6X 2ZJYA 5GAPK 3DONA 3JVUA 3DM5A 1M5RA 1D5NA 4CLRA 2FPOA 2ZDIA 5EIEA 1TEZA 1RP1A 5LYJB 1Z4LA 1QYWA 2IYNA 3CHYA 4IGKA 1OYOA 3B78A 1N0HA 2GX6A 3DOEA 2FV8A 1TM7E 1I7FA 3CLSD 4GOJA 4LHZA 2X2OA 3PJFA 3INRA 4NZNA 3VNQA 2PX4A 3OZWA 1RYBA 3RD5A 3O6VA 4U02A 1E60A 4UNSA 2DHCA 1U0LA 4D3SA 3K9FC 2QUBA 2HMAA 4RZ2A 4NATA 4JTDB 4D44A 3BK1A 3F73A 2YIDA 2ZIUB 1J0AA 1T8YA 3BEOA 1JN0A 1SHJA 4L85A 2IQIA 1UADA 1OCZC 3JD0A 1XHOA 2FZGA 2VSNA 3COPA 4OPAA 3CNBA 2KMLA 3BMXA 3F96A 2JVIA 1DNPA 3NIDB 2K5UA 1CIPA 1YIJV 3K70B 2C9OA 2HL6A 4DABA 1M56B 1Y3FE 1UKEA 4AY6A 2ODMA 3SIUA 1YUBA 5KVSA 5CCXA 1Q84A 1QBGA 3QK7A 5HCIA 3RW0A 5GIOE 5U9CA 2VZLA 3DNMA 5BN4B 3K20A 3MFYA 3IEXA 3GL9A 1BN6A 1A2BA 3NASA 4F9EA 2PTHA 4IXDA 1S2DA 3BJRA 3K9WA 3T7JA 5DBIA 1K98A 1UJ4A 3LPCA 1BHAA 4NWIA 3TD4A 4EI9A 1KWKA 4Y1GA 5AI4A 2HB6A 2G82A 9LDTA 3AR9A 1N9KA 3IODA 4MUGA 1A8IA 4R5HA 5IX8A 2RK4A 4QOIA 1PV0A 3HZRA 4QXQA 1VQPF 4J7AA 4N7RA 3PTZA 1NH2B 1Q50A 3CCEF 2YFYA 4B73A 1QFZA 2VP9A 2P22C 2X0DA 1TUBA 1CDDA 1A8HA 4Z6KA 1G1MA 5ICCA 4DV0B 3X44A 3KXLA 1TAHA 2B25A 5C0OE 3TQRA 2VJYA 3SMQA 4IDEA 4P36A 2BH2A 3B7WA 1FBNA 4NR1A 4P4NA 1XF9A 4Y7DA 1VXRA 2ATEA 1T13A 1FKAO 3GMDA 2Z1NA 2OK8A 3D7KA 2IJJA 2DEUA 4DE5A 4G1UC 3MT9A 1FTSA 1SZPA 3GA0A 2B2CA 3AERA 1FYFA 2ZREA 4IRXA 3PCXA 5HOQA 3O8QB 2EG9A 1EWYA 3IBYA 4OJKA 2YIMA 5A05A 2VH2A 1KJJA 4YYZA 2CVZA 1B6GA 3L18A 5DHRA 5KOYA 2V3CC 1BOOA 4XDKA 1DLBA 2F62A 1S76D 3Q8LA 2XUHA 2HSJA 3WLRA 4BHTA 4OLHA 1PJTA 3SF8A 2OHXA 2PLRA 1XDCA 3EQ8A 1CY0A 1E4YA 4QWWA 1H2EA 3CMEF 1PE0A 5JI3E 1KA9H 5A9SB 2FF5A 1KAEA 1QX4A 1SC3A 4JCOA 1KORA 4HBZA 3UXYA 3JYLA 3OJXA 4BVEA 2IIBA 5HG0A 4ZHQF 2H8KA 4JI0O 4DR1O 3T7DA 5KNLA 1E5TA 1OB2A 3C1OA 3H1AA 4ZO4A 2O4UX 5J1SB 2OCIA 4A8JB 3L7MA 4KXLA 3ITNA 2QZ9A 3V4FA 1ROPA 2PMCA 1DS6A 3B82A 5LFAA 4FEAA 2G0TA 1DAFA 1LF0A 4P83A 5DIZA 1IPFA 4CV2A 3WLPA 3R3SA 3HPQA 5EQFA 1E1LA 5AW9A 4L6CA 3HV0A 1N0NA 4BY9D 3AFMA 3IR6A 1DTWA 3QTYA 2QM4A 4HADA 1F2VA 3JAWA 3LRXA 2FQXA 3RABA 1SC1A 4IIXA 4ZANA 3AVOA 2P6MA 2DQKA 2GJKA 5JD4A 3OCCA 4KQIA 3HXOA 3DE0X 1E8NA 3QKSA 1A2OA 5JY1A 2EF0A 4MVYA 2WKRA 3SK0A 4ICIA 3K2BA 2WJJA 3KYCA 3CLUD 2J87A 2EJTA 4MEJA 2E21A 2PZSA 3FPLA 3KBBA 2C9BA 3ZLVA 2C7BA 1AUOA 2HVYD 3DOUA 1WP8A 3O1HB 4W1PA 3BYZA 2XDWA 3ACBA 1CPYA 3BVOA 3EWSA 4GQAA 3WJRA 4CC5A 1LJ8A 5DSXA 3ICWA 3N0VA 4BXOA 3DBHA 1YHQV 4WACA 4V03A 4KR0A 2K4MA 4YRTA 2OCCB 1M2OB 2ZB8A 1Q5PA 3UICA 3NPAA 2F9LA 4HLCA 3HFJA 2J5XA 3UMFA 3NWEA 2OMKA 1NT4A 2Y71A 2QVCA 1XL0A 2R65A 2A0XA 4WRRA 4BAUA 2QPTA 5HIKA 3P9CA 1Z6GA 2Q5LA 1TUEB 5B4TA 2VTBB 3OQOA 4DV6O 4G23A 4CCYA 1V96A 1U2RA 1QGYA 3EGOA 3DPUA 1KIMA 1I94B 3M6AA 4GPBA 5AUQA 4HJXA 2RHBA 3LFTA 1SCJA 1XL4A 2V9YA 1U0TA 4RQBA 4RJKA 4O5OA 1BEUB 3OTIA 1Z17A 1MQSA 4NDNE 3VR4A 1I13A 3BBLA 4IIHA 4TWRA 1ZN9A 1RFYA 3T12A 3RSOA 2WWRA 5BMVA 4FQ5A 1CJSA 4MIKA 4Z2WA 4GM0A 7ABPA 1EG2A 5KCMA 4OHCA 2FR8C 4U1RA 3VC1A 3C9RA 2Z57A 1JVSA 4U4AA 5G0SA 2OC4A 3F6YA 4MR8B 3O73A 5HKOA 3S0YA 2QT0A 1PTJC 3NQ41 1ADGA 4HDMA 1SURA 3T4PA 3PQ3A 3A14A 2R6FA 4GOOD 1VPTA 5AVRA 3NKFA 3B51X 1XN4A 1OASA 4U2FA 5K0EA 1A71A 2F4VO 1NFFA 1CF2O 4D9BA 3BXZA 2NWQA 3ROGA 1LLFA 3AF4A 1U28A 1XEWY 5LYJA 4RHUA 3AZOA 2CJYA 1VHQA 4ZCIA 3SR0A 2J45A 1W49A 3UMCA 4BX2A 1O97D 2RD2A 3ANMA 3ZRVA 4BLUA 4PQFA 4YRDA 4NI5A 5TRTA 3LWDA 4H27A 5JXIA 3HBFA 1QU7A 1JHAA 4NK5A 3ZE7A 1VHTA 3Q9LA 4I9QA 1I4EB 5ITSA 4D96A 2QRQA 5LL6P 5JROA 4N7BA 4N3NA 1ISRA 1P9WA 3A4TA 1EJ2A 4K8RB 4KR3A 1QO7A 3QELB 2JBAB 4PHZA 5BY1A 4J0JA 4FLUA 2I33A 3P32A 3PUIA 3IPRA 4M54A 4ZVTA 2VDLB 1Q15A 1U2GC 2OSVA 1RTTA 2JFXA 4UJ3A 2PQMA 5K4AA 4X1IB 3LNCA 1P0QA 4D9NA 1MCZA 3GVXA 4PZAA 4JYZA 1QS0B 3LGXA 5JS8A 1WETA 3HACA 1UJWB 5T4EA 2VHYA 2GEJA 3JQQA 1ULAA 4BMNA 3LSYA 5DIFA 4PJ0Z 1KJIA 4YMGA 1JA8A 4W6QA 3R3JA 1FP4B 3KX2A 1FQJA 2QD5A 3VZSA 3IVMA 3LY9A 4RH0A 2RB5A 1LZLA 1WCYA 1ND6A 2FZKA 3GEIA 3ROTA 5JQWA 4TSFG 1LSUA 3UK7A 3ABUA 3HXQA 5E8JA 2P6YA 1JPUA 2XLBA 3F0EA 1CXZB 2B21A 3H1FA 1XNRB 4FQ7A 2RCVA 3TM4A 2J9XB 3L0SA 2VJLA 3V9AA 2LCAA 3KUDA 1NMQA 2JNBA 3IAUA 2Q07A 3ABLC 3L79A 3A6GA 5BR8O 5L3FA 2ZP1A 1TNDA 3OEHD 2XTMA 5LQSA 4HFNA 4EMTA 2WIAA 2B4TO 1R0SA 2HM7A 1G4HA 2QTPA 1IHYA 1JZTA 1Z0FA 3NTXA 2IXBA 3T0GA 3QYFA 1QONA 4X63A 2HY7A 4NH4A 4JI8B 5K3BA 4E15A 4J7JA 3LXXA 3AR3A 1FP2A 2W6ID 3BQMB 1HEUA 1DBRA 2OXCA 5KNBA 4TKZA 4KRYA 3L1JA 3C6YA 1DMSA 5I9TA 1INLA 1VKNA 3SNHA 4WBNB 5EE3A 3FLMA 4CN9A 4ME6A 3BCRA 1S4MA 5CXQA 3SPJA 4BLWA 5E38A 2P4QA 4FX5A 1D4FA 4PGAA 3D1JA 2CE4A 4LHEA 1BTOA 4XM0A 4KITB 1V2HE 3VJLA 5K0BA 2QN6A 4N1AA 3MTEA 4WY2A 3GJ8A 4BO1A 3T3NA 1JYSA 2AX3A 2JGEA 5A9SA 3SR4A 4KLZA 2R9RB 1K6MA 1JEJA 1G16A 4AZVA 1CJVC 2ILMA 5B58C 3IQZA 4F5YA 4MS2A 1ETHA 2UUCB 2RAUA 2G07A 4JYCA 1KVUA 2HSEA 3ZP7A 5GVRA 3KOUA 1LBQA 1T4MA 3N6XA 2Z2KA 3LA6A 5B7NA 2GVNA 3RHTA 2ZT9B 1WZCA 2TRSB 1ECJA 2KW5A 5F4ZA 5B30A 2VP6A 3ASNC 1F5NA 3EFFK 2NO5A 1J5EO 1KK2A 2QLMA 2JGUA 2BBTA 3ZGXA 4H1WA 4BLRA 2FKXA 5SZJA 4CBCA 1S3JA 5EIAA 2BP7B 2WLTA 2HLDD 1XQXA 3F6PA 5LDHA 1XB2A 3S0JA 1Z7GA 3MTQA 1X7DA 4M0FA 1DF4A 2E75B 3S28A 2N42A 4ANFA 3FTEA 4B47A 4BS9A 3OIUA 3UAVA 121PA 1D8TA 1BMDA 3A4IA 4MVXA 2A79B 3E9YA 4BNNA 3F5TA 3F5FA 5AM4A 2O23A 3SXUA 4CUZA 2VK2A 4ZO8A 4O4HB 3E86A 5TISZ 2FRVA 1VF5B 3FOAA 2RGCA 1UKCA 1I4TD 3O47A 3JAMA 3GJTA 2DTDA 1JD1A 3ZOPA 3QXXA 2Q4RA 2H6EA 2YV3A 4RE6A 1WU8A 3F78A 3H83A 1M2OA 4M2LA 1ZD2P 2QG4A 4D3FA 3HI6A 2QZPA 3V8RA 1BKYA 2PMFA 4ZJZA 1RHRA 1UT5A 5DF1A 4TKVB 4G1VA 5ED0A 4AJOA 2NN3C 4EKDA 3PQ5A 1XCMA 1YDXA 2OCAA 4Q6BA 5DTQA 2P7TC 1RZRD 3GARA 1YVWA 3A0HZ 1TUEA 2VTBA 3ZCUA 3N8NA 4PIMA 3CLRC 4TLEA 5IT4A 4DHWA 5F2EA 5EKXA 4GVLA 1YRWA 4KIFA 3KEGA 3C4VA 4MLCA 3KC2A 2ZM6B 2X76A 2OV8A 1CY2A 4AZTA 1FLAA 2VCYA 2PRIA 1CJTC 4GT1A 2R5NA 4IDAA 4TZZA 2X6QA 3EVDA 3H1PA 1XI2A 3I6BA 4BE9A 3ICOA 2XZTA 4YA6A 3RBAA 3CPQA 4JBHA 2G9UA 4KE9A 1Q7YH 4GQBA 1ZCFA 4G0QA 1PK7A 3AKCA 4CUJA 4XTCS 2X6CA 2WSMA 1OXKB 4MR8A 4QTXA 2EQBA 4DZTA 4RDIA 4ZCQA 1SUSA 2G1JA 5D3KA 4AULA 4NENB 4JI1B 4Y2SA 4UTRA 1EAMA 5TQ2B 1UK8A 3R7FA 4J07A 1BE8A 3IUYA 3JQBA 2W48A 4RANA 2E3CA 2HJSA 2ZUCA 5CW1A 4IV5A 4RKEA 3QVXA 5AUOB 1S8AA 1WB7A 3CJTA 1FDSA 2I6UA 1QHYA 1T36B 1QIKA 3WHPA 2DWOA 2VNSA 5L95A 4W8GA 5HKKD 1Y7PA 1QQ6A 3GGCA 3JQDA 4R8RA 4ZKEA 2Y92A 4CBVA 3R3ZA 3OE7D 3A1EA 1VQ7V 1BA3A 2AEEA 3AKZA 5KSPA 1Z08A 4LA4A 2HPVA 3V1LA 4S12A 2BGLA 4DJJA 3QELA 4QQKA 4OA5A 2JBAA 1MP0A 2RGNA 4JK3A 1G1XB 1VGRA 1C9EA 3E7FA 5EPOA 1H2SB 1GEEA 3KR1A 3UAOA 3LC7O 5TE9A 2GBCA 4NBNA 4NYMR 4X1IA 4M86A 4QUEA 2O3UA 3HM9A 1MJGM 2IJHA 4JQCA 1C3OB 3DKVA 3QLUA 1J2UA 2J4CA 3N6RA 2FEAA 4MUAA 3V6MA 2C57A 2ITDC 1Y7IA 1HLFA 3MWYW 5BWBA 4DLTA 4DUYO 4RHAA 4PN7A 2GZ2A 1M1XB 3AL3A 5HGJA 1IC6A 5LB2A 2J9FB 3V7YA 3VVMA 3P9SA 5T6MA 1U3GA 4RVCA 2ECKA 3I9KA 3AM4A 2OB1A 1BS1A 3CPEA 1YQNA 2QTTA 1ML3A 3L0PA 3D3EA 4ZAZA 1FC0A 4O2AF 1DCKA 3WFVA 1CXZA 3TH5A 2CXRA 3BQNB 1ZTEA 1AI6A 2OYQA 4JLDA 2I6XA 1IHUA 4G5RA 2VAWA 1BDBA 3ZCXA 2V74B 5AKXA 1LDGA 1BX1A 4YRCA 5HE9A 4C5CA 4CLEA 3K09A 3RJTA 4C6TB 3AOGA 3BK2A 5A6VA 2HG5C 2LCQA 3K6SB 1NW5A 2PYIA 1J90A 1Y8QB 5F7ZA 4GOXA 2NNLD 3CCJF 4KZKA 4CL3A 2C31A 1U3WA 3E83A 3PQDA 1E0KA 5CJPA 4BKQA 3ZV3A 1ULUA 5IHXA 3JQCA 4YUVA 3RRYA 4QNNA 5AESA 3H5AA 3GDFA 3QRWA 4ETIA 2VYQA 2BE7A 4GI5A 3D1VA 4IHJF 4NMWA 3EEBA 4RELA 2WWIA 4WBNA 3E0QA 3EFOA 1OILA 2QYSA 1H0RA 3UK6A 4MKHA 4PIVA 2YWCA 3S5UA 1JLKA 3Q2KA 1SD2A 1PX0A 1AO0A 2NXWA 1XDZA 3A11A 4HS9A 3AZPA 3E9MA 2PI4A 3MWLA 2CL0X 2F1IA 2P0EA 3AILA 3QVGB 1AS3A 3CLKA 4L74A 4CR6A 4PYMA 2JLCA 3PC8C 1ZZEA 2ZR2A 1XAGA 4LS3A 2C4KA 2I99A 2HBRA 4AN1A 1M1YB 3ZBUA 1JKXA 4JUDX 4R51A 4Z0TA 4RJ2A 4B84A 1ONNA 1HETA 2ZULA 1BRTA 3KNZA 4KU4A 5AW7A 4J94A 4P84A 1XRSB 3FOFC 4ZDIA 9ATCA 3VV2A 2XOEA 4DV1B 3E5RA 4H60A 3HKDB 2X6RA 3VISA 2ONKA 5EQTA 1M2VB 4YPVA 3VNVA 4ECEA 1CKEA 1N3LA 2KLBA 4XIGS 4IRMA 4ZK6A 3ZLTA 3ASUA 3IAXA 2PPLA 4QQFA 3LVRE 1NP3A 4LRXA 4PU0A 3RFUA 2CLEB 2H0QA 4M8NE 3WL6A 1J6UA 1BXZA 5G4LA 4HQOA 1MR3F 4N54A 4ZIBA 2VVTA 3EH1A 3UMSA 3DXFA 2OO3A 2BP7A 2CLMB 3K8QA 1BMFG 5EJ8A 2C0CA 1CDOA 4Q9NA 3LBYA 4M1KA 2P9JA 1HP8A 4OHKA 5FR1A 3BPZA 1V16B 4B6GA 4CWAA 3T1TA 3AI3A 4ZALA 1XZPA 3RYCB 3A31A 1A4XA 1RPAA 3K35A 1XQ1A 4ZHYB 1JSCA 2VT7A 3IOBA 2RBEA 4TXMA 3F67A 1W44A 2JGMA 2AG8A 4P9PA 2JLZA 2G83A 2WYWA 3IGFA 1F06A 4ND7A 2OZVA 3OMNB 4NEHB 2HXSA 3BF7A 4ER3A 5EB1B 2VYNA 1XN1A 1GTG1 1UBOS 4HAOA 2D59A 2V7QG 3WLKX 4CLXA 3LUTB 3VPCA 2PR7A 4XJTA 3MN1A 3A9VA 3CINA 2ZIOA 3F47A 3B3JA 3F3KA 2GPNA 2HXYA 2CLKB 4PHHA 2EILC 4UEJA 3WMFA 4QIWF 1AXEA 1C1XA 3UHFA 4ZPJA 4C8IA 4WD3A 2QSUA 2CMKA 1UI9A 3OJ0A 2YWDA 3DV0B 1RKVA 1Z29A 1P3JA 5CHYA 3VOSA 2Q2QA 4N9WA 1IXMA 1N5DA 2XB4A 4LRWA 5ARDA 4PG7A 3ZCTA 1R4AA 3UHOA 2VP0A 3QLEA 3W79A 5D01A 4RMNA 1KUQA 3GPIA 3K1JA 3DMRA 2Y6UA 3AJRA 3SQDA 4A10A 4JEIA 4PF1A 3GBVA 2PNFA 1MIHA 4UCXA 3DMHA 3UGJA 2XQVA 2IYLD 3EGXB 2DWEC 1WUIS 2NTEA 4UVBA 1WKCA 5HP8A 2HREA 3L74H 3S1AB 3AVUA 5U4QA 3QVVA 4YMIA 3PNSA 2P9ZA 1NVAA 1KE1A 1JJFA 5H8WA 2ODQA 2VHQA 4V0MA 3ILHA 3OP4A 3D36A 3BM5A 1V4VA 1GKLA 2YIBA 8ATCA 1UPCA 3THXB 3TBHA 4J10A 2GZAA 1X3LA 2PKQO 1XL6A 4A6XA 4EYOA 5TQ2A 1SQGA 4OK6A 4UFOA 5BSMA 2N48A 1D0SA 2A84A 2XGJA 4GZ5A 2YVQA 3SS7X 2DERA 5B8FA 2ZYDA 3RGWS 3O91A 3RC9A 1XZIA 3EZFA 5JJIA 3EW7A 1O9BA 4A23A 1T36A 3CCFA 3W7BA 3BULA 2Z9BA 1QFMA 4J9UE 3KE9A 5CLFA 2QD1A 1YU9A 4BV3A 2MOKA 5ECDA 3TL6A 3WLLA 2VQ3A 3MK31 1W6UA 4ZTZB 3ADOA 2D06A 2WLKA 2AFHB 1C8BA 4MI3A 5HRAA 1G63A 4K6FA 3H99A 2O8NA 5FLXA 5FHQA 2O2GA 5IFLA 3IMPA 4ZA2A 1GZ6A 5I5EA 4AECA 1USKA 4KXWA 1VARA 1VBMA 1V1RB 3JYPA 2CNBA 1I7SB 1KZHA 5LNK1 2IXEA 2IQ5A 2R7NA 1VQNF 3CH4B 5IEJA 1Q1GA 4E5NA 1ZIDA 5C8DA 2P40A 2FHPA 2J9FA 1E7RA 1Z4IA 4N5HX 4QFBA 2QQ5A 3V2IA 2HPHA 3D6JA 4IDQA 1CR4A 2AR7A 3MGBA 2PVSA 1YCFA 3HB9A 4WESB 1ZH2A 4IQ0A 2VLIA 4L7VA 4CQJA 4IEIA 2DY0A 3B1KA 4CMIB 4LN1A 3KZVA 4NBTA 2IUSA 1K3FA 1NSFA 3CRQA 3IB6A 1H5UA 3JSNA 1KFEB 1U94A 1SC6A 2BKXA 4C6TA 1QDLB 4LDJA 5IAAA 4YP5A 1NVBA 1GRRA 2XDQA 1T3TA 2C2MA 5SV2A 1TF2A 4MOWA 4A2PA 4BYMA 4X6YA 3IDZA 1NNEA 2JD0A 2VOEA 3B8NA 4HMPA 1OGJA 2DAPA 2ZBVA 4MKFA 3H0CA 4I1UA 3BMNB 4OP1A 1W29A 2P11A 4QGGA 1MPXA 1HNNA 3AWDA 4U8GA 3AB7A 2CSLA 3G7NA 3DXRB 1KB9F 1GQ2A 2EGUA 1UBJS 5L3BA 1WAZA 4DCOA 1Y6GA 1Z2EA 3P4YA 5B66Z 2CHGA 2XYHA 4X85A 5C5DA 4L3OA 2J3LA 4MQ4A 4OK5A 4AY3A 1VMIA 3EX7C 2R7KA 1Z56C 4DIDA 2RGAA 2HRDA 1VPLA 4G07A 3LKVA 3KQTA 3KSBC 2XLCA 1TT7A 1OI2A 1A9QA 1M1YA 5HTOA 2CLLB 3IHTA 1ISJA 4PLZA 3ZY5A 1SHKA 2QTZA 3QPDA 4BECA 3E2EA 1ZHOA 3ROEA 4HVAA 1I3NA 3Q0EA 4AZ3B 4N4AA 1X8JA 1PEYA 3HKDA 4ZV4A 5AJXA 1PGJA 1T5DX 3UH1A 1U1GA 1M2VA 3PPIA 1Y33E 4IH4A 3UENA 2G8LA 5I4KA 1LWNA 1R6UA 1QYDA 3E81A 3GMTA 3QX3A 1RJ9B 2RI6A 2IXGA 3GB7C 2IP4A 2Q8NA 5TSDA 2VK8A 4AZWA 3OCXA 1Q2UA 1FA9A 2I22A 4C22A 2TS1A 2R00A 2XNCA 3NJRA 1D6SA 4OXKA 3VIUA 2VWPA 4IDOA 3DMNA 3L0ZA 1V16A 1LVHA 3P45A 4HLDA 2WTMA 2GN2A 5LQDA 3MD0A 3RYCA 2UZHA 3RFTA 2Z08A 2XCRB 3SKVA 1WA5A 2VYVD 2WD8A 1SC5B 3ZE8A 3RS0A 2HMVA 1JW9B 2QY9A 2LP4Y 4EPYA 1E2GA 1WDWB 3E9RA 4CC6A 1X3SA 4MVJF 3H2SA 4OX9B 4TSFD 3P2EA 4FGWA 3WL4A 1DC4A 1QIGA 2BRUC 2ZJBA 1AKEA 1UKAA 2FPUA 2WSBA 1C30B 1EZJA 1G9TA 2Q3MA 3JQAD 1PJ3A 1N2OA 5EHXA 3IE2A 1NJ2A 2VNAA 3BTUA 4FKMA 4EELA 4EHHA 1WDLA 1HDJA 1JJVA 3CEPB 5EAIA 3ABRB 4Q3AA 1FJHA 1PF5A 1BQ3A 2QXYA 4MQ5A 3DV0A 3I0NA 5J5AA 1VJ5A 2VWKA 3DAPA 1IN7A 3LK6A 1T5TA 1CT9A 4G2NA 3R7LA 3G2MA 3H1TA 4IJVA 1V54B 4KBYA 1H2ZA 4ARSA 4NTWA 2OZKA 1JYEA 3WL3A 2QN7A 1UBNA 2E0IA 4DM7A 4YJFB 1S02A 1XD2A 4FM0A 1Q21A 2B30A 2IITA 5CVTA 3H2ZA 2G0NA 3TZ6A 3EGXA 2IOHA 2Q3JA 4DGQA 1ZM7A 5ELXA 1EQAA 2Q4TA 3TD2A 4PY2A 1U5BA 3EPJA 3WO0A 4BVFA 4K05A 4U7OA 3FJYA 1BNCA 2AF4C 3EXG1 2PMBA 3S1AA 4NPAA 4X9QA 1IJEA 2X1MA 2MMGA 3PYLA 1JDTA 3CA8A 3VPSA 2DFPA 4RHXA 3UC9A 1VGVA 3O3NB 4AS2A 1AGRA 4DBLC 1T29A 1H0SA 1SA0B 4Q9IA 3ZRSA 1VF6A 1TT5B 3K53A 2X9LA 5AJTA 5EFOA 1MT3A 2GEDA 2ZIAA 3KVOA 5E1DA 1P84F 2I2XB 5BV0A 3HB1A 3WKBA 1WZUA 1XZQA 5AK4A 3I58A 3LUAA 4X90A 2JIZG 3MILA 1AR4A 1SUEA 3RVKA 2ID4A 1ECCA 4UEQA 4QASA 1SNYA 4YRPA 5G0UA 4JI6O 3VMMA 5CB0A 4N01A 3SYLA 1BHQ1 1AB3A 1XZAA 1QAOA 3BE4A 4LVOA 1Z0AA 2ZUBA 2YEVB 2EEZA 3B89A 2XB2