4X1KB

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 134
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x1kB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x1kB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x1kB01
4I4TB 4O2AB 3HKEA 1FSZA 5LA6A 4O4JB 5LYJA 5BMVA 5ITZB 5IYZA 5J2UB 3RYFB 5KX5A 5MN5A 4EI9A 4O4HB 5LXTB 4ZOLA 4IHJB 3HKBB 3UT5B 1FFXA 4U39A 3M89A 3HKEB 3R4VA 5LP6A 2Q1YA 1RLUA 4YJ3A 3JASB 4DRXA 5FNVB 3N2KA 4E6EA 2XKBA 3RB8A 3E22B 4EB6A 4YJ2B 5J2TB 4XCQA 4TV9A 4ZI7B 4O4IA 5FNVA 4YJ3B 5IJ9A 3HKCA 3JALA 4F6RA 5CA0B 3RYFA 3WGNA 5IYZB 1RQ2A 5C8YA 3RYHA 4M8IA 5EYPA 4DXDA 4EI7A 5EZYA 2BTQB 1Z5VA 1JFFA 5GONA 3N2GB 2VXYA 5IJ0B 4TUYA 2GVIA 1Z5WA 5EYPB 3RYIB 2RHOA 2BTQA 5CA1A 3WGMA 5CA0A 3JARA 4IIJA 3HKCB 4FFBA 4X1KA 4WBNA 3RYHB 5C8YB 3VOBA 1W5BA 5CA1B 3JALB 4F6RB 3VO9A 4X1KB 5CB4A 1OFUA 3ZBQA 3WGKA 5JQGB 1W5EA 5JCOC 4TV9B 4ZI7A 3ZBPA 5GONB 4TV8A 4U3JB 1TVKA 3RYIA 5EZYB 4TUYB 1W581 1SA0B 5JH7B 4O2BA 4ZOLB 5LP6B 3N2GA 1TUBB 3JAWB 2VAWA 3VOAA 2RHLA 1FFXB 3HKBA 5M7EA 1W5FA 5EIBD 4B45A 5J2UA 4ZHQA 5LA6B 3JATA 5BMVB 5KX5B 5LYJB 3C8LA 1TUBA 3JAWA 2RHHA 4I4TA 4O2AA 2Q1XA 3WGLA 3CB2A 2XKAA 3WGJA 5MN6A 3VPAA 3JAKB 1RQ7A 4TV8B 5LP6C 2VAPA 3ZIDA 4YJ2A 5JQGA 3JATB 3E22A 4HNAA 4EB6B 4DRXB 4WBNB 3RYCB 4X20B 4O4JA 5ITZA 3V3TA 4LNUA 4O4LB 4O4HA 5JVDA 5LXTA 4I55A 5KMGB 5JCOA 4X1YA 2R751 5LOVB 1TVKB 4U3JA 4B46A 4O2BB 1SA0A 5JH7A 1W59A 4I55B 5KMGA 3HKDA 4I50B 5JVDB 1JFFB 5LOVA 2RHJA 4X1IA 4X20A 5CB4B 5IJ9B 3M8KA 4LNUB 4O4LA 4HNAB 3RYCA 5EIBC 4FFBB 2R6R1 3JARB 3JAKA 4IIJB 4X1IB 5MN4A 3N2KB 4O4IB 3JASA 5J2TA 4KWEA 2BTOA 2VAMA 3HKDB 4I50A 4X1YB 4ZHQB 3UT5A 5IJ0A 3VO8A 4IHJA 4EI8A 1W5AA
chains in the Genus database with same CATH superfamily
1NJGA 1PL4A 1JQJC 1X1RA 3MTJA 1EUQA 1Z06A 1NJSA 1SM4A 1VC2A 5CYOA 4DMHA 5JQWA 3O4IA 5BSTA 4EEKA 4LJ7A 3AERB 1CSEE 1U0TA 4F3RA 4KXFB 3GVMA 3IMGA 3E05A 4BNJA 4KBYA 4QJIA 1KU0A 1V16A 2XD4A 1HZZA 2P9CA 2YUTA 1U8TA 3WGOA 1QIMA 3AH8A 3C3DA 3CH6A 3KT6A 4NS4A 3TAUA 3A9UA 1TQDA 1N5LA 3EZNA 2DKOA 3WRYC 2OT3B 2CAZC 5EBMC 3RC8A 3BH6A 3P0EA 1WZNA 1JYSA 3TOSA 3KQYA 5DNYB 1ZG3A 5MFPA 2G06A 3D2BA 4DV1B 3FYEB 4LHVA 2DHDA 2ATCA 1RYFA 1RHQA 2CL6X 3N7TA 2JI8A 4GVPA 2XAQA 5BY1A 1JEOA 2ZP1A 4LNAA 3A4MA 4K3VA 1LDYA 4M36A 4YY3O 3W5UA 4DSUA 2FF7A 3DSQA 4HV4A 1K66A 1KEVA 3FD9A 1EDZA 3BHJA 3DZFA 1O5IA 3X1ZA 4GBGA 3H2BA 2J0UB 2DECA 1WVGA 2OZVA 3MTAA 4EMTA 5BV1A 1A4RA 2ZI6A 3G79A 3CUWA 3KVOA 2DFLA 3M9LA 4Z8XA 5EMNA 3DLPX 5E2AA 1NZFA 3K5NA 1NI4B 2KB1A 5IBRA 1N3LA 1THMA 1X8LA 3IODA 1NP6A 2OBYA 5FF9A 3TUJC 1SNYA 4QJ3A 1YS2X 1E3SA 3L77A 3O03A 1W5BA 1ZI8A 3HUUA 5CA1B 4GMGA 4TQGA 5SYAA 3ZW9A 5EC2C 2HIHA 4I4NA 2FUG6 2IF2A 1JDZA 2ZTLA 3LC1O 4FOOA 4CM9A 1UWLA 1GY8A 3N07A 4OXRA 2BR5A 2OORC 3RYIA 1AKEA 3KPWA 3PC8A 5A4MS 2FVYA 3IJEB 4FLUA 3VI4B 5D6OA 1QR9A 1ML3A 4C9BA 2OAGA 4NAVA 4WCFC 4C29A 4D6PA 1OKKD 2GZ2A 2EXXA 3H87A 1QQ7A 2F1IA 1XRNA 2H1SA 4QPZA 1SXJA 2XXJA 2ZRCA 4ZI7F 2BH9A 4RJKA 3LLCA 3WO0A 1SUEA 3VR1A 3AW8A 4ZTZB 1K2VN 2FWNA 1Z73A 3U7HB 3CEIA 4UCUA 1FW8A 2X9GA 3LKDA 4G63A 4YT5A 5IASA 3A27A 1X7OA 5LKAA 3NKFA 1QLEB 5EXSA 3UFXB 1P1IA 1WKCA 1V54C 4P22A 1QGDA 3G6WA 1YVDA 2ZJ2A 3V33A 4AJHA 1Y6GA 3FDXA 2ODBA 1UK9A 4O02B 4M0KA 1VQKV 2V7TA 5CLQA 4JJIA 3HNRA 4EGJA 3RE1A 1SIUA 2C4HA 3DT9A 4YN3A 2W6IG 2BGKA 3T9BA 3BAFA 3KJIA 3MIIA 4US0R 1I6KA 3EE6A 1SFRA 4OSPA 5LBIA 1V8BA 3A3PA 3I2JA 3LBIA 3UA4A 5T8KC 3AVWA 3RVYA 3P2IA 1K73H 4KDEA 3WJRA 5KZMB 2I0FA 3GBPA 1K0UA 1CFZA 4MMYB 5HCUA 3HO6A 1VHAA 2HBRA 3HY6A 1ECFA 3H1AA 4UCWA 3DVRX 4AXXA 1K7DA 4QDKA 4CIVA 2LJ2A 1YL7A 3NM5A 3I58A 4Q3NA 3V1MA 3V2GA 3KVYA 2EARA 2R1ZA 1GNLA 1A72A 1LW7A 3W9YA 4QYSA 5KU7A 4FBLA 2AR9A 2I2AA 1W4LA 2AYXA 2Z01A 2WTUA 2C57A 1TU0A 2QY9A 2GM3A 5EUCA 3W8RA 1CLEA 1WMEA 1T26A 1WZ2A 2D59A 3E1SA 4EIWA 2PUCA 2J67A 4M6WA 2H1OA 1O9HA 4FFWA 4PQYA 2AG6A 5JYEA 1UFIA 2W58A 3F2VA 2WRZA 2ZS9A 4GE0A 2HKOA 1KTIA 2QWPB 5CTJA 5FBHA 5GTIZ 4QODA 4CM8B 3GOHA 4FC6A 1WZEA 5C80A 1M5RA 3UG6A 3ICXA 1I4DD 2O5EA 3PC4A 4M1MA 4Y6OA 2HA3A 2KW5A 4UOQA 5IT5A 5ITWA 2LBWA 4XD2A 1A3CA 1EUDB 2FZGA 3D31A 3QEMB 4BGVA 2P9BA 4ZKIA 9ATCA 1N9KA 2YRFA 2P3OA 3HPQA 4DANA 1FTNA 1OAOC 2MIIA 3DHVA 4WUVA 4M0CA 3WQBA 1RXWA 4PRYA 5E1OA 3HVRA 1I36A 1YI8A 1J7JA 4FYHA 2I3DA 1BGVA 4RHFA 4F9GA 2A3QA 3TDNA 3H3FA 3T3NA 3OBWA 1Y7LA 5ES3A 2PA3A 1H1LB 3VX4A 4B6GA 4DLWA 4DUYB 1E1RA 1GEEA 2H7VA 1G42A 2IY7A 3B6ZA 1L5OA 3RFVA 3VBBA 3M8AA 4RTJA 2GAIA 4PYKA 4OJKA 2JJ1A 4NATA 1VQ9V 2G80A 3LQKA 4N0PA 3RYIB 1NMSA 3ILXA 3SZLA 3OFNG 1HO3A 2Q50A 5KYWB 2AN9A 5AR1A 1Z68A 5IYBO 3FB4A 1O57A 3I6MA 1BWPA 2EIHA 3ZLTA 1JHOA 5IM4F 2XZLA 1IN1A 3KL2A 4ER0A 1FSPA 1U3GA 3TJZA 1QNFA 4C7JA 3PTAA 4UVBA 4NQ3A 1E7RA 4NH4A 3LP6A 3U5TA 3V00A 1P31A 4QOIA 5IVIA 2CXQA 4HB2A 5FLEX 5FYQA 4A2WA 4E1VA 5ICGA 1CW2B 2OD9A 1V4VA 1PI3A 5KAFZ 4MQFB 1EFRD 2ST1A 1L7VC 1G5RA 3A6LA 4H3HB 3BAAA 3H1KH 1LBEA 2OV3A 3QSGA 4ZU6X 3TZ6A 3UCEA 2WTBA 3FCEA 1P0MA 3M49A 4PICA 3GW8A 5A7GA 5C0OE 3OT7A 1ZA2A 1ZJJA 1HE1C 2MSCB 2ZYAA 1Z38A 3FH0A 3ILHA 4GWLA 2NN4A 4MJ7A 1UBRS 4WWHA 4IMJB 4C81A 1XG5A 2Y3IA 1XZJA 3NBUA 4PGHA 2OD7A 2QMEA 2Y68A 3LUGA 2H4JA 3LO5A 4H1UA 4BT4A 1GQOA 1NVVQ 1HDJA 3AR6A 4RDHA 3WLTA 3CPWU 5CA3A 5KYYA 4MHSA 1KSGA 1V95A 2WP8J 1MG5A 3IUEA 3CRAA 1RQRA 1YR3A 3THWB 1SKBA 1I7SB 4QUEA 3MTBA 1D9XA 1VKOA 2FY8A 3JCMM 2RGWA 4WFIA 2D6FA 2IAFA 3K58A 1DX4A 2AI2A 2HRDA 3SXUA 5FNVF 1A76A 3UXEA 3WR5A 1E20A 3PDCA 2Q9BA 4GQIA 5BWCA 3Q3IA 5DGTA 2IHVA 3VTFA 1U7XA 2CGEA 1R4AA 2P65A 1OR8A 2B83A 2Y0EA 3LZDA 4HHEA 4UBMA 1SGWA 2O20A 2XBLA 3JWGA 2BLNA 3QKSB 4G36A 3ECAA 3LY9A 4C4OA 3AHDA 4K88A 2J87A 1B00A 1KBOA 5C53B 1W73A 5LOVA 2FEPA 3COVA 4HXFB 4C6TB 3L46A 2F90A 4R7TA 4C0WA 2PIDA 2ZVPX 3E83A 3D6MA 4DSZA 5ERXA 1E2QA 1K6EA 4CI0B 2ID8A 2GJAA 3BYQA 4LG1A 3TKAA 4FYVA 2P9GA 3DMRA 1JA1A 4JJ4A 2UZ0A 1Y8QB 3U1VA 4WRRA 3M9WA 3V46A 1PQPA 2AMTA 3L7YA 3N2KB 1H2ZA 2Y27A 4KO1S 1HMPA 3KT8A 1RWMA 4JR0A 2MOKA 2JS3A 1N6IA 1RTTA 1R9GA 2DMXA 5FLXM 3E4DA 2NUAB 3CG6A 4UATA 2QLBA 3ZMUA 3T15A 3T3HA 4MVJD 2RHTA 3PWZA 1HSZA 4DW1A 5AJYA 4WZBE 2Z3ZA 3ACCA 1QYCA 3FFBA 1GN2A 3FHOA 5KYGA 2X1VA 1XXHE 3ESAA 3KVNA 3AY3A 4YV1A 1JTVA 1BCSB 3UMRA 4JJKA 5E38A 5KOJB 3TGPA 5CGQB 5FADA 4WK6A 2PANA 3JXEA 3UHAA 5JJJB 3EIXA 4RHXA 3ZY2A 5DK6A 1PX0A 4BAUA 3JQEA 2OOSA 3PEWA 1REQA 4X3CA 1LBHA 3ZE6A 1EAYA 1XYGA 2XMPA 5FUQA 2F23A 1C7QA 1M90W 4MQFA 3TX2A 5KC9A 1JHPA 1HZZC 1ZA1A 1P6QA 1Z2NX 3OCXA 2GJ8A 5CVDA 3F97A 3T7JA 3VNBA 3P2MA 2J9XB 2JLCA 2J07A 2B5OA 1CIPA 3MCUA 5AM3A 2AZXA 1OASA 2Q6OA 4BKPA 2X0JA 4LY9A 1CRPA 5FUXA 2OMEA 2PT6A 5HDQA 1FXHA 4FFOA 4OI1A 4ROSA 4N4AA 1W2BF 5CIQA 4CF7A 1LLDA 2IUSA 2WF8A 4OKSA 3ZEDA 1JI3A 2M1ZA 2C8JA 3CIOA 6REQA 5TGTA 4D56A 4DT1A 3VYUB 3N0RA 1JX9A 5HY1A 1ZD2P 1DRKA 4GX0A 3Q88A 2XIJA 3NX4A 2HIMA 3O8QB 4HXYA 4MS1B 3WADA 4G4WA 4J0KA 3PI7A 4MQ4A 5IT9M 3GTZA 3WFZA 4KUHA 1F1BA 1U0FA 1QIDA 3VVMA 1Q8RA 2FFAA 1YDMA 3CG0A 3ZBQA 1RQLA 3O65A 1XBIA 1DAMA 1GG2A 1OC2A 1U94A 2PZMA 2XA1A 1VLZA 3AFHA 3Q1LA 4EYOA 1QXSA 3GIDA 1EVKA 1YB4A 3T8YA 2SKEA 4KN8A 4BVLA 1H2XA 4WD3A 5LGUA 3URMA 2H4HA 3VR6D 3ZE0B 1A04A 2CUZA 1CS0B 3SYLA 4W4KA 1JT9A 1KSHA 4P83A 3IKFA 2XAAA 1PJ3A 3MQ2A 1TX4B 4XIGS 5BWBA 4OLHA 4CM3A 3EIOA 3SBOA 3R0QA 5T4FA 2NMVA 3DKVA 3FYCA 2WUGA 3LY8A 3B78A 3P9KA 4UARA 2CH7B 3MTIA 2JDID 2AOTA 2Y0IA 1K6XA 2FB9A 1Z16A 3VZPA 3ABLC 2FEOA 3VPAA 3CP1A 4NAUA 2YBDA 4WK0B 4Q01A 2Q2NA 2C2ZA 1I08A 1YBMA 1XYVA 4TGLA 4ANFA 3CCUV 4R9VA 5FH9A 3WE7A 5L7WA 3J81N 4IW3B 4MTXA 4RX1A 3TEJA 3SS8A 1U7WA 2LKCA 2PX5A 3EVFA 2CNWD 3DWIA 2EG9A 4OFZA 4B09A 5JSZA 2ZT6A 4B4WA 2I76A 4EFEA 1U11A 2PYDA 4L8FA 3CUTA 4RVOA 3ZWPA 2XDWA 5F7XA 3DA8A 1BFUA 2C2MA 3PL5A 1JQDA 1X7WA 4X1YA 1XAJA 2YHSA 4X66O 2YWXA 1TVKB 1T3TA 1JAXA 5A9TA 3LYAA 1ZIOA 3NEYA 4JXJA 4N54A 1YF2A 5FTNA 3T4UA 3C74A 5KJ1A 4DA4A 1L2TA 4I50B 2P3QA 1G1XB 1QYXA 2GBIA 4FXPA 4HSGA 4QYIA 1Z6XA 1XHFA 1TAQA 4RH3A 3SR2C 1Y4AE 1CLUA 4QUAA 4I0XB 5KTRA 2JCXA 1GPDG 4V0ME 5IJ9B 5GINE 3L6CA 1MF7A 4R6WA 2AE2A 3NFRA 4H2DA 4M86A 4RVGA 3LT5A 5BN5B 4BBJA 4DXWA 5ARBA 4X90A 3R9XB 4PS1A 3GZJA 3P9XA 3TXXA 4CQNA 2RI0A 4K9MA 4MGIR 3RNLA 3JQBA 2HF9A 4DDVA 5ES4B 5HJ7A 4H3SA 2GM9A 4AP6A 2PL9A 2R1VB 2DQ0A 4P2ZA 4AQYB 2A7WA 4RPCA 2O5CA 2HIAA 1AGRA 2H4WA 1CQPA 3CHYA 2IU0A 2UUCO 1H69A 1GQRA 2QK4A 2B1GA 3CS5A 3CH7A 3IKMB 3PUJA 4HFRA 5A4IS 4R6ZA 1ZR2A 3OC6A 4N3NA 4Q1DA 3VI6A 1XZMA 2W8BB 4WY8A 1JU4A 1JDUA 1X7ZB 2V4MA 3QE3A 3Q7IA 3QH4A 5FOXA 5LSAA 2PZJA 1QO7A 4MWBA 2R8ZA 2ZBGA 5C32A 4DNQA 4LZAA 4CTOA 4OLAA 1EZJA 4X9QA 4IP0A 1KJ9A 2QZZA 4OI4A 3RVSA 5EXPA 1Q7GA 2GAJA 3O4JA 4JTDB 2ZW9A 2IF0A 3OEEA 1IZYA 2AIZP 4KSYA 4PZCA 4GR5A 4TLCA 3AUJB 4QSHA 1GNVA 1YC5A 1J25A 3CEJA 4RTKA 4PO9A 2OAQ1 2C0QA 4ZTBA 2FUG1 2XY4A 4RWZA 1JMYA 3UWKA 5EP1A 5KNBA 4JT2A 4GDMA 4DIEA 3F6YA 4DMKA 5KTTA 3T9DA 2C7VA 4JLKA 1PQUA 1OXVA 2RH8A 1UC8A 2QJFA 4II2A 5CPFA 1BE6A 5K4GA 3JCZA 4G24A 2F43G 1JLRA 3OA0A 1NBIA 2WTNA 4AZSA 2DBZA 3GOQA 4R1QA 3ZH2A 4OH7A 2RDMA 4Q6WA 4CODB 2QPTA 4U7NA 3E9CA 3F3SA 2JH9A 4AYTA 3K4PA 3THYB 3K1YA 4ONEA 1M34B 4MS4B 2QM4A 2IHBA 3G88A 4Y2TA 1YA4A 2XWQA 4JY7A 5TQ2A 1Y80A 1I3OA 4R1PA 3DYVA 3UWSA 5HGXA 3EXAA 3ZE1B 2DUWA 4WJKB 1SZCA 4BR6A 1G2QA 3E9ZA 1SVKA 4I8DA 3NC1C 3LQRA 4I5SA 2RH5A 4FYKA 4U7JA 1ZVVA 1W0KG 1T4DA 5GOTA 3HZHA 3GLFE 3HCDA 5LD2B 5F9HA 4ARUA 1YSCA 4EENA 1O5TA 1PL8A 2C4TA 1DLBA 5FJ4C 4KWTA 4C3OB 1GGMA 1ZGZA 5D5QA 1T8WA 4OBWA 4C4WC 1RTKA 2WJWA 1VLLA 1HYBA 4V03A 2ZRGA 1FYVA 1HT2E 1W4AA 3DMPA 1G8AA 3LVQE 4P5EA 4ZEVA 4L1KA 1M7GA 3KPVA 3KKPA 4QLAA 2CF6A 4YB8A 1PJBA 2QM8A 2J85A 2FGYA 4ITUA 4QTXA 1IPFA 1R7RA 1VL5A 1RHUA 4EY5A 5KSOA 4I9HA 5D01A 1YITF 2O4UX 1N6RA 4Q16A 4RAOA 4ZCMA 2R8YA 1WXWA 3K53A 4GAEA 1C1DA 1WABA 1YV9A 3JATB 2EFEB 1IQ0A 1UWVA 2HEIA 2J08A 2VJNA 3EJWA 4WCFB 4YCAA 3X1YA 1D04A 1XRGA 1T6BY 1Z3CA 2G88A 2OC4A 4NTWA 2JCBA 2HLDD 3DMTC 2HSDA 4Y2JA 4EA7A 3CX3A 5BRJA 5IY5C 2J0VA 4FHCA 1J2RA 1XZDA 2GPAA 2VK1A 4TSFG 3EGWA 4ES6A 4YIPA 3I5XA 3ANNA 3ISVA 4LV6A 3MG9A 1H4SA 4B3GA 1BD4A 3RLFA 4RD2A 3R3YA 4OXIA 4G1CA 1ZMXA 2O8BA 3F49S 2DFNA 1XZBA 4QRHA 2WBLC 3FI0A 2IIVA 3LA6A 2AZ2A 4PGAA 3CCRF 3C6QA 4P9PA 1UDWA 1QHFA 3EPHA 5KHKA 4MVQA 3K03A 2BMFA 2IEDA 1JF8A 2QMQA 3B6MA 4KWIA 4M7WA 4TVKA 2IPAB 4YRKA 3U11A 2Q1TA 4D8TA 4Q82A 4FILA 2F48A 4KTVE 3V3KA 3WNBA 3FGZA 3PT9A 2UVPA 2Z4TA 2FW8A 1DIGA 4O2AB 1PSWA 2Q07A 2JLSA 4KUEA 2I80A 3II6X 1TD1A 2DPHA 3UFBA 4IEIA 1TB4A 4L57A 3OKFA 3L01A 3PUZA 3FETA 4UXNA 1JIJA 3VVCA 1FXKA 3I09A 5J59A 4LTDA 4XSGA 3ABRB 1Y74B 2X41A 2QTSA 3V55A 2VHQA 3B3GA 3PJRA 2UUOA 1T6XA 2VOEA 4M7OA 5TY0A 2FR0A 3OW2U 4A8JC 1VDZA 3T41A 1EWTA 2ZIMA 1RXSA 3JD4A 1QRUA 4J9ZB 3EZYA 3MGKA 5GJWC 5SY9A 5AW7A 5U9CA 2QQGA 3MCVA 2CLEB 4XSHA 3ZNOA 2JJ2A 4MEBA 1G5TA 4YUVA 3QVMA 4J7UA 3R5SA 5DCVA 3EQ8A 2EU8A 1MLDA 1ZINA 2XOKA 2X6CA 1FDOA 1NRIA 3LGXA 1P1RA 4HCJA 1T5IA 4K9SA 2O8DB 4DO2A 1U1FA 3HB3B 3F67A 1DAHA 3Q5EA 4KXWA 3KDPA 3Q85A 2EW1A 3FAZA 2NPIA 4BX3A 5IPFA 1C30B 3AR4A 2BGTA 2PQ2A 2XZDA 4II3A 1K8QA 3ZLBA 2X6AA 2F1HA 3CTMA 4NY1A 1YONA 5KHJA 2CTPA 4GXTA 1QTNA 3LUAA 4DR5B 2JDIG 1H4VB 4Q1AA 1EDEA 1M6YA 2CFRA 3GJTA 3KBBA 4PDMA 1OIXA 4NNJA 3CZ9A 1JDJA 2Q0OC 1GZ7A 1U0GA 3W2TA 2DR3A 3EGXB 3OMAB 2QQFA 1DBFA 1MJHA 5GONF 5H68A 3SX4A 1JLMA 3G4SF 2NOAA 5H16A 2I9KA 1YQGA 3C7CB 2RHDA 4GYCB 5JD3A 3UJNA 4X88A 2DSNA 3PHJA 4FPPA 4JL6A 1NR7A 1T9CA 4W7HA 3TB6A 3U31A 2EIKB 1MB0A 2HK8A 3HXLA 4DC1A 3BJRA 2B0JA 1EXMA 3MJTA 3A6JA 1W6UA 1G41A 2A5GA 2WWWA 1SBQA 2ZIFA 1Z6ZA 2ZSAA 5HF9A 2JEZA 1XVUA 3ROEA 1JHYA 2NVWA 5LU8A 3CN9A 3Q8MA 1KRXA 1NUAA 1N2BA 1XJ5A 1OUMA 1PDWA 3IELA 4OBEA 2X76A 2BR4A 3E4CA 3ENKA 3CUSA 4IMPA 2PUDA 4ZOQI 3FPKA 5JAZA 2ZXFA 4I3HA 3EG9B 4X8AA 2QLMA 4A6PA 1YDWA 1OSNA 5CVVA 3ZHXA 4BFCA 3PDWA 4E09A 3QEMA 1IK4A 2RAFA 5FLXN 4FOPA 2VCEA 4QOFA 4HDAA 2G1KA 1SG6A 2I03A 1AU9A 3H9QA 3A0BZ 5JADA 1PBNA 1CBUA 1JKXA 2HMAA 2Q28A 3DL2A 4KV7A 3UO3A 1KO4A 5F1KA 3U4IA 4R2MA 1P4HA 3STWA 3KEGA 3U9SA 1PR3A 1HLGA 3I7TA 1DJMA 1GT6A 2GI4A 4MULA 3WKAA 4RAQA 3LX8A 2FZCA 4U3JA 3E82A 3OTWA 2G28A 4V0SA 4Y2HA 2NGRA 5DMXA 5FI3A 3S81A 5DLYA 2FWRA 1U28C 1FYXA 2JFGA 2PIAA 4RYDA 3SOPA 1DBQA 4C1NA 1IQPA 1PEYA 2FOLA 3FWKA 3NHRA 4G01B 5B4VA 1MV5A 1Q1QA 2JLYA 3KXDA 3WPXA 4G0QA 4ON9A 4XDLA 2DT5A 3UIEA 1EBUA 1C9JA 1ZKDA 2YWRA 1NP7A 3A37A 4KJXA 2BFEB 4C7VA 5AUPB 5G0UA 5JC8A 5JNVA 3DOEA 1SKUA 3GNTA 4IWNA 1Y1SA 3WLEA 1WUJS 1GTSA 1WM1A 4PU0A 4MW2A 1Z36A 3EISA 3F7TA 1GM7A 4OMDA 4Y6PA 3TZLA 3AG4C 5JAIA 2ZDIC 1WE2A 4TLEA 2J5QA 4QDTA 2JIZA 1KY4A 2OUKA 3EXIB 4R1MA 3ZLJA 4GM0A 1VCMA 3FYUB 4QFCA 4EB3A 1C3OA 2B8WA 1F2VA 3CNNA 1KC1A 2ERXA 2JJQA 4IDAA 4IILA 4MKFA 4PX3A 1NW6A 1QHYA 1QH9A 4JLNA 8ATCA 3RS2A 4UVAA 4ROTA 3QZUA 3O31A 4WBXC 3W5BA 3NH6A 3U9LA 1D6SA 4BASA 4WKCA 3ZDZB 2D7CA 2F95B 3FPBA 1DL5A 1XRRA 3ECCA 1K68A 3VPSA 1R88A 2B94A 3EMKA 3MINB 3U7GA 2V7PA 1JQ3A 1ZVMA 2H06A 2PD6A 2XODA 4C7UA 5CK4A 4M53A 3MB5A 2HW8A 4RIIA 4C8GA 1DOAA 2IJHA 4KO8A 4F6RA 2I7CA 2YCBA 3JYHA 4IS3A 4NMWA 3RR2A 3TPFA 5CBPA 5LM3A 1H6CA 5HUQA 1MAHA 2W7TA 2YXBA 5AVMA 4GM1A 2WF7A 5LD2C 1X7DA 1QHGA 4DJTA 4J91A 1KH2A 3NYIA 3VMFA 3STZC 1KD1H 2YJ5A 3T1QA 1R6AA 4WDQA 5K0ZA 2WM2A 3FPGA 4WCEV 4BNLA 1KI8A 1TM4E 2HM7A 3BQMB 3C8UA 2HWWA 3HG7A 2P40A 3ZBTA 2QA4F 1PZNA 5CA1A 1PNRA 2ZZNA 3OEED 1DAGA 1NTZH 3BRWD 4RZHA 1AKUA 2XTNA 3QQ5A 2MK3A 1M8FA 1QGAA 1MHPA 1P5RA 2I34A 3ICPA 3T7AA 1UC5B 1PZXA 1T2EA 2P6RA 3OD1A 2RDCA 2VSXA 4P3PA 5K01A 3A6GA 4GT1A 3FTEA 4CE6A 1SXJB 1OHHA 2JD2A 1R0KA 1H7MA 1JQAA 4OHKA 1Q0PA 2WYVA 3G5MA 1PNMA 4MTOA 4R69A 4XQ9A 3PT5A 1LXCA 2CMFA 2VNIA 5HBRA 3KLBA 1AZTA 2QSZA 3BWCA 4IGAA 2O8EB 4KVAA 1F0KA 2PX4A 5DNWA 3CFYA 1DC6A 1PZEA 2GWHA 1DT3A 3EVTA 4HN9A 4XGIA 4CM4B 2OOKA 1AV7A 5HIJA 2HEGA 3VKUA 5AVZA 2OXIA 1NKSA 2EILC 1LVHA 2AWNA 2J30A 2WJ6A 4M7PA 4AWXA 4EO4A 5A5EA 3O2NA 4NBVA 2PKQP 3P9NA 3K12A 1T2FA 3HRHA 2BZ1A 2XQVA 2OILA 4GU5A 4BN5A 2QWQB 1HV8A 3RYCB 3FKSD 1Y1RA 1YBAA 1KO7A 4EK9A 1U6KA 2DBQA 1UT5A 5JWHA 1VQ9F 5DEIA 1Z4OA 4P9OA 1WCV1 1FYFA 3OSZA 5M29A 4NCHA 2B7LA 1SVLA 2Y1KA 2YDXA 4E33A 3K9WA 3GARA 4TMYA 1WUHS 4LISA 4B6QA 3RARA 3WKDA 5BWNA 4CR8A 2AZTA 5KMGA 1HTWA 5JVDB 3HE3A 4RKQA 3KKLA 1BS2A 2CB0A 5EPUA 1TJ3A 4P33A 2D1RA 2A0YA 1YZFA 4Q4AB 3X2FA 1SUFA 1NUPA 2ZI4A 4MWGA 2QRVB 1M2EA 1TO1E 3NZEA 3F6CA 4JASB 3GD5A 2DH5A 2ZB3A 3BFJA 3C48A 4QJ5A 5AIAA 5HSGA 4PFQA 2VYVA 3NHMA 4TS1A 5IKOA 5GAPK 1F4MA 1Q6ZA 3B5IA 2C7QA 1T0HB 2H2DA 1TYEB 4PR0A 3UV7A 5ER6A 2AFHA 3SF8A 1VP7A 3GV0A 1UKYA 1Q12A 1LLQA 4XPZA 3EPKA 2G76A 3RVDA 5KNBH 1AMUA 1BYIA 3HVHA 4FLZA 3WKBA 2PZBA 4D8XA 4FM1A 1EVYA 4OAQA 5HZMA 3BULA 5TQVA 3LX6A 1RP1A 4QJFB 3B12A 2HA0A 1NQ3A 1Y37A 3A4LA 4ZK2A 1ZN2A 1BS1A 5KVSA 3LNMB 4HMQA 4P4TA 3AR8A 3DTUB 3AT1A 3RIGA 4GKJO 3HNOA 1R0BA 2ZPTX 4UD2A 3D6FA 3ROPA 1UZMA 2WJZB 2BCJQ 1TFRA 2IE8A 2Z1NA 2WIKA 5BURA 3V8QA 2X6BA 5IU6A 2D8AA 4I9GA 3PGKA 5AOBA 3I52A 2BFCB 2FPPA 4X6YA 2QN8A 3ZE8A 1W0CA 3F5SA 4Q4DA 2O7NA 4MWEA 1LF5A 4A73A 1KQOA 4ZU1X 3QG1A 4YFYA 2FEXA 3M82A 4LZZA 4W5RA 4BVEA 1FUYB 1JHRA 4W5WA 3ACDA 4YRAA 1L5MA 3DFUA 5DHAA 3IXLA 4C5BA 2GCOA 1MH1A 2FDXA 2YJTD 2BMJA 3DD5A 4G1BA 2IW3A 4JV5B 1S01A 1U8AA 4FNGA 2JIOA 4N18A 1W4RA 4F84A 1QM5A 4REQA 2XCSB 5DCWA 4F6RB 4PRLA 3A9VA 2C31A 3DOJA 3KWLA 4RVFA 1I7NA 2BEUB 5BW6B 1E98A 3ZU5A 2Z2JA 4OK6A 5E8JA 2ZKIA 5KYXA 2FZVA 1VHWA 4MCJA 1QONA 3B51X 1S9DA 1YRBA 4LHEA 4XIYA 4UM9D 1XD8A 4A2CA 4RQUA 1IX9A 3HBAA 3OPVA 2Z3WA 1K9MW 3JD0A 5JAOA 1CRQA 4LOHA 3P9IA 2YVKA 7YASA 5E6UA 4YGXB 3KOYA 3TXYA 4JLBA 5AKHA 3IAAA 1Z8NA 2OQ2A 3MLEA 4FKMA 1SK8A 1LZLA 1ZWZA 4FT2A 5SYNA 4MLZA 4N03A 4D9IA 2XB9A 2MINB 3LLSA 4IEEA 1SXPA 3OR6C 3I32A 5ILGA 3STVA 4PI2A 2PLNA 1SHKA 1UIRA 3CISA 1KVUA 1QPZA 1O03A 1BQZA 4OGLA 3CX5F 4ZYZA 2FPOA 2IYAA 5EMMA 3A0RB 4N82A 4JP5A 1QR8A 1JR3E 2X1LA 1CJCA 3G8BA 4Q4HB 3EIQA 4UNQA 1H3FA 4YP5A 4ZC1A 4BIIA 1TEHA 5K0JA 4QQFA 3M1YA 4IYHA 4EUHA 3AM4A 3TAHA 2NYAA 4H7KA 4XRRA 4TMKA 3GZTB 2FWIA 3TUZC 3IPYA 2CLDX 3X2SA 1LI5A 1QAMA 4F3CA 4RZQA 4IDBA 4RLHA 4X64O 1TCCA 2AXEA 4TT8A 1KK2A 2V7BA 3FIUA 2QL7A 3D5QA 1NRXA 3EGCA 1M7BA 1OFHA 4EVSA 3MUFA 1ECJA 2ZJ1A 3M6AA 4RHEA 4KQ6A 4BEBA 3ELYA 1LRJA 1E9SA 1NQVA 1CE8B 3DEHA 2PJDA 2IXTA 4OYLA 5EQTA 5JDIC 4HYQA 2HT1A 2RMKB 1C9YA 3IOEA 3GAAA 4P2GA 2W2PA 5CR9A 5GTHZ 1U7HA 4HEA6 3RU2A 4B6JA 3GBVA 1M33A 2IXGA 4I1OA 3BMCB 3DBIA 1YKFA 1A8PA 2J7PA 1U4NA 2R4QA 3QEAZ 2KS6A 5ECWA 1Z12A 4UDXX 2FB5A 1PQWA 1X9HA 2QX6A 2XZPA 4IIVA 4MA4A 4NFHA 4OJYA 5HFNA 5JAUA 1SVUA 4G37A 4C22A 4F3TA 1ZHHA 1SPXA 2C1EA 1Y0BA 1ZMTA 3FLBA 4RS3A 5GJVC 3S28A 3DULA 1ZGHA 3ZXIA 2QBYB 2PZLA 4Q3CA 1VQ6F 1A8HA 2DHCA 5CLFA 2CDYA 3DPUA 4ZANA 1ZLXA 3LSYA 4ZOBA 5C2JB 1SCUB 13PKA 2X4LA 3RS8A 1JILA 4KHPB 3F7MA 2FKAA 2P4SA 2I2DA 1XK7A 5CH3A 5JSYA 3ERNA 4F60A 4ASUD 5AOVA 3SBXA 1MGOA 2EBUA 2RGRA 4UZSA 2QTHA 1E2DA 3FCOA 2OA0A 2WTEA 4I9QA 2IYYA 1QIEA 4QGAA 4MVJF 3JWHA 2WLJA 1GYRA 4K87A 5ULLA 5KHGA 3BL6A 1ZH4A 1VMAA 1DKLA 1NN3A 4IDOA 5F5LA 5M2QA 4MUXA 2AGAA 4BFXA 2BTQB 1XZ8A 2GNAA 1L5KA 4R0VA 2J3EA 4W1QA 3JVVA 4ARBA 4Y7DA 2HXYA 4IY1A 5ALIA 1VIDA 4FW9A 4YV0A 2MSLA 4K7JA 4C0HA 1OB2A 4BMXA 4C5AA 3LBYA 1MIOA 2XRMA 4BXOB 3A6PC 4RANA 1Q77A 2IOHA 3FGPA 1AN0A 1YI1A 3TLJA 3DAPA 4YMSA 5BN1A 3E35A 3S2IA 2Z43A 3ELUA 4DK0A 3DDZX 2EZ8A 2ZXWB 2JAPA 3AWDA 4B7UA 1A9OA 3DO8A 3M4JA 1CETA 2OBXA 4UAUA 1DAEA 5HXUA 4PA6A 5HFMA 3GGDA 1Q3KA 3TSAA 3VYRB 4QDXA 3L07A 1Q82W 1W5EA 1XTJA 2VPXA 4ZI7A 5DN6D 2H4ZA 3EDMA 1G21E 1QGUA 3TUIC 2A8YA 1UPAA 4OQ4A 5DJ5A 3SJBC 2CLHB 2D2VA 2GJ9A 3SQDA 1B2RA 4KKVA 3GLSA 1BH2A 1EJ2A 2C99A 2GJKA 4JOCA 3RFXA 3S7ZA 5IDXA 4RAIA 1W93A 3QBDA 3FPHA 4RFSA 1M1YE 1MOZA 3LFUA 2QKCA 1N3BA 3QVJA 4LZOA 1AJQA 1YB1A 3UKOA 4BNUA 5F2OA 1T4BA 2V3WA 3COSA 1QRAA 5CT5A 1CUSA 5K0EA 1PG5A 4HQNA 2QL5A 1MX9A 3LDFA 1L5GB 2Q1XA 7MHTA 5DIFA 1ZKMA 5HKKD 1UP6A 1HDCA 2BEUA 3HP4A 4MVWA 3GL9A 2BFAA 4X8LA 2RCNA 1YCGA 1XLUA 1UKBA 3BL5A 4LCJA 1FBNA 2IBMA 1UBOS 3DR3A 4GSYA 5H5NA 2PD3A 5DYNA 2BGRA 4LXXA 1WZUA 4GNKA 5AIBA 5IEJA 2HRQA 1V47A 1Z6AA 4A1OA 5ALKA 2HJFC 5TRTA 1V11B 3U0BA 2AOUB 1E2GA 2X42A 1H2NA 3G8AA 3PVCA 3PFBA 1AH2A 5ILQA 3L6DA 3T4DA 4D9GA 1DP4A 5A2QN 1ENOA 1UCFA 4D43A 1I2CA 1NURA 3IE1A 3E0QA 1W59A 4YDQA 2HP8A 3A1TA 3AWIA 3ADKA 1Q7YH 3DTVD 4LRQA 2OCXA 1E4VA 2QMOA 4CKWA 1LX6A 1KZ7B 1IXBA 4KK4A 4RETA 1R0CA 2HHLA 2VNAA 4X8MA 4ATNA 5I7UA 2HYIC 3A1WA 2AV6A 2RJOA 2E89A 3BA9A 3ON5A 2GK6A 3TGUH 1SBCA 5C52B 3S0HA 1GO3F 3PN1A 2D13A 2XIQA 3F0TA 2DFDA 3WGZA 1TM2A 5EHNA 3GWOA 5G3YA 4CBVA 2YYEA 2JGMA 2A4KA 3NOXA 4LV8B 1KYWA 3EIWA 4RK6A 4L78A 3RS7A 1JHUA 1SESA 1NU6A 1ZRMA 2I2XB 2P7HA 4C7MA 2XYQA 4LWPA 2HKIA 4DJFC 2R4UA 5IT9N 3ZHCA 4REOA 1H22A 2C61A 1DI0A 3J7AR 1K3UB 2PXAA 2ZWVA 1OV9A 1OQAA 3GZ4A 4ME6A 4U2FA 4URHA 1IIBA 2D74A 2HPHA 2F66C 4GKKB 1V35A 3I9JA 5CVUA 3U13A 4DCCA 5KWVA 3AF5A 4K0RA 5BPHA 1GN9A 2QR5A 3O90A 1W35A 4BVSA 2H7XA 3T94A 4ER6A 4Z7JA 5CDFE 2XKJE 4ZI7B 1C7EA 1YDXA 5JS2A 2VDUE 4IRUB 3KQUA 1TA8A 1WB5A 2YMLA 4AP5A 4F2DA 1HP8A 1KIAA 1I5RA 2XUFA 1OXMA 1G3RA 2NSDA 2QVBA 1RU3A 5H70A 5I7EA 2YWDA 1TT5B 3ESDA 4MWOA 3AONB 4OIMA 4W8OA 3B77A 3ADCA 1Z63A 5FWNA 1GTJ1 4HH1A 2WUDA 2PPVA 3QEOA 1FSGA 4I50F 4ZMSA 4XUEA 1GUBA 5I7FA 4KU4A 1ILEA 1YIJF 3OIUA 4US1R 4L5YA 2J48A 4JSTA 4J0CA 1QKIA 2R68A 1Z3IX 2Q49A 3JQGB 1KDTA 1HT1E 3JQAD 4N39A 1J06A 3CUYA 4TMVA 4XJVA 4E5MA 2QROA 2D4AA 4TYMA 4LH6A 2VIIA 4WBNA 1PJLA 2ZYUX 1AQ6A 3DVAB 3HS3A 3OLCX 4RM3A 3VM6A 4WASA 3S2UA 4GPAA 4K9OA 4PINA 1VQPV 3HP7A 4KI7A 1U2QA 3FTQA 5CB4A 4ENUA 4B2PA 5TJ9A 5C37A 1KJWA 4QM6A 2C9CA 3AEKA 1II9A 3AG6A 1A8IA 2JZNA 2R4TA 1LPNA 1SXGA 3TR6A 2ZJ4A 3EPPA 3AB7A 2WIGA 4LS3A 4NCBA 3ADPA 1C9EA 1EX7A 5HKBA 3CF2A 4Y6SA 1OHHG 3K0TA 3AHGA 5FOQA 1H3NA 1NTKH 3K09C 2OHHA 5KQMA 2IYLD 1Y7PA 3ELCA 4DL9A 4M0EA 4F12A 3FNBA 2O5VA 4ZHQA 2O2CA 3B2EA 2CKDA 4XUGB 2YL2A 1MVLA 3ZKAA 5KLVH 1OXKB 1MB4A 5JSZB 2OHJA 1YD7A 3U0ZA 4L4ZA 3EZXA 2XDQA 3RRBA 1ZIPA 2FEMA 1QQ5A 1NHGA 3AV3A 2EL9A 2XGOA 3B7PA 1ZUNA 5DTJA 3EWNA 1LDGA 3JD1A 1Z7GA 2A1UA 4QGHA 4YHHB 3BYZA 3ZUPA 3C3BA 2DWOA 4RM2A 3LOPA 3HJUA 2Q0AA 1KBQA 5C81A 5CFLA 2ORVA 3ABMC 3FFMA 2MYNA 3BWBA 4OEHA 4UEKA 3L7LA 4MV8A 2ALJA 1S8AA 4ZO6A 4LYDA 4OXNA 3A31A 3QE0A 4FFDA 5CEJA 2EYUA 5HG0A 4HQOA 4CFSA 2R0QC 2EKBA 1UOPA 4P32A 4MUEA 1SC4A 3W3ZB 2P1DA 3PWKA 3WOVA 4CKEB 1A7JA 2YC0A 3ZHVA 1ZP6A 2GN8A 3BE5A 1RR6A 4JMPA 3AR2A 2JI7A 4ZWNA 5LPNA 1Q6UA 3UC5A 2FPRA 2RGUA 3PL1A 2HK9A 4OL0A 4F4UA 5IK2D 2CFSA 1M3SA 3AETA 4N21A 4RQFA 2GZ3A 4JCOA 4M89A 3REQA 2ZSFA 1K9VF 3UTCA 3H7IA 5GTDA 1YFJA 4WXRA 5FWDA 2NNUA 2G0AA 2HFKA 3CNEA 5EY5B 5FUVA 3ZHYA 2WF5A 4DEXA 1MSDA 4OKNA 2BTOA 5KSPA 4E70A 2X3UA 4MMXB 3T5MA 4NSNA 5CAEA 4F06A 4M1EA 1GL9B 4AQ7A 3IV9A 4I4TB 2FZ4A 3H8VA 3I01M 4TN1A 5JOQA 1GXSB 1QZZA 3WSWA 5KSZA 5DYYA 2H9AA 4LF6O 3U3ZA 1MV8A 4BO7A 2QG6A 2WIAA 5E6UB 3IDOA 5AVQA 1BX1A 2P2NA 3EZ7A 5L51A 3RSGA 4QPKA 3DBLB 3L05A 3C8DA 3P27A 2WMDA 1GLVA 2EZUA 2DFTA 2BUBA 4KVZA 3WL6A 3L0SA 1KJYA 2BEJA 1ZGAA 2E4YA 3CCBA 4CU2A 1MO4A 5A4DA 1NNSA 2YUAA 4ZGWA 4YI3A 1KEZA 3FOZA 1FU8A 2FPIA 2IRWA 3LUKA 3PJEA 4KPGA 2RC6A 4QUKA 4WAUA 3UJPA 4B75A 4ERXA 1Q0HA 1ZZGA 1K1EA 1L5QA 1Y3IA 3T9AA 1D6JA 1DG9A 4LY0A 1HLDA 5LWHA 3PP8A 5K3DA 3UHFA 1FFSA 2DYYA 4HGYA 2XW6A 2CWJA 5JO9A 3HXPA 5HMLA 5KBYA 3QTBA 2IPNA 4D0GA 3R5KA 3AEKB 1CEEA 1IPHA 2LCAA 2IHTA 4AS1A 3DZDA 2G17A 1K34A 4J4TA 2H16A 4MV9A 2XA9A 3LNNA 3KEMA 2WE8A 4HATA 4WJZA 4ZGBA 5JYDA 1GRCA 2QDXA 3D7KA 4MVJE 4WN9A 3CMCO 2RQ6A 2A1UB 1OZGA 2NADA 2OHIA 3A32A 4MRAA 5CH8A 3LYUA 2K7FA 5AVSA 4CT4B 2CD9A 2PHNA 1RADA 1L9XA 2ZBDA 4EP1A 4ZI3A 4ZK7A 4D8YA 1BVHA 5EHIA 1E7SA 4EMSA 1I14A 3FBWA 4HNSA 3FHCB 4K6FA 1U1DA 1BA3A 3QTCA 3FMVA 1OZ0A 2VF5X 2OKCA 2WD8A 1A9SA 1R74A 3L04A 3OECA 1A8UA 1J23A 2WIBA 1M57C 4F04A 2DVMA 1D5CA 4OYRA 2OTJV 1CX9B 1S02A 3H2SA 4XWKA 4H4DA 4UB6Z 1UBUS 2E21A 3CSDA 2TSYB 4N7BA 5K3FA 3SJAC 4CCYA 5AFSA 5HZKA 1DX6A 4Z1MD 2YI9A 1L7OA 2P06A 4BB6A 4WCDA 2A9KA 3K92A 4QEZA 2RCYA 4NBTA 1U3WA 1RD4A 5FA6A 3WYCA 4EPXA 3SVLA 3K70D 1WPXA 1E6CA 2HVJC 1MRSA 1SBYA 2FZEA 4J4BA 3SHVA 4BFWA 4BZPA 3K4HA 5FBVB 4DSNA 1WDKA 1QFZA 2FSPA 2Z8ZA 3GWZA 3K1TA 4O4JA 5IUNC 2Y4UA 1VFPA 2MR5A 2QP9X 2XGMA 3NAMA 2BM8A 3RT9A 5NULA 3CUUA 3EAFA 3TNJA 1E5QA 1FLNA 3PQFA 4L75A 3S2FA 1J90A 1X2EA 1VRWA 3HI4A 5ESXA 4DVGA 4HLUC 4TV8F 2OWDA 4KBGA 3RREA 3ZWMA 4XASA 2VTKA 3KV3O 2ODMA 5L3GA 3C85A 3IR6A 4C0XA 3KQLA 3S1AA 5BSFA 2WG0A 1JJAA 3HRIA 1Y9ZA 4P0PB 1V8FA 4JYAO 3ITDA 2C4KA 3STYA 5F7JA 3HA2A 4R1TA 5DBHX 3UT0A 4D9BA 3KHSA 2WJGA 3R0XA 3N27A 4PRZA 5ESWA 3USCS 4BBAA 4CG3A 2BJHA 5EIBC 3D5EA 5IX8A 3NVMB 3HN7A 4MUYA 2PYJA 4RQBA 4KQEA 2OZBA 1PFYA 4BNVA 1ODSA 4RWEA 1OX4B 4URVR 2F1MA 3QF4A 1N6KA 1U7ZA 1GVHA 2Q7GA 1PJ8A 1YJNV 1U98A 3HWRA 4KO2S 4U7GA 3OH8A 4YAFA 4N76A 4M99A 5BQOA 1M73E 3TTUA 1PLLA 3ZWDA 4MHOA 1T2NA 4LBYA 4YRZA 4ZJPA 3PRHA 3SZMA 2F9FA 3TNLA 1N7JA 4DV5B 1AB3A 2FP4A 4JWTA 5A3VA 1X74A 4M46A 2E3JA 4BCCA 2XXBA 4OSEA 3TINA 1KYZA 1VQ7V 3UTDA 2C78A 3WI7A 1YR8A 2AL7A 3G13A 1ZM7A 3B6IA 1VKJA 3MJRA 1LK0A 2P2YA 5BO5A 3ELDA 4DGSA 5F7OA 4X93A 5JWRA 4KPYA 3HBFA 3DC5A 5TS2A 2AHZA 3WGYA 5B36A 4RC9A 5ADHA 4NCKA 2F4VB 3OWOA 3H01A 2WYIA 5HWEA 4YT4A 1XZHA 3WPWA 4B3DA 3M4SA 1ODIA 3T7EA 1XL4A 3EORA 2XVXA 4W6ZA 4YS6A 4LXUA 3ICQB 3W7XA 1ECLA 3NORA 1RQ2A 1XKTA 3GCXA 3T4ZA 5DNVA 4BNXA 4BCBA 5HF6A 5KEIA 1SQVH 4LF7B 4AURA 4ZYLA 3C97A 1AA9A 2VJKA 2ZUFA 2NUTA 1GSHA 4IG4A 3G1UA 3H83A 2VJYA 1AC5A 2EGUA 2VI5A 4OHVA 3JQRA 3ZVRA 4Y30A 4EPYA 4PPYA 3DOUA 1KYYA 2B35A 1I24A 2ZRIA 3WLHA 4BV3A 1L5NA 3DBVO 1IV3A 1RRKA 3D00A 2ZUVA 3O74A 3K15A 2D00A 3EG5A 4PIMA 3C2QA 2ZOVA 2WJIA 1OLSB 2WT9A 3LUJA 4XEUA 1P2UA 5C1IA 3S70A 3GAMA 3THXB 4EGFA 5JLJA 4NWOB 2HTEA 1BL8A 3MM4A 2EIXA 2FMXA 3N4ZA 3SSMA 3TTTA 3CQ9A 2WU1A 3MINA 2BKUA 1KNJA 2AEMA 3K30A 4PX2A 3UAWA 5EJ5A 2X5XA 3E2PA 1NNEA 1HEIA 3QVGA 4KE7A 2LGJA 1O96A 1E3EA 1SEPA 2FUEA 1NF3A 1LY1A 1BN6A 3JWIA 1E1QA 1XHLA 3Q3CA 2EF1A 2WYUA 2PH5A 5CM9C 4ZO8A 4YWHA 4AMYA 1GZUA 2GFQA 4KQIA 2PGOA 2XSZD 4FYIA 1RXEA 4LJKA 2C3OA 2BGGA 3P9ZA 2D2IA 1C3VA 2AZ0A 3KSUA 4LXIA 3T0IA 1OV6A 3T5PA 3INNA 5AVOA 1QLWA 3V2IA 2RBKA 2GXSA 2ORYA 3C8LA 3L0ZA 4AAYA 2FL4A 1JU3A 3QUQA 3ABSB 4K8OA 4WLEA 5JMPA 3ZGLA 5DKFA 4E6PA 3G9TA 2CJYA 4BZXA 3UQ8A 2NZYA 4IFEA 1XUQA 1RKUA 3G5AA 3RRZA 5B1BC 3MWLA 5EP2A 5TT0A 4PM4A 1P9LA 5COBA 4D96A 5B6PA 3EODA 4FJ0A 4D1YA 3VR5D 3FB7C 4GOMD 4G56A 5GZ1A 4BUZA 5EHZA 3BERA 2BFEA 5JXJA 4Y9SA 3RUCA 1VQ8V 3Q1KA 4B83A 4HYYA 4W4TA 2VNSA 4ZIRA 2FW1A 1S5HC 4UNNA 5AQ1A 1X14A 1TW2A 2OCIA 3F2IA 5CXQA 4QG3A 4ZAZA 4K5QA 2AQKA 3RJTA 1N9GA 4WPGA 1YZKA 2DWUA 5DU2A 3EZLA 1BGXT 1I4TD 1B6TA 3QYFA 3B4SA 1KMQA 1YQDA 5REQB 2Q4RA 3CT4A 4IH4A 1JXAA 4U2EA 1JLLB 4AJPA 1T9GR 4RUFA 1QVFF 4KXLA 3PFFA 5DCYA 5K20A 3EEFA 5KQPA 1IVSA 2XVAA 3I61A 3S27A 1DRJA 1H42A 2XRYA 1GDTA 4BMOB 1W0KD 5P21A 4GMXA 3FUWA 1XRMA 3OJWA 3Q2IA 2JBAA 2JFHA 5GV8A 1XD2A 3JASA 1P29A 2I5PO 1VQLV 3GY0A 5KNCH 3FTDA 5C4IA 3DXRA 2HS0A 4I50A 1J39A 1EFUA 4UW9A 4D0SA 3HVUA 3L8YA 3AILA 4IZ6A 4PA4A 4MW5A 4AROA 5C5EA 4MVMA 3EBLA 1YB2A 2YY7A 3EOBI 1VQMF 1YB6A 3PD7A 4M1SA 1P9RA 2WVHA 3JV7A 3HSSA 4WCVA 3RYFB 5DSZA 3Q12A 2M6YA 1EFHA 4C4PA 3UB3A 3B1YA 4RKYA 4NBNA 3K2QA 4XYGA 2OCCC 3UJ9A 1ZCFA 4BDTA 2A9RA 2EFGA 3KU4A 4YCBA 4EGQA 4G2TA 4BKOA 3OPXA 4BEWA 4EB6A 4GI5A 5K4AA 2AOTB 4J94A 1QVRA 5J2TB 1CRLA 4BAYA 1ARZA 1O97C 3CF4G 4FMCF 4JT9A 3V5NA 4YV2A 3NBXX 1PWHA 3PEEA 4ZOAA 5IVPA 4LJYA 5IJ9A 2G8LA 3GRPA 5J40A 4H60A 5ALSA 1KRWA 1NSFA 4UCOA 4ZO7A 1IYZA 2TMGA 3F6SA 1A27A 3BD8A 3IULA 2Q4TA 4UBLA 3EXFB 5AM1A 4LFAB 3K8ZA 4QDJA 3T7TA 1K4MA 5BXYA 1XMXA 1VIBA 2UXCO 4H6PA 2ZIEA 5GIPC 2QPLA 3N6RA 3A58B 1E1DA 4GKKO 4OQYA 3GDFA 4P3YA 3KELA 3F7YC 1KJIA 2FSFA 3S0WA 2GBFA 3E61A 4NPAA 5CM8B 1E1CB 1JDNA 3SWWA 2VG8A 2HK7A 3QVKA 1COWG 1NVUQ 1C80A 3Q7PA 3BD9A 5IN5A 1B8OA 2FU5C 3P26A 3CINA 1LCIA 3QWBA 4GH5A 8MHTA 5E3IA 4PFSA 1AURA 5KYUB 3FZYA 1IWPB 3GB9A 3SC4A 2IDJA 3OSUA 4F91B 3G6EV 4MWCA 4OHPA 3QO7A 1ISSA 4W9MC 3PEUA 4FLYA 4IKOA 3AFIA 1UI9A 5M04A 4V1CA 3GU3A 4C7XA 2LP7A 4ND5A 1LNSA 1X2BA 1SZTA 3D7LA 4JUAA 1X1AA 1JMKC 3L1JA 3PRKE 1YJNF 3IXQA 3UT6A 4KJZA 1ID1A 2CYCA 2VP3A 3MDSA 2WM9B 2DY0A 3I4FA 4H37A 3GLGB 1S3JA 1Z18A 1P4JA 2ZRPA 1FJGB 1G66A 3T7CA 3PLAC 2UDPA 4FZ5A 1JHAA 1QCDA 2H29A 1CZNA 1XRLA 2C9BA 3ECSA 4NOKA 2ENWA 4L51A 5TEWA 4BPBA 1JPUA 2ZANA 3AVOA 2XOKG 4XEHA 3VO1A 5FDFA 3KDSE 4Y2RA 2BGLA 1T5OA 6YASA 3H4IA 2J6CA 2RSLA 4BQPA 1ZITA 1W29A 3UN1A 1H6BA 1R10A 3RJMA 3HA3A 4BJ1A 5DLPA 1BZYA 4RIFA 2DR2A 1UM9B 3KHKA 3VTAA 2OYRA 3OUUA 4FNOA 4RF5A 4UTZA 3B38A 1J2YA 1OPXA 1ODEA 2Z0MA 3IPXA 1NMUB 3OE7A 4P7JA 4DHWA 5KB3A 5DNDA 2GEFA 1NJ6A 1DEXA 3FAKA 3QKRA 4LCUC 3DLCA 4KFSA 4XJXA 2OG1A 2W90A 3DEFA 1DDOA 5DM70 1KFJB 1DF4A 1P8JA 2IW1A 2MSNA 4GSKA 3VSEA 4MCAA 4O4LA 3HCFA 3L2OB 1SDSA 1IB6A 5GPBA 3GLGE 3RVKA 1XMOO 4QT4A 4G1MB 3Q0IA 4OMFG 3APQA 1U0LA 1SAYA 2GSMB 1Z56C 2Y48A 3HCNA 4IYJA 4JODA 5DE3A 5IH7A 2UYHA 2NUPA 2ZSHA 2MJLA 5AQEA 1EE9A 1GA6A 1JUDA 1HUQA 2H59A 2IZ1A 4HB3A 4Z2AA 4OH1A 1JX6A 3G3EA 5K2MA 1DO0A 5EFOA 3OURA 5JJEB 5FTJA 2XF8A 3TCUA 4JAUA 3PSHA 3OWHA 1QC5B 1E2NA 3OM9A 4FE4A 3HH8A 4FB4A 3DGEC 4MQUA 4TYNA 5MGBA 1L7DA 1OCCC 2F3SA 3H2JA 1PT8A 2SKDA 4DR6B 4UMFA 4X54A 3EFOA 4ZCQA 1I1QB 4D9FA 5BV0A 4JDUA 4QOSA 4JI3O 3VC2A 7ADHA 2C5GA 2HI0A 2PAFA 4ZAGA 3HKCA 4ABMA 2HHHO 5F78A 1GQQA 3O2SB 1Z4LA 2OP0A 5ALXA 2JRIA 3LKBA 3MJFA 3ZBUA 3AG7A 2LFSA 4QRDA 4F8EA 1AA6A 3ONFA 1FFEA 2AR7A 3BREA 2PFSA 4KIGA 5EJ6A 5JALA 3DEIA 2HPVA 2C5SA 4QKQA 1LBSA 3LNTA 2JAWA 3AF4A 3KQSA 1O9BA 3V8RA 4D6TH 4Y2SA 5JRZA 3DXFA 2RIPA 3JVEA 4IM7A 5CNJA 1OOEA 2OWOA 2YV2A 3P2JA 4NULA 4R9SA 5B30A 3OP4A 5LZ7A 4LBWA 4JFAA 2VNKA 4P3OA 5FNZA 2QAJA 2BBOA 2EKQA 2DBYA 3B2QA 2XI4A 4HTFB 4DR4O 1EI9A 1V48A 2G08A 3CLUD 3HB0A 5A05A 1QYDA 3OONA 1BRMA 2OAEA 2XPCA 3EXG2 3R7LA 2WLNA 5DCUA 3WYFA 3IC5A 1ZN9A 1PS9A 4DGQA 3T7RA 3RC1A 4UTXA 3WNZA 3OZ7A 3HXMA 4JGBA 3F78A 2IC5A 2JRCA 3F8WA 4CVNA 5JPCA 2UYCA 4PZUA 4MHTA 1QU3A 3A1VA 1G20E 4GRAA 4D99A 1DC4A 1KI2A 1YT5A 1HTTA 1L7BA 4XD7D 1P3JA 2I6FA 3CX4A 3WYAA 2YS6A 4MPTA 2B5VA 1DU4A 4AY6A 2H07A 1MN6A 1AUPA 1BROA 1C29B 1T5BA 2G72A 3KAJA 3ODPA 5DNUA 2D5AA 2QGNA 3OM8A 1M8KA 1RQ7A 4UMVA 5E1BA 1E1QD 2W0MA 5KDDA 1FYEA 2LIVA 3W7SA 2KG7B 4BO8A 2JLBA 4RD6A 2AK2A 3F6RA 1R9NA 1XNQO 3HJNA 4MJ3A 4CS4A 2GPNA 4NK4A 5L4NA 1E3QA 2FG5A 4WLVA 1GKUB 3VKVA 4EI2A 5L95A 5CCBA 3A4NA 4Z4EA 1C4XA 2LXNA 3I5MA 2NU8B 2EKLA 3B13B 5L3FA 1HYGA 4PHHA 3CPHA 2IOYA 4PPGA 3D01A 4QNHB 3I3SR 3K59A 1W1WA 1YTFD 5M3BA 2IEYA 3PQ2A 4IKPA 1RHRA 2G5GX 4AY2A 3RAPR 2ZD9A 1BE8A 3G7UA 4F3YA 1U5CA 3EEIA 3JQ8A 2IWHA 3IDFA 4DBLC 3LDAA 4MPPA 4DLVA 4BNKA 3S3TA 2YZ7A 3M81A 1D0IA 1K9SA 4FNAA 5U4QA 5EMJA 3WBBA 1GV1A 5AVKA 2GLZA 2Z1DA 5FQNA 4BWVA 1UJ6A 2JASA 5HY0A 4P31A 1DKUA 1S3FA 2QE6A 3AF3A 4XIIA 1TMKA 2DBRA 3BCCH 2EQ5A 2XDYA 4KG7A 4U5QA 3ZV4A 4Z7OB 2YWFA 1GTG1 4EPTA 4BIOA 2X1MA 4WFBV 3C9SA 4M9SA 4HDRB 3U7QA 1HDZA 4YPFA 2XCRB 5L3DA 1U96A 1LNQA 3CRCA 4Y2GA 3FCYA 5FORA 3CMMA 1GKYA 5AHWA 2FRDA 3TPCA 2P7TC 3J81A 2FN7A 2FPWA 4YACA 3MWEB 3S02A 1QH0A 4KKXB 2GXUA 1A8QA 3J80N 2INGX 2Q1SA 1O96B 3UAGA 1HRKA 4TSFA 4ER3A 3G0DA 3AW9A 4X44A 1UJ5A 1KYXA 3CZPA 5AT1A 3H6KA 4DWOA 4R0MA 1V25A 1M0SA 4PN7A 4HS9A 4GYJA 3I72A 1N0JA 2VUHB 5A6SB 1I1HA 3UK7A 2WZQA 1YRWA 3FR8A 1E3TA 2R9IA 1NIPA 3H18A 2G1UA 3DSRA 4YUZA 4ZXPA 4F93B 3ER6A 2Q4OA 5CNIA 2QN9A 4RH1A 1YGPA 4NCXA 3E5NA 2PF4E 4BNGA 5C4MA 4XWGA 1VRCA 4QARA 5C1DA 3O8DA 4A5UB 1GK9A 3RIXA 3JQDA 1A4IA 2X4GA 1GTVA 1Z5VA 4G88A 2I2WA 2Y4NA 1VSTA 2W6IA 3FKSG 1SN7A 4M9ZA 4QNMA 2O48X 2PMKA 2IV7A 4Q05A 1O89A 1ZI9A 4WZBB 2PWZA 3ND8A 3L40A 1K08A 1YJ5A 3OQPA 1PVVA 3B5JA 4GP9A 3LAWA 1UFKA 2YR0A 5BN5A 1VP3A 3R0PA 3ER9A 3R9XA 1QRRA 4K2HA 3R44A 2GZLA 3M83A 2HMWA 4LEIA 2R65A 3DAOA 4QWWA 4YJKA 5FL7A 5JEDA 2V7EA 1P4RA 1WP4A 2FGKA 3V7UA 4LVUA 3UOAB 4GOLD 1OFUA 4G0UA 1E2IA 2GTAA 1JWLA 1KSJA 2X19A 3K04A 5E6SB 3TJTA 1QAHA 3CEHA 4O4IF 4HDSA 4XWTA 4UVIA 5AO9A 4CMAA 2EL7A 4DA6A 3T3PB 4RSGA 9MHTA 1A98A 3FYSA 3I9FA 1Y76B 3L1IA 3SLGA 3CPEA 4KV9A 1OVMA 3PPXA 5THQA 1RBQA 3TRDA 1CP9A 1MG1A 1NVWQ 3A0RA 2GLXA 3AKEA 3CWBH 1EK2A 3HBNA 5CEEA 5CPBA 4B3BA 1FVXA 1L5HB 2WAXA 1SUCA 1DKNA 3GJ6A 2H31A 5JO0A 3WGLA 2W6QA 3K70B 4JGSA 5K0GA 1AGXA 4BX2A 1E6MA 1F4PA 1KMMA 2EIKC 3ZN2A 2XGGA 3L4JA 3IQIX 1YDFA 2M9MA 1IH8A 2ZUUA 3FYDA 3H0KA 1JL3A 5JBNA 1QBKC 3KZMA 2VP6A 4FIDA 1PF5A 3F9IA 3COWA 1R3IC 3BJMA 1XCOA 1JSLA 2E74B 3KSBC 3MHTA 1QVWA 5BSWA 2W8ZA 1V39A 1SK9A 3QU9A 1C3LA 4DNPA 2WR8A 2LDXA 3CU5A 3IX7A 3ZKWB 5KYKA 4MDFA 1CF4A 1TEVA 3F98A 3MILA 1DIRA 3N8HA 4FD3A 3HJFA 1AP5A 1ZI6A 2CXOA 3TTVA 3ZGXA 4HXEB 5AJVB 2K9PA 3L7CA 2COEA 3ENVA 1AQJA 5CP8A 1OFUX 4I55B 1DAFA 2Q3EA 4XX0B 1VLJA 4TTPA 2NXEA 3B6JA 2RHJA 1UMCB 1FLAA 3RF6A 3ZRSA 1PEDA 5GVSA 5LYJF 1X9IA 1J20A 1RRCA 3MGBA 3RQIA 1JI0A 3LY7A 1KYTA 2RGCA 1KEPA 3GDHA 1FYDA 1GPBA 1DBVO 1TC2A 1W4BA 2C00A 1YQUA 5IFKA 5JAMA 2CK3A 2UAGA 5LP6F 3EULA 1R73A 3GUVA 2ZXEA 1DMRA 1XRSB 2JD1A 1ZH2A 3WIUA 5KA6A 3WDLA 1C0IA 1L7RA 4BC0A 2HMUA 1DB3A 4ZT6A 1BVRA 2VO1A 3RRMA 3HCWA 1XYYA 4LHYA 4CBCA 4LNHA 3B6EA 3WLPA 1CUJA 2PY5A 2FYTA 1KJQA 3VR0A 1CWUA 2NT3A 2WA1A 5LQJA 6PFKA 3GRYA 3H2HA 4XIFA 4AP9A 1Z5OA 2UVQA 2ZBQA 1S6YA 1QZ3A 3HADA 3ABKC 1DC8A 1RACA 1B4DA 1PLKA 2UXBB 1E2EA 1WHSB 2ZTSA 3ML0A 3KLPX 2VBIA 2BW0A 2JAQA 2GJ4A 3P1JA 3QXHA 3GLGA 3DG9A 3REFA 2Z08A 2KLBA 3A3NA 5DYTA 3PHHA 1UBJS 4WEQA 1FU4A 1N92A 3DVQX 2NO5A 1TO6A 4LUCA 1EZ1A 5K0LA 4DADA 4DXAA 1YIAA 4XXHA 3UW3A 3RUHA 1OAOA 2ZE7A 2BUCA 4M8IA 1L7QA 4WV3A 4HQRA 2PEZA 4K9DA 5FPRA 1M90H 3ICWA 4J16A 5KYWA 1V5IA 3ZD8A 4D7SA 2F3QA 4QYIB 1QIJA 2WJPA 3AJDA 3NT4A 1NBMD 4C88A 1PK7A 2O1SA 4WDRA 2A0LA 3G2NA 4AJ2A 5JS8A 1FMLA 3TEFA 5FI0B 3RC9A 3ONEA 1EWRA 1W88A 1DKMA 1JS1X 2BEWA 2ECQA 1EFPB 2VSOA 4G5YA 4OTZA 3TKLA 3ZCPA 3RYHB 1GT91 4XLLA 2EHJA 4S1VA 3G49A 2G9IA 5EJFA 3FZNA 3IQGX 1K75A 3NRJA 1B3RA 3OOJA 1XMQB 1IUPA 1YXMA 2BDEA 2HGZA 3CF0A 4H7FA 3Q3EA 3EZ9A 3HB4X 2VAVA 5DI9A 3FDFA 4ZYVA 2JC3A 3CZAA 4LF9O 3VZSA 3ZYCA 4E31A 5AVXA 4S05A 1BXRB 3G2MA 2PKRA 1BC5A 1B6QA 3OJFA 3KJXA 2HP0A 4CKCA 1UFYA 2H5EA 4Q47A 1OH6A 4HK4A 4YPVA 2IUYA 2A79B 1Z45A 2VYND 3V4FA 2A78A 2XBMA 3QWFA 1Z7EA 1YJWV 1H93A 1OIWA 4LOJA 3LWVC 2R1TB 4KE6A 4NV0A 2D7DA 2XUHA 4D44A 4ZVPA 5HTKA 3VX3A 4E11A 5MN6A 1M2OA 1XJ0A 4R8MA 3QI7A 1LVGA 1WVMA 3D8BA 3FKSA 2BFPA 4Q1CA 5K8JB 5JARA 1XKLA 4W5HA 3SK0A 4FM0A 1Q1AA 1ZRNA 2HHJA 1EUCA 3CW9A 1VCHA 2QKSA 5CIWA 2QJ1A 4B3SO 3CYQA 3GJYA 5FA8A 2NTVA 3FB1A 1UDRA 1DKOA 3KFLA 1P61B 4I55F 4R0NA 4WSOA 4FVMA 5JC1A 1I3KA 3IHLA 3O84A 1GQFA 1I5XA 4RSMA 4NRDA 5HILA 4CCSA 2R2GA 3OM0A 3AG1C 1NM5C 2CXUA 3OBYA 2JS5A 5EK0A 3HSKA 4HUQA 2XE6A 4PX9A 3IA7A 5FPSA 1TAEA 1P1BA 3ZNPA 4J6FA 4E2WA 2L18A 5I9SA 1Z4IA 1PDOA 5DTIA 1DQNA 3OF3A 3QU2A 4LJ5A 4WZAA 3G4SV 3NNNA 2VYVD 3A10A 4NKRA 3RTDA 3I1IA 3UAOA 3F90A 3UQZA 2C9OA 2WKQA 3AQ4A 3I64A 2EJTA 3ABIA 3DNFA 3ETJA 3TLBA 3BIXA 2YYAA 3AFGA 2C8VA 2KPOA 3QBEA 2IBTA 2IXDA 2ODPA 4PXYA 4B87A 2NP6A 1G16A 1GGFA 5DNEA 3G2HA 3KSAC 2C96A 2G4VA 2VPYA 3FYTA 2LKDA 4YR7A 1XPJA 4FEGA 1Z4QA 2EFCB 3HQ4O 1WEHA 4O1MA 2EJ7A 3M70A 1VMEA 3FY4A 3PK0A 2X0KA 5CT4A 2Q0XA 2B1IA 3LZCA 3QXSA 3EHEA 5AXCA 4DDHA 2XTAA 1B04A 3W1WA 5CW1A 5JS6A 1N8NA 1UC4B 3L9WA 4BECA 4XJTA 1U6IA 1BDJA 2XRFA 3M34A 4N01A 3A11A 4FCWA 5LUBA 3HWSA 4IDHA 2N42A 4OREX 4XVRA 2YYSA 4MKGA 2HMTA 3UJ7A 3P8ZA 4ZVQA 2LBPA 2HVKC 4X91A 1DINA 3UW1A 5H8WA 2QL6A 3OEHA 3RW9A 4CV3A 2R3SA 4E07A 3HO1A 1AHNA 1Q86W 4D6YA 1K9MH 1T9HA 2DQKA 1P0IA 2B2XA 3S5JA 3X1KA 1MDFA 3FMFA 1UBFA 2YVAA 1A5SB 1YJBA 3F96A 1X6VA 1SQFA 2ISQA 3U40A 3E8SA 3RRYA 2VTDA 2YBEA 3NBKA 4WECA 5IABA 3UZUA 2E76B 1JFFA 1HEUA 3BWDD 1SKQA 3JVHA 3OIFA 3MD0A 3Q98A 2VRBA 3H5TA 1CQWA 1WKVA 3WJPA 2UVPB 4I66A 5A1JA 5A4KA 3SSNA 2ATKC 2LGWA 4NYMR 3TJMA 1BXRA 1CUIA 5BOSB 4ZAVA 1VG1A 3M4NA 3SHWA 2R25B 4H4EA 3DLBA 3ENZA 1P5JA 4CIXA 3TW4A 4H0NA 4UDNA 3R8CA 1U8ZA 2DTDA 1KKMA 4ERNA 3U4QA 5DH9A 4P9NA 1H2SB 1E2MA 4M0FA 4BO6A 3QBTA 4U9IS 4KYUA 3UCFA 2JI4A 5KQRA 2PKXA 3QIVA 2ZRNA 1Z82A 3N86A 2ODQA 4EEXA 3MMPA 1C8BA 4RVNA 1G8GA 3HYRA 4BYMA 3UWPA 3ZBPA 5A02A 3P9CA 3PUWA 2PX0A 1TCAA 4IWYA 3B1VA 4I5GA 4AYWA 3PLAE 2RBEA 3INTA 3F7NA 4GG1A 4U4AA 1E3MA 1T4GA 3OFNA 2DFVA 3LDDA 1MOPA 1YRHA 3HWWA 4DW8A 3LWQC 3BWEA 3ZHSA 1U0JA 4FUTA 4DB2A 1EM8B 1NOIA 4J7CA 4RK5A 1G8FA 3IBFA 2JKZA 1IXSB 3DV0B 3QM1A 2Q2QA 3K9GA 1TAHA 3G2LA 4RPIA 4U0KA 2JK1A 4OFWA 3PX7A 4LWSA 4KXYA 1KMIZ 1NT2B 1LW6E 4Q24A 2PUSA 4G4YA 3QFSA 4MB6A 3ESQA 2G9RA 1LSUA 1SCQA 1I7QB 1PF7E 3U44A 2ERYA 1XNQB 1A2BA 1QCYA 2CBXA 3E22A 1G8MA 2XX3A 3EGIA 1PU2A 2CSUA 2CJFA 3OCJA 2TRSB 3JPWA 4QTTB 4ZRMA 4G4SP 1G1MA 2EIMC 2E75B 1YASA 1QR2A 2R6JA 4WOJA 4LNUA 3B2EE 1F8FA 1OE0A 2XUIA 3K0FA 3Q8WA 5GOZA 5TPWB 3D64A 3QUSA 1OLXB 4UAJA 5D3MB 4DDKA 1RCUA 4KO3S 4UM5A 1ZC4A 3EIUA 3LDCA 1OFVA 1GAXA 2FE4A 3GZNA 3KZOA 5B3JC 3PG5A 3IMKA 2C77A 2W0XA 3JAMN 3C1TA 3V32A 3WKEA 1IZ8A 1SCJA 2MQEA 2WJJA 3OQBA 5I7WA 3O5AA 4ZCIA 2CVHA 2V4ZA 1N5JA 3NYRA 1CHDA 4OD0A 1Q0TA 3EASA 1P0PA 2G36A 3E1YA 1KC8H 1Z4KA 3L0BA 3QITA 4MV0A 4ID3A 4YAKA 1RLTA 2WV9A 3IPAA 4G1VA 4Q3LA 5JZMA 1L8AA 4LGMA 4O8ZA 4RD0A 3TFQA 3RAEC 1C4WA 5JATA 4JN6B 3GT0A 4Z4QA 3TD3A 2ALEA 1LTQA 5L3BA 4F7DA 3KC2A 3IEMA 3ESZA 1J8FA 1SC9A 2RARA 1D2MA 2H0RA 3LWNA 1I3CA 4Z1VA 2B2CA 2Y77A 1QH8B 1PCXA 1IULA 1EDBA 4NZOA 3NANA 1XCJA 4N47A 4KN6A 1GMGA 1BKSB 4U9UA 2DERA 1B0AA 3A06A 5LXTB 4H27A 4Z86A 3FMGA 1U5BA 3ID6C 2PS1A 4KVFA 4KUGA 1II0A 3W2EA 3CC2V 3R4VA 1CB7A 2O0JA 3LNCA 4IV8A 4P8RA 5HS6A 3LHFA 3T34A 1BW9A 5TPZA 4UXIA 1DZIA 3CXCU 3MNFA 3SFTA 4H44B 1SVWA 1DBIA 4NBWA 3C3EA 4DC0A 1M34A 4GMDA 1I2BA 4MS4A 1L5HA 2QT0A 2Q3DA 1EFVA 1KPGA 4WFGA 1TO2E 2C9YA 3PUHA 4HZUA 4WKNA 5CT8A 3VYVA 5JS1A 5EJ9A 3P96A 2R5WA 3ZRVA 3QE9Y 4B7XA 5H4GA 4HDKA 4HWOA 2R6ZA 1UBTS 4PHTA 4JBYA 2MR6A 4MP6A 5HIMA 2IU4A 1HZJA 1G0OA 1PDVA 1RWVA 2GO1A 3ZMVA 3SC3A 3U4DA 2B37A 3SXUB 1IY1A 1RFLA 5AVUA 2AW5A 1U1IA 1YZVA 2JKVA 4LWZA 1UXJA 2P9JA 3SI7A 4BO1A 4JI0B 1YHZA 5GANK 3G5UA 3RHTA 1A7AA 3DKIA 4NYIQ 5FFMA 3JAMA 2WIJA 4M9CA 3RN4A 4BBPA 2AG0A 3DTNA 3ZOZA 1J56A 4G2NA 5LIRA 2PLFA 4Z4GA 3E3MA 3AXSA 4PQFA 3EH2A 4IDPA 3EN0A 3DTVB 3QE4A 3N9IA 2ISCA 5E1MA 2EYQA 1D4AA 1N1EA 3LUPA 5AM2A 1N3IA 1XNGA 3SEZA 3OFJA 4EUFA 1PEAA 2FA9A 1O3YA 2J5XA 1DGQA 2ZB4A 4JL8A 5FOSA 2WJYA 2GOYA 4K8XA 1L8DA 1BH6A 1S1MA 4XR9A 5E7MA 2Y4TA 1TKAA 1NNI1 1LUAA 3OMLA 4HQLA 1JECA 3DPSA 2AXPA 3PDIA 1SQQH 4EY7A 1VPTA 1QJ4A 4CZ2A 4ZIRB 3RTEA 1C1DB 1KY2A 3G17A 3JAWA 1H6AA 5TC4A 3TQQA 2DH6A 5JFOA 2ZSJA 1JIXA 1VCNA 3TZHA 1E59A 3QVWA 2GWRA 2P9QA 1K06A 4JZGA 4R7CA 2BGNA 4GE3A 5ALRA 5TQ0B 5JI3E 1F7VA 3C3MA 3LDUA 3TLCA 4S04A 4E14A 4NCAA 2CV2A 2MINA 1VQVA 1E6LA 4BL5A 1DTSA 1IWOA 2OP1A 2Q4PA 2HCBA 3PRJA 3LWPC 1UMKA 2OGTA 2BMAA 2CNDA 3AGKA 1QHSA 2X4DA 3CKMA 2PBLA 2QNRA 4IDEA 3R7FA 2EDAA 3KG2A 2AC2A 3HY4A 4C03A 2HD4A 1NJIH 1SBHA 2NAFA 3M9XA 2QXYA 3ER8A 2R751 1HE2A 3DE3X 4PDRA 2GAOA 1JEDA 1WDMA 1F9AA 1BNCA 2H5JA 2WWTA 2X5OA 1QB7A 5LQRA 3RS9A 4R50A 2A67A 3UMCA 3VBCA 1RIIA 1GILA 4N9WA 3ZS9A 1QG0A 2AFVA 2VR1A 1FDIA 2KTVA 5G4KB 4OPAA 2CXSA 2VDLB 4L22A 2C54A 3AU8A 1WB4A 1G5FA 1EFCA 5B3JA 1MO5A 2VUIB 3BMQB 4JI7B 5FJIA 3TZCA 2M98A 1IZ7A 1CYEA 2P11A 3K5OA 1KEEB 3QVXA 4RPKA 5JJKA 4ZCTA 4ZAYA 5LP1A 3ESYA 3F7VC 5J9PC 1V2HE 3SHOA 3KUKA 4LF5O 4J75A 1P0FA 4XOUA 3OQIA 4N65A 3FNIA 2MYTA 3PKZA 1KNXA 3O1HB 3KOOA 4CKXA 3ZIUA 1T9ZA 1WAMA 2EV9A 2WHXA 4Q9DA 3NHBA 2Q6VA 3T5CA 3DCYA 2WF9A 5TVGA 5CDUA 2EKZA 4JX8A 4QULA 4PA3A 1I94O 1DJOA 1FBTA 1N7IA 1NG1A 1NDHA 1P6UA 2P9HA 2WG2A 1H4QA 3DYIA 4AQYO 2BM9A 3I6YA 5DM2A 2HP0B 2C2KA 5AKLA 4CKCB 2V7QD 4EL0A 2QN1A 2EZ4A 3LBNA 3KCYA 1QG6A 5CA1F 4GMHA 1VF7A 5IAAA 1FXUA 1XA3A 4G81A 2QENA 3R9IA 1SCUA 5JMWA 1J7KA 1Y3CE 4RD1A 4DDUA 1RYNA 5K0BA 4RTNA 5AK3A 4ZZ0A 1T9KA 2V0NA 4DWVA 1VK3A 5E2IA 1NLFA 2I55A 3PXUA 3RTGA 2R7KA 3R1IA 4F92B 1ONIA 3PNYA 2QSYA 3E3OA 4OAPA 4L5JA 5FO0A 4M7RA 3GR6A 3VHXA 4UTNA 2PCLA 5EERA 1BQ4A 2V7QG 3WP1B 1FX0B 2BFNA 5HFJA 2P67A 2CXXA 2EJUA 3E15A 4Q34A 3TBHA 3GT3A 1HDGO 3CEAA 2UXBO 1O95D 1CQJA 1Y8RB 3KSDO 1I32A 8ADHA 4MSWC 1CRWG 3UV3A 2NSHA 4FK8A 4LWOA 2PMEA 3EUEA 4LF8O 3S99A 3F1LA 4UHCA 1P60A 2OBLA 1ZNYA 4DMGA 5CA0A 2XYHA 1PJ4A 4M60A 2X0EA 3DBOB 1QP7A 3MCZA 3NHWA 1E32A 1F4VA 4HH0A 4WBSA 4B0PA 5KWIA 3KTOA 4YPOA 3DOHA 2VRWA 2OLKA 1A9XB 3BPZA 1NVDA 2AD1A 1FRQA 1TUGA 1E94E 2V5UA 3I9MA 3KPUA 2WHPB 4NMXB 1TTHA 3WHIA 4LDPA 5EZYF 4ZQHA 2BF7A 4Z9AA 3RBZA 2UZHA 2Q9UA 2YHIA 4L9RA 3QENA 3X1WA 1XZNA 3VOAA 2X1HA 3SKXA 4R71A 2HY7A 1FFXB 1QCCA 1JZQA 5EIBD 3B3QA 3GJ4A 3RVMA 2OZKA 2QVZX 4DLBA 3T1HO 2DQ4A 2GVZC 1HNWO 2IDZA 2VHEA 2WAYA 3TW8B 2HLDA 1NTMH 3C15C 5IDWA 1ZK4A 4JLPA 5CMUA 4L08A 4OMCA 3KYCB 5JNRA 4OG2A 3AR3A 4M9RA 1QNLA 3GX1A 4YHBA 2M1XA 2O8VA 2JK0A 3DMTA 4HGZA 2JFFA 1GFZA 4N7JA 4OHOA 3WLSA 3QVSA 1BHSA 1KRHA 3F6PA 2ZBUA 4CMEA 5D6NA 1LGYA 2IYTA 4MROA 5LL6P 2PL5A 5EMLA 1SBNE 1NPDA 1PKXA 2CJWB 4IUCS 5L9AA 3QEKA 1G64A 3F5MA 4JASA 5IC4A 4TLDA 4RXUA 3ACBA 1OWOA 1KR2A 2XD9A 2H3EA 4YALA 2QRZA 4KNVA 3LQFA 5FUMA 5ANRB 3ZE2B 4IVQA 1UZLA 2NUPB 4UXJA 1PT6A 1BVYF 1PZFA 3LMEA 2VRZA 1UWCA 3HB1A 1U9YA 1SVSA 1JHQA 2MTBA 2YXNA 1TW3A 3NNSA 5T7BA 5BN4B 2P62A 4YMUA 5JW6A 3QKWA 5G1PA 2AKEA 5BMVF 5IXSA 1KJ8A 3FROA 3ZMZA 2XB6A 2CE7A 4KEAA 1KS9A 2XYGA 3MSCA 2LVBA 1XL0A 3O7MA 4QBKA 2NQTA 3RT1A 2HDNB 4C0AC 1UJNA 4EKNB 2OL4A 3E1KA 1B6GA 4ZI5A 5BWLA 1TAUA 1SY7A 2CDBA 3DVSX 1D9ZA 1QH1B 2HBQA 3VBEA 1KR5A 4WESB 3FTFA 3WNDA 4NU6A 5C7YA 1ZWLA 1H2RS 2FUNB 3EPRA 4DTIA 2PYLA 4GOXA 1RWPA 4L8GA 4OO3A 2WHEA 2ZYHA 4UHKA 4I46A 1FTQA 2C5FA 5AJHA 1G6UA 4ZV4A 3SQXA 1ZGCA 4DDMA 4GC9A 4MWTA 2E85A 3RD5A 3GGSA 3AUAA 5ALQA 4H16A 4KRYA 4DPKA 1BKYA 4XWWA 3JRNA 4XDJA 1U04A 2N05A 1WPRA 2BM0A 1B1AA 4RNCA 3WWPA 3GFRA 2HRYA 4H17A 1HKHA 4P2BA 4Q7JB 4H7IA 2WHPA 1NYQA 2O07A 4JXKA 3OOSA 4DHEA 1M2WA 2H1WA 3BE8A 3CC4F 3BX1A 4GEGA 4N12A 2JJ1D 2Y6UA 3L8EA 1JGTA 2QOEA 4N8DA 4XLTA 5AKEA 4E2FA 1VKHA 1KTVA 4ZIBA 3HR8A 4ZD6A 2WLLB 2YWHA 4BWGA 3H1IH 5IT0A 4LWSB 1E63A 2SICE 4DS3A 5CA0B 1SU4A 4RF4A 4GX1A 2DQSA 1H2HA 1RZUA 2FMTA 1NUUA 3HTNA 3BSFA 3GEPA 4R5HA 1Y6FA 4TVOA 2PH7A 3CE9A 4V0NA 2GRAA 2RHMA 4GF5A 4HEQA 5TPZD 4R1NA 3IVCA 1T34A 4TZ6A 5ALYA 521PA 3N2GB 4GOJA 1H9CA 4ZDKA 3ROKA 1XHEA 3ZC3A 1ZK1A 3OLWA 1AR5A 4JB3A 5FPKA 3KB1A 1JIQA 3K0FB 1L0BA 4GX2A 3KQTA 2BFDA 4F3NA 4BVJA 1BIFA 2V6IA 4IGIA 5ECYA 5HUJA 4HWGA 4ZREA 3WFJA 3PKIA 4KDRA 3NUZA 4DAOA 1RT9A 4FBGA 1M57B 4AB1A 5JI2E 2QRMA 4W8HA 4AO7A 5FI1B 2ZXUA 3HEBA 5EP4A 2QZPA 1WCIB 3PENA 4JYZA 3ASVA 1A5BB 1LUVA 2YDYA 1M0TA 3KKQA 4HWRA 1H0HA 3E27A 3RU7A 5ED4A 4I5EA 1JCHA 2ZODA 1QUFA 2BONA 2GESA 2R5NA 4J2OA 2R7MA 5A5VA 2EFHB 2Y66A 4B6FA 4C6RA