4X1NU

The crystal structure of mupain-1-16 in complex with murinised human upa at ph7.4
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mupain-1-16
publication title A cyclic peptidic serine protease inhibitor: increasing affinity by increasing peptide flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
total genus 58
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1nU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1nU01
1JMOH 2WINI 1UHBB 1O37A 1UVOA 3NK8A 2FMJA 3STIA 1O2JA 1BMLA 1A5GH 1PQAA 2FXRA 5DKMA 1HAZB 3NPSA 2EI8A 2XYAA 2J38A 1OKXA 5B6OA 3P70B 1CGIE 1KXBA 4ZXYH 3LGUA 3GYMA 1EPTA 1HDTH 2OLGA 2CXVA 1NU9A 1P11E 1VITH 1T4UH 2RG3A 1MTNC 1VJAU 1DLKB 1DWDH 1H9HE 1C2DA 4LK4A 2BVSH 4ISLA 5F8TA 2OINA 5T6GA 1FN6A 1MKXH 4K60A 3LC3A 4M7GA 1H8DH 5GIBA 2VIPA 2H5DA 1TPOA 5JYIA 4DT7B 4MLFB 1GJ5H 2KAIB 3URCA 2ZGHA 1TYNA 1SLUB 1C5TA 2Z9KA 2FEQH 1LO6A 2BY5X 1MD7A 2BQ6B 4B74A 3GDVA 3EYDA 3SJKA 2C8XB 1ZYOA 1W2KH 2ZI2H 4WXVA 3U1IB 4Y6DA 1P9UA 3DUXH 4B76A 1UCYH 3OSYA 3SU2A 5EG4A 3KGPA 3P95A 1CA0B 2R2WU 1QA0A 3GCTF 1IQFA 3P92A 1MD8A 3E0NB 3ITIA 4X6OA 1Y5UT 1AI8H 1THSH 2C90B 3ZV9A 1SSXA 5J4QA 3BEIB 1BRBE 1G3BA 3PMJA 4X1SU 1C4V2 4FUJA 4OS6A 1GBIA 2AGGX 3SO3A 2PTNA 4A92A 5F6MA 2XBXA 2EC9H 1NRQH 3FAOA 1QL9A 3M5NA 2J34A 1FY5A 4CR5A 4UD9H 1C2HA 4FUGA 4ISOA 4K1TA 3KN2A 1L1NA 4JYVH 5L2ZH 1OX1A 1Z8JB 2A0QB 4MTBA 3UREA 2BY8X 1GMHG 4JYTA 5IYTA 4TY7A 1TB6H 1RJXB 3QGNB 1BRUP 4YM9A 2QY0B 2ODPA 1O33A 1HAVB 4J2YB 1UTPA 2F91A 2VJ1A 2HVXA 4THNH 4AFSA 1HAYB 1BB0B 2BQWB 1O3DA 3M3TA 1SPJA 1H1BA 2QN5T 1GJ7B 4H4FA 1OWIA 2P3TB 4NIVA 1GDNA 1EKBB 3A80A 1B0FA 2ZWLH 3ZVCA 5ESBA 1CGJE 4INLA 2AFQB 1LQDB 3PWBA 1TBQH 1BUIA 1O3EA 1DY8A 3RMMH 1V2PT 4D7GA 2ZPQA 1EX3A 4FUHA 3D23A 1HAXB 1FZZA 1O3CA 4MNWA 2G5NA 1UCYE 3FP7E 1BT7A 3GCOA 1KDQA 1P2OA 1V2WT 1P0SH 1OXGA 4B73A 4R8TB 1O0DH 1ETRH 2VVCA 1XM1A 3BTFE 1A46H 3H5CB 4ABGA 4YTAA 1SB1H 1GG6B 3QGJA 1S0QA 4IS5A 1ELBA 1EOJA 2PR3A 4Y10E 3QZQA 1O2VA 3OU0A 1HB0B 4UFDH 3SU3A 4HZHA 4TWYA 3OX7U 1F0TA 5A2MH 2ANKH 3E0PB 1DY9A 4K1SA 3LC5A 2BDGA 2CN0H 5CHAB 3DD2H 1UTMA 2GV7A 1PYTD 3KCGH 1TA2A 4YOIA 1IHSH 2GV6A 1HYLA 1HJ9A 4NFEA 3B9FH 3P8GA 3M3VA 1HNEE 1LPGB 1RD3B 1GVKB 1GI6A 4DY7B 3V0XA 4K5ZA 1KXCA 1TRNA 1FY4A 3SGBE 3BN9A 4KTUA 1PFXC 4AG1A 4MPVA 4E05H 3FZDA 3U8OH 3QX5H 2OBOA 3C1KA 3UNSA 2A1DB 1DXPA 2GT8A 4ABEA 1V2RT 3T27A 1Z6JH 1GHXH 3RDZA 4NZQA 1EUFA 5E0JA 1AVXA 1JWTA 3A7TA 2F9NA 5EGMA 1FXYA 5C1UA 3GY2A 2G81E 3DFJA 2JH5D 1MMJN 2STAE 1NN6A 1TPPA 3LOXA 4ZH8A 4ZMAH 4X2YA 1O3FA 3LONA 3MHWU 5JBTA 1F5RA 4X8TH 3MU1A 3LGVA 3GCNA 3AASA 1TFXA 1RIWC 1ZTKA 2FYRA 3QZRA 1UCYK 1LHGH 1T8MA 3SJ9A 3LPRA 1XUFA 1GCDA 1HRTH 5I25A 1ZMJA 1GMCF 2ZHFH 4LZ4B 1AUTC 1EZXC 3HPTB 2WV5A 2FOBA 4AORA 1GI7B 2J94A 3V3MA 4UEHH 3ZZ5A 1E38B 4GLYA 1O5AB 3FZZA 3OTJE 1O2IA 1SR5C 2UUJB 5DPAA 2ESTE 1EZUC 2FI5E 1YCPM 3BIVH 1ELEE 1S83A 1GHVH 4HI3A 2W3IA 3MYWA 1P03A 1BRAA 2Q6DA 1YYY1 5JDUB 1UK4A 5AHGH 1TABE 1ID5H 4BTIB 1QBNA 4R0IA 2R3YA 1TE0A 2EA3A 2GCTC 2XTTB 1C1SA 4KELA 3SQHE 4JYUH 4OS1A 1C5ZB 1WU1A 1SGFA 2XC4A 1MAYA 3ZZAA 1O2MA 1J16A 4ISNA 1UK2A 2RDLA 1ZRBA 1AWHB 1P2KA 1HXFH 1W7XH 1VCQA 2VGCB 5E2OA 2ZQ1A 1DPOA 2VNTA 1O36A 3F6UH 3M7QA 1F2SE 3A8DA 2O8UA 1NT1A 3SUFA 4NZLA 1XX9A 3GDSA 2EI6A 1GHWH 1O2UA 3TGJE 1P02A 5LPEA 1TONA 1IQHA 1UTNA 2VU8E 3EGKH 4B2AA 3GOVB 1KLIH 1WSSH 2GTBA 1QNJA 3TNSA 8ESTE 1A4WH 1E34B 3D49H 5EQSA 1P2MA 2G4TA 2AIPA 3FP6E 4IN1A 3TH2H 3ZZ8A 1V6DA 3AVZA 1RRKA 2A5KA 3MO9A 4WXIA 3EAJA 4AGKA 1TNJA 4FXGH 1Z71A 5C3NA 1TA6A 1N8OB 1K28D 2BZAA 1MZDA 4Q7XA 2PGBB 1TX8A 3A87A 2CV3A 1CE5A 3D65E 1O2QA 3MH4A 3M3SA 1CBWC 1ZHPA 3RXHA 2AGIX 1TX7A 3RXAA 1ELTA 3HKIB 4WJG2 4K69A 4X1QU 1GDUA 3A7XA 4IGDA 3UY9A 3KL6A 1NROH 5EXLA 3VGCC 3SJIA 1ACBE 1V2QT 3MFJA 3NXPA 1TGCA 2ZDVH 1K1NA 4BTTB 5EXMA 1GCTC 4IW4E 4JZ1A 3A7YA 5JB8S 4I8JA 1G2LA 3U98H 4AFZA 3TJUA 3SHAH 2AH4X 1QTFA 2YOLA 4JMYA 1NRPH 5LH8A 2TIOA 1QJ7B 1ABIH 2SGPE 3UTUH 3HGPA 1C5OH 1FY8E 2QXHA 1KSNA 2ASUB 2Q6FA 5HGGA 1D6RA 5TCAA 3RP2A 3VFEA 4CH2B 1FNIA 2FP7B 1K1IA 1GJ4H 6ESTA 4CRFA 3MNBA 2QCYA 5A0AE 3RMOH 1JRSA 1YPLH 1DT2A 1TMBH 4CBNA 1FPCH 3BIUH 1SMFE 1BBRK 1P2JA 3Q76A 1O2YA 1Q3XA 2ZHDA 3A88A 4DGJA 2ZG0H 1ZOMA 5A0CA 1VITG 4AZ2B 2QYIA 3A8BA 4FUFA 7KMEH 2G00A 1RGQA 1LMWB 1BQYA 1QB6A 1G30B 1EJAA 1RTLA 5F8ZA 4VGCC 2G52A 2A7CA 2BDBA 3M61U 5HYOA 4XE4A 5A8XA 4Y7AA 5G4BA 1J14A 4Z6AH 4AGJA 4DIHH 3TK9A 4E7NA 4U2WA 1BTUA 4ABFA 4X1NU 1NRRH 3UOUA 3UOPA 3I78A 4ABAA 4E7RG 3H7OA 5H4IB 1OWDA 2BLQA 2ZECA 5SGAE 1AKSA 3RXRA 3RMNH 1YP9A 3M35A 3BTWE 1GDQA 1ZGIA 1Z1IA 2ZPRA 1GBBA 1T8LA 3MWIU 1UJ1A 2PKAA 1JIRA 1FAKH 5DP7A 3TK6A 1UTQA 1PJPA 1K1MA 3LKWA 4DG4A 4F4OC 3TNTA 1TNHA 3TITA 8LPRA 1JOUB 2XWAA 2SGFE 1NFXA 4NA9H 5A8YA 1YPMH 1WQVH 3GY7A 2EI7A 1BTPA 1B7XB 2AIQA 4FU8A 1AUJA 1O2WA 2NWNA 1GGDC 1PPZA 3F1SB 1MTWA 3I77A 1GI8B 4CHAC 3R3GB 1MTVA 2Z9IA 5DP4A 1O2SA 1A5HA 1HFDA 1SL3A 2J2UA 4J1YA 1O30A 1O2HA 5TCCA 4K2YA 3PTBA 2FLBH 5JB9S 2BY6X 3SU6A 1YPKH 1G9IE 1TWXB 1PPEE 3RLWH 3RUOA 3GY6A 3SUEA 3F9HA 4NIYA 4YLUA 1SGDE 2R0KA 1TBZH 3TJVA 3GCHB 1GJ6A 1KTTB 1C5WB 1HJAC 1GHAG 2J92A 1TNGA 2WPLS 3ZZBA 4DOQA 5FCKA 1G32B 1SGCA 4F49A 2B5TB 1EP6A 2W5EA 1HIAA 1T4VH 4I32A 4UONA 3SJOA 1DOJA 3VXEH 5I46H 3Q3XA 1C2GA 1D3PB 2AMPA 2HNTE 3BTEE 1NO9H 4GPGA 1G2MA 2BYAX 5FHTA 3VB6A 1SI5H 1YKTA 6LPRA 1C2JA 5EOKA 3K6YA 3BG8A 2A5AA 2SGQE 4DW2U 2HNTC 1YPJH 4X6PA 3ELAH 1ZJKA 1MTNB 1QURH 2BDHA 4Y71A 2FESH 3SV9A 1GJCB 1WOFA 2OC8A 1GJAB 1LKBA 1AFEH 3LDXH 4WH6A 5T3HA 3QDZB 1OP8A 4WWYA 1GBJA 3MNXA 2O8TA 3PMBB 1DSTA 1KXFA 1UHBA 1NU7B 2HGTH 3ATLA 1QCPA 3L3TA 1QL7A 5GJ4B 3P8OA 1P10A 3S9AA 3A7ZA 3SBKA 3TJOA 1IQGA 2IPHA 2B0FA 1NY22 2XBYA 3JZ2B 3CS0A 1SOTA 1FIWA 3RU4T 2H2ZA 3UNRA 1SGTA 4AYVB 3KF2A 3Q3YA 2ZHEH 1GMDG 1Q31A 3B23B 4A1XA 4AB8A 2RA0A 3PLKA 2AERH 1DS2E 5E2PA 2PHBA 3MNCA 2KAIA 1F0UA 2FLRH 1MZAA 3TU7H 4ZKOU 3SN8A 2ANWA 2XCFA 2BOHB 2YNBA 1MQ5A 1TLDA 5FPSA 3SUGA 3GDUA 2BDAA 4A1TA 5JPMH 3E3TA 4B2BA 3F9EA 1GBKA 1XUGA 2V3OH 3MU0A 1MCTA 3T2NA 3URDA 5E0HA 3S7KB 2F3CE 2WPHS 1QB9A 3TGKE 1B5GH 7GCHF 1AHTH 1V2NT 1LHCH 3ATWA 2ALPA 1BMMH 2FI3E 3LJOA 3BTHE 1D3DB 1GBAA 3MO6A 3BF6H 4AX9H 2QAAA 3A7VA 4D8NA 2Z3CA 2XW9A 1YGCH 2K1QA 3ZYDA 1HJ8A 4IMZA 3EA9A 1TQ7B 2GP9B 3ATIA 2OCVB 1D3QB 2UWLA 1PQ7A 2C8ZB 4AG2A 4O03A 3B8JA 3K2UA 4Y79A 5ETXA 3NZIA 3RXSA 4BNRA 2ZGCA 1ZJDA 2A4OA 1AQ7A 1OYQA 1EPTC 1BHXB 2F83A 1HAVA 2QGRA 4ABJA 2ZDLA 1UVPA 1YPEH 4K1EA 2OP9A 1SGFG 3MH7A 1ELFA 1O2NA 1DUAA 3GICB 2ZFRH 7LPRA 3OYPA 1DDJA 2NU1E 2ZDNA 2ZNKH 4JZDH 3S69A 2WPKS 2IOTA 5CE1A 1FMGA 1C5SA 1FJSA 2WPIS 1NESE 1HLTH 1OWEA 3GCTG 1FQ3A 1V2MT 2FX6A 3K9XB 3PLBA 1ZSKA 1BRCE 3U8TH 2O8MA 1MAXA 1GI1A 4LOYH 3ZVEA 2ZU4A 3DFLA 4B71A 1ETTH 3GISB 5C1XA 4Q2KA 2ZFPH 4KTSA 1C2KA 4U32A 1QQ4A 3SGQE 2O8WA 1IQEA 2AGEX 1V2LT 1NRSH 1UMAH 1SLVB 2H1UA 3ATKA 4FUEA 2DE9A 5DP6A 2WPJS 1DANH 4ABBA 1TRMA 1C1OA 4MNXA 2SNVA 3L6PA 4MG3A 1GHBG 1O5CB 2TRMA 1BZXE 1K1LA 3QTOH 1QRWA 1CVWH 4NIWA 1BJUA 1P01A 1N1LA 1MTSA 4O9VA 2FOFA 2ZGJA 1LVMA 3A89A 1Y3WA 3PM3A 2VH6A 3F9GA 2Z6BD 2FOCA 5HXFA 5EODA 4FUDA 1DM4B 2CF9H 1DICA 3RM0H 1Y3UA 3U8RH 2UWOA 3QO6A 1OWKA 2A2XH 1SHYA 4FUCA 3KQEA 1SHHB 3LGWA 1DITH 3OY5U 2OD3B 4Z0KA 4LXBH 1CHOF 1E36B 1EAUA 4ABDA 4WMDA 1NFYA 3MU5A 3ESTA 1NRNH 5DGJA 3ZYEA 1G3EA 1YBWA 3ZZ7A 5F8XA 6CHAC 2JETC 5ESTE 2BHGA 1BBRH 5LPFA 2ODQA 4Q7ZA 4INKA 1P09A 3NCLA 3PROA 4BXSA 1C4Y2 3HATH 4O3UA 4NA7A 2CHAB 5FX5A 4NIXA 3ZVFA 3SNCA 2C4FH 1ZGVA 1KIGH 5DG6A 2WYJA 4ZAEA 1J15A 3A84A 1C5LH 1BDAA 1C5YB 3ZVDA 4INHA 2HRVA 1SC8U 2VB0A 4BAMB 2GCTB 2BD9A 1PPHE 3V7TA 2BY7X 5C1YA 1TNIA 2PKSC 4MVNA 3RXFA 1VGCC 1V2KT 2VWNA 4ASHA 5CHAC 4Y0ZE 1DXWA 1W11U 1Z8GA 4RKJB 1O2XA 4NCYA 1AVGH 2BDIA 3TJNA 4WH8A 3ODDA 1ZHRA 1AMHA 4ISHH 1DWBH 3EQ0H 1BMNH 3NWUA 4ZHLU 1FV9A 2JH0D 1L1GA 1KXAA 1MTUA 6GCHF 2FS9A 4RSPA 2BMGB 1BITA 1LHEH 1O2KA 5GCHG 3RXGA 1V2TT 1QFKH 3H7TA 1XUHA 2ZGBH 4AOQA 3RXLA 4ZROA 2ZCKP 2VIVA 1NFUA 1SLXB 3NUMA 2D8WA 3L33A 5T6DA 3ZVGA 3AW1A 5EW2H 3LGIA 1S84A 3UR9A 1OWHA 1GI3A 3E91A 4X2XA 1BBRE 1CBWB 1D4PB 1C1VH 2Y5FA 3CS7A 5TJXA 1TIOA 1WUNH 1ABJH 2AMQA 2A4RA 2JKHA 1XVMA 2ODYB 3A83A 1K9OE 3A8CA 1F7ZA 4JZIA 4JK5A 1W3CA 2FWWA 2FOGA 3VGCB 3TIUA 1ZSLA 4GSOA 1HAGE 4ZUHA 4H6SB 4E06H 1GMCG 1ARCA 1ESTA 2XNIA 1AB9C 5FX6A 1ELAA 1GCTB 1K1PA 2XC0A 2BD2A 1TNKA 3M5MA 3ZZCA 2P95A 1AFQC 1C5UA 3UWJH 4ZKRU 5IDKA 3HKJB 2B8OH 1VZQH 5L6NH 2HLCA 1XXFA 4OS7A 2FOMB 2GMTB 2PTCE 3AAVA 3DT0H 4NWLA 1JIMA 3NKKA 5K7RA 3KHVA 1NTPA 1AZ8A 1FI8A 1O5BB 2NU0E 1HUTH 1H9IE 1RTFB 3V13A 4NWKA 4CBOA 2R2MB 2Y5GA 1OP0A 2OC7A 1NC6A 2OXSA 2VWLA 1QJ6B 2J9NA 1HV7A 4Y11E 2TGTA 1VCWA 3RU4E 1O3BA 1XUKA 2R9PA 1P57B 1ELCA 2SFAA 3SOSA 5HMAA 5FPTA 3ZZ6A 1ANDA 3SNEA 1QHRB 2BD7A 4WY3A 1C9PA 2OQ5A 5JBCS 2ZTZA 4VGCB 4X8UH 3GY5A 2C8YB 2QF0A 1S6FA 1V2OT 1OOKB 1S6HA 1HGTH 2FS8A 1X7AC 2OC1A 2P8OC 4A7IB 4D7FA 1ZPBA 1E0FD 2ZFTA 5BRRE 2F9PA 1YC0A 1C5NH 2Z9GA 4RKOB 4UDWH 4TYDA 4MQAA 3HK3B 3LGYA 1WBGB 1GI5A 4YOJA 2BD4A 2XBVA 5C67A 3BG4B 1CGHA 2BX4A 4BXWA 1XUJA 1DLEA 1GI9B 5AFYH 4CRBA 3C27B 1OYTH 1W0ZU 1BHXF 1N8OC 3VB4A 1EASA 2GZ8A 2TBSA 2V3HH 2THFB 1YPHE 1C5QA 4D76A 3ZVBA 2BTCE 1O3JA 3P8FA 1AO5A 1YPHC 5HM2A 2ZTXA 1ZPCA 3RXDA 2ZDMA 3BTGE 1KXEA 3UIRA 2XRCA 2QXJA 3VB3A 1GGDB 1C5PA 4ZKSU 4ESTE 3RC6A 1EAWA 1E37B 1RFNA 2OTVA 2VVUA 2XBWA 4CHAB 2V0BA 4H6TA 3S0NA 4A6LA 1O31A 4OS5A 1EOLA 2BVXH 3KIDU 1QB1A 4CREA 4NSYA 1Z8RA 4UFFH 3BV9B 4ZHAA 1FPHH 3RXEA 5EQQA 2R0LA 1P06A 1WAYB 1LDTT 2STBE 1DE7H 1FY3A 1TGTA 2PGQB 1CU1A 1AN1E 3P8NA 4X6NA 9ESTA 1EZSC 2ZIQH 1HJAB 1AU8A 1G36A 1O3LA 3ZZ3A 1T31A 1O2OA 4XFQA 1GBHA 2FX4A 2A4QA 3PYHA 4WVPE 2C93B 4DIIH 3BTTE 2Y81A 2H9TH 1C2IA 1WQSA 3SW2B 1ELDE 1GHAF 2BD8A 2CJIA 2FO9A 4O97A 3UUZA 1P2IA 2Z3DA 4Y0YE 4FVDA 1GL0E 1W12U 1GI2A 5T6FA 1SGPE 3JZ1B 3VB5A 1MH0A 2O9QA 1O3MA 1F5KU 2QA9E 3SHCH 5AFZH 4ABHA 3F9FA 4I8HA 4XBDA 4Y7BA 3RXQA 1C2LA 2UUYA 1W0YH 1GJ8B 4OS2A 4X2WA 4SGAE 1PPGE 4IMQA 3W94A 1GBEA 3MI4A 1AY6H 4I31A 4Y8YA 1O2GH 1SOZA 4BAOB 3PO1C 1O2LA 4BANB 2Z94A 1EAIA 1GPZA 2SGDE 1KTSB 1O32A 1A0JA 1K1JA 1P3EA 1QR3E 2VWOA 3Q77A 3RXTA 1AE8H 4YZUA 1JBUH 1LPKB 2HPQH 2GCHF 3SI3H 1RTKA 1TMUH 5F03A 2FM2A 2QC2A 1TGBA 2ZDKA 2BD5A 1CHGA 8GCHF 1SGRE 1SGQE 1N6XA 3STJA 1CT0E 2A7HA 1F0SA 2H9EH 1LCYA 2Y6TA 1W10U 4YLQH 2G5VA 4Y8ZA 1C1TA 1ZPZA 2GDEH 3DHKH 1MBQA 1IQJA 2VIWA 3LH3A 5FAHA 1F0RA 1LTOA 4UFEH 1QIXB 1GJ9B 3VB7A 4GHQA 1D6WA 3A85A 1LVBA 3KEEA 4X0WU 1K1OA 2BDYA 4XOJA 4XDEA 3Q3KA 1N6YA 1C5XB 1ZTLA 1PPCE 4XSKU 3UWIA 2GVFA 1T8OA 1QL8A 2WYGA 1MKWH 3M5LA 4GCHG 3TLOA 3LT3A 3MH6A 5C5NA 3BTKE 5JBBS 4HTCH 1C5RA 4GAWA 3G01A 4ABIA 1YCPH 2J95A 1O5GH 4X8VH 4AN7A 4Q80A 4U30A 1P2NA 2ZPSA 1TX6A 3ZZ9A 2IN2A 4MNYA 3UQVA 1IQKA 2ALVA 2Z7FE 3A81A 2SGAA 3M7UA 3T5FH 4YO9A 1NPMA 3IG6B 2ZTYA 2FODA 3N7OA 1HXEH 1WTGH 2ZFSA 1OS8A 4OS4A 1YM0A 3HGNA 3P17H 1PPFE 3RU4D 1DUEA 3CP7A 1WCZA 1AWFH 1TOCB 3O8RA 4OGXA 1A0LA 1ZLRA 1DFPA 2WUCA 1EPTB 3RXKA 3BTDE 2P93A 1P9SA 2M5TA 1TBRH 3T25A 1GI0A 1O2RA 2BM2A 3SORA 1V2VT 2XWBI 3O8CA 1GVZA 5EXNA 2BOKA 2QF3A 1A3EH 4FU7A 2NU2E 1A61H 2F9VA 4X2VA 1GMHF 1SFQB 1QBVH 1TAWA 1MUEB 2HALA 1W7GH 3O8BA 2FOEA 1GBFA 4JCNA 1MCVA 1C1UH 1GBMA 4O3TA 2W26A 4A1VA 3EA7A 3E16B 4FUIA 1C1WH 3ODFA 1XXDA 3MU4A 4B2CA 2NU3E 4MPWA 1GJDB 2VH0A 1EQ9A 1QRXA 1IQLA 5FBIA 2BQ7B 1BIOA 4BAQB 1C1PA 4AB9A 1P8VC 3QTVH 3QUMP 9LPRA 1HAIH 1C2MA 1KLJH 2ZU2A 4OGYA 3AW0A 3SU5A 3UR6A 3IITA 1KXDA 3T29A 4AYYB 3ZVAA 4HFPB 1HBTH 1ELVA 1DX5M 2ZA5A 4TPIZ 4SGBE 1A1RA 1ZZZA 4AFUA 1CA8B 2YNAA 2PFEA 2WPMS 2O8LA 2UWPA 1HAOH 7GCHG 2G8TA 3SQEE 5GXPA 2AYWA 3TH3H 1HAHH 1EP5A 4WF8A 4GUXA 3V12A 4IN2A 1BTXA 2NU4E 1IQMA 3TK5A 1Y3VA 3GYLB 1BTWA 4CRCA 1LHFH 1GHBF 2Z3EA 2BXUH 2I6QA 2ZF0H 1NFWA 2C8WB 1GHYH 2GX4A 1TGSZ 1CA0C 3RC4A 2F9BH 3MMGA 1BTZA 5J4SA 1EB1H 2FTLE 2UUKB 1MU8B 1CT2E 1TRYA 1Q2WA 4JZFH 2AEIH 2VIDA 1TPSA 5GDSH 1GWAA 1UTLM 2BX3A 2HPPH 6CHAB 1ANBA 4K8BA 1SGIB 4BTUB 2JETB 2VIOA 5A8ZA 1LKAA 2V35A 3TVJB 2FOAA 1QGFA 1Y3YA 1O39A 3UNQA 5EPNA 4BAKB 1OPHB 1V2JT 2ZU3A 1C9TA 5DJ7A 1THRH 2PWXA 1Z8IB 2ZQ2A 3E6PH 3KQDA 1P12E 1E35B 1D9IA 1KDQB 1V3XA 3RC5A 1MU6B 1W14U 3LU9B 3VPKA 2C3SA 1FY1A 1G3CA 1QRZA 2HOBA 2ZC9H 4TWWA 2ZHQH 4NFFA 3RXCA 2ANMH 1O34A 2IJOB 2A7JA 2BLOA 1XUIA 2CMYA 2QXIA 2ULLA 1QJ1B 1IAUA 1UTKA 3RXVA 1ORFA 1MKWK 1ANEA 1K2I1 4YESB 2ZFFH 2PKSB 1VGCB 1O3HA 1RIWB 5FXLA 1THPB 1VR1H 4ZHMU 1EJNA 3AAUA 4K3JA 1ZR0A 4MNVA 1YCPK 1C2FA 4B75A 4NSVA 1O3GA 1S85A 1SBWA 2LNCA 2PUXB 1IQNA 2Q6GA 3WY8A 2Y80A 4RN6A 1C5VA 1MBMA 1UVTH 2FI4E 2G51A 2G55A 2PLXA 2A32A 2Y7ZA 3MO3A 4KTCA 3TH4H 1C5MD 4K8YA 5DP8A 3SJ8A 3M5OA 4Y8XA 1OP2A 3SNDA 1AE5A 3MH5A 4B1TA 1GG6C 1QQUA 2A4GA 3HK6B 2ZDAH 2HNTF 2TGDA 2WV4A 5GPIB 1ESBA 2BXTH 3SU4A 1SG8B 5GCHF 4NA8A 1Z1JA 2VIQA 3O8DA 2ZEBA 1MKXK 3D62A 1EXFA 3GY3A 4U01A 4I8LA 2P3UB 4Q7YA 2WUBA 2W7SA 2P59A 2H6MA 2BDCA 2PSXA 2ZO3H 3PLPA 1CHOG 1OSSA 2ZU1A 1FIZA 3ZV8A 5K0HA 1WYKA 1UK3A 1J9CH 3KQCA 1TGNA 1LVOA 1YLDA 4BOHA 2CF8H 4I8GA 2OUAA 3KNXA 4X1PU 5EU8A 1J8AA 1AB9B 1EZQA 3FVFB 1YPGH 2VVVA 3LJJA 5PTPA 2BVRH 2RCEA 2D1JA 1GBTA 1BCUH 1DSUA 3BTQE 1ZMLA 3A8AA 3TPIZ 1AFQB 3UQOA 5E0GA 1H9LB 5A0BA 2P94A 5AF9H 1F5LA 1C1QA 2ZCHP 3E8LA 3FP8E 2CHAC 2PV9B 1PQ8A 2ILNA 3PMAB 5C5OA 1RXPA 4TPYA 3FANA 3UFAA 3A86A 2TGAA 3ZZ4A 4DVAU 3RLYH 3P6ZB 2QV1A 2GZ7A 3BEUA 4QT8C 2VWMA 3PB1E 1IOEA 1C1MA 1O38A 1ZMNA 2CGAA 1GI4A 3MU8A 2LPRA 2PW8H 3T62A 1L0ZA 3R0FA 1M9UA 1EB2A 2QIQA 2Y82A 1KY9A 1SQOA 2TGPZ 3ZZDA 4YT7H 3MTYA 1HAPH 1GVLA 1Y5AT 1Y5BT 2BZ6H 1ZTJA 3S7HB 4I8KA 1O3IA 1EJMA 2OBQA 1S82A 3S9BA 6GCHG 1NS3A 5ABWA 3RXJA 4HGCA 3FFGA 1GHZA 4JK6A 1V2UT 2P8OB 2H9HA 3PTNA 1P05A 2FOHA 4FU9A 2FDAA 2P3FH 3PWCA 4FUBA 5L30H 1G3DA 3RMLH 1T8NA 2SNWA 1TNLA 3SV8A 4MPUA 3MOCA 1J17T 2OC0A 4DCDA 2QXGA 2ZKSA 1MQ6A 1JRTA 2DUCA 2G4UA 1A2CH 1HPGA 4X1RU 4I7YH 3TGIE 2ZGXH 3SU1A 3SZNA 1BTYA 3LIWA 1P3CA 3BTME 3M37A 1GBLA 3SNAA 1ARBA 2RA3A 1LPZB 3MNSA 2BB4A 2A45B 2VGCC 1GL1A 2GT7A 4PROA 3LH1A 1VITF 1YF4A 4FVBA 4KGAA 4IC6A 8KME2 4CRGA 2ZHWH 1PQ5A 3CENA 2FYQA 3QLPH 4CRAA 3BSQA 2HWLB 5EPYA 1H4WA 3I29A 3BEFB 1O3PB 5DP5A 4I33A 1AVWA 3A82A 1CO7E 2A2QH 3F68H 3QWCH 1Z6EA 4MDSA 2GGVB 2F9UA 1A0HB 1SFIA 1Z7KA 4LZ1H 1UVSH 2BLVA 1O2ZA 2GMTC 2GD4B 1A7SA 1GBDA 4IC5A 3U1JB 2TPIZ 3SGAE 1FDPA 3OY6U 1DVAH 1FAXA 1LHDH 4YT6H 4KKDA 4CRDA 1LVYA 1T32A 3SUDA 1ZHMA 2XXLA 5DP3A 2GDDA 3W95A 4D9QA 4CH8B 5JBAS 4ZKNU 5L2YH 1P04A 2B7DH 4KP0A 5FPYA 1DWEH 4DJZB 4Y76A 2W3KA 2SGEE 1NM6A 1TALA 1ESAA 4MPXA 4AFQA 1BMAA 3LGTA 3ATMA 3DA9B 1CQQA 1BOQA 5A09A 2BLWA 1TMTH 1ETSH 3EA8A 1UVUH 3PV4A 3K65B 1SVPA 1K22H 3EDXB 5FBEA 3UPEA 1C1NA 2A31A 2ANYA 4GVUA 5LGOA 2FTMA 3SV7A 2A5IA 1ZRKA 4XBCA 2XCNA 2AMDA 4CR9A 4JZEH 2ZCLP 1UTJA 2PSYA 3IWMA 1L4DA 5EW1H 2BY9X 2D26C 1Y8TA 1VJ9U 2EEKA 2DE8A 1O2TA 1D3TB 2ZFQH 1INCA 1FN8A 1YLCA 2FPZA 2Y7XA 5DP9A 2PUQH 2D2DA 1K21H 1EATA 3PO1B 2GZ9A 3K6ZA 1IHTH 1BA8B 1PPBH 3RXOA 3RXBA 3BG4C 4NGAH 1GJBB 3KQBA 3M7TA 4ZXXH 2R3UA 1P2QA 5C2ZA 3SV6A 1AKSB 2H5CA 1XKAC 1RS0A 2P16A 1AD8H 5HM9A 1CT4E 1O3OA 1DWCH 5BPEA 2PKAB 3RXMA 5DO4H 1W8BH 2ZU5A 1XVOA 1SGEE 4GHTA 1KYNA 4YOGA 1H8IH 1O5FH 4WMFA 1QY6A 1FUJA 2V6NA 2Z9JA 1T7CA 1XMNB 4WMEA 1FLEE 5AVDA 1O3KA 3GY4A 5E8EH 2GKVE 1TQ0B 2Q1JA 1O3NA 2B9LA 4X6MA 4XBBA 2I6SA 3VXFH 5LPRA 1O2PA 5CMXH 1G37A 3SU0A 1ANCA 1C2EA 1AIXH 1A3BH 1Y3XA 4IBLH 3PMHB 3E90B 1EAXA 1UO6A 1ZSJA 4A5TS 1SGNE 1TOMH 2W7UA 1JXPA 4BAHB 7ESTE 2J4IA 1KLTA 3E1XB 1S81A 4X8SH 1CSOE 1XKBC 2JH6D 3RXIA 2ZP0H 1O35A 1F92A 4UE7H 1W13U 3U69H 1AGJA 1PYTC 1QBOA 2XC5A 1O5EH 4GCHF 3S9CA 2Z9LA 1AZZA 1ELGA 2F9OA 1L1JA 5DK1A 1O5DH 4TY6A 4UFGH 1WTHD 1S5SA 4H42U 4ISIH 5FCRA 3SNBA 1GMDF 1SGYE 3QN7A 3U9AH 2FZZA 1C1RA 1B0EA 3RXUA 1A5IA 1HIAB 1C4U2 5GWZA 2AS9A 3A7WA 2UUFB 1IQIA 2Y5HA 4D9RA 1QA7A 5EQRA 3RXPA 1TPAE 1SQTA 3Q00A 1BJVA 1UTOA 1OWJA 1GBCA 1LQEA 1L4ZA 2BD3A 5C20A 3T26A 2FIRH 2VINA 1BTHH 3T28A 3RM2H 4DURA 3VEQB 3M36A 3SV2H 1SQAA 1SLWB 1HCGA 1V2ST 2GCHG 2OQUA 2ZZUH 3EE0B 4NG9H 3ENSB 3GCHC 1VCPA 3QK1A 1L2EA 1O3AA 1S0RA 1U6QA 1Y59T 1WV7H 3SI4H 1NZQH 1FONA 3GY8A 8GCHG
chains in the Genus database with same CATH superfamily
1JMOH 2WINI 1UHBB 1O37A 1UVOA 3NK8A 2FMJA 3STIA 1O2JA 1BMLA 1A5GH 1PQAA 2FXRA 5DKMA 1HAZB 3NPSA 2EI8A 2XYAA 2J38A 1OKXA 5B6OA 3P70B 1CGIE 1KXBA 4ZXYH 3LGUA 3GYMA 1EPTA 1HDTH 2OLGA 2CXVA 1NU9A 1P11E 2F4LA 1VITH 1T4UH 2RG3A 1MTNC 1VJAU 1DLKB 1DWDH 1H9HE 1C2DA 4LK4A 2BVSH 4ISLA 5F8TA 2OINA 5T6GA 1FN6A 1MKXH 4K60A 3LC3A 4M7GA 1H8DH 5GIBA 2VIPA 2H5DA 1TPOA 5JYIA 4DT7B 4MLFB 1GJ5H 2KAIB 3URCA 2ZGHA 1TYNA 1SLUB 1C5TA 2Z9KA 2FEQH 1LO6A 2BY5X 1MD7A 2BQ6B 4B74A 3GDVA 3EYDA 3SJKA 1VKYA 2C8XB 1ZYOA 1W2KH 2ZI2H 4WXVA 3U1IB 2L74A 4Y6DA 1P9UA 3DUXH 4B76A 1UCYH 3OSYA 1NBMD 4FETA 3SU2A 5EG4A 3KGPA 3P95A 1CA0B 2R2WU 1QA0A 3GCTF 1IQFA 3P92A 1MD8A 3E0NB 3ITIA 4X6OA 1Y5UT 1AI8H 1THSH 2C90B 3ZV9A 1SSXA 5J4QA 1H8HD 3BEIB 1BRBE 1G3BA 3PMJA 4X1SU 1C4V2 4FUJA 2KFWA 4OS6A 1GBIA 2AGGX 3SO3A 2PTNA 4A92A 5F6MA 2WSSD 2XBXA 2EC9H 1NRQH 3FAOA 1QL9A 3M5NA 2J34A 1FY5A 4CR5A 4UD9H 1C2HA 4FUGA 2YMSD 3EE7A 4ISOA 4K1TA 4P00A 3KN2A 1L1NA 4JYVH 5L2ZH 1OX1A 1Z8JB 2A0QB 4MTBA 3UREA 2BY8X 1GMHG 4JYTA 5IYTA 4TY7A 1TB6H 1RJXB 3QGNB 1BRUP 4YM9A 2QY0B 2ODPA 1O33A 1HAVB 4J2YB 1UTPA 2F91A 2VJ1A 2HVXA 4THNH 4AFSA 1HAYB 1BB0B 2BQWB 1O3DA 3M3TA 1SPJA 1H1BA 2QN5T 1GJ7B 4H4FA 1OWIA 2P3TB 2LELA 4NIVA 1GDNA 1YWUA 3N7EA 1EKBB 3A80A 1B0FA 2ZWLH 3ZVCA 5ESBA 1CGJE 4INLA 5C94A 2AFQB 1LQDB 3PWBA 1TBQH 1BUIA 1O3EA 1DY8A 3RMMH 1V2PT 4D7GA 2ZPQA 1EX3A 4FUHA 2IJD1 3D23A 2J97A 1HAXB 1FZZA 1O3CA 4MNWA 2G5NA 1UCYE 3FP7E 1BT7A 3GCOA 1KDQA 1P2OA 1V2WT 1P0SH 1OXGA 4B73A 4R8TB 1O0DH 1ETRH 2VVCA 1XM1A 3BTFE 2W6JD 1A46H 3H5CB 4ABGA 4YTAA 1SB1H 3UB0A 1GG6B 3QGJA 1S0QA 4IS5A 5B6LA 1ELBA 1EOJA 2PR3A 4Y10E 3QZQA 1O2VA 3OU0A 1HB0B 4UFDH 3SU3A 4HZHA 4TWYA 3OX7U 1F0TA 5A2MH 2ANKH 3E0PB 1DY9A 4K1SA 3LC5A 2BDGA 2CN0H 5CHAB 3DD2H 1UTMA 2GV7A 1PYTD 3KCGH 1TA2A 4YOIA 2XNDD 1IHSH 4RT0A 2GV6A 1HYLA 1HJ9A 4NFEA 3B9FH 3P8GA 3M3VA 1HNEE 1LPGB 1RD3B 1GVKB 1GI6A 4DY7B 3V0XA 4K5ZA 1KXCA 1TRNA 1FY4A 3SGBE 3BN9A 4KTUA 1PFXC 4AG1A 4MPVA 4E05H 3FZDA 4M9FA 3U8OH 3QX5H 2OBOA 3C1KA 3UNSA 2A1DB 1DXPA 2GT8A 4ABEA 1V2RT 3T27A 1Z6JH 1GHXH 3RDZA 4NZQA 1EUFA 5E0JA 1AVXA 1JWTA 3A7TA 2F9NA 5EGMA 1FXYA 5C1UA 3GY2A 2G81E 3DFJA 2JH5D 1MMJN 2STAE 1NN6A 1TPPA 3LOXA 4ZH8A 4ZMAH 4X2YA 1O3FA 3LONA 3MHWU 5JBTA 1F5RA 4X8TH 4B6FA 3MU1A 3LGVA 3PRDA 3GCNA 3AASA 1TFXA 1RIWC 1ZTKA 2KCAA 2FYRA 3QZRA 1UCYK 1LHGH 1T8MA 3SJ9A 3LPRA 1XUFA 1GCDA 1HRTH 5I25A 1ZMJA 1GMCF 2ZHFH 4LZ4B 4FOUC 1AUTC 1EZXC 3HPTB 2WV5A 2FOBA 4AORA 1GI7B 2J94A 3V3MA 4UEHH 3ZZ5A 1E38B 4GLYA 1O5AB 3FZZA 3OTJE 1O2IA 1SR5C 2UUJB 5DPAA 2ESTE 1EZUC 2FI5E 1YCPM 3BIVH 1ELEE 1S83A 1GHVH 4HI3A 2W3IA 3MYWA 1P03A 1BRAA 2Q6DA 1YYY1 5JDUB 1UK4A 5AHGH 1TABE 1ID5H 4BTIB 1QBNA 4R0IA 2R3YA 1TE0A 2EA3A 2GCTC 2XTTB 1C1SA 4KELA 3SQHE 4JYUH 4OS1A 1C5ZB 1WU1A 1SGFA 2XC4A 1MAYA 3ZZAA 1O2MA 1J16A 5HKKD 4ISNA 1UK2A 2RDLA 1ZRBA 1AWHB 1P2KA 1HXFH 1W7XH 1VCQA 2VGCB 5E2OA 2ZQ1A 1DPOA 2VNTA 1O36A 3F6UH 3M7QA 1F2SE 3A8DA 2O8UA 1NT1A 3SUFA 4NZLA 1XX9A 3GDSA 2EI6A 1GHWH 1O2UA 3TGJE 1P02A 5LPEA 1TONA 1IQHA 1UTNA 2VU8E 3EGKH 4B2AA 3GOVB 1KLIH 1WSSH 2GTBA 1QNJA 3TNSA 8ESTE 1A4WH 1E34B 3D49H 5EQSA 5EJZA 1P2MA 2G4TA 2AIPA 3FP6E 4IN1A 3TH2H 3ZZ8A 1V6DA 3AVZA 1RRKA 2A5KA 3MO9A 4WXIA 3EAJA 4AGKA 1TNJA 4FXGH 1Z71A 3F2FA 3DCLA 5C3NA 1TA6A 1N8OB 1K28D 2BZAA 1MZDA 4Q7XA 2PGBB 1TX8A 3A87A 2CV3A 1CE5A 3D65E 1O2QA 2RDEA 3MH4A 3M3SA 1CBWC 1ZHPA 3RXHA 2AGIX 1TX7A 2KR7A 3RXAA 1ELTA 3HKIB 4WJG2 4K69A 4X1QU 1E1QD 1GDUA 3A7XA 4IGDA 3UY9A 3KL6A 1NROH 2OK5A 5EXLA 4Q63A 3VGCC 3SJIA 1ACBE 1V2QT 3MFJA 3NXPA 1TGCA 2V7QD 2ZDVH 1K1NA 4BTTB 5EXMA 1GCTC 4IW4E 4JZ1A 3A7YA 5JB8S 2YMSB 4I8JA 3SZEA 1G2LA 3U98H 4AFZA 3TJUA 3SHAH 2AH4X 1QTFA 2YOLA 4JMYA 1NRPH 4ACAA 5LH8A 2TIOA 1QJ7B 1ABIH 2SGPE 3UTUH 3HGPA 1C5OH 1FY8E 2QXHA 1KSNA 2ASUB 2Q6FA 5HGGA 1D6RA 5TCAA 3RP2A 3VFEA 4CH2B 1FNIA 2FP7B 1K1IA 1GJ4H 6ESTA 4CRFA 3MNBA 2QCYA 5A0AE 3RMOH 1JRSA 5KEDA 2PP6A 1YPLH 1DT2A 1TMBH 4CBNA 1FPCH 3BIUH 1SMFE 1BBRK 1P2JA 3Q76A 1O2YA 1Q3XA 2ZHDA 3A88A 4DGJA 2ZG0H 1ZOMA 2KM0A 5A0CA 1VITG 4AZ2B 2QYIA 3A8BA 4FUFA 7KMEH 2G00A 1RGQA 1LMWB 1BQYA 1QB6A 1G30B 1SKYE 1EJAA 1RTLA 5F8ZA 4VGCC 2G52A 2A7CA 2BDBA 3M61U 5HYOA 4XE4A 5A8XA 4Y7AA 5G4BA 1J14A 4Z6AH 4AGJA 4DIHH 3TK9A 4E7NA 4U2WA 1BTUA 4ABFA 4X1NU 1NRRH 3UOUA 3UOPA 3I78A 4ABAA 4E7RG 3H7OA 5H4IB 1OWDA 5F53A 2BLQA 2ZECA 5EJ1A 1AKSA 5SGAE 3RXRA 3RMNH 1YP9A 3M35A 3BTWE 1GDQA 1ZGIA 1Z1IA 2ZPRA 1GBBA 1T8LA 3MWIU 1UJ1A 2PKAA 1JIRA 1FAKH 5DP7A 3TK6A 1UTQA 1PJPA 1K1MA 3LKWA 4DG4A 4F4OC 3TNTA 1TNHA 3TITA 8LPRA 1JOUB 2XWAA 2SGFE 1NFXA 4NA9H 5A8YA 1YPMH 1WQVH 2HVYB 3GY7A 2EI7A 1BTPA 1B7XB 2AIQA 4FU8A 1AUJA 1O2WA 2NWNA 1GGDC 1PPZA 3F1SB 1MTWA 3I77A 1GI8B 4CHAC 3R3GB 1MTVA 2Z9IA 5DP4A 1O2SA 1A5HA 1HFDA 1SL3A 2J2UA 4J1YA 1O30A 1O2HA 5TCCA 4K2YA 3PTBA 2FLBH 5JB9S 3FOAA 2BY6X 3SU6A 1YPKH 1G9IE 1TWXB 1PPEE 3RLWH 5DSFA 3RUOA 3GY6A 3SUEA 3F9HA 4NIYA 4YLUA 1SGDE 2R0KA 1TBZH 3TJVA 3GCHB 1GJ6A 1KTTB 1C5WB 3CNRA 1HJAC 1GHAG 2J92A 1TNGA 2WPLS 3ZZBA 4DOQA 5FCKA 1G32B 1SGCA 4F49A 2B5TB 1EP6A 2W5EA 4OM9A 1HIAA 1T4VH 4I32A 4UONA 3SJOA 1DOJA 3VXEH 5I46H 3Q3XA 1C2GA 1D3PB 2AMPA 2HNTE 3BTEE 1NO9H 4GPGA 1G2MA 2BYAX 5FHTA 3VB6A 1SI5H 1YKTA 6LPRA 1C2JA 5C0UA 5EOKA 3K6YA 3BG8A 2A5AA 2SGQE 4DW2U 2HNTC 1YPJH 4X6PA 3ELAH 1ZJKA 1MTNB 1QURH 2BDHA 4Y71A 2FESH 3SV9A 1GJCB 1WOFA 2OC8A 1GJAB 1LKBA 1AFEH 3LDXH 4WH6A 5T3HA 3QDZB 1OP8A 4WWYA 1GBJA 3MNXA 2O8TA 3PMBB 1DSTA 1KXFA 1UHBA 3KYFA 3MQKC 1NU7B 2HGTH 3ATLA 1QCPA 3L3TA 1QL7A 5GJ4B 3P8OA 1P10A 3S9AA 3A7ZA 3SBKA 3TJOA 1IQGA 2IPHA 2B0FA 1NY22 2XBYA 3JZ2B 3CS0A 1SOTA 3F3BA 1FIWA 3RU4T 2H2ZA 3UNRA 1SGTA 4AYVB 3KF2A 3Q3YA 2ZHEH 1GMDG 1Q31A 3B23B 4A1XA 4AB8A 2RA0A 3PLKA 2AERH 1DS2E 5E2PA 2PHBA 3MNCA 1MABB 2KAIA 1F0UA 2FLRH 1MZAA 3TU7H 4ZKOU 3SN8A 2ANWA 2XCFA 2BOHB 2YNBA 1MQ5A 1TLDA 5FPSA 3SUGA 3GDUA 2BDAA 4A1TA 5JPMH 3E3TA 4B2BA 3F9EA 1GBKA 1XUGA 2V3OH 5C17A 3MU0A 1MCTA 3T2NA 3URDA 5E0HA 3S7KB 2F3CE 2WPHS 1QB9A 3TGKE 1B5GH 7GCHF 1AHTH 1V2NT 1LHCH 3ATWA 2ALPA 1BMMH 2HLDD 2FI3E 3LJOA 3BTHE 1D3DB 1GBAA 3MO6A 3BF6H 4AX9H 2QAAA 3A7VA 4D8NA 2Z3CA 2XW9A 1YGCH 2K1QA 3ZYDA 1HJ8A 4IMZA 3EA9A 1TQ7B 2GP9B 3ATIA 2OCVB 1D3QB 2UWLA 1PQ7A 2C8ZB 4AG2A 4O03A 3OFND 3B8JA 3K2UA 4Y79A 5ETXA 3NZIA 3RXSA 4Q4LA 4BNRA 2ZGCA 1ZJDA 2A4OA 1AQ7A 1OYQA 1EPTC 1BHXB 2F83A 1HAVA 2QGRA 4ABJA 2ZDLA 1UVPA 1YPEH 3DSGA 4K1EA 2OP9A 1SGFG 3MH7A 1ELFA 1O2NA 1EFRD 1DUAA 3GICB 3PV2A 2ZFRH 7LPRA 3OYPA 1DDJA 2NU1E 2ZDNA 2ZNKH 4JZDH 3S69A 2WPKS 2IOTA 5CE1A 1FMGA 1C5SA 1FJSA 2WPIS 1NESE 1HLTH 1OWEA 3GCTG 4HG6A 1FQ3A 1V2MT 2FX6A 3K9XB 3PLBA 1ZSKA 1BRCE 3U8TH 2O8MA 1MAXA 4B6EA 1GI1A 3OE7D 4LOYH 3ZVEA 2ZU4A 3DFLA 4B71A 1ETTH 3GISB 5C1XA 4Q2KA 2WPDD 2ZFPH 4KTSA 5T1VA 1C2KA 4U32A 1QQ4A 3SGQE 2O8WA 1IQEA 2AGEX 1V2LT 1NRSH 1UMAH 1SLVB 2H1UA 3ATKA 3NRLA 4FUEA 2DE9A 5DP6A 2WPJS 1DANH 4ABBA 1TRMA 1C1OA 4MNXA 2SNVA 5EJLA 2EY4C 3L6PA 4MG3A 1GHBG 3WW7A 1O5CB 2TRMA 1BZXE 1K1LA 3QTOH 1QRWA 1CVWH 4NIWA 1BJUA 1P01A 1N1LA 1MTSA 4O9VA 2FOFA 2ZGJA 1LVMA 3A89A 1Y3WA 3PM3A 3GS9A 2VH6A 3F9GA 2Z6BD 2FOCA 5HXFA 5EODA 4FUDA 1DM4B 2CF9H 1DICA 3RM0H 1Y3UA 3U8RH 2UWOA 2J98B 3QO6A 1OWKA 2A2XH 1SHYA 1W0JD 4FUCA 3KQEA 1SHHB 3LGWA 1DITH 3OY5U 4ASUD 2OD3B 4Z0KA 4LXBH 1CHOF 1E36B 1EAUA 4ABDA 4WMDA 1NFYA 3MU5A 3ESTA 1NRNH 5DGJA 3ZYEA 1G3EA 1YBWA 3ZZ7A 5F8XA 6CHAC 2JETC 5ESTE 2BHGA 1BBRH 5LPFA 2ODQA 4Q7ZA 4INKA 1P09A 3NCLA 3PROA 4BXSA 5IK2D 1C4Y2 3HATH 4O3UA 4NA7A 2CHAB 5FX5A 4NIXA 3ZVFA 3SNCA 2C4FH 1ZGVA 1KIGH 5DG6A 2WYJA 4ZAEA 1J15A 3A84A 1C5LH 1BDAA 1C5YB 3ZVDA 4INHA 2HRVA 4TT3D 1SC8U 2VB0A 4BAMB 5KECA 2GCTB 2BD9A 1PPHE 3V7TA 2BY7X 5C1YA 1TNIA 2PKSC 4MVNA 3RXFA 1VGCC 1V2KT 2VWNA 4ASHA 5CHAC 4Y0ZE 1DXWA 1W11U 1Z8GA 4RKJB 1WXRA 2JJ1D 1O2XA 4NCYA 1AVGH 2BDIA 3TJNA 4WH8A 1KMHB 3ODDA 1ZHRA 1AMHA 4ISHH 1DWBH 3EQ0H 1BMNH 3NWUA 4ZHLU 1FV9A 2JH0D 1L1GA 1KXAA 1MTUA 6GCHF 2FS9A 4RSPA 2BMGB 1BITA 1LHEH 1O2KA 5GCHG 3RXGA 5CDFE 1V2TT 1QFKH 3H7TA 1XUHA 2ZGBH 4AOQA 3RXLA 4ZROA 2ZCKP 2VIVA 1NFUA 1SLXB 3NUMA 2D8WA 3L33A 5T6DA 3ZVGA 3AW1A 5EW2H 3LGIA 1S84A 3UR9A 1OWHA 1GI3A 3E91A 4X2XA 1BBRE 2QF5A 1CBWB 1D4PB 5HIYA 1C1VH 2Y5FA 3CS7A 5TJXA 1TIOA 1WUNH 1ABJH 2AMQA 2A4RA 2JKHA 1XVMA 2ODYB 3A83A 1K9OE 1YY3A 3A8CA 1F7ZA 4JZIA 4JK5A 1W3CA 2FWWA 2FOGA 3VGCB 3TIUA 1ZSLA 4GSOA 1HAGE 4ZUHA 4H6SB 4E06H 1GMCG 1ARCA 1ESTA 2XNIA 1AB9C 5FX6A 1ELAA 1GCTB 1K1PA 2XC0A 2BD2A 1TNKA 3M5MA 3ZZCA 2P95A 1AFQC 2K0QA 1C5UA 3UWJH 4ZKRU 5IDKA 3HKJB 2B8OH 3F0OA 1VZQH 5L6NH 2HLCA 1FX0B 4ACBA 1XXFA 4OS7A 2FOMB 2GMTB 2PTCE 3AAVA 3DT0H 4NWLA 1JIMA 3NKKA 5K7RA 3KHVA 1NTPA 1AZ8A 1FI8A 1O5BB 2NU0E 1HUTH 1H9IE 1RTFB 3V13A 4NWKA 4CBOA 2R2MB 2Y5GA 1OP0A 2OC7A 1NC6A 2OXSA 2VWLA 4DT4A 4F48B 1QJ6B 2J9NA 1HV7A 4Y11E 2TGTA 1VCWA 3RU4E 2WV9A 1O3BA 1XUKA 2R9PA 1P57B 1ELCA 2SFAA 3SOSA 5HMAA 5FPTA 3OEED 3ZZ6A 1ANDA 3SNEA 1QHRB 2BD7A 4WY3A 1C9PA 2OQ5A 5JBCS 2ZTZA 4VGCB 4X8UH 3GY5A 2C8YB 2QF0A 1S6FA 1V2OT 1OOKB 1S6HA 1HGTH 2FS8A 1X7AC 2OC1A 2P8OC 4A7IB 4D7FA 1ZPBA 1E0FD 2ZFTA 5BRRE 2F9PA 1YC0A 1C5NH 2Z9GA 4RKOB 4UDWH 4TYDA 4Z1MD 4MQAA 3HK3B 3LGYA 1WBGB 1GI5A 4YOJA 2BD4A 2XBVA 2XOKD 5C67A 3BG4B 1CGHA 2BX4A 4BXWA 1XUJA 1DLEA 1GI9B 5AFYH 4CRBA 3C27B 1NBME 1OYTH 1W0ZU 1BHXF 1N8OC 3VB4A 1EASA 4AC9A 2GZ8A 2TBSA 2V3HH 2THFB 1YPHE 1C5QA 4D76A 3ZVBA 2BTCE 1O3JA 2IPQX 3P8FA 1AO5A 1YPHC 5HM2A 2ZTXA 3VG8A 1ZPCA 3RXDA 2ZDMA 3BTGE 1KXEA 3UIRA 3UAIC 2XRCA 2QXJA 3VB3A 1GGDB 1C5PA 4ZKSU 1UW7A 4ESTE 3RC6A 1EAWA 1E37B 1RFNA 2OTVA 2VVUA 2XBWA 4CHAB 2V0BA 4H6TA 3S0NA 4A6LA 1O31A 4OS5A 5DN6D 1EOLA 2BVXH 3KIDU 1QB1A 4CREA 3ZIAD 4NSYA 1Z8RA 4UFFH 3BV9B 4ZHAA 1FPHH 3RXEA 1K0HA 5EQQA 2R0LA 1P06A 1WAYB 1LDTT 2STBE 1DE7H 1FY3A 1TGTA 2PGQB 1CU1A 1AN1E 3P8NA 4X6NA 9ESTA 1EZSC 3DSOA 2ZIQH 1HJAB 1AU8A 1G36A 1O3LA 3ZZ3A 1T31A 1O2OA 4P02A 4XFQA 1GBHA 2FX4A 2A4QA 3PYHA 4WVPE 2C93B 4DIIH 3BTTE 2Y81A 2H9TH 1C2IA 1WQSA 3SW2B 1ELDE 1GHAF 2BD8A 2CJIA 2FO9A 4O97A 3UUZA 1P2IA 2Z3DA 4Y0YE 4FVDA 1GL0E 1W12U 1GI2A 5T6FA 1SGPE 3JZ1B 3VB5A 1MH0A 2O9QA 1O3MA 1F5KU 2QA9E 3SHCH 5AFZH 4ABHA 3F9FA 4I8HA 4XBDA 4Y7BA 3RXQA 1C2LA 2UUYA 1W0YH 1GJ8B 4OS2A 4X2WA 5GNDA 5FL7D 4SGAE 2VBCA 1PPGE 4IMQA 3W94A 1GBEA 3MI4A 1AY6H 4I31A 4Y8YA 1O2GH 1SOZA 4BAOB 3PO1C 1O2LA 4BANB 2Z94A 1EAIA 2KZ4A 1GPZA 2SGDE 1KTSB 1O32A 1A0JA 1K1JA 1P3EA 1QR3E 2CK3D 2VWOA 3Q77A 3RXTA 1AE8H 1QZ8A 4YZUA 1JBUH 1LPKB 2HPQH 2GCHF 3SI3H 1RTKA 1TMUH 5F03A 2FM2A 2QC2A 1TGBA 2ZDKA 2BD5A 1CHGA 8GCHF 1SGRE 1SGQE 1N6XA 3STJA 3W1EA 1CT0E 2A7HA 1F0SA 2H9EH 1LCYA 2Y6TA 1W10U 4YLQH 2G5VA 4Y8ZA 1C1TA 1ZPZA 2GDEH 3DHKH 1MBQA 1IQJA 2VIWA 3LH3A 5FAHA 1F0RA 1LTOA 4UFEH 1QIXB 1GJ9B 3VB7A 4GHQA 1D6WA 3A85A 1LVBA 3KEEA 4X0WU 1K1OA 2BDYA 4XOJA 4XDEA 3Q3KA 1N6YA 1C5XB 1COWD 1ZTLA 1PPCE 4XSKU 3UWIA 2GVFA 1T8OA 1QL8A 2WYGA 1MKWH 3M5LA 4GCHG 3TLOA 3LT3A 3MH6A 5C5NA 3BTKE 5JBBS 1W0KD 4HTCH 1C5RA 2WHXA 4GAWA 2KCYA 3G01A 4ABIA 1YCPH 1OHHD 2J95A 2EQNA 1O5GH 2QE7D 4X8VH 4AN7A 3PV5A 4Q80A 4U30A 1P2NA 2ZPSA 3KYGA 1TX6A 3ZZ9A 2IN2A 4MNYA 3UQVA 1IQKA 2ALVA 4XRNA 2Z7FE 3A81A 2SGAA 3M7UA 3T5FH 4YO9A 1NPMA 3IG6B 2ZTYA 2FODA 3N7OA 1HXEH 1WTGH 2ZFSA 1OS8A 4OS4A 1YM0A 3HGNA 3P17H 1PPFE 3RU4D 1DUEA 1YLNA 1E1RD 1WCZA 1AWFH 1TOCB 3CP7A 3O8RA 4OGXA 1A0LA 1ZLRA 1DFPA 2WUCA 2KCOA 1EPTB 3RXKA 3BTDE 2P93A 1P9SA 2M5TA 1TBRH 3OTPA 3T25A 1GI0A 1O2RA 2BM2A 3SORA 1V2VT 2XWBI 3O8CA 1GVZA 5EXNA 2BOKA 2QF3A 1A3EH 4FU7A 2NU2E 1A61H 2F9VA 4X2VA 1GMHF 1SFQB 1QBVH 1TAWA 1MUEB 2HALA 1W7GH 3O8BA 2FOEA 1GBFA 4JCNA 1MCVA 1C1UH 1GBMA 4O3TA 2W26A 4A1VA 3EA7A 3E16B 4FUIA 1C1WH 3ODFA 1XXDA 3MU4A 4B2CA 2NU3E 4MPWA 1GJDB 2VH0A 1EQ9A 1QRXA 1IQLA 5FBIA 2BQ7B 1BIOA 4BAQB 1C1PA 4AB9A 1P8VC 3QTVH 3QUMP 9LPRA 1HAIH 1C2MA 1KLJH 2M2AA 2ZU2A 4OGYA 3AW0A 3SU5A 3UR6A 3IITA 1KXDA 2QF4A 3T29A 4AYYB 3ZVAA 4HFPB 1HBTH 1ELVA 1DX5M 2ZA5A 4TPIZ 4SGBE 2K8IA 1A1RA 1ZZZA 4AFUA 1CA8B 2YNAA 2PFEA 2WPMS 2O8LA 2UWPA 1HAOH 7GCHG 2G8TA 3SQEE 5GXPA 2AYWA 3TH3H 1HAHH 1EP5A 4WF8A 4GUXA 3V12A 4IN2A 1BTXA 2NU4E 1IQMA 3TK5A 1Y3VA 3GYLB 1BTWA 4CRCA 1LHFH 1GHBF 2Z3EA 2BXUH 2I6QA 2ZF0H 1NFWA 2C8WB 1GHYH 3F2HA 2GX4A 1TGSZ 1CA0C 3RC4A 1WDIA 2F9BH 3MMGA 1BTZA 5J4SA 1EB1H 2FTLE 2UUKB 1MU8B 1CT2E 1TRYA 1Q2WA 4JZFH 2AEIH 2VIDA 1TPSA 5GDSH 1GWAA 1UTLM 2BX3A 2HPPH 3H09A 6CHAB 1ANBA 4K8BA 1SGIB 4BTUB 2JETB 2VIOA 5A8ZA 1LKAA 3U28C 1SQRA 2V35A 3TVJB 2FOAA 1QGFA 1Y3YA 1O39A 3UNQA 5EPNA 4BAKB 1OPHB 1V2JT 2ZU3A 1C9TA 5DJ7A 1THRH 2PWXA 1Z8IB 2ZQ2A 3E6PH 3KQDA 1P12E 1E35B 1D9IA 1KDQB 1V3XA 3RC5A 1MU6B 2J98A 1W14U 3LU9B 3VPKA 2C3SA 1FY1A 1G3CA 1QRZA 2HOBA 2ZC9H 4TWWA 2ZHQH 4NFFA 3RXCA 2ANMH 1O34A 2IJOB 2A7JA 2BLOA 1XUIA 2CMYA 2QXIA 2ULLA 1QJ1B 4ZCNA 1IAUA 1UTKA 3RXVA 1ORFA 1MKWK 1ANEA 1K2I1 4YESB 2ZFFH 2PKSB 1VGCB 1O3HA 1RIWB 5FXLA 1THPB 1VR1H 4ZHMU 1EJNA 3AAUA 4K3JA 1ZR0A 4MNVA 1YCPK 1C2FA 4B75A 4NSVA 1O3GA 1S85A 1SBWA 2LNCA 2PUXB 1IQNA 2Q6GA 3WY8A 2Y80A 4RN6A 1C5VA 1MBMA 1UVTH 2FI4E 2G51A 2G55A 2PLXA 2A32A 2Y7ZA 2WZQA 4YXWD 3DSPA 2J5UA 3MO3A 4KTCA 3TH4H 1C5MD 4K8YA 5DP8A 3SJ8A 3M5OA 4Y8XA 1OP2A 3SNDA 1AE5A 3MH5A 4B1TA 1GG6C 1QQUA 2A4GA 3HK6B 2ZDAH 2HNTF 2TGDA 2WV4A 5GPIB 1ESBA 2BXTH 3SU4A 1SG8B 5GCHF 4NA8A 1Z1JA 2VIQA 3O8DA 2ZEBA 1MKXK 3D62A 1EXFA 3GY3A 4U01A 4I8LA 2P3UB 4Q7YA 2WUBA 2W7SA 2P59A 2H6MA 2BDCA 2PSXA 2ZO3H 3PLPA 1CHOG 1OSSA 2ZU1A 1FIZA 3ZV8A 5K0HA 1WYKA 1UK3A 1J9CH 3KQCA 1TGNA 3OAAD 1LVOA 1YLDA 4BOHA 2CF8H 4I8GA 2OUAA 3KNXA 4X1PU 5EU8A 2JJ2D 1J8AA 1BMFD 1AB9B 1EZQA 3FVFB 1YPGH 2VVVA 3LJJA 5PTPA 2BVRH 2RCEA 2D1JA 1GBTA 1BCUH 1DSUA 3BTQE 1ZMLA 3A8AA 3TPIZ 1AFQB 3UQOA 5E0GA 1H9LB 5A0BA 2P94A 5AF9H 1F5LA 3WWFA 1C1QA 2ZCHP 3E8LA 3FP8E 2CHAC 2PV9B 1PQ8A 2ILNA 3PMAB 5C5OA 1RXPA 4TPYA 3FANA 5KGOA 3UFAA 3A86A 2TGAA 3ZZ4A 4DVAU 3RLYH 5EIYA 3P6ZB 2QV1A 2GZ7A 3BEUA 4QT8C 2VWMA 3PB1E 1IOEA 1C1MA 1O38A 1ZMNA 2CGAA 1GI4A 3N7DA 3MU8A 2LPRA 2PW8H 3T62A 1L0ZA 3R0FA 1M9UA 1EB2A 2QIQA 2Y82A 1KY9A 1SQOA 2TGPZ 3ZZDA 4YT7H 3MTYA 1HAPH 1GVLA 1Y5AT 1Y5BT 2BZ6H 1ZTJA 2AHME 3S7HB 4I8KA 1O3IA 1EJMA 2OBQA 1S82A 3S9BA 3FO8D 4F55A 6GCHG 1NS3A 4I86A 3RXJA 4HGCA 5ABWA 3FFGA 1GHZA 4JK6A 1V2UT 2P8OB 2H9HA 3OEHD 1P05A 2FOHA 3PTNA 4FU9A 2FDAA 2P3FH 3PWCA 4FUBA 5L30H 1G3DA 3RMLH 1T8NA 2SNWA 1TNLA 3SV8A 4MPUA 3MOCA 1J17T 2OC0A 4DCDA 2QXGA 2ZKSA 1MQ6A 1JRTA 2DUCA 2G4UA 1A2CH 1HPGA 4X1RU 4I7YH 3TGIE 2ZGXH 3SU1A 4RT1A 3SZNA 1BTYA 3LIWA 1P3CA 3BTME 3F0PA 3M37A 1GBLA 3SNAA 1ARBA 2RA3A 1LPZB 3MNSA 2BB4A 2A45B 2VGCC 1GL1A 2GT7A 4PROA 1S6LA 3LH1A 1VITF 1YF4A 4FVBA 4KGAA 4IC6A 8KME2 4CRGA 2ZHWH 1PQ5A 3CENA 2FYQA 3QLPH 4CRAA 3BSQA 2HWLB 5EPYA 1H4WA 3I29A 3BEFB 1O3PB 5DP5A 1H8ED 4I33A 1AVWA 3A82A 1CO7E 2RFKC 2A2QH 3F68H 3QWCH 1Z6EA 4MDSA 2GGVB 2F9UA 1A0HB 2LP6A 1SFIA 1Z7KA 4LZ1H 1UVSH 2BLVA 1O2ZA 2GMTC 2GD4B 1A7SA 1GBDA 4IC5A 3U1JB 2TPIZ 3SGAE 1FDPA 3OY6U 1DVAH 1FAXA 1LHDH 4YT6H 4KKDA 4CRDA 1LVYA 1T32A 3SUDA 1ZHMA 2L6OA 2XXLA 5DP3A 2GDDA 3W95A 4D9QA 4CH8B 5JBAS 4ZKNU 5L2YH 3N99A 1P04A 2B7DH 4KP0A 2JDID 5FPYA 1DWEH 4DJZB 4Y76A 2W3KA 2SGEE 1NM6A 1TALA 1ESAA 4MPXA 4AFQA 1BMAA 3LGTA 3ATMA 4XD7D 3DA9B 1CQQA 1BOQA 5A09A 2BLWA 1TMTH 1ETSH 2V3MA 3EA8A 1UVUH 3PV4A 3K65B 1SVPA 1K22H 3EDXB 5FBEA 3UPEA 1C1NA 2A31A 2ANYA 4GVUA 5LGOA 2YMSC 2FTMA 3SV7A 2A5IA 1ZRKA 4XBCA 2XCNA 2AMDA 4CR9A 4JZEH 2ZCLP 1UTJA 2PSYA 3IWMA 1L4DA 4TSFD 5EW1H 2BY9X 2D26C 1Y8TA 1VJ9U 2EEKA 2DE8A 1O2TA 1D3TB 2ZFQH 1INCA 1FN8A 1YLCA 2FPZA 2Y7XA 5DP9A 2GJGA 2PUQH 2D2DA 1K21H 2JIZD 1EATA 2KX4A 2GZ9A 3PO1B 3K6ZA 1IHTH 1BA8B 1PPBH 3RXOA 3PRBA 3RXBA 3BG4C 4NGAH 1GJBB 3KQBA 3M7TA 5CHBA 4ZXXH 2R3UA 1P2QA 5C2ZA 3SV6A 1AKSB 2H5CA 3SYJA 1XKAC 1RS0A 3WWBA 2P16A 1AD8H 5HM9A 1CT4E 1O3OA 1DWCH 5BPEA 2PKAB 3FN8A 3RXMA 5DO4H 1W8BH 2ZU5A 1XVOA 1SGEE 4GHTA 1KYNA 4YOGA 1H8IH 1O5FH 4WMFA 1QY6A 1FUJA 2V6NA 2Z9JA 1T7CA 1XMNB 4WMEA 1FLEE 5AVDA 1O3KA 3GY4A 5E8EH 2GKVE 1TQ0B 2Q1JA 1O3NA 2B9LA 4X6MA 4XBBA 2I6SA 3VXFH 5LPRA 1O2PA 5CMXH 3F2GA 2F43B 1G37A 3SU0A 1ANCA 1C2EA 1AIXH 1A3BH 1Y3XA 4IBLH 3PMHB 3E90B 1EAXA 1UO6A 1ZSJA 4A5TS 1SGNE 1TOMH 2W7UA 1JXPA 4BAHB 7ESTE 2J4IA 2W6ID 1KLTA 3E1XB 1S81A 3KQ5A 4X8SH 1CSOE 1XKBC 3AK5A 4RI0A 2JH6D 3RXIA 2ZP0H 1O35A 1F92A 3FKSD 4UE7H 1W13U 3U69H 1AGJA 1PYTC 1QBOA 2XC5A 1O5EH 4GCHF 3S9CA 2Z9LA 1AZZA 1ELGA 2F9OA 1L1JA 5DK1A 1O5DH 4TY6A 4UFGH 5HIZA 1WTHD 1S5SA 4H42U 4ISIH 5FCRA 3SNBA 1GMDF 1SGYE 3QN7A 3U9AH 1E79D 2FZZA 1C1RA 1B0EA 3RXUA 1A5IA 1HIAB 1C4U2 5GWZA 2AS9A 3A7WA 2UUFB 1IQIA 2Y5HA 4D9RA 1QA7A 5EQRA 3RXPA 1TPAE 1SQTA 3Q00A 1BJVA 1UTOA 1OWJA 1GBCA 1LQEA 1L4ZA 2BD3A 5C20A 3T26A 2FIRH 2VINA 5C0TA 1BTHH 3T28A 3RM2H 4DURA 3VEQB 3M36A 3SV2H 1SQAA 1SLWB 1HCGA 1V2ST 2GCHG 2OQUA 2ZZUH 3EE0B 4NG9H 3ENSB 3GCHC 1VCPA 3QK1A 2KCPA 1L2EA 1O3AA 1S0RA 1U6QA 1Y59T 1WV7H 3SI4H 1NZQH 1FONA 3GY8A 8GCHG
chains in the Genus database with same CATH topology
1JMOH 2WINI 1UHBB 1O37A 1UVOA 3NK8A 2FMJA 3STIA 1O2JA 1BMLA 1A5GH 1PQAA 2FXRA 5DKMA 1HAZB 3NPSA 2EI8A 2XYAA 2J38A 1OKXA 5B6OA 3P70B 1CGIE 1KXBA 4ZXYH 3LGUA 3GYMA 1EPTA 1HDTH 2OLGA 2CXVA 1NU9A 1P11E 1VITH 1T4UH 2RG3A 1MTNC 1VJAU 1DLKB 1DWDH 1H9HE 1C2DA 4LK4A 2BVSH 4ISLA 5F8TA 2OINA 5T6GA 1FN6A 1MKXH 4K60A 3LC3A 4M7GA 1H8DH 5GIBA 2VIPA 2H5DA 1TPOA 5JYIA 4DT7B 4MLFB 1GJ5H 2KAIB 3URCA 2ZGHA 1TYNA 1SLUB 1C5TA 2Z9KA 2FEQH 1LO6A 2BY5X 1MD7A 2BQ6B 4B74A 3GDVA 3EYDA 3SJKA 2C8XB 1ZYOA 1W2KH 2ZI2H 4WXVA 3U1IB 4Y6DA 1P9UA 3DUXH 4B76A 1UCYH 3OSYA 3SU2A 5EG4A 3KGPA 3P95A 1CA0B 2R2WU 1QA0A 3GCTF 1IQFA 3P92A 1MD8A 3E0NB 3ITIA 4X6OA 1Y5UT 1AI8H 1THSH 2C90B 3ZV9A 1SSXA 5J4QA 3BEIB 1BRBE 1G3BA 3PMJA 4X1SU 1C4V2 4FUJA 4OS6A 1GBIA 2AGGX 3SO3A 2PTNA 4A92A 5F6MA 2XBXA 2EC9H 1NRQH 3FAOA 1QL9A 3M5NA 2J34A 1FY5A 4CR5A 4UD9H 1C2HA 4FUGA 4ISOA 4K1TA 3KN2A 1L1NA 4JYVH 5L2ZH 1OX1A 1Z8JB 2A0QB 4MTBA 3UREA 2BY8X 1GMHG 4JYTA 5IYTA 4TY7A 1TB6H 1RJXB 3QGNB 1BRUP 4YM9A 2QY0B 2ODPA 1O33A 1HAVB 4J2YB 1UTPA 2F91A 2VJ1A 2HVXA 4THNH 4AFSA 1HAYB 1BB0B 2BQWB 1O3DA 3M3TA 1SPJA 1H1BA 2QN5T 1GJ7B 4H4FA 1OWIA 2P3TB 4NIVA 1GDNA 1EKBB 3A80A 1B0FA 2ZWLH 3ZVCA 5ESBA 1CGJE 4INLA 2AFQB 1LQDB 3PWBA 1TBQH 1BUIA 1O3EA 1DY8A 3RMMH 1V2PT 4D7GA 2ZPQA 1EX3A 4FUHA 3D23A 1HAXB 1FZZA 1O3CA 4MNWA 2G5NA 1UCYE 3FP7E 1BT7A 3GCOA 1KDQA 1P2OA 1V2WT 1P0SH 1OXGA 4B73A 4R8TB 1O0DH 1ETRH 2VVCA 1XM1A 3BTFE 1A46H 3H5CB 4ABGA 4YTAA 1SB1H 1GG6B 3QGJA 1S0QA 4IS5A 1ELBA 1EOJA 2PR3A 4Y10E 3QZQA 1O2VA 3OU0A 1HB0B 4UFDH 3SU3A 4HZHA 4TWYA 3OX7U 1F0TA 5A2MH 2ANKH 3E0PB 1DY9A 4K1SA 3LC5A 2BDGA 2CN0H 5CHAB 3DD2H 1UTMA 2GV7A 1PYTD 3KCGH 1TA2A 4YOIA 1IHSH 2GV6A 1HYLA 1HJ9A 4NFEA 3B9FH 3P8GA 3M3VA 1HNEE 1LPGB 1RD3B 1GVKB 1GI6A 4DY7B 3V0XA 4K5ZA 1KXCA 1TRNA 1FY4A 3SGBE 3BN9A 4KTUA 1PFXC 4AG1A 4MPVA 4E05H 3FZDA 3U8OH 3QX5H 2OBOA 3C1KA 3UNSA 2A1DB 1DXPA 2GT8A 4ABEA 1V2RT 3T27A 1Z6JH 1GHXH 3RDZA 4NZQA 1EUFA 5E0JA 1AVXA 1JWTA 3A7TA 2F9NA 5EGMA 1FXYA 5C1UA 3GY2A 2G81E 3DFJA 2JH5D 1MMJN 2STAE 1NN6A 1TPPA 3LOXA 4ZH8A 4ZMAH 4X2YA 1O3FA 3LONA 3MHWU 5JBTA 1F5RA 4X8TH 3MU1A 3LGVA 3GCNA 3AASA 1TFXA 1RIWC 1ZTKA 2FYRA 3QZRA 1UCYK 1LHGH 1T8MA 3SJ9A 3LPRA 1XUFA 1GCDA 1HRTH 5I25A 1ZMJA 1GMCF 2ZHFH 4LZ4B 1AUTC 1EZXC 3HPTB 2WV5A 2FOBA 4AORA 1GI7B 2J94A 3V3MA 4UEHH 3ZZ5A 1E38B 4GLYA 1O5AB 3FZZA 3OTJE 1O2IA 1SR5C 2UUJB 5DPAA 2ESTE 1EZUC 2FI5E 1YCPM 3BIVH 1ELEE 1S83A 1GHVH 4HI3A 2W3IA 3MYWA 1P03A 1BRAA 2Q6DA 1YYY1 5JDUB 1UK4A 5AHGH 1TABE 1ID5H 4BTIB 1QBNA 4R0IA 2R3YA 1TE0A 2EA3A 2GCTC 2XTTB 1C1SA 4KELA 3SQHE 4JYUH 4OS1A 1C5ZB 1WU1A 1SGFA 2XC4A 1MAYA 3ZZAA 1O2MA 1J16A 4ISNA 1UK2A 2RDLA 1ZRBA 1AWHB 1P2KA 1HXFH 1W7XH 1VCQA 2VGCB 5E2OA 2ZQ1A 1DPOA 2VNTA 1O36A 3F6UH 3M7QA 1F2SE 3A8DA 2O8UA 1NT1A 3SUFA 4NZLA 1XX9A 3GDSA 2EI6A 1GHWH 1O2UA 3TGJE 1P02A 5LPEA 1TONA 1IQHA 1UTNA 2VU8E 3EGKH 4B2AA 3GOVB 1KLIH 1WSSH 2GTBA 1QNJA 3TNSA 8ESTE 1A4WH 1E34B 3D49H 5EQSA 1P2MA 2G4TA 2AIPA 3FP6E 4IN1A 3TH2H 3ZZ8A 1V6DA 3AVZA 1RRKA 2A5KA 3MO9A 4WXIA 3EAJA 4AGKA 1TNJA 4FXGH 1Z71A 5C3NA 1TA6A 1N8OB 1K28D 2BZAA 1MZDA 4Q7XA 2PGBB 1TX8A 3A87A 2CV3A 1CE5A 3D65E 1O2QA 3MH4A 3M3SA 1CBWC 1ZHPA 3RXHA 2AGIX 1TX7A 3RXAA 1ELTA 3HKIB 4WJG2 4K69A 4X1QU 1GDUA 3A7XA 4IGDA 3UY9A 3KL6A 1NROH 5EXLA 3VGCC 3SJIA 1ACBE 1V2QT 3MFJA 3NXPA 1TGCA 2ZDVH 1K1NA 4BTTB 5EXMA 1GCTC 4IW4E 4JZ1A 3A7YA 5JB8S 4I8JA 1G2LA 3U98H 4AFZA 3TJUA 3SHAH 2AH4X 1QTFA 2YOLA 4JMYA 1NRPH 5LH8A 2TIOA 1QJ7B 1ABIH 2SGPE 3UTUH 3HGPA 1C5OH 1FY8E 2QXHA 1KSNA 2ASUB 2Q6FA 5HGGA 1D6RA 5TCAA 3RP2A 3VFEA 4CH2B 1FNIA 2FP7B 1K1IA 1GJ4H 6ESTA 4CRFA 3MNBA 2QCYA 5A0AE 3RMOH 1JRSA 1YPLH 1DT2A 1TMBH 4CBNA 1FPCH 3BIUH 1SMFE 1BBRK 1P2JA 3Q76A 1O2YA 1Q3XA 2ZHDA 3A88A 4DGJA 2ZG0H 1ZOMA 5A0CA 1VITG 4AZ2B 2QYIA 3A8BA 4FUFA 7KMEH 2G00A 1RGQA 1LMWB 1BQYA 1QB6A 1G30B 1EJAA 1RTLA 5F8ZA 4VGCC 2G52A 2A7CA 2BDBA 3M61U 5HYOA 4XE4A 5A8XA 4Y7AA 5G4BA 1J14A 4Z6AH 4AGJA 4DIHH 3TK9A 4E7NA 4U2WA 1BTUA 4ABFA 4X1NU 1NRRH 3UOUA 3UOPA 3I78A 4ABAA 4E7RG 3H7OA 5H4IB 1OWDA 2BLQA 2ZECA 5SGAE 1AKSA 3RXRA 3RMNH 1YP9A 3M35A 3BTWE 1GDQA 1ZGIA 1Z1IA 2ZPRA 1GBBA 1T8LA 3MWIU 1UJ1A 2PKAA 1JIRA 1FAKH 5DP7A 3TK6A 1UTQA 1PJPA 1K1MA 3LKWA 4DG4A 4F4OC 3TNTA 1TNHA 3TITA 8LPRA 1JOUB 2XWAA 2SGFE 1NFXA 4NA9H 5A8YA 1YPMH 1WQVH 3GY7A 2EI7A 1BTPA 1B7XB 2AIQA 4FU8A 1AUJA 1O2WA 2NWNA 1GGDC 1PPZA 3F1SB 1MTWA 3I77A 1GI8B 4CHAC 3R3GB 1MTVA 2Z9IA 5DP4A 1O2SA 1A5HA 1HFDA 1SL3A 2J2UA 4J1YA 1O30A 1O2HA 5TCCA 4K2YA 3PTBA 2FLBH 5JB9S 2BY6X 3SU6A 1YPKH 1G9IE 1TWXB 1PPEE 3RLWH 3RUOA 3GY6A 3SUEA 3F9HA 4NIYA 4YLUA 1SGDE 2R0KA 1TBZH 3TJVA 3GCHB 1GJ6A 1KTTB 1C5WB 1HJAC 1GHAG 2J92A 1TNGA 2WPLS 3ZZBA 4DOQA 5FCKA 1G32B 1SGCA 4F49A 2B5TB 1EP6A 2W5EA 1HIAA 1T4VH 4I32A 4UONA 3SJOA 1DOJA 3VXEH 5I46H 3Q3XA 1C2GA 1D3PB 2AMPA 2HNTE 3BTEE 1NO9H 4GPGA 1G2MA 2BYAX 5FHTA 3VB6A 1SI5H 1YKTA 6LPRA 1C2JA 5EOKA 3K6YA 3BG8A 2A5AA 2SGQE 4DW2U 2HNTC 1YPJH 4X6PA 3ELAH 1ZJKA 1MTNB 1QURH 2BDHA 4Y71A 2FESH 3SV9A 1GJCB 1WOFA 2OC8A 1GJAB 1LKBA 1AFEH 3LDXH 4WH6A 5T3HA 3QDZB 1OP8A 4WWYA 1GBJA 3MNXA 2O8TA 3PMBB 1DSTA 1KXFA 1UHBA 1NU7B 2HGTH 3ATLA 1QCPA 3L3TA 1QL7A 5GJ4B 3P8OA 1P10A 3S9AA 3A7ZA 3SBKA 3TJOA 1IQGA 2IPHA 2B0FA 1NY22 2XBYA 3JZ2B 3CS0A 1SOTA 1FIWA 3RU4T 2H2ZA 3UNRA 1SGTA 4AYVB 3KF2A 3Q3YA 2ZHEH 1GMDG 1Q31A 3B23B 4A1XA 4AB8A 2RA0A 3PLKA 2AERH 1DS2E 5E2PA 2PHBA 3MNCA 2KAIA 1F0UA 2FLRH 1MZAA 3TU7H 4ZKOU 3SN8A 2ANWA 2XCFA 2BOHB 2YNBA 1MQ5A 1TLDA 5FPSA 3SUGA 3GDUA 2BDAA 4A1TA 5JPMH 3E3TA 4B2BA 3F9EA 1GBKA 1XUGA 2V3OH 3MU0A 1MCTA 3T2NA 3URDA 5E0HA 3S7KB 2F3CE 2WPHS 1QB9A 3TGKE 1B5GH 7GCHF 1AHTH 1V2NT 1LHCH 3ATWA 2ALPA 1BMMH 2FI3E 3LJOA 3BTHE 1D3DB 1GBAA 3MO6A 3BF6H 4AX9H 2QAAA 3A7VA 4D8NA 2Z3CA 2XW9A 1YGCH 2K1QA 3ZYDA 1HJ8A 4IMZA 3EA9A 1TQ7B 2GP9B 3ATIA 2OCVB 1D3QB 2UWLA 1PQ7A 2C8ZB 4AG2A 4O03A 3B8JA 3K2UA 4Y79A 5ETXA 3NZIA 3RXSA 4BNRA 2ZGCA 1ZJDA 2A4OA 1AQ7A 1OYQA 1EPTC 1BHXB 2F83A 1HAVA 2QGRA 4ABJA 2ZDLA 1UVPA 1YPEH 4K1EA 2OP9A 1SGFG 3MH7A 1ELFA 1O2NA 1DUAA 3GICB 2ZFRH 7LPRA 3OYPA 1DDJA 2NU1E 2ZDNA 2ZNKH 4JZDH 3S69A 2WPKS 2IOTA 5CE1A 1FMGA 1C5SA 1FJSA 2WPIS 1NESE 1HLTH 1OWEA 3GCTG 1FQ3A 1V2MT 2FX6A 3K9XB 3PLBA 1ZSKA 1BRCE 3U8TH 2O8MA 1MAXA 1GI1A 4LOYH 3ZVEA 2ZU4A 3DFLA 4B71A 1ETTH 3GISB 5C1XA 4Q2KA 2ZFPH 4KTSA 1C2KA 4U32A 1QQ4A 3SGQE 2O8WA 1IQEA 2AGEX 1V2LT 1NRSH 1UMAH 1SLVB 2H1UA 3ATKA 4FUEA 2DE9A 5DP6A 2WPJS 1DANH 4ABBA 1TRMA 1C1OA 4MNXA 2SNVA 3L6PA 4MG3A 1GHBG 1O5CB 2TRMA 1BZXE 1K1LA 3QTOH 1QRWA 1CVWH 4NIWA 1BJUA 1P01A 1N1LA 1MTSA 4O9VA 2FOFA 2ZGJA 1LVMA 3A89A 1Y3WA 3PM3A 2VH6A 3F9GA 2Z6BD 2FOCA 5HXFA 5EODA 4FUDA 1DM4B 2CF9H 1DICA 3RM0H 1Y3UA 3U8RH 2UWOA 3QO6A 1OWKA 2A2XH 1SHYA 4FUCA 3KQEA 1SHHB 3LGWA 1DITH 3OY5U 2OD3B 4Z0KA 4LXBH 1CHOF 1E36B 1EAUA 4ABDA 4WMDA 1NFYA 3MU5A 3ESTA 1NRNH 5DGJA 3ZYEA 1G3EA 1YBWA 3ZZ7A 5F8XA 6CHAC 2JETC 5ESTE 2BHGA 1BBRH 5LPFA 2ODQA 4Q7ZA 4INKA 1P09A 3NCLA 3PROA 4BXSA 1C4Y2 3HATH 4O3UA 4NA7A 2CHAB 5FX5A 4NIXA 3ZVFA 3SNCA 2C4FH 1ZGVA 1KIGH 5DG6A 2WYJA 4ZAEA 1J15A 3A84A 1C5LH 1BDAA 1C5YB 3ZVDA 4INHA 2HRVA 1SC8U 2VB0A 4BAMB 2GCTB 2BD9A 1PPHE 3V7TA 2BY7X 5C1YA 1TNIA 2PKSC 4MVNA 3RXFA 1VGCC 1V2KT 2VWNA 4ASHA 5CHAC 4Y0ZE 1DXWA 1W11U 1Z8GA 4RKJB 1O2XA 4NCYA 1AVGH 2BDIA 3TJNA 4WH8A 3ODDA 1ZHRA 1AMHA 4ISHH 1DWBH 3EQ0H 1BMNH 3NWUA 4ZHLU 1FV9A 2JH0D 1L1GA 1KXAA 1MTUA 6GCHF 2FS9A 4RSPA 2BMGB 1BITA 1LHEH 1O2KA 5GCHG 3RXGA 1V2TT 1QFKH 3H7TA 1XUHA 2ZGBH 4AOQA 3RXLA 4ZROA 2ZCKP 2VIVA 1NFUA 1SLXB 3NUMA 2D8WA 3L33A 5T6DA 3ZVGA 3AW1A 5EW2H 3LGIA 1S84A 3UR9A 1OWHA 1GI3A 3E91A 4X2XA 1BBRE 1CBWB 1D4PB 1C1VH 2Y5FA 3CS7A 5TJXA 1TIOA 1WUNH 1ABJH 2AMQA 2A4RA 2JKHA 1XVMA 2ODYB 3A83A 1K9OE 3A8CA 1F7ZA 4JZIA 4JK5A 1W3CA 2FWWA 2FOGA 3VGCB 3TIUA 1ZSLA 4GSOA 1HAGE 4ZUHA 4H6SB 4E06H 1GMCG 1ARCA 1ESTA 2XNIA 1AB9C 5FX6A 1ELAA 1GCTB 1K1PA 2XC0A 2BD2A 1TNKA 3M5MA 3ZZCA 2P95A 1AFQC 1C5UA 3UWJH 4ZKRU 5IDKA 3HKJB 2B8OH 1VZQH 5L6NH 2HLCA 1XXFA