4X1NU

The crystal structure of mupain-1-16 in complex with murinised human upa at ph7.4
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A cyclic peptidic serine protease inhibitor: increasing affinity by increasing peptide flexibility.
pubmed doi rcsb
molecule keywords mupain-1-16
molecule tags Hydrolase inhibitor/hydrolase
source organism Homo sapiens
total genus 58
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1nU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1nU01
5C2ZA 1AKSA 2EI8A 2C8XB 2ZIQH 2GKVE 1RIWB 3LJOA 3QZRA 1ZPZA 1LPKB 4SGBE 3GCNA 2FXRA 1T32A 1P2KA 2VIWA 3QGNB 1TPPA 4BXWA 3A8DA 1A61H 3A82A 1N6YA 1TNHA 1TNLA 1PPGE 2HVXA 1GHAG 5FHTA 4K1SA 1PFXC 3PMJA 5EW2H 2QYIA 2FOFA 1OXGA 3UQVA 1ANBA 1A4WH 3H5CB 3HK6B 2QN5T 3SJKA 3A8BA 2BXTH 8LPRA 3GCHB 1HAYB 1EP5A 2ZGXH 4OS6A 1RD3B 1RXPA 1MKWK 2A2XH 2ODQA 1V2VT 1B5GH 1SGTA 3EYDA 4BAMB 1UTPA 5DJ7A 1S85A 2ZTYA 1CA0C 1VITH 3SV6A 1EZQA 1D9IA 1ANCA 2XBWA 2P95A 4MDSA 5LPEA 2SGFE 3SJ9A 2VVUA 1BRBE 1K22H 1GBBA 1HAPH 4NZLA 1B7XB 1L1JA 3UOUA 1SC8U 4Y10E 1N6XA 3SN8A 3SORA 2ZF0H 4HFPB 1BITA 2OQUA 3ZZ5A 4A6LA 4ZKNU 2P8OB 2BY7X 4Y8XA 2ZFTA 3GY6A 2W7SA 1FONA 3B9FH 2EEKA 1O2TA 2C4FH 2NU4E 3PM3A 2IPHA 1CGHA 4Q7XA 1AHTH 2XTTB 4FU8A 4ZHAA 2AGGX 1BT7A 4FUJA 7KMEH 1EAXA 1UVUH 1GG6B 4Y0YE 4D9RA 5A0BA 4AORA 3P17H 1LO6A 2AIQA 1V2PT 4X1QU 3VGCB 4X2WA 2W5EA 1DX5M 3HPTB 1TX7A 1ZTKA 8GCHF 1EAUA 1P0SH 4UDWH 2HNTC 1HXEH 2FOGA 2VIDA 4MNXA 3M36A 4D76A 4UONA 4Q7YA 1G32B 1DSUA 2G51A 1ZOMA 2ZO3H 1C9TA 1GJ9B 1IQJA 1KXCA 2B9LA 3MH5A 1EPTC 2V35A 1VGCC 1L1NA 1FNIA 1MZDA 2HPPH 1YF4A 3RXVA 1SOZA 1O3JA 3R0FA 4WMFA 1Z6JH 2AH4X 3FP8E 1QB9A 1TGBA 4AGKA 4B76A 4DIHH 3KQDA 1F0RA 1GI8B 1SFIA 1YPEH 1HAGE 4JK5A 4VGCC 3RC5A 4FUBA 2OTVA 1ZGIA 1OP2A 1QY6A 1WQVH 2CGAA 3D49H 3LPRA 5I25A 1ZRBA 1C2MA 1V2TT 4B73A 1ZLRA 4NZQA 4YO9A 4GHTA 4ZXYH 3FANA 1QL8A 2KAIB 1OWDA 2BQ6B 1O2ZA 1DXWA 1P2NA 1Y3YA 2QXHA 1T8LA 1TRNA 2PGBB 3LH3A 1HXFH 4UE7H 1GMCG 1MMJN 1FPCH 1OP8A 1C1MA 2FPZA 1V6DA 5EQQA 4X6OA 2J4IA 3GY5A 5A09A 4HI3A 1A3BH 1YLDA 3RU4E 3VEQB 2O8UA 6GCHF 2D26C 1BDAA 3M3SA 4UEHH 1FLEE 1DWEH 1MKWH 1P05A 2A5KA 2XRCA 1P3EA 3LGIA 1GCTC 1C5LH 1SGIB 2BDHA 5F8TA 1ZSKA 1SGPE 1V2UT 5G4BA 1P2MA 1C5VA 3FAOA 4X6MA 1HBTH 1O2YA 2WUBA 5DP8A 2O8MA 1GPZA 1GJBB 1GJDB 1DICA 2YNBA 3NUMA 1DSTA 4AGJA 1O38A 4ABHA 2VWOA 1WUNH 1AUTC 1F5KU 3CS0A 4XBDA 1C5TA 1NO9H 4ZH8A 3V0XA 3BEIB 1JOUB 2GDEH 2I6SA 2A4RA 1SGYE 4H4FA 4ABJA 1C2HA 1C5RA 2DE8A 3SNBA 2F9NA 2G5NA 1EP6A 1FMGA 3H7OA 1ID5H 4THNH 3BTDE 3JZ1B 2O8LA 3SUDA 1BUIA 3Q3KA 1HIAB 1QR3E 2F83A 2Z9KA 3VPKA 2F91A 4AZ2B 5E0GA 1WSSH 3LJJA 1Y8TA 5FPYA 2PW8H 2BYAX 6LPRA 1BBRE 1V2QT 1OWIA 1YGCH 1MQ6A 3KL6A 1AI8H 1MCVA 2BOHB 4DIIH 4NA8A 3SV2H 5CMXH 1TGNA 4MNVA 5EQSA 3RXOA 1NTPA 1C2EA 1DLEA 3ZZ9A 1DY9A 5FBIA 1G37A 2OQ5A 1QA0A 1SGCA 3UIRA 3PO1C 3PV4A 4AFZA 5DKMA 1TFXA 2FEQH 2A31A 3U8OH 1SBWA 2ZPQA 5T6GA 4FUIA 3A83A 3EA7A 1MTVA 1GBKA 1TOMH 1F2SE 1TYNA 1H1BA 2Z3DA 4CRAA 1TONA 2QIQA 4ZHMU 1O2QA 5C5OA 2ZC9H 3ATMA 1P02A 1M9UA 2AERH 4YT6H 4E05H 3KGPA 5EXNA 4CRDA 1G2MA 4NIWA 2ZDAH 4WY3A 2BLQA 1AWFH 2BOKA 1A5IA 3AVZA 1SHHB 3OY6U 3TVJB 2QC2A 3FZZA 1LHEH 4SGAE 2BLVA 3FFGA 2FS8A 1LTOA 4XDEA 1F5LA 3A7WA 1YM0A 1HDTH 1O3DA 1O3GA 2A7CA 4AFQA 2F3CE 1PQ5A 1S82A 1TABE 3KQBA 1FJSA 2PSYA 3V13A 1GI1A 4XBCA 4ISOA 1KLTA 1SQTA 1MH0A 3AASA 4D7GA 1HJAC 2A7JA 1D6WA 4FVBA 4I31A 4OS4A 2STAE 2J38A 3BF6H 5EPNA 1J14A 1SGEE 1T4VH 2A4OA 1EJNA 1HNEE 1T4UH 1XMNB 1O39A 2YOLA 3I29A 9LPRA 5E0JA 1C2DA 3STIA 1UTQA 1K21H 2QV1A 1SLWB 2BVSH 1F0TA 4X2VA 1V2LT 3MNCA 1QRWA 4DCDA 2BDYA 3RXSA 2XBYA 1PPBH 2FIRH 1J16A 2PLXA 1S5SA 5IYTA 1K1NA 2V3OH 3ODDA 1XVOA 5J4QA 4BTUB 1EUFA 1GHZA 2B7DH 1NFWA 2IN2A 1Q3XA 5DK1A 1D3QB 3MWIU 1GMDF 3SUFA 4K5ZA 3QO6A 3MU5A 4JYTA 1GG6C 1BTHH 1C5SA 1K1IA 4WJG2 1C1VH 2XCFA 3RMMH 3HGPA 3RMLH 2Z3EA 1TALA 3A80A 3VGCC 1C2KA 1MQ5A 1TBQH 3QZQA 1IQEA 2QXGA 2Y7XA 1GHWH 1W8BH 3UNSA 4JZ1A 1NFUA 4NFEA 3SI4H 3TK5A 2JH0D 1CBWB 2FS9A 2A7HA 1RTFB 5EG4A 2ZNKH 1LVYA 4NIXA 4Z6AH 3A7ZA 5F6MA 1BMNH 1GHYH 2BD2A 3LH1A 1YPHE 1YC0A 1O36A 1GHVH 2TBSA 4KELA 2JETB 5PTPA 4DVAU 3BTME 1SQAA 3IITA 3WY8A 2OC7A 2P94A 1OWHA 1K1MA 4ZMAH 3EDXB 5ESTE 3SNCA 4ABBA 1PJPA 1ZMNA 5L2ZH 3RXFA 3SZNA 1W2KH 3C1KA 1P10A 1K2I1 5BRRE 4ABDA 2ZFPH 2GV6A 4J1YA 1EASA 2ULLA 5FCRA 3Q76A 1O3LA 4FVDA 1C5XB 4J2YB 3T62A 2AMQA 1F5RA 2WPIS 1PPCE 2Y81A 2FX6A 3SU5A 4RKJB 1W0ZU 2BLOA 2GP9B 5GDSH 5K7RA 1C1PA 1P2IA 3C27B 4I33A 1TQ7B 1O3AA 2VGCC 1SG8B 1AN1E 1ZZZA 3TJUA 3MO6A 4I8JA 1GI5A 4UFEH 3S7KB 4I8GA 3FZDA 2AGIX 3RXCA 4CBNA 4U32A 2HLCA 1X7AC 3MMGA 1LKBA 5TCAA 3UR9A 4ABFA 1S6FA 2FYRA 1SGNE 5HYOA 4ZKOU 1JRSA 1P57B 1EOJA 2ZHDA 3EE0B 1ZGVA 5HM9A 3RXQA 2KAIA 4X1SU 3A88A 1BZXE 4AX9H 3PWCA 1SLVB 3NKKA 2BXUH 5C20A 1MTNB 2OXSA 4GSOA 4A7IB 1QL7A 3S7HB 4NIVA 1O2VA 3SV9A 1NFYA 1PPFE 4XSKU 2UUKB 2H9HA 1UJ1A 4H42U 2GT8A 1C1RA 2DE9A 3TH4H 1GBHA 2P3TB 5JB8S 1CHOF 1EZSC 4ISLA 5FBEA 2R3UA 1KDQA 2BVRH 2NU2E 3LGUA 2BX3A 4MLFB 4MPVA 1A3EH 1P03A 3MU8A 3T27A 1S84A 1A2CH 4LXBH 1E35B 3ZVEA 3A87A 1BA8B 3O8DA 5AFYH 2J95A 2NU1E 6CHAC 4QT8C 2AFQB 3SUEA 1LKAA 1BCUH 1JRTA 3SI3H 3BTWE 2WINI 1O3BA 1AB9B 1P9UA 5DP9A 4AG2A 4ASHA 3K6ZA 3OYPA 4YM9A 4MG3A 1SHYA 7GCHF 1BTYA 1ZMJA 2TGDA 3RXIA 1HB0B 3ZVGA 2ZDKA 3LC5A 1S6HA 5A2MH 2FOBA 1O3CA 1UCYK 1U6QA 1WCZA 3DUXH 2ZDNA 1W10U 2Z9LA 4TWYA 5DP3A 1EX3A 3ATLA 2R2MB 2BB4A 1Z8GA 3ODFA 3R3GB 2BX4A 3SGBE 2ODPA 2XBXA 5CHAC 2JKHA 2Y80A 2XC4A 3U8TH 3PLBA 1BB0B 1TIOA 4I8HA 3ZZCA 2GZ7A 1AO5A 4ZROA 4UFFH 5GCHG 5JBAS 5L30H 4Q2KA 3AW1A 4DG4A 5FPSA 1TNKA 1FY3A 4NG9H 3BIVH 1C5WB 3P70B 4ZKSU 3H7TA 1QTFA 1EATA 1Y5BT 3BTKE 2FESH 3BEFB 1QFKH 5JDUB 1LDTT 1WOFA 4Y6DA 1A7SA 1ARBA 4UD9H 3ZVBA 1YPLH 1BTZA 1PQAA 2BDAA 1LPZB 1GMHF 1UTOA 4K8BA 3GOVB 1LPGB 3OY5U 5EPYA 3S9BA 4R0IA 1O5CB 1P11E 1A0HB 3FP6E 1SL3A 1YYY1 3OU0A 4HZHA 1EKBB 4ZXXH 2BZ6H 1ZYOA 3MNBA 2BTCE 4M7GA 2GCTB 2P16A 1NRNH 3UWJH 1W7GH 1CQQA 4ESTE 2ZHQH 1QRZA 1P09A 5F8XA 3UNQA 1QNJA 1W0YH 2SNWA 3ZZDA 3PMHB 2ZFQH 3UWIA 8KME2 3MH4A 3GY3A 2ZU5A 3SNAA 4BAHB 3A81A 1SGFG 3B8JA 3NK8A 1C1NA 1CT2E 3VFEA 1MKXH 3M3TA 1RJXB 2HPQH 2SNVA 3TPIZ 4KTSA 3E90B 1SI5H 1J8AA 4DJZB 1FY4A 1C5UA 1HAIH 3SGQE 2QXJA 2ZFFH 3PMAB 4BTIB 1KTSB 1HYLA 2C3SA 1NRQH 3BTQE 1DM4B 1OWJA 1AD8H 5C67A 2VIVA 1C2LA 2H9EH 1A0LA 3LGWA 2AMDA 1O3PB 3GY7A 1CBWC 1HV7A 1UCYH 2H5CA 3V3MA 1JIRA 3A7XA 4MNWA 1DUAA 1VR1H 1O0DH 4U2WA 4GPGA 1QB1A 4XBBA 3PTNA 4A5TS 4ZKRU 1OWEA 1KYNA 2V3HH 4AN7A 2TIOA 2TGPZ 1ACBE 1INCA 2BZAA 3U98H 2ZPRA 2GCHF 4X1PU 1J15A 4X8VH 4GUXA 3ATIA 2CMYA 3F9GA 1GBIA 1THPB 2HNTE 1Z8IB 4Z0KA 4DY7B 1E0FD 2A0QB 2OC8A 1ZMLA 1GBTA 2OP9A 3PYHA 2R9PA 2EI6A 1W13U 3SU0A 1KXFA 1L2EA 1SGRE 3E6PH 4FUGA 2BY9X 3U1IB 1D4PB 1DLKB 2HRVA 3RP2A 1KSNA 1EOLA 1SR5C 5C1UA 1FZZA 2BD9A 4WMEA 1P01A 3ZZ4A 2AIPA 1SPJA 3TJVA 2AEIH 1HUTH 3MNXA 4F49A 2PKAA 2ZCHP 2VWMA 4FU9A 1CGIE 4D9QA 3QN7A 4YESB 1NRSH 5DP7A 3UFAA 1KDQB 3P95A 1C1OA 2AYWA 3CP7A 1V2WT 4B75A 1AVGH 1SLXB 2VVVA 2J9NA 1GI0A 2TGAA 1EAWA 1GGDB 4WXVA 2G4UA 4NGAH 2Y5GA 2QY0B 1OWKA 1OP0A 2FTLE 1NESE 1L4DA 2V6NA 1TQ0B 1YPKH 1IQFA 2J2UA 2UWPA 3SV7A 1Z71A 1FI8A 1DE7H 2Y5HA 1BTXA 2G00A 3UNRA 4H6SB 4X0WU 1F0SA 4Q80A 2QCYA 4NSYA 3DFLA 4CR5A 1ELBA 1K1LA 3LIWA 4DURA 2IOTA 3GDVA 4JMYA 1E34B 1UTMA 3RXBA 3SGAE 5ABWA 4ABGA 3VXEH 4LZ4B 1OS8A 1GBFA 1ZPBA 2ZZUH 3DA9B 3GCTG 4D7FA 4B2BA 3ZYEA 4H6TA 4GCHG 1A0JA 1NY22 3M37A 1Y3VA 4B71A 2PGQB 2UWOA 2F9UA 1C1UH 4CHAC 1D6RA 1ZR0A 1PPHE 5EW1H 3SOSA 3Q3XA 2XWBI 2LPRA 1Z8JB 5DPAA 2PKSB 3QDZB 3A7TA 3KIDU 1ARCA 1A5HA 2ZTXA 3HK3B 5FPTA 3BTFE 5C3NA 3GYLB 3E0PB 2OBQA 3TLOA 3RXDA 2HOBA 3BN9A 1NM6A 3NWUA 3SQEE 3A84A 1ANEA 1CHGA 1N8OB 1ABJH 1W14U 5E2OA 1XX9A 2VIOA 2BDIA 1FY5A 1A46H 1GJ7B 3NZIA 1P12E 1ETSH 2VU8E 2P59A 9ESTA 2IJOB 1YCPH 3T28A 1O2KA 1WTHD 2GV7A 1SLUB 1QA7A 1HJ9A 3KEEA 4ZUHA 3CS7A 4U30A 1NRRH 3MHWU 1K1JA 4YOGA 3TITA 1MAXA 1OOKB 5EU8A 2W3KA 3F68H 3LGYA 8ESTE 1YPMH 1MTSA 2ASUB 2BY8X 1O5BB 5I46H 1GVZA 1RIWC 3TK6A 1MUEB 1Z1IA 1UTNA 2A4GA 4NA7A 1HAVA 2FTMA 4ISNA 3SJIA 1O5AB 1RFNA 5CE1A 1TLDA 1FAKH 3UQOA 3K65B 2ZTZA 2BM2A 3ZZ8A 4ABEA 1SVPA 2OD3B 2O8TA 2CJIA 2J94A 1IQNA 4I32A 1DS2E 4IC5A 1LQDB 3F1SB 2BLWA 4K3JA 2VNTA 1FDPA 4INLA 3GCHC 1EJAA 3EGKH 4BTTB 1QURH 1QBOA 2W7UA 1F7ZA 5AHGH 2FP7B 3I78A 4TWWA 1KLJH 1FQ3A 1FXYA 2BDBA 4WH6A 1GHAF 1GJAB 2GX4A 3S69A 3D23A 3BTTE 2WYGA 2ESTE 1LMWB 1Q2WA 2NWNA 1DY8A 3E1XB 1GWAA 4BAOB 3BG4B 5A0AE 1C4U2 5HXFA 1QBNA 1K1PA 1YPGH 4Y71A 1SSXA 4BOHA 2A5IA 1LHGH 5JBBS 3AAVA 2C8YB 3GISB 2P8OC 2H6MA 2PSXA 2ZP0H 2HGTH 4O3TA 4OGYA 5FXLA 1UVTH 4GHQA 5JB9S 1UHBB 4X8SH 2BD5A 4MPWA 1FPHH 4AYYB 2Z6BD 4FUEA 1L1GA 1DUEA 1ELTA 1FN8A 3M7QA 2NU0E 4MQAA 2EI7A 1HAHH 4JK6A 1NU9A 1C4V2 1EB1H 1BBRH 4A1XA 1KXEA 1GBLA 3NXPA 1NN6A 2BMGB 4A1TA 1NC6A 1ETTH 4OS1A 1FUJA 4JZFH 1Z1JA 4Y0ZE 1EZXC 2ZI2H 4DGJA 1GVLA 1PPEE 1IQIA 4K1EA 2GGVB 4AOQA 3UREA 1QJ6B 4UFGH 3SV8A 1BRCE 2RDLA 1KLIH 1T8OA 4K2YA 1GBCA 3SNDA 1P04A 2PKAB 1PPZA 5GWZA 2GMTB 3QLPH 1GI9B 1XUGA 3BG8A 3GDUA 1WBGB 1GVKB 4X1RU 1AFEH 1O35A 1ZHRA 1W11U 3RC4A 2Z9GA 2CV3A 3ATKA 3VXFH 1TPOA 4PROA 1YCPM 1O5GH 4ISHH 1G3BA 3PMBB 1V2JT 5LPRA 1AWHB 3PLPA 4YZUA 3ZV8A 5JBTA 3MYWA 4WXIA 4Y76A 3ZV9A 1BHXB 1EPTB 1VGCB 2GZ9A 3MO9A 1BTUA 2PFEA 3IG6B 1WQSA 3BTGE 1LVBA 1TMBH 4INHA 3ZZ7A 3TIUA 1MBMA 4YOIA 2FI4E 4TPYA 1C5OH 4IBLH 5A0CA 1O3FA 2CHAB 2TGTA 2VWLA 1OSSA 2JH6D 1O31A 3F9FA 3O8RA 3MU0A 2YNAA 2GT7A 1T8MA 3VB7A 6ESTA 1XUKA 4KGAA 2BD3A 1HRTH 6GCHG 1TBRH 4BAKB 3SHCH 3K2UA 1B0EA 1DWBH 4AFUA 3KN2A 1F92A 1O2UA 3T2NA 1EB2A 1BTWA 1H9IE 2XW9A 3HATH 3T25A 4Y7BA 3URCA 2ANWA 4YOJA 1GMCF 5A8YA 3NCLA 5A8ZA 1QIXB 5JBCS 1TBZH 5DP5A 2OC1A 1B0FA 3P8FA 3STJA 5ESBA 1P2JA 1DOJA 2SGEE 2ZDVH 3M35A 4MVNA 3RXJA 3VB6A 1GCTB 1NROH 4JZDH 2A5AA 2SGAA 1HJ8A 2XYAA 3LKWA 2XNIA 2CXVA 1MD7A 2R3YA 1TGSZ 1NRPH 1LHDH 3LDXH 2JH5D 1ELEE 2A45B 3TJNA 1CT4E 1IQKA 1FN6A 1UVOA 2ZFSA 1QQ4A 1Z6EA 3LOXA 3A86A 2ZFRH 2G55A 2OUAA 1O2RA 1O37A 4CH2B 1JIMA 1KXAA 1ELAA 5C5NA 1G3EA 1TPAE 1SOTA 4I8KA 2DUCA 4B2CA 1MKXK 1DFPA 3E16B 2BVXH 1VCQA 2PV9B 4IW4E 1UK3A 3ZVCA 1D3DB 1TRMA 2PKSC 4B1TA 1ZSJA 1K9OE 3RC6A 2RG3A 3CENA 1BMAA 5DP4A 3UY9A 1FIWA 1HAVB 2BY5X 5DGJA 3O8CA 4IN2A 2H2ZA 1O3MA 3IWMA 3SJ8A 1AU8A 1GI7B 3RDZA 1G9IE 1P8VC 3A7YA 3UR6A 1N1LA 1PYTC 2QA9E 1V2OT 1KY9A 3U69H 2ZDMA 1O2OA 4TY6A 1EJMA 5T6DA 2PTCE 1MTWA 3MH6A 2XC0A 2R2WU 1O3KA 3LT3A 1K28D 3LC3A 2FOEA 1GJ4H 1BTPA 1SQOA 5E8EH 2Q6GA 2EC9H 3D65E 2FI3E 2VH0A 4X8TH 1AVXA 2Z3CA 2FX4A 1ZJDA 1VJ9U 3AW0A 1MTUA 1T31A 4Y11E 3ZZBA 4K8YA 3PO1B 3KF2A 1O2NA 4X2YA 3MTYA 2XCNA 4LOYH 4TY7A 1O33A 3GY4A 2ZECA 3L6PA 1ABIH 1AVWA 1PQ7A 1C1WH 1WAYB 2ZGCA 1ETRH 5IDKA 4FXGH 1DT2A 1O34A 1V3XA 1T7CA 2B0FA 1VITG 3BV9B 1CA8B 3SNEA 2G81E 3BTHE 1SGFA 1GBAA 2ZKSA 1IAUA 1UTLM 1WTGH 1UVSH 4IN1A 1GJ8B 2I6QA 4FUHA 1OYQA 1GBMA 1HAZB 3UUZA 3VB5A 1QJ7B 3N7OA 2UWLA 2FOCA 3ZVAA 1C4Y2 2J92A 1GJ6A 3SJOA 1H8DH 3E3TA 4RKOB 1O2JA 1O32A 3M5OA 2VVCA 4NFFA 1Y3UA 2PUQH 1C5ZB 2O9QA 1AQ7A 3MU4A 5HGGA 2HWLB 1XXFA 1CT0E 3RXKA 1IHTH 4K60A 3RXEA 3P6ZB 1HJAB 4B2AA 1TB6H 3SO3A 1GBJA 1TA6A 3BG4C 2ZDLA 4MTBA 3EAJA 1G30B 1G2LA 1TNJA 3I77A 3W94A 4GLYA 2R0KA 3QX5H 3TH3H 1ESAA 5L6NH 1JWTA 2ANKH 1GHXH 4X2XA 3SW2B 1XVMA 1AUJA 4IMQA 3KNXA 2A2QH 1GMDG 1C5NH 1FY1A 4MNYA 2F9BH 1BMLA 1H8IH 1O2SA 2WV5A 1UK4A 4DOQA 2WPJS 3LGVA 1DANH 1W12U 2HALA 2THFB 4IGDA 3TU7H 2Y6TA 1P9SA 2XWAA 4WVPE 2RA3A 3DHKH 3M5LA 4AB8A 1XM1A 1O3HA 1DWDH 3A89A 1O2HA 1AE5A 3EQ0H 2BD7A 1TAWA 1TWXB 1NFXA 1GHBG 2FO9A 3T5FH 1TGTA 2VWNA 2UUJB 2ZQ1A 2Z94A 5DP6A 4INKA 3SUGA 5F03A 1AMHA 1OX1A 2FZZA 4YTAA 1S0RA 1AE8H 3PB1E 2QF3A 2SFAA 4NCYA 1T8NA 1Y59T 2GMTC 3Q77A 1AY6H 1O3NA 2JETC 5FCKA 2VH6A 4YLUA 1UHBA 3ELAH 1DDJA 2ZPSA 4JYVH 3MI4A 3MNSA 1EAIA 5TJXA 3ZVFA 1CGJE 2ZEBA 3U1JB 5E0HA 4CREA 1YCPK 1UTKA 3GYMA 1XKAC 1C1QA 2D8WA 1GDQA 3GICB 2ZQ2A 1GJCB 2Q1JA 4NA9H 4GVUA 4A92A 3SU4A 1C2IA 1ZRKA 1C2FA 4E7NA 2ODYB 2OLGA 3ZZ6A 2CHAC 1UTJA 2UUFB 3TNTA 4AFSA 2Y82A 5C1YA 3RXHA 2ANMH 1MAYA 4Y8YA 3RXGA 5SGAE 4IMZA 1EQ9A 2GTBA 2ZCLP 3KQEA 4BAQB 4D8NA 4AYVB 3FVFB 3FP7E 3RXMA 1DXPA 3SBKA 1XUJA 2QF0A 1G3DA 2WPLS 1S83A 1G36A 1QCPA 2V0BA 3MH7A 2CN0H 2WPHS 1C5YB 3L3TA 2ZU2A 1TX6A 1O2PA 1C9PA 3K9XB 5JYIA 2ZU1A 3BEUA 4Y7AA 1H9LB 2ANYA 3RLYH 4O3UA 2B5TB 1GL0E 1ZSLA 1HAXB 2ZCKP 1TE0A 3RXRA 1RS0A 1WYKA 2ALPA 1EPTA 2VGCB 1Y3WA 1E37B 1W7XH 3P8GA 4X6PA 2C90B 1A5GH 2BD4A 2Z9JA 3QGJA 1CO7E 5HM2A 3TGKE 2SGDE 1QRXA 1DPOA 5DO4H 1MTNC 1UVPA 1TNIA 5AF9H 1IQLA 1NS3A 1THRH 4KTCA 1MBQA 3ESTA 5E2PA 3NPSA 1RGQA 3QTOH 4BXSA 2PWXA 2OC0A 4CRCA 4FUFA 1CHOG 3RXTA 1SFQB 3QWCH 4O03A 5EXMA 1ELFA 1AFQB 4CR9A 1SMFE 3ZZ3A 1YPJH 3ZYDA 2H1UA 5GJ4B 2OCVB 3RLWH 1Z7KA 2FODA 3S9CA 3KCGH 1V2ST 4NWKA 2F9OA 1Q31A 1Y3XA 3D62A 3TGJE 2ZGHA 3PTBA 3RUOA 1UK2A 1ZTLA 1C2GA 1XUHA 4TYDA 4HGCA 1TMUH 1MU8B 1AB9C 3AAUA 2W26A 1KIGH 4BANB 4JZIA 1UO6A 3MO3A 1JMOH 1BBRK 1TOCB 2WYJA 5EOKA 7GCHG 3UOPA 1FAXA 2WV4A 3A8AA 4Q7ZA 4MPUA 2G5VA 2H9TH 2OBOA 3EA8A 1ZJKA 3RMOH 2FM2A 1GCDA 5H4IB 1HCGA 3B23B 3LU9B 3Q00A 7ESTE 6CHAB 1HPGA 4LK4A 3E91A 4R8TB 1LVOA 1AKSB 2C8WB 5HMAA 2G8TA 3BTEE 4B74A 4XE4A 3RMNH 2GVFA 2ZGBH 3MU1A 3LGTA 1ESTA 3DT0H 3RM2H 2FLBH 1W3CA 3UPEA 3F9EA 2LNCA 1C5PA 1GI3A 7LPRA 3T26A 2PUXB 4U01A 4X8UH 1P06A 1LQEA 1OPHB 1A1RA 1LCYA 2BD8A 1MU6B 3S9AA 2FI5E 3BIUH 5T3HA 4CBOA 1BJVA 1WU1A 4OS7A 3MOCA 2CF8H 2FMJA 3SQHE 5A8XA 2B8OH 1O5DH 1ESBA 5C1XA 3QTVH 4NIYA 5CHAB 5EGMA 3UTUH 4XFQA 1BRUP 2TPIZ 3ZVDA 4JZEH 1SGDE 4FU7A 1ELVA 3RM0H 1PYTD 1NZQH 1S0QA 5AVDA 1FIZA 1O2MA 1Z8RA 1H4WA 2AS9A 5GCHF 3TH2H 2WPMS 1GMHG 1NPMA 1QL9A 3GCOA 1V2RT 4OGXA 2Y5FA 1IQMA 2FOMB 2WPKS 1LVMA 1THSH 2XC5A 3BSQA 2FYQA 3Q3YA 1VITF 2RA0A 1ZHMA 2XXLA 1CVWH 3ATWA 2VJ1A 3L33A 2GCTC 2H5DA 1J9CH 4UFDH 1O30A 1RTLA 1O5FH 2ZHWH 3GDSA 2CF9H 1J17T 1XXDA 2O8WA 1IOEA 4K1TA 1Y5UT 1AZZA 5J4SA 1D3PB 3HGNA 1KXDA 2ZHFH 2Q6DA 3PWBA 2PTNA 4WWYA 1CA0B 2M5TA 1YKTA 2STBE 1MD8A 1UMAH 4RN6A 1BQYA 1CSOE 4XOJA 3URDA 1ZTJA 2EA3A 1O2IA 2Z7FE 2Y7ZA 3VB4A 1NT1A 2BDGA 1RRKA 1D3TB 3QK1A 4O97A 1VCWA 2OINA 3LONA 4KKDA 3RXPA 3SU2A 2FOAA 4MPXA 3RU4T 4ABIA 1O2WA 1IHSH 1KXBA 8GCHG 1P3CA 2VIPA 3MFJA 4KTUA 5DG6A 4GAWA 1TA2A 2VB0A 5F8ZA 1O3OA 1HFDA 3TGIE 5JPMH 2VINA 2ZG0H 4NWLA 2WUCA 3M7TA 3EA9A 5FAHA 1YPHC 1L0ZA 2SGPE 5ETXA 4CRBA 3F6UH 3PROA 1IQHA 1FY8E 5EXLA 2UUYA 1YLCA 1H9HE 2BQ7B 2ILNA 2ZWLH 3G01A 4IC6A 4ISIH 1OYTH 1GHBF 1O2XA 2P93A 2GCHG 4CH8B 4X6NA 2Z9IA 2VIQA 3E0NB 1Y5AT 5K0HA 3VB3A 1FV9A 5T6FA 2GDDA 3M5MA 5LH8A 1HAOH 1MCTA 1QJ1B 3SU1A 3W95A 2G4TA 5LGOA 2R0LA 1BRAA 4I8LA 4YLQH 1RTKA 4Y8ZA 2QAAA 3RXUA 4DT7B 1AZ8A 3ZZAA 1DWCH 3S0NA 3ITIA 1JBUH 1VCPA 2QXIA 2D2DA 1EXFA 4HTCH 5L2YH 2P3FH 2GD4B 4ZAEA 1P2OA 4VGCB 1E38B 1GBEA 1ZHPA 1C5QA 1CU1A 1JXPA 1VZQH 2ZGJA 3DFJA 3RXAA 1IQGA 1GDUA 2FWWA 1GI6A 1V2NT 1ELCA 2ZU4A 4WMDA 1C1SA 3DD2H 4X1NU 5GPIB 3RXLA 1TX8A 1ELDE 2A1DB 4O9VA 4ZHLU 2QGRA 1EZUC 1V2MT 1BIOA 1E36B 4WH8A 5EQRA 5LPFA 3P92A 3P8NA 1C1TA 1BJUA 1GGDC 1K1OA 3T29A 2Q6FA 5AFZH 4CRGA 2ZU3A 1YBWA 4TPIZ 3F9HA 4E7RG 4JCNA 3V12A 1QGFA 5FX6A 5BPEA 1DITH 4NSVA 3GY8A 3JZ2B 2A32A 2FLRH 4AB9A 4KP0A 1TPSA 4WF8A 1MZAA 1GDNA 1TRYA 2BQWB 2ZHEH 3O8BA 3RU4D 4DW2U 4ABAA 1ZPCA 1C5MD 3U8RH 2ALVA 1KTTB 1NU7B 5TCCA 1PQ8A 5FX5A 2PR3A 1QQUA 1TGCA 1DVAH 1G3CA 1SB1H 2K1QA 1C2JA 3TJOA 1GI4A 1BMMH 1AGJA 1AFQC 3M7UA 1S81A 2TRMA 3P8OA 3V7TA 3M3VA 2P3UB 2F9VA 2BHGA 4BNRA 1OKXA 1AIXH 1VJAU 2BDCA 1YP9A 4AG1A 5B6OA 3GY2A 5EODA 1WV7H 3KHVA 4IS5A 1GBDA 1CE5A 1GL1A 1O2GH 4JYUH 4A1VA 3E8LA 2RCEA 2PHBA 3OTJE 1XKBC 2C8ZB 3GCTF 4OS2A 3A7VA 3OSYA 3SU6A 4GCHF 2HNTF 1QHRB 4CHAB 1HLTH 1N8OC 1XUIA 3A85A 1TMTH 3U9AH 1LHCH 4FUDA 2A4QA 1GI2A 2W3IA 3M5NA 3A8CA 2C93B 3KQCA 2FOHA 1ORFA 1O2LA 2G52A 1BHXF 3ENSB 3M61U 3OX7U 5GIBA 2AGEX 2SGQE 1ANDA 1O3EA 3PLKA 1F0UA 4K69A 4LZ1H 2D1JA 5GXPA 1QB6A 2GZ8A 1UCYE 1GJ5H 2BY6X 1V2KT 1ELGA 1SGQE 1HGTH 4FUCA 2F9PA 4Y79A 4E06H 1XUFA 1O5EH 2AMPA 4CRFA 2J34A 4YT7H 1QBVH 1BOQA 1LHFH 1TNGA 2NU3E 3HKJB 3SU3A 2ZA5A 4F4OC 2XBVA 4I7YH 4OS5A 1L4ZA 3QUMP 1O3IA 1HIAA 2FDAA 3HKIB 3TNSA 3SHAH 4RSPA 1P2QA 3TK9A 3K6YA
chains in the Genus database with same CATH superfamily
5C2ZA 1AKSA 2EI8A 2C8XB 2ZIQH 2GKVE 1RIWB 3LJOA 3QZRA 1ZPZA 1LPKB 4SGBE 3GCNA 2FXRA 1T32A 1P2KA 2VIWA 3QGNB 1TPPA 4BXWA 3A8DA 1A61H 3A82A 1N6YA 1TNHA 1TNLA 1PPGE 2HVXA 1GHAG 5FHTA 5IK2D 4K1SA 1PFXC 3PMJA 5EW2H 2QYIA 2FOFA 1OXGA 3UQVA 1ANBA 2EQNA 1A4WH 3H5CB 3HK6B 2QN5T 3SJKA 3A8BA 2BXTH 8LPRA 1FX0B 3GCHB 1HAYB 1EP5A 2ZGXH 4OS6A 1RD3B 1RXPA 1MKWK 2A2XH 2ODQA 1V2VT 1B5GH 1SGTA 3EYDA 4BAMB 1UTPA 5DJ7A 1S85A 2ZTYA 1CA0C 1VITH 3SV6A 1EZQA 2L6OA 1D9IA 1ANCA 2XBWA 2P95A 4MDSA 5LPEA 2SGFE 3SJ9A 2VVUA 3PRDA 4M9FA 1BRBE 1K22H 1GBBA 1HAPH 4NZLA 1B7XB 1L1JA 3UOUA 5EIYA 1SC8U 4Y10E 1N6XA 3SN8A 4OM9A 3SORA 2ZF0H 4HFPB 1BITA 2OQUA 3ZZ5A 4A6LA 4ZKNU 2P8OB 2BY7X 4Y8XA 2ZFTA 3GY6A 2W7SA 1FONA 3B9FH 2EEKA 1O2TA 2C4FH 2J98A 2NU4E 3PM3A 2IPHA 1CGHA 4Q7XA 1AHTH 2XTTB 4FU8A 4ZHAA 2AGGX 1BT7A 4FUJA 7KMEH 1EAXA 1UVUH 1GG6B 4Y0YE 4D9RA 5A0BA 4AORA 3P17H 1LO6A 2AIQA 1V2PT 4X1QU 2VBCA 3VGCB 5KECA 4X2WA 2W5EA 1DX5M 2YMSD 3HPTB 5C0UA 1TX7A 1ZTKA 8GCHF 1EAUA 1P0SH 4UDWH 2HNTC 1HXEH 2FOGA 2VIDA 4MNXA 3M36A 4D76A 4UONA 4Q7YA 1G32B 1DSUA 2G51A 1ZOMA 2ZO3H 1C9TA 1GJ9B 1IQJA 1KXCA 2B9LA 3MH5A 1EPTC 2V35A 1VGCC 1L1NA 1FNIA 1MZDA 2HPPH 5HIYA 1YF4A 3RXVA 1SOZA 1O3JA 3R0FA 4WMFA 1Z6JH 2AH4X 3FP8E 1QB9A 1TGBA 4AGKA 4B76A 4DIHH 3KQDA 1F0RA 1GI8B 1SFIA 1YPEH 1HAGE 4JK5A 4VGCC 3RC5A 4FUBA 2OTVA 1ZGIA 1OP2A 1QY6A 1WQVH 2CGAA 3D49H 3LPRA 5I25A 1ZRBA 1C2MA 1V2TT 4B73A 1ZLRA 3CNRA 4NZQA 2KCAA 4YO9A 4GHTA 4ZXYH 3FANA 1QL8A 2KAIB 1OWDA 2BQ6B 1O2ZA 5HKKD 1DXWA 1P2NA 1Y3YA 2QXHA 1T8LA 1TRNA 2PGBB 3LH3A 1HXFH 4UE7H 1GMCG 1MMJN 1FPCH 1OP8A 3PV2A 1C1MA 2FPZA 1V6DA 5EQQA 4X6OA 2J4IA 3GY5A 5A09A 4HI3A 1A3BH 1YLDA 3RU4E 3VEQB 4ZCNA 2O8UA 6GCHF 2D26C 1BDAA 3M3SA 4UEHH 1FLEE 1DWEH 1MKWH 1P05A 2A5KA 2XRCA 1P3EA 3LGIA 1GCTC 1C5LH 1SGIB 2BDHA 5F8TA 1ZSKA 1SGPE 1V2UT 5G4BA 1P2MA 1C5VA 3FAOA 4X6MA 1HBTH 1O2YA 2WUBA 5DP8A 2O8MA 1GPZA 1GJBB 1GJDB 3FN8A 1DICA 2YNBA 3NUMA 1DSTA 4AGJA 1O38A 4ABHA 2VWOA 1WUNH 4AC9A 1AUTC 1F5KU 3CS0A 4XBDA 1C5TA 1NO9H 4ZH8A 3V0XA 3BEIB 1JOUB 2GDEH 2I6SA 2A4RA 1SGYE 4H4FA 4ABJA 1C2HA 1C5RA 3ZIAD 2DE8A 3SNBA 2F9NA 2G5NA 1EP6A 1FMGA 3H7OA 1ID5H 4THNH 3BTDE 3JZ1B 2O8LA 3SUDA 1BUIA 3Q3KA 1HIAB 1QR3E 2F83A 2Z9KA 3VPKA 2F91A 4AZ2B 5E0GA 1WSSH 3LJJA 1Y8TA 5FPYA 2PW8H 2BYAX 2QF5A 6LPRA 1BBRE 1V2QT 1OWIA 1YGCH 2KCOA 1MQ6A 3KL6A 1AI8H 4YXWD 1MCVA 2BOHB 4DIIH 4NA8A 3SV2H 5CMXH 1TGNA 4MNVA 5EQSA 3RXOA 1NTPA 1C2EA 1DLEA 3ZZ9A 1DY9A 5FBIA 3OFND 1G37A 2OQ5A 1QA0A 1SGCA 3UIRA 3PO1C 3PV4A 1YLNA 1OHHD 4AFZA 5DKMA 1TFXA 2FEQH 2A31A 3U8OH 1SBWA 2ZPQA 5T6GA 4FUIA 3A83A 3EA7A 1MTVA 1GBKA 3PV5A 1TOMH 1F2SE 1TYNA 1H1BA 2Z3DA 4CRAA 1TONA 2QIQA 4ZHMU 1O2QA 5C5OA 2ZC9H 3ATMA 1P02A 1M9UA 2KZ4A 2AERH 4YT6H 4E05H 3KGPA 5EXNA 4CRDA 1G2MA 4NIWA 2ZDAH 5CHBA 4WY3A 2BLQA 1AWFH 2BOKA 1A5IA 3AVZA 1SHHB 3OY6U 3TVJB 1NBMD 2QC2A 3FZZA 1LHEH 4SGAE 2BLVA 3FFGA 2FS8A 1LTOA 4XDEA 1F5LA 3A7WA 1YM0A 3F2GA 1HDTH 1O3DA 1O3GA 2A7CA 4AFQA 2F3CE 1PQ5A 1S82A 1TABE 3KQBA 1FJSA 2PSYA 3OAAD 1GI1A 4XBCA 3V13A 4ISOA 1KLTA 1SQTA 1MH0A 3AASA 4D7GA 1HJAC 2A7JA 1D6WA 2V3MA 4FVBA 4I31A 4OS4A 2STAE 2J38A 2K8IA 3BF6H 5EPNA 1J14A 1SGEE 1T4VH 2A4OA 1EJNA 1HNEE 1T4UH 1XMNB 1O39A 2YOLA 3I29A 2WV9A 3GS9A 9LPRA 5E0JA 2L74A 1C2DA 3STIA 1UTQA 2AHME 1K21H 2QV1A 1SLWB 2BVSH 1F0TA 4X2VA 1V2LT 3MNCA 1QRWA 4DCDA 2BDYA 3RXSA 2XBYA 1PPBH 2FIRH 4F48B 1J16A 2PLXA 1S5SA 2WZQA 5IYTA 1K1NA 2V3OH 3ODDA 1XVOA 5J4QA 4BTUB 1EUFA 1GHZA 2B7DH 1NFWA 2IN2A 1Q3XA 5DK1A 1D3QB 3MWIU 1GMDF 3SUFA 4K5ZA 3QO6A 3MU5A 4JYTA 1QZ8A 1GG6C 1BTHH 1C5SA 1K1IA 4WJG2 1C1VH 2XCFA 3AK5A 3RMMH 3HGPA 3RMLH 2Z3EA 1TALA 3A80A 3FKSD 3VGCC 1C2KA 1MQ5A 1TBQH 3QZQA 1IQEA 2QXGA 2Y7XA 1GHWH 1W8BH 3UNSA 4JZ1A 1NFUA 4NFEA 3SI4H 3TK5A 2JH0D 1CBWB 2FS9A 2A7HA 1RTFB 5EG4A 2ZNKH 1LVYA 4NIXA 4Z6AH 3A7ZA 5F6MA 1BMNH 1GHYH 2BD2A 3LH1A 1YPHE 1YC0A 1O36A 1GHVH 2TBSA 4KELA 2JETB 5PTPA 4DVAU 3BTME 1SQAA 3IITA 3WY8A 2OC7A 2P94A 1OWHA 1K1MA 4ZMAH 3EDXB 5ESTE 3SNCA 4ABBA 1PJPA 1ZMNA 5L2ZH 3RXFA 3SZNA 1W2KH 3C1KA 1P10A 1K2I1 5BRRE 4ABDA 2RDEA 2ZFPH 2GV6A 4J1YA 1EASA 2ULLA 5FCRA 5KEDA 3Q76A 1O3LA 4FVDA 1C5XB 4J2YB 3T62A 2AMQA 1F5RA 2WPIS 1PPCE 2Y81A 2FX6A 3SU5A 4RKJB 1W0ZU 2BLOA 2GP9B 5GDSH 5K7RA 1C1PA 1P2IA 3C27B 4I33A 1TQ7B 1O3AA 2VGCC 1SG8B 2W6ID 3OTPA 1AN1E 1ZZZA 3TJUA 1E1RD 3MO6A 4I8JA 1GI5A 4UFEH 5GNDA 3S7KB 4I8GA 3FZDA 2AGIX 3RXCA 4CBNA 4U32A 2HLCA 1X7AC 3MMGA 1LKBA 5TCAA 3UR9A 4ABFA 1S6FA 2FYRA 1SGNE 5HYOA 4ZKOU 1JRSA 1P57B 1EOJA 2ZHDA 3EE0B 3DSPA 1ZGVA 5HM9A 3RXQA 1K0HA 2KAIA 4X1SU 4FOUC 3A88A 1BZXE 4AX9H 1WXRA 3MQKC 2JIZD 3PWCA 1SLVB 3NKKA 2BXUH 5C20A 1MTNB 2J5UA 2OXSA 4GSOA 4A7IB 1QL7A 3S7HB 4NIVA 1O2VA 3SV9A 2LP6A 1NFYA 1PPFE 4XSKU 2UUKB 2H9HA 1UJ1A 4H42U 2GT8A 1C1RA 2DE9A 3TH4H 1GBHA 2P3TB 5JB8S 1CHOF 1EZSC 1MABB 4ISLA 5FBEA 2R3UA 1KDQA 2BVRH 2NU2E 3LGUA 2BX3A 4MLFB 4MPVA 1A3EH 1P03A 3MU8A 3T27A 1S84A 2F4LA 1A2CH 4LXBH 1E35B 3ZVEA 3A87A 1BA8B 3O8DA 5AFYH 2J95A 2NU1E 6CHAC 4QT8C 2AFQB 3SUEA 1LKAA 1BCUH 1JRTA 3SI3H 4ACAA 3BTWE 2WINI 1O3BA 1AB9B 1P9UA 5DP9A 4AG2A 4ASHA 3K6ZA 3OYPA 2KCYA 4YM9A 4Z1MD 4MG3A 1SHYA 7GCHF 2RFKC 1BTYA 1ZMJA 2TGDA 3RXIA 1HB0B 3ZVGA 2ZDKA 3LC5A 1S6HA 5A2MH 2FOBA 1O3CA 1UCYK 1U6QA 1WCZA 3DUXH 2ZDNA 1W10U 2Z9LA 3N7EA 4TWYA 5DP3A 1EX3A 3ATLA 2R2MB 2BB4A 1Z8GA 3ODFA 5EJLA 2WPDD 3R3GB 2BX4A 3SGBE 2ODPA 2XBXA 4Q63A 5CHAC 3W1EA 2JKHA 2Y80A 2XC4A 3U8TH 1WDIA 3PLBA 1BB0B 1TIOA 4I8HA 3ZZCA 2GZ7A 1AO5A 4ZROA 4UFFH 5GCHG 5JBAS 5L30H 4Q2KA 3AW1A 4DG4A 5FPSA 1TNKA 1FY3A 4NG9H 3BIVH 1C5WB 3P70B 4ZKSU 3H7TA 1QTFA 1EATA 1Y5BT 3BTKE 5B6LA 2FESH 3BEFB 1QFKH 5JDUB 1LDTT 1WOFA 4Y6DA 1A7SA 1ARBA 4UD9H 3ZVBA 1YPLH 3NRLA 1BTZA 1PQAA 2BDAA 1LPZB 1GMHF 1UTOA 4K8BA 3GOVB 1LPGB 3OY5U 5EPYA 3S9BA 4R0IA 3KYGA 1O5CB 1P11E 1A0HB 3FP6E 1SL3A 1YYY1 3OU0A 4HZHA 3PRBA 1EKBB 4ZXXH 2BZ6H 1ZYOA 3MNBA 2BTCE 4M7GA 2GCTB 2P16A 1NRNH 3UWJH 3OEHD 1W7GH 1CQQA 4ESTE 2ZHQH 1QRZA 1P09A 5F8XA 3UNQA 1QNJA 1W0YH 2SNWA 3ZZDA 3PMHB 2ZFQH 3UWIA 8KME2 3MH4A 3GY3A 2ZU5A 3SNAA 4BAHB 3A81A 1SGFG 3B8JA 2YMSB 3NK8A 1C1NA 1CT2E 3VFEA 1MKXH 3M3TA 1RJXB 2HPQH 2SNVA 3TPIZ 4KTSA 3E90B 1SI5H 1J8AA 4DJZB 1FY4A 1C5UA 1HAIH 3SGQE 2JDID 2XOKD 2QXJA 2ZFFH 3PMAB 4BTIB 3N7DA 1KTSB 1HYLA 2C3SA 1NRQH 3BTQE 1DM4B 3UB0A 1OWJA 1AD8H 5C67A 2VIVA 1C2LA 2H9EH 1A0LA 3H09A 2AMDA 3LGWA 1O3PB 3GY7A 1CBWC 1BMFD 1HV7A 1UCYH 2H5CA 3V3MA 3FOAA 1JIRA 3A7XA 4MNWA 1DUAA 1VR1H 1O0DH 4U2WA 4GPGA 1QB1A 4XBBA 3PTNA 4A5TS 4ZKRU 1OWEA 1KYNA 2V3HH 4AN7A 2TIOA 2TGPZ 1ACBE 1INCA 2BZAA 3U98H 2ZPRA 4XD7D 2GCHF 4X1PU 1J15A 4X8VH 4GUXA 3ATIA 2CMYA 3F9GA 1GBIA 1THPB 2HNTE 1Z8IB 4Z0KA 4DY7B 1E0FD 2A0QB 2OC8A 1ZMLA 1GBTA 2OP9A 3PYHA 4HG6A 2R9PA 2EI6A 1W13U 3SU0A 1KXFA 1L2EA 1SGRE 4RT0A 3E6PH 4FUGA 2BY9X 3U1IB 1D4PB 1DLKB 1EFRD 2HRVA 3RP2A 1KSNA 1EOLA 1SR5C 5C1UA 1FZZA 2BD9A 4WMEA 1P01A 2KM0A 2AIPA 3ZZ4A 1SPJA 3TJVA 2AEIH 1HUTH 3MNXA 4F49A 2PKAA 2ZCHP 2VWMA 4FU9A 1CGIE 4D9QA 3QN7A 4YESB 1NRSH 5DP7A 3UFAA 1KDQB 3P95A 1C1OA 2AYWA 3CP7A 1V2WT 4B75A 1AVGH 3SZEA 1SLXB 2VVVA 2J9NA 2KR7A 1GI0A 2TGAA 1EAWA 1GGDB 4WXVA 2G4UA 4NGAH 2Y5GA 2QY0B 1OWKA 1OP0A 2FTLE 1NESE 1L4DA 2V6NA 1TQ0B 1YPKH 1IQFA 2J2UA 2UWPA 3SV7A 1Z71A 1FI8A 1DE7H 2Y5HA 1BTXA 2G00A 3UNRA 4H6SB 4X0WU 1F0SA 4Q80A 2QCYA 4NSYA 3DFLA 4CR5A 1E1QD 1ELBA 1K1LA 3LIWA 4DURA 2IOTA 3GDVA 4JMYA 1E34B 1UTMA 3RXBA 3SGAE 5ABWA 4ABGA 3VXEH 4LZ4B 1OS8A 1GBFA 1ZPBA 2ZZUH 3DA9B 3GCTG 4D7FA 5HIZA 4B2BA 3ZYEA 4H6TA 4GCHG 1A0JA 1NY22 3UAIC 3M37A 1Y3VA 4B71A 2PGQB 2UWOA 2F9UA 1C1UH 4CHAC 1D6RA 1ZR0A 1PPHE 5EW1H 3SOSA 3Q3XA 2XWBI 2LPRA 1Z8JB 5DPAA 2PKSB 3QDZB 3A7TA 3KIDU 1ARCA 1A5HA 2ZTXA 3HK3B 5FPTA 3BTFE 5C3NA 3GYLB 3E0PB 2OBQA 3TLOA 1H8ED 3RXDA 2HOBA 3BN9A 1NM6A 3NWUA 3SQEE 3A84A 1ANEA 1CHGA 1N8OB 1ABJH 1W14U 5E2OA 1XX9A 2VIOA 1VKYA 2BDIA 5C17A 1FY5A 1A46H 1GJ7B 3NZIA 1P12E 1ETSH 2VU8E 2P59A 9ESTA 2IJOB 1YCPH 3T28A 1O2KA 1WTHD 2GV7A 1SLUB 1QA7A 1HJ9A 2CK3D 3KEEA 4ZUHA 3CS7A 4U30A 1NRRH 3MHWU 1K1JA 4YOGA 2QE7D 3TITA 1MAXA 1OOKB 5EU8A 2W3KA 3F68H 3LGYA 8ESTE 1YPMH 1MTSA 2ASUB 2BY8X 1O5BB 5I46H 1GVZA 1RIWC 3TK6A 1MUEB 1Z1IA 1UTNA 2A4GA 4NA7A 1HAVA 2FTMA 4ISNA 3SJIA 1O5AB 1RFNA 5CE1A 1TLDA 1FAKH 3UQOA 3K65B 1W0JD 2JJ2D 2ZTZA 2BM2A 3ZZ8A 4ABEA 1SVPA 2OD3B 2O8TA 4XRNA 2CJIA 2J94A 1IQNA 4I32A 1DS2E 4IC5A 1LQDB 3F1SB 2BLWA 4K3JA 2VNTA 1FDPA 4INLA 1UW7A 3GCHC 2WSSD 1EJAA 3EGKH 4BTTB 1QURH 1QBOA 2W7UA 1F7ZA 5AHGH 2FP7B 3I78A 2W6JD 4TWWA 1KLJH 1FQ3A 1FXYA 2BDBA 4WH6A 1GHAF 1GJAB 4DT4A 2GX4A 3S69A 3D23A 3BTTE 2WYGA 2QF4A 2ESTE 1LMWB 1Q2WA 2NWNA 1DY8A 3E1XB 1GWAA 4BAOB 3BG4B 5A0AE 1C4U2 5HXFA 1QBNA 1K1PA 1YPGH 4Y71A 1SSXA 4BOHA 2A5IA 1LHGH 5JBBS 3AAVA 2C8YB 3GISB 2P8OC 2H6MA 5CDFE 2PSXA 2ZP0H 2HGTH 4O3TA 4OGYA 5FXLA 1UVTH 4GHQA 5JB9S 1UHBB 4X8SH 2BD5A 4MPWA 1FPHH 4AYYB 2Z6BD 4FUEA 1L1GA 1DUEA 1ELTA 1FN8A 3M7QA 2NU0E 4MQAA 2EI7A 1HAHH 4JK6A 1NU9A 1C4V2 1EB1H 1BBRH 4A1XA 1KXEA 1GBLA 3NXPA 1NN6A 2BMGB 4A1TA 1NC6A 1ETTH 4OS1A 1FUJA 4JZFH 1Z1JA 4Y0ZE 1EZXC 2ZI2H 4DGJA 1GVLA 1PPEE 1IQIA 4K1EA 2GGVB 4AOQA 3UREA 1QJ6B 4UFGH 3SV8A 1BRCE 2RDLA 1KLIH 1T8OA 1H8HD 1GBCA 4K2YA 1P04A 2PKAB 1PPZA 3SNDA 5GWZA 2GMTB 3QLPH 1GI9B 1XUGA 3BG8A 3GDUA 1WBGB 1GVKB 4X1RU 1AFEH 1O35A 1ZHRA 1W11U 3RC4A 2Z9GA 2CV3A 3ATKA 3VXFH 1TPOA 4PROA 1YCPM 1O5GH 4ISHH 1G3BA 3DCLA 1V2JT 3PMBB 5LPRA 1AWHB 3PLPA 4YZUA 3ZV8A 5JBTA 3MYWA 4WXIA 1KMHB 4Y76A 3ZV9A 2KX4A 1BHXB 1EPTB 1VGCB 2GZ9A 3MO9A 1BTUA 2PFEA 3IG6B 1WQSA 3BTGE 1LVBA 1TMBH 4INHA 3ZZ7A 3F0PA 3TIUA 1MBMA 4YOIA 2FI4E 4TPYA 1C5OH 4IBLH 4B6EA 5A0CA 1O3FA 2CHAB 2TGTA 2VWLA 1OSSA 2JH6D 1O31A 3F9FA 3O8RA 3MU0A 2YNAA 2GT7A 1T8MA 3VB7A 6ESTA 1XUKA 4KGAA 2BD3A 1HRTH 6GCHG 1TBRH 4BAKB 3SHCH 3K2UA 1B0EA 1DWBH 4AFUA 3KN2A 1F92A 1O2UA 3T2NA 1EB2A 1BTWA 1H9IE 2XW9A 3HATH 3T25A 4Y7BA 3URCA 2ANWA 4YOJA 1GMCF 5A8YA 3NCLA 5A8ZA 1QIXB 3F3BA 5JBCS 1TBZH 5DP5A 2OC1A 1B0FA 3P8FA 3STJA 5ESBA 1P2JA 1DOJA 2SGEE 1COWD 2ZDVH 3M35A 4MVNA 3RXJA 3VB6A 1GCTB 1NROH 4JZDH 2A5AA 2SGAA 1HJ8A 2XYAA 3LKWA 2XNIA 2CXVA 1MD7A 2R3YA 1TGSZ 1NRPH 1LHDH 3LDXH 2JH5D 1ELEE 2A45B 3TJNA 1CT4E 1IQKA 3N99A 1FN6A 1UVOA 2ZFSA 1QQ4A 1Z6EA 3LOXA 3A86A 2ZFRH 2G55A 2OUAA 1O2RA 1O37A 4CH2B 1JIMA 1KXAA 1ELAA 5C5NA 1G3EA 2WHXA 5C94A 1TPAE 1SOTA 4I8KA 2DUCA 4B2CA 1MKXK 1DFPA 3E16B 2BVXH 1VCQA 2PV9B 4IW4E 1UK3A 3ZVCA 1D3DB 1TRMA 2PKSC 4B1TA 3U28C 1ZSJA 1K9OE 3RC6A 2RG3A 3CENA 1BMAA 1E79D 5DP4A 3UY9A 1FIWA 1HAVB 2BY5X 5DGJA 3O8CA 4IN2A 2H2ZA 1O3MA 3IWMA 3SJ8A 1AU8A 1GI7B 3RDZA 1G9IE 1P8VC 3A7YA 3UR6A 1N1LA 1PYTC 2QA9E 1V2OT 1KY9A 3U69H 2ZDMA 1O2OA 4TY6A 1EJMA 5T6DA 2PTCE 1MTWA 3MH6A 2JJ1D 2XC0A 2R2WU 1O3KA 3LT3A 1K28D 3LC3A 2FOEA 1GJ4H 1BTPA 1SQOA 5E8EH 2Q6GA 2EC9H 3D65E 2FI3E 2VH0A 4X8TH 1AVXA 2Z3CA 2FX4A 1ZJDA 1VJ9U 3AW0A 1NBME 1MTUA 1T31A 4Y11E 2OK5A 2GJGA 3ZZBA 4K8YA 3PO1B 3KF2A 1O2NA 4X2YA 3MTYA 2XCNA 4LOYH 4TY7A 1O33A 3GY4A 2ZECA 3L6PA 1ABIH 1AVWA 1PQ7A 1C1WH 1WAYB 2ZGCA 1ETRH 5IDKA 4FXGH 3VG8A 1DT2A 1O34A 1V3XA 1T7CA 2B0FA 4F55A 1VITG 2LELA 1CA8B 3BV9B 3SNEA 2G81E 3BTHE 1SGFA 1GBAA 2ZKSA 1IAUA 1UTLM 1WTGH 1UVSH 4IN1A 1GJ8B 2I6QA 4FUHA 1OYQA 1GBMA 1HAZB 3UUZA 3VB5A 1QJ7B 3N7OA 5FL7D 2UWLA 2FOCA 3ZVAA 1C4Y2 2J92A 4RT1A 1GJ6A 3SJOA 1H8DH 3E3TA 4RKOB 1O2JA 2V7QD 1O32A 3F0OA 2IPQX 3M5OA 2VVCA 4NFFA 1Y3UA 2PUQH 1C5ZB 2O9QA 1AQ7A 3MU4A 5HGGA 2HWLB 1XXFA 1CT0E 3RXKA 1IHTH 4K60A 3RXEA 3P6ZB 1HJAB 4B2AA 1TB6H 3SO3A 1GBJA 1TA6A 3BG4C 2ZDLA 4MTBA 3EAJA 1G30B 1G2LA 1TNJA 3I77A 3W94A 4GLYA 2R0KA 3QX5H 1YWUA 3TH3H 1ESAA 5L6NH 5DN6D 1JWTA 2ANKH 1GHXH 4X2XA 3SW2B 1XVMA 1AUJA 4ACBA 4IMQA 3KNXA 2A2QH 4I86A 1GMDG 1C5NH 1FY1A 4MNYA 2F9BH 1BMLA 2HVYB 1H8IH 1O2SA 2WV5A 1UK4A 4DOQA 2WPJS 3LGVA 1DANH 1W12U 2HALA 2THFB 4IGDA 3TU7H 2Y6TA 1P9SA 2XWAA 4WVPE 4B6FA 2RA3A 3DHKH 3M5LA 4AB8A 1XM1A 1O3HA 1DWDH 2XNDD 3A89A 3KYFA 1O2HA 1AE5A 3WWFA 3EQ0H 2BD7A 1TAWA 1TWXB 1NFXA 1GHBG 2FO9A 3T5FH 1TGTA 2VWNA 2UUJB 2ZQ1A 2Z94A 5DP6A 4INKA 3SUGA 5F03A 1AMHA 1OX1A 2FZZA 4YTAA 1S0RA 1AE8H 3PB1E 2QF3A 2SFAA 4NCYA 1T8NA 1Y59T 2GMTC 3Q77A 1AY6H 1O3NA 2JETC 5FCKA 2VH6A 4YLUA 1UHBA 3ELAH 1DDJA 2ZPSA 4JYVH 3MI4A 3MNSA 3OE7D 1EAIA 4TSFD 2M2AA 5TJXA 4P02A 3ZVFA 1CGJE 2ZEBA 1YY3A 3U1JB 5E0HA 4CREA 1YCPK 1UTKA 3GYMA 1XKAC 3F2HA 1C1QA 2D8WA 1GDQA 3GICB 2ZQ2A 1GJCB 2Q1JA 4NA9H 4GVUA 4A92A 3SU4A 5EJ1A 1C2IA 1ZRKA 1C2FA 4E7NA 2ODYB 2OLGA 3ZZ6A 2CHAC 1UTJA 2UUFB 3TNTA 4AFSA 2Y82A 5C1YA 3RXHA 2ANMH 1MAYA 4Y8YA 2K0QA 3RXGA 5SGAE 4IMZA 1EQ9A 2GTBA 2ZCLP 3KQEA 4BAQB 4D8NA 4AYVB 3FVFB 1SKYE 3FP7E 3RXMA 1DXPA 3SBKA 1XUJA 2QF0A 1G3DA 2WPLS 1S83A 1G36A 1QCPA 2V0BA 3MH7A 2CN0H 2WPHS 1C5YB 3L3TA 2ZU2A 1TX6A 1O2PA 1C9PA 3K9XB 5JYIA 2ZU1A 3BEUA 4Y7AA 1H9LB 2ANYA 3RLYH 4O3UA 2B5TB 1GL0E 1ZSLA 1HAXB 2ZCKP 1TE0A 3RXRA 1RS0A 1WYKA 2J97A 2ALPA 1EPTA 2VGCB 1Y3WA 1E37B 1W7XH 3DSOA 2IJD1 3P8GA 4X6PA 2C90B 1A5GH 4FETA 2BD4A 2Z9JA 3QGJA 1CO7E 5HM2A 3TGKE 2SGDE 1QRXA 1DPOA 5DO4H 1MTNC 1UVPA 1TNIA 5AF9H 1IQLA 1NS3A 1THRH 4KTCA 1MBQA 3ESTA 5E2PA 3NPSA 2HLDD 1RGQA 3QTOH 4BXSA 5C0TA 2PWXA 2OC0A 4CRCA 4FUFA 1CHOG 3RXTA 1SFQB 3QWCH 4O03A 5EXMA 1ELFA 1AFQB 4CR9A 1SMFE 3ZZ3A 1YPJH 3ZYDA 2H1UA 5GJ4B 2OCVB 3RLWH 1Z7KA 2FODA 3S9CA 3KCGH 1V2ST 4NWKA 2F9OA 1Q31A 1Y3XA 3D62A 5T1VA 1W0KD 3TGJE 2ZGHA 3PTBA 5KGOA 3RUOA 1UK2A 1ZTLA 1C2GA 1XUHA 4TYDA 4HGCA 1TMUH 1MU8B 1AB9C 3AAUA 2W26A 1KIGH 4BANB 4JZIA 1UO6A 3MO3A 1JMOH 1BBRK 1TOCB 2WYJA 5EOKA 7GCHG 3UOPA 1FAXA 2WV4A 3A8AA 4Q7ZA 4MPUA 2G5VA 2H9TH 2OBOA 3EA8A 1ZJKA 3RMOH 2FM2A 1GCDA 5H4IB 1HCGA 3B23B 3LU9B 3Q00A 7ESTE 6CHAB 1HPGA 4LK4A 3E91A 4R8TB 1LVOA 1AKSB 2C8WB 5HMAA 2G8TA 3BTEE 4B74A 4XE4A 3RMNH 2GVFA 2ZGBH 3MU1A 3LGTA 1ESTA 3DT0H 3RM2H 2FLBH 3WW7A 1W3CA 3UPEA 3F9EA 2LNCA 1C5PA 1GI3A 7LPRA 3T26A 2PUXB 4U01A 4X8UH 1P06A 1LQEA 1OPHB 4ASUD 4P00A 1A1RA 1LCYA 2BD8A 1MU6B 3S9AA 2FI5E 3BIUH 5T3HA 4CBOA 1BJVA 1WU1A 4OS7A 3MOCA 2CF8H 2FMJA 3SQHE 5A8XA 2B8OH 1O5DH 1ESBA 5C1XA 3QTVH 4NIYA 5CHAB 5EGMA 3UTUH 5F53A 4XFQA 3EE7A 3KQ5A 1BRUP 2TPIZ 3ZVDA 4JZEH 1SGDE 4FU7A 1ELVA 3RM0H 1PYTD 1NZQH 1S0QA 5AVDA 1FIZA 1O2MA 1Z8RA 1H4WA 2AS9A 5DSFA 5GCHF 3TH2H 2WPMS 1GMHG 1NPMA 1QL9A 3GCOA 1V2RT 4OGXA 2Y5FA 1IQMA 2FOMB 2WPKS 1LVMA 1THSH 2XC5A 3BSQA 3F2FA 2FYQA 2F43B 3Q3YA 1VITF 2RA0A 1ZHMA 2XXLA 1CVWH 1SQRA 3ATWA 2J98B 2VJ1A 3L33A 2GCTC 2H5DA 1J9CH 4UFDH 1O30A 3FO8D 1RTLA 1O5FH 2ZHWH 3GDSA 2CF9H 1J17T 1XXDA 2O8WA 1IOEA 4K1TA 1Y5UT 1AZZA 5J4SA 1D3PB 3HGNA 1KXDA 2ZHFH 2Q6DA 3PWBA 2PTNA 4WWYA 1CA0B 2M5TA 1YKTA 2STBE 4TT3D 1MD8A 1UMAH 4RN6A 1BQYA 1CSOE 4XOJA 3URDA 2YMSC 1ZTJA 2EA3A 1O2IA 2Z7FE 2Y7ZA 3VB4A 1NT1A 2BDGA 1RRKA 1D3TB 3QK1A 4O97A 1VCWA 2OINA 3LONA 4KKDA 3RXPA 3SU2A 2FOAA 4MPXA 3RU4T 4ABIA 1O2WA 1IHSH 1KXBA 8GCHG 1P3CA 2VIPA 3MFJA 4KTUA 5DG6A 4GAWA 1TA2A 2VB0A 5F8ZA 1O3OA 1HFDA 3TGIE 5JPMH 2VINA 2ZG0H 4NWLA 2WUCA 3M7TA 3EA9A 5FAHA 1YPHC 1L0ZA 2SGPE 5ETXA 4CRBA 3F6UH 3PROA 1IQHA 1FY8E 5EXLA 2UUYA 1YLCA 1H9HE 2BQ7B 2ILNA 2ZWLH 3G01A 4IC6A 4ISIH 1OYTH 1GHBF 1O2XA 2P93A 2GCHG 4CH8B 4X6NA 2Z9IA 2VIQA 3E0NB 1Y5AT 5K0HA 3VB3A 1FV9A 5T6FA 2GDDA 3M5MA 5LH8A 1HAOH 1MCTA 1QJ1B 3SU1A 3W95A 2G4TA 5LGOA 2R0LA 1BRAA 4I8LA 4YLQH 1RTKA 4Y8ZA 2QAAA 3RXUA 4DT7B 1AZ8A 3ZZAA 1DWCH 3S0NA 3ITIA 3OEED 1JBUH 1VCPA 2QXIA 2D2DA 1EXFA 4HTCH 5L2YH 2P3FH 2GD4B 4ZAEA 1P2OA 4VGCB 4RI0A 1E38B 1GBEA 1ZHPA 1C5QA 1CU1A 1JXPA 5EJZA 1VZQH 2ZGJA 3DFJA 3RXAA 1IQGA 1GDUA 2FWWA 1GI6A 1V2NT 1ELCA 2ZU4A 4WMDA 1C1SA 3DD2H 4X1NU 5GPIB 3RXLA 1TX8A 1ELDE 2A1DB 4O9VA 4ZHLU 2QGRA 1EZUC 1V2MT 1BIOA 1E36B 4WH8A 5EQRA 5LPFA 3P92A 3P8NA 1C1TA 1BJUA 1GGDC 1K1OA 3T29A 2Q6FA 5AFZH 4CRGA 2ZU3A 1YBWA 4TPIZ 3F9HA 2PP6A 4E7RG 4JCNA 3V12A 1QGFA 5FX6A 5BPEA 2EY4C 1DITH 4NSVA 3GY8A 3JZ2B 2A32A 2FLRH 4AB9A 4KP0A 1TPSA 4WF8A 1MZAA 1GDNA 1TRYA 2BQWB 2ZHEH 3O8BA 3RU4D 4DW2U 4ABAA 1ZPCA 1C5MD 3U8RH 2ALVA 1KTTB 1NU7B 5TCCA 1PQ8A 5FX5A 2PR3A 1QQUA 1TGCA 1DVAH 1G3CA 1SB1H 2K1QA 1C2JA 3TJOA 1GI4A 1BMMH 1AGJA 1AFQC 3M7UA 1S81A 2TRMA 3P8OA 3V7TA 3M3VA 2P3UB 2F9VA 2BHGA 4BNRA 1OKXA 1AIXH 1VJAU 2BDCA 1YP9A 4AG1A 5B6OA 3GY2A 2KCPA 5EODA 1WV7H 3KHVA 4IS5A 1GBDA 1CE5A 1GL1A 1O2GH 4JYUH 4A1VA 2KFWA 3E8LA 2RCEA 2PHBA 3OTJE 1XKBC 2C8ZB 3GCTF 4OS2A 3A7VA 3OSYA 3SU6A 4GCHF 2HNTF 1QHRB 4CHAB 1HLTH 1N8OC 1XUIA 3A85A 1TMTH 3U9AH 1LHCH 4FUDA 2A4QA 1GI2A 2W3IA 3M5NA 3A8CA 2C93B 3KQCA 2FOHA 1ORFA 1O2LA 2G52A 1BHXF 3ENSB 3M61U 3OX7U 5GIBA 2AGEX 2SGQE 1ANDA 3WWBA 1O3EA 3PLKA 1F0UA 4K69A 4LZ1H 2D1JA 5GXPA 1QB6A 2GZ8A 1S6LA 1UCYE 3DSGA 1GJ5H 2BY6X 1V2KT 1ELGA 1SGQE 1HGTH 4FUCA 2F9PA 4Y79A 4E06H 1XUFA 1O5EH 2AMPA 4CRFA 2J34A 4YT7H 1QBVH 1BOQA 1LHFH 1TNGA 2NU3E 3HKJB 3SU3A 2ZA5A 4F4OC 2XBVA 4I7YH 4OS5A 1L4ZA 3QUMP 1O3IA 1HIAA 3SYJA 2FDAA 3HKIB 3TNSA 3SHAH 4RSPA 1P2QA 3TK9A 4Q4LA 3K6YA
chains in the Genus database with same CATH topology
5C2ZA 1AKSA 2EI8A 2C8XB 2ZIQH 2GKVE 1RIWB 3LJOA 3QZRA 1ZPZA 1LPKB 4SGBE 3GCNA 2FXRA 1T32A 1P2KA 2VIWA 3QGNB 1TPPA 4BXWA 3A8DA 1A61H 3A82A 1N6YA 1TNHA 1TNLA 1PPGE 2HVXA 1GHAG 5FHTA 4K1SA 1PFXC 3PMJA 5EW2H 2QYIA 2FOFA 1OXGA 3UQVA 1ANBA 1A4WH 3H5CB 3HK6B 2QN5T 3SJKA 3A8BA 2BXTH 8LPRA 3GCHB 1HAYB 1EP5A 2ZGXH 4OS6A 1RD3B 1RXPA 1MKWK 2A2XH 2ODQA 1V2VT 1B5GH 1SGTA 3EYDA 4BAMB 1UTPA 5DJ7A 1S85A 2ZTYA 1CA0C 1VITH 3SV6A 1EZQA 1D9IA 1ANCA 2XBWA 2P95A 4MDSA 5LPEA 2SGFE 3SJ9A 2VVUA 1BRBE 1K22H 1GBBA 1HAPH 4NZLA 1B7XB 1L1JA 3UOUA 1SC8U 4Y10E 1N6XA 3SN8A 3SORA 2ZF0H 4HFPB 1BITA 2OQUA 3ZZ5A 4A6LA 4ZKNU 2P8OB 2BY7X 4Y8XA 2ZFTA 3GY6A 2W7SA 1FONA 3B9FH 2EEKA 1O2TA 2C4FH 2NU4E 3PM3A 2IPHA 1CGHA 4Q7XA 1AHTH 2XTTB 4FU8A 4ZHAA 2AGGX 1BT7A 4FUJA 7KMEH 1EAXA 1UVUH 1GG6B 4Y0YE 4D9RA 5A0BA 4AORA 3P17H 1LO6A 2AIQA 1V2PT 4X1QU 3VGCB 4X2WA 2W5EA 1DX5M 3HPTB 1TX7A 1ZTKA 8GCHF 1EAUA 1P0SH 4UDWH 2HNTC 1HXEH 2FOGA 2VIDA 4MNXA 3M36A 4D76A 4UONA 4Q7YA 1G32B 1DSUA 2G51A 1ZOMA 2ZO3H 1C9TA 1GJ9B 1IQJA 1KXCA 2B9LA 3MH5A 1EPTC 2V35A 1VGCC 1L1NA 1FNIA 1MZDA 2HPPH 1YF4A 3RXVA 1SOZA 1O3JA 3R0FA 4WMFA 1Z6JH 2AH4X 3FP8E 1QB9A 1TGBA 4AGKA 4B76A 4DIHH 3KQDA 1F0RA 1GI8B 1SFIA 1YPEH 1HAGE 4JK5A 4VGCC 3RC5A 4FUBA 2OTVA 1ZGIA 1OP2A 1QY6A 1WQVH 2CGAA 3D49H 3LPRA 5I25A 1ZRBA 1C2MA 1V2TT 4B73A 1ZLRA 4NZQA 4YO9A 4GHTA 4ZXYH 3FANA 1QL8A 2KAIB 1OWDA 2BQ6B 1O2ZA 1DXWA 1P2NA 1Y3YA 2QXHA 1T8LA 1TRNA 2PGBB 3LH3A 1HXFH 4UE7H 1GMCG 1MMJN 1FPCH 1OP8A 1C1MA 2FPZA 1V6DA 5EQQA 4X6OA 2J4IA 3GY5A 5A09A 4HI3A 1A3BH 1YLDA 3RU4E 3VEQB 2O8UA 6GCHF 2D26C 1BDAA 3M3SA 4UEHH 1FLEE 1DWEH 1MKWH 1P05A 2A5KA 2XRCA 1P3EA 3LGIA 1GCTC 1C5LH 1SGIB 2BDHA 5F8TA 1ZSKA 1SGPE 1V2UT 5G4BA 1P2MA 1C5VA 3FAOA 4X6MA 1HBTH 1O2YA 2WUBA 5DP8A 2O8MA 1GPZA 1GJBB 1GJDB 1DICA 2YNBA 3NUMA 1DSTA 4AGJA 1O38A 4ABHA 2VWOA 1WUNH 1AUTC 1F5KU 3CS0A 4XBDA 1C5TA 1NO9H 4ZH8A 3V0XA 3BEIB 1JOUB 2GDEH 2I6SA 2A4RA 1SGYE 4H4FA 4ABJA 1C2HA 1C5RA 2DE8A 3SNBA 2F9NA 2G5NA 1EP6A 1FMGA 3H7OA 1ID5H 4THNH 3BTDE 3JZ1B 2O8LA 3SUDA 1BUIA 3Q3KA 1HIAB 1QR3E 2F83A 2Z9KA 3VPKA 2F91A 4AZ2B 5E0GA 1WSSH 3LJJA 1Y8TA 5FPYA 2PW8H 2BYAX 6LPRA 1BBRE 1V2QT 1OWIA 1YGCH 1MQ6A 3KL6A 1AI8H 1MCVA 2BOHB 4DIIH 4NA8A 3SV2H 5CMXH 1TGNA 4MNVA 5EQSA 3RXOA 1NTPA 1C2EA 1DLEA 3ZZ9A 1DY9A 5FBIA 1G37A 2OQ5A 1QA0A 1SGCA 3UIRA 3PO1C 3PV4A 4AFZA 5DKMA 1TFXA 2FEQH 2A31A 3U8OH 1SBWA 2ZPQA 5T6GA 4FUIA 3A83A 3EA7A 1MTVA 1GBKA 1TOMH 1F2SE 1TYNA 1H1BA 2Z3DA 4CRAA 1TONA 2QIQA 4ZHMU 1O2QA 5C5OA 2ZC9H 3ATMA 1P02A 1M9UA 2AERH 4YT6H 4E05H 3KGPA 5EXNA 4CRDA 1G2MA 4NIWA 2ZDAH 4WY3A 2BLQA 1AWFH 2BOKA 1A5IA 3AVZA 1SHHB 3OY6U 3TVJB 2QC2A 3FZZA 1LHEH 4SGAE 2BLVA 3FFGA 2FS8A 1LTOA 4XDEA 1F5LA 3A7WA 1YM0A 1HDTH 1O3DA 1O3GA 2A7CA 4AFQA 2F3CE 1PQ5A 1S82A 1TABE 3KQBA 1FJSA 2PSYA 3V13A 1GI1A 4XBCA 4ISOA 1KLTA 1SQTA 1MH0A 3AASA 4D7GA 1HJAC 2A7JA 1D6WA 4FVBA 4I31A 4OS4A 2STAE 2J38A 3BF6H 5EPNA 1J14A 1SGEE 1T4VH 2A4OA 1EJNA 1HNEE 1T4UH 1XMNB 1O39A 2YOLA 3I29A 9LPRA 5E0JA 1C2DA 3STIA 1UTQA 1K21H 2QV1A 1SLWB 2BVSH 1F0TA 4X2VA 1V2LT 3MNCA 1QRWA 4DCDA 2BDYA 3RXSA 2XBYA 1PPBH 2FIRH 1J16A 2PLXA 1S5SA 5IYTA 1K1NA 2V3OH 3ODDA 1XVOA 5J4QA 4BTUB 1EUFA 1GHZA 2B7DH 1NFWA 2IN2A 1Q3XA 5DK1A 1D3QB 3MWIU 1GMDF 3SUFA 4K5ZA 3QO6A 3MU5A 4JYTA 1GG6C 1BTHH 1C5SA 1K1IA 4WJG2 1C1VH 2XCFA 3RMMH 3HGPA 3RMLH 2Z3EA 1TALA 3A80A 3VGCC 1C2KA 1MQ5A 1TBQH 3QZQA 1IQEA 2QXGA 2Y7XA 1GHWH 1W8BH 3UNSA 4JZ1A 1NFUA 4NFEA 3SI4H 3TK5A 2JH0D 1CBWB 2FS9A 2A7HA 1RTFB 5EG4A 2ZNKH 1LVYA 4NIXA 4Z6AH 3A7ZA 5F6MA 1BMNH 1GHYH 2BD2A 3LH1A 1YPHE 1YC0A 1O36A 1GHVH 2TBSA 4KELA 2JETB 5PTPA 4DVAU 3BTME 1SQAA 3IITA 3WY8A 2OC7A 2P94A 1OWHA 1K1MA 4ZMAH 3EDXB 5ESTE 3SNCA 4ABBA 1PJPA 1ZMNA 5L2ZH 3RXFA 3SZNA 1W2KH 3C1KA 1P10A 1K2I1 5BRRE 4ABDA 2ZFPH 2GV6A 4J1YA 1EASA 2ULLA 5FCRA 3Q76A 1O3LA 4FVDA 1C5XB 4J2YB 3T62A 2AMQA 1F5RA 2WPIS 1PPCE 2Y81A 2FX6A 3SU5A 4RKJB 1W0ZU 2BLOA 2GP9B 5GDSH 5K7RA 1C1PA 1P2IA 3C27B 4I33A 1TQ7B 1O3AA 2VGCC 1SG8B 1AN1E 1ZZZA 3TJUA 3MO6A 4I8JA 1GI5A 4UFEH 3S7KB 4I8GA 3FZDA 2AGIX 3RXCA 4CBNA 4U32A 2HLCA 1X7AC 3MMGA 1LKBA 5TCAA 3UR9A 4ABFA 1S6FA 2FYRA 1SGNE 5HYOA 4ZKOU 1JRSA 1P57B 1EOJA 2ZHDA 3EE0B 1ZGVA 5HM9A 3RXQA 2KAIA 4X1SU 3A88A 1BZXE 4AX9H 3PWCA 1SLVB 3NKKA 2BXUH 5C20A 1MTNB 2OXSA 4GSOA 4A7IB 1QL7A 3S7HB 4NIVA 1O2VA 3SV9A 1NFYA 1PPFE 4XSKU 2UUKB 2H9HA 1UJ1A 4H42U 2GT8A 1C1RA 2DE9A 3TH4H 1GBHA 2P3TB 5JB8S 1CHOF 1EZSC 4ISLA 5FBEA 2R3UA 1KDQA 2BVRH 2NU2E 3LGUA 2BX3A 4MLFB 4MPVA 1A3EH 1P03A 3MU8A 3T27A 1S84A 1A2CH 4LXBH 1E35B 3ZVEA 3A87A 1BA8B 3O8DA 5AFYH 2J95A 2NU1E 6CHAC 4QT8C 2AFQB 3SUEA 1LKAA 1BCUH 1JRTA 3SI3H 3BTWE 2WINI 1O3BA 1AB9B 1P9UA 5DP9A 4AG2A 4ASHA 3K6ZA 3OYPA 4YM9A 4MG3A 1SHYA 7GCHF 1BTYA 1ZMJA 2TGDA 3RXIA 1HB0B 3ZVGA 2ZDKA 3LC5A 1S6HA 5A2MH 2FOBA 1O3CA 1UCYK 1U6QA 1WCZA 3DUXH 2ZDNA 1W10U 2Z9LA 4TWYA 5DP3A 1EX3A 3ATLA 2R2MB 2BB4A 1Z8GA 3ODFA 3R3GB 2BX4A 3SGBE 2ODPA 2XBXA 5CHAC 2JKHA 2Y80A 2XC4A 3U8TH 3PLBA 1BB0B 1TIOA 4I8HA 3ZZCA 2GZ7A 1AO5A 4ZROA 4UFFH 5GCHG 5JBAS 5L30H 4Q2KA 3AW1A 4DG4A 5FPSA 1TNKA 1FY3A 4NG9H 3BIVH 1C5WB 3P70B 4ZKSU 3H7TA 1QTFA 1EATA 1Y5BT 3BTKE 2FESH 3BEFB 1QFKH 5JDUB 1LDTT 1WOFA 4Y6DA 1A7SA 1ARBA 4UD9H 3ZVBA 1YPLH 1BTZA 1PQAA 2BDAA 1LPZB 1GMHF 1UTOA 4K8BA 3GOVB 1LPGB 3OY5U 5EPYA 3S9BA 4R0IA 1O5CB 1P11E 1A0HB 3FP6E 1SL3A 1YYY1 3OU0A 4HZHA 1EKBB 4ZXXH 2BZ6H 1ZYOA 3MNBA 2BTCE 4M7GA 2GCTB 2P16A 1NRNH 3UWJH 1W7GH 1CQQA 4ESTE 2ZHQH 1QRZA 1P09A 5F8XA 3UNQA 1QNJA 1W0YH 2SNWA 3ZZDA 3PMHB 2ZFQH 3UWIA 8KME2 3MH4A 3GY3A 2ZU5A 3SNAA 4BAHB 3A81A 1SGFG 3B8JA 3NK8A 1C1NA 1CT2E 3VFEA 1MKXH 3M3TA 1RJXB 2HPQH 2SNVA 3TPIZ 4KTSA 3E90B 1SI5H 1J8AA 4DJZB 1FY4A 1C5UA 1HAIH 3SGQE 2QXJA 2ZFFH 3PMAB 4BTIB 1KTSB 1HYLA 2C3SA 1NRQH 3BTQE 1DM4B 1OWJA 1AD8H 5C67A 2VIVA 1C2LA 2H9EH 1A0LA 3LGWA 2AMDA 1O3PB 3GY7A 1CBWC 1HV7A 1UCYH 2H5CA 3V3MA 1JIRA 3A7XA 4MNWA 1DUAA 1VR1H 1O0DH 4U2WA 4GPGA 1QB1A 4XBBA 3PTNA 4A5TS 4ZKRU 1OWEA 1KYNA 2V3HH 4AN7A 2TIOA 2TGPZ 1ACBE 1INCA 2BZAA 3U98H 2ZPRA 2GCHF 4X1PU 1J15A 4X8VH 4GUXA 3ATIA 2CMYA 3F9GA 1GBIA 1THPB 2HNTE 1Z8IB 4Z0KA 4DY7B 1E0FD 2A0QB 2OC8A 1ZMLA 1GBTA 2OP9A 3PYHA 2R9PA 2EI6A 1W13U 3SU0A 1KXFA 1L2EA 1SGRE 3E6PH 4FUGA 2BY9X 3U1IB 1D4PB 1DLKB 2HRVA 3RP2A 1KSNA 1EOLA 1SR5C 5C1UA 1FZZA 2BD9A 4WMEA 1P01A 3ZZ4A 2AIPA 1SPJA 3TJVA 2AEIH 1HUTH 3MNXA 4F49A 2PKAA 2ZCHP 2VWMA 4FU9A 1CGIE 4D9QA 3QN7A 4YESB 1NRSH 5DP7A 3UFAA 1KDQB 3P95A 1C1OA 2AYWA 3CP7A 1V2WT 4B75A 1AVGH 1SLXB 2VVVA 2J9NA 1GI0A 2TGAA 1EAWA 1GGDB 4WXVA 2G4UA 4NGAH 2Y5GA 2QY0B 1OWKA 1OP0A 2FTLE 1NESE 1L4DA 2V6NA 1TQ0B 1YPKH 1IQFA 2J2UA 2UWPA 3SV7A 1Z71A 1FI8A 1DE7H 2Y5HA 1BTXA 2G00A 3UNRA 4H6SB 4X0WU 1F0SA 4Q80A 2QCYA 4NSYA 3DFLA 4CR5A 1ELBA 1K1LA 3LIWA 4DURA 2IOTA 3GDVA 4JMYA 1E34B 1UTMA 3RXBA 3SGAE 5ABWA 4ABGA 3VXEH 4LZ4B 1OS8A 1GBFA 1ZPBA 2ZZUH 3DA9B 3GCTG 4D7FA 4B2BA 3ZYEA 4H6TA 4GCHG 1A0JA 1NY22 3M37A 1Y3VA 4B71A 2PGQB 2UWOA 2F9UA 1C1UH 4CHAC 1D6RA 1ZR0A 1PPHE 5EW1H 3SOSA 3Q3XA 2XWBI 2LPRA 1Z8JB 5DPAA 2PKSB 3QDZB 3A7TA 3KIDU 1ARCA 1A5HA 2ZTXA 3HK3B 5FPTA 3BTFE 5C3NA 3GYLB 3E0PB 2OBQA 3TLOA 3RXDA 2HOBA 3BN9A 1NM6A 3NWUA 3SQEE 3A84A 1ANEA 1CHGA 1N8OB 1ABJH 1W14U 5E2OA 1XX9A 2VIOA 2BDIA 1FY5A 1A46H 1GJ7B 3NZIA 1P12E 1ETSH 2VU8E 2P59A 9ESTA 2IJOB 1YCPH 3T28A 1O2KA 1WTHD 2GV7A 1SLUB 1QA7A 1HJ9A 3KEEA 4ZUHA 3CS7A 4U30A 1NRRH 3MHWU 1K1JA 4YOGA 3TITA 1MAXA 1OOKB 5EU8A 2W3KA 3F68H 3LGYA 8ESTE 1YPMH 1MTSA 2ASUB 2BY8X 1O5BB 5I46H 1GVZA 1RIWC 3TK6A 1MUEB 1Z1IA 1UTNA 2A4GA 4NA7A 1HAVA 2FTMA 4ISNA 3SJIA 1O5AB 1RFNA 5CE1A 1TLDA 1FAKH 3UQOA 3K65B 2ZTZA 2BM2A 3ZZ8A 4ABEA 1SVPA 2OD3B 2O8TA 2CJIA 2J94A 1IQNA 4I32A 1DS2E 4IC5A 1LQDB 3F1SB 2BLWA 4K3JA 2VNTA 1FDPA 4INLA 3GCHC 1EJAA 3EGKH 4BTTB 1QURH 1QBOA 2W7UA 1F7ZA 5AHGH 2FP7B 3I78A 4TWWA 1KLJH 1FQ3A 1FXYA 2BDBA 4WH6A 1GHAF 1GJAB 2GX4A 3S69A 3D23A 3BTTE 2WYGA 2ESTE 1LMWB 1Q2WA 2NWNA 1DY8A 3E1XB 1GWAA 4BAOB 3BG4B 5A0AE 1C4U2 5HXFA 1QBNA