4X1NU

The crystal structure of mupain-1-16 in complex with murinised human upa at ph7.4
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A cyclic peptidic serine protease inhibitor: increasing affinity by increasing peptide flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords mupain-1-16
total genus 58
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1nU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1nU01
3G01A 2PKSC 4BTIB 2V0BA 3TJVA 3ZVGA 3BTDE 3BG4B 4JYVH 1GMCF 1MAYA 3Q77A 4MPWA 4I8KA 4KTCA 1WOFA 5C5NA 3W95A 2EA3A 3UY9A 3MH4A 1TNIA 2V3OH 1F5RA 2WINI 1JIRA 1BUIA 1A2CH 1ACBE 1FLEE 5EOKA 3HK3B 2BHGA 4VGCC 3BEIB 2A45B 4K60A 3TITA 1GL1A 3MNBA 3ZZ7A 2LPRA 2ODYB 4ZKNU 4XBCA 1ZTKA 2B8OH 1ETSH 5GWZA 4ABHA 2F9OA 2A7CA 1AB9C 2OC8A 2ZTXA 4U01A 3U8TH 1ZTLA 5LPFA 3UNQA 3E6PH 1PYTC 3T27A 3KIDU 1T32A 1P10A 1BMAA 1GJ5H 7GCHG 2TPIZ 4NIVA 1K1NA 5DP3A 1ZHPA 1PJPA 1MTNC 3VFEA 3GCTG 3QGNB 2BVSH 4OS4A 4MTBA 4BAHB 4I33A 2HGTH 2NU2E 3IITA 5DJ7A 1TNHA 3MO9A 1GJ6A 2ZDVH 1ARBA 1SGTA 2R2WU 1C9TA 1HFDA 1TMUH 1GI4A 4X2XA 2OP9A 1Z6JH 3JZ1B 1ZJKA 2J38A 3M5MA 2STBE 1GBTA 4NG9H 1DE7H 3TJNA 1AMHA 1HPGA 2BDIA 4ABBA 3LGIA 3U8RH 1IQKA 3ODDA 2FOEA 5FCRA 3NWUA 1O32A 3RXVA 1UMAH 2NU0E 2BDBA 5T6GA 3RU4D 1JWTA 1GWAA 4Q80A 2RA3A 1UTKA 1QA0A 1LTOA 1LQDB 5EU8A 2ZDMA 1XUJA 1TRMA 2A2XH 2STAE 1NESE 1T8LA 2BY6X 1GJ9B 3A7YA 3KQBA 3CP7A 1NRQH 4TPYA 2C8XB 1B5GH 1SFIA 1V2JT 2FO9A 2EI8A 1HUTH 5EPYA 5A09A 4XOJA 2OINA 1C5SA 2ODPA 1HAXB 3VEQB 3GCNA 1Y5BT 2C8YB 3RLYH 4OS5A 4AFSA 1FPCH 2ZI2H 4LOYH 1DY8A 4BNRA 3LOXA 4OS2A 3TK5A 3OY6U 4DG4A 3GCHB 1MBQA 3M5OA 3TGKE 4OS1A 2XC5A 1HJAC 1NU9A 3OU0A 1F0SA 1UVUH 1C1SA 1FIZA 4RKJB 4A92A 2G4UA 5C1XA 1LKBA 5EQSA 1RGQA 3I78A 2P8OC 3STIA 1RS0A 3RXTA 1QRWA 2OLGA 3SOSA 1YBWA 4X6PA 1GI1A 1V2VT 2F3CE 1ZOMA 1Z8RA 3HGNA 4HI3A 4B2AA 1EB2A 2SGQE 1A3EH 5AFZH 1YKTA 4O3TA 1C5TA 3RXQA 4CH8B 3JZ2B 4OGYA 3UTUH 1FDPA 1MQ5A 2FYQA 1HB0B 1BTUA 2GCTC 1AO5A 4Y7BA 2AMPA 3SNAA 2ZGXH 1MTNB 5TCAA 1MTWA 3RMMH 1C2GA 1C2JA 1IHTH 3ZZ4A 1TGTA 2ZFFH 4IMQA 1VITF 5F6MA 1O37A 1BTPA 4XBBA 2GGVB 2ZU1A 5DP6A 3U1JB 1AKSB 2W5EA 2ZQ2A 4Y8XA 4FUEA 3RXDA 2Y82A 1EZUC 4OGXA 3A7ZA 4B73A 1GCDA 1YLDA 3LGYA 3GY5A 2ZU2A 3M5LA 3NZIA 1P9SA 5E0HA 3PV4A 1NRRH 1RTLA 2ZPSA 1QCPA 4HFPB 1GHAG 3RXCA 5EXNA 3NCLA 1KLTA 4J2YB 1IQMA 3MU8A 3RXHA 1NY22 3ZV8A 1Y8TA 1P02A 3QZRA 1BTXA 8GCHF 2H9EH 1CT4E 4JYTA 3SU1A 5DG6A 1NTPA 3F9EA 1AB9B 4UFGH 1C5MD 4GAWA 3K6YA 2Z6BD 4YO9A 4BANB 1AE5A 1A0HB 1O3IA 2AEIH 1C1PA 2GZ9A 3V7TA 4LZ1H 1L1JA 4ISOA 3MNSA 3MOCA 4YM9A 4CRCA 3T25A 2AIPA 4ZHAA 3D65E 1GJ7B 1DFPA 3BTQE 1O2HA 5AHGH 2ZDNA 3L6PA 1RTKA 2HLCA 2QC2A 4Y8YA 3BEUA 5F8TA 2G51A 1P2KA 1O34A 2PSYA 2RDLA 1Q2WA 1K9OE 4QT8C 2BYAX 2PSXA 1NT1A 2QCYA 1ZGIA 3O8CA 3HATH 1EP5A 3UQVA 5C5OA 3RU4E 2EC9H 4Y7AA 2HNTF 2NU4E 1W13U 3RM2H 2FOFA 4MQAA 5FPSA 1W11U 2F83A 2ZHFH 1C5OH 2H6MA 1S83A 1UHBA 1P2NA 1AIXH 2BOHB 5T3HA 3HGPA 1OP2A 1JBUH 1GI7B 2R3YA 4WMDA 1O2MA 1LVYA 3DT0H 5J4SA 4UD9H 3SZNA 3SGAE 5I25A 2HWLB 1CHOG 1ZPZA 3CS0A 2BX3A 4NA7A 1XUHA 1IQNA 1TNLA 2J95A 1GGDC 7LPRA 2QF0A 2ZDKA 4KTUA 1IQHA 1EATA 3VXEH 3WY8A 1O0DH 3M3VA 3ZZ5A 1P2IA 1NC6A 2GDDA 4K1EA 2ZFPH 1SGCA 4BAKB 3MI4A 2ZPRA 1Z8JB 2ILNA 3SBKA 3F9HA 2VJ1A 4X1RU 2FS9A 1TX8A 2FXRA 1UVPA 1AN1E 1QB9A 5JB8S 2C8WB 2ZHDA 4A1VA 2CJIA 1FONA 4Y10E 1O5EH 2H5DA 3M3SA 4E05H 2SNVA 2ALPA 3M3TA 1C1QA 2DE8A 2OBQA 2G52A 2Y80A 5GJ4B 1FNIA 2QY0B 5CE1A 1GJDB 4OS7A 2ZCLP 1WYKA 4UFDH 3V0XA 5EQQA 4FUFA 1X7AC 4DW2U 1WUNH 2OC7A 1O5AB 1SSXA 2YNAA 1JXPA 1OWJA 1O2VA 5DKMA 1YC0A 3ODFA 3K2UA 1IAUA 3SJ9A 3AAUA 1T4UH 3A7XA 2R3UA 3PLBA 1BRAA 4CRBA 1N8OB 2SNWA 4H42U 1OYTH 1W7XH 1C2MA 4B1TA 5CMXH 1G30B 2AMDA 4D7GA 1MAXA 1TABE 2C90B 3STJA 1C5XB 1FY4A 2B5TB 4X2WA 1TONA 1CHOF 2VH0A 4JZDH 3UNRA 2RG3A 4MLFB 1C2IA 1FZZA 2SGFE 2BY7X 3EGKH 1BRBE 1PFXC 1DT2A 1W0YH 5GPIB 3RXRA 3PTBA 5T6FA 1HAYB 3UWIA 3U1IB 1C5LH 2VIOA 2P8OB 5E0GA 1O2LA 4X8TH 1O2PA 1V3XA 1BA8B 2BLVA 3RMNH 3ZZ8A 2G55A 4YT7H 2CN0H 1ANBA 1NS3A 3QN7A 1FIWA 1MD7A 1O3EA 1L1NA 5A2MH 2FX4A 1O3MA 5TJXA 3PM3A 1G3EA 5DK1A 1SLWB 2WPJS 4FU9A 8KME2 3ZVEA 1HNEE 1SGDE 1BTWA 1SGYE 4RN6A 1GHYH 1O3DA 1YPGH 1LO6A 1G37A 3T29A 2PWXA 1SPJA 4WH6A 1HAPH 3D62A 3F6UH 1KDQA 1ESTA 2O9QA 1BMLA 1GJ8B 2VINA 1BMNH 1K1PA 1S0RA 3GDVA 2CXVA 1OP0A 3ZZAA 1TPAE 1O33A 1Z1IA 2JKHA 2TGTA 2W26A 1S0QA 3CENA 2B7DH 1P2MA 1L4ZA 4Z6AH 2H5CA 3RP2A 4XSKU 3PMAB 3PLPA 1SQTA 3NKKA 3RXPA 2Q6FA 4DJZB 2SGAA 3ZZ9A 1XXFA 4KTSA 1K1LA 2VGCC 3PMBB 1ARCA 1J9CH 1XUIA 2R2MB 5LH8A 3LC3A 4INLA 3M35A 2UUJB 3VB4A 1ELDE 2D26C 2GT7A 4Y11E 2JH6D 1W7GH 1TOCB 2TGAA 6LPRA 2CMYA 5ETXA 3BTGE 3GCTF 1OOKB 1EJMA 3FAOA 3URCA 1UTNA 1D6WA 1O2YA 3O8BA 1JIMA 1UVOA 1CT0E 2ANKH 4AFZA 5GXPA 2H2ZA 2VIPA 1HAVA 1SOZA 2H9HA 1IOEA 1QY6A 4ABFA 3ATMA 5DP8A 1HJAB 3ZVBA 2M5TA 4GPGA 1OX1A 2ZGJA 3AW1A 1F0TA 2PUQH 1EUFA 3MFJA 4YOIA 1AZ8A 2P59A 3A8BA 3DFLA 4ASHA 5AFYH 1C1UH 2FODA 1K2I1 4GHTA 3Q3KA 1SGPE 5F8ZA 3RM0H 1O3PB 1MZDA 1O2QA 3N7OA 4A5TS 1T31A 1MKXH 3ATIA 3SJOA 1WBGB 1E0FD 1GI8B 2C3SA 4ISHH 1N8OC 1GMHF 4I8HA 2AERH 1DVAH 1SMFE 1CGIE 4JCNA 3DD2H 1A7SA 2HPQH 3ZZ6A 1C4U2 1DPOA 1W10U 1QL8A 2XC0A 2Z9KA 1EPTC 1KTTB 2O8WA 1TNJA 3K65B 2R9PA 1Z6EA 1O3NA 3VGCC 5EG4A 1HIAA 4YZUA 1TFXA 2A4OA 2PKSB 3HPTB 1ANEA 5ABWA 1A4WH 1AFEH 4WH8A 1B0EA 5EW2H 5EPNA 3T62A 2GCTB 3SV7A 4A1TA 4KP0A 2H9TH 2FOCA 1GBJA 2UUFB 3OSYA 1YP9A 4NGAH 1O3FA 1C1WH 5AF9H 2ZIQH 1S6HA 4ZHLU 2VB0A 3K9XB 4Q7ZA 4AORA 2YOLA 2FM2A 1WAYB 2GDEH 2FOAA 3Q76A 1V2ST 3LDXH 1GGDB 3NK8A 1GHVH 2Q6GA 5A8XA 5C2ZA 4ESTE 4IS5A 1VR1H 1NO9H 1AVXA 1BOQA 3UPEA 3URDA 1C9PA 1QL9A 5EODA 2W3KA 1NM6A 2Y7ZA 1VITH 1XKBC 4AGKA 1IQJA 1T7CA 2G5VA 2PFEA 4J1YA 2W7UA 1PQ5A 1PPZA 5A0AE 1C5UA 1KXFA 2PW8H 4ZXXH 1D4PB 2WYJA 3NUMA 1XMNB 9ESTA 4E7NA 3S7KB 1CSOE 1GMDG 1SGFG 2FEQH 1AHTH 1SI5H 3A80A 2PTNA 1NROH 3KQEA 4AFQA 1GG6B 2VIDA 5AVDA 4Y76A 3QGJA 2ZHWH 4Q7YA 1XUGA 1XVOA 4JZ1A 1KIGH 3GCHC 1OKXA 4K1SA 1O2IA 1G36A 1QA7A 1P06A 3PO1C 2QAAA 1ZR0A 1GI2A 1BTYA 1EZSC 2ZU5A 1T8MA 4ZKSU 3UR6A 1FXYA 2CGAA 1IHSH 1QNJA 1E38B 5LGOA 1KXCA 2A5IA 2P94A 1CU1A 4AG1A 5C1UA 1CO7E 3OYPA 1SLVB 2BD9A 2BM2A 2GVFA 3W94A 2FI5E 3U98H 1SR5C 1VCQA 3UIRA 1GPZA 1TPOA 1LKAA 2O8LA 4X6OA 4ZMAH 4INKA 2F91A 4AB8A 1QURH 3L33A 1SHYA 2A7JA 4NFFA 3L3TA 1TOMH 1HJ8A 4CBOA 2PV9B 1K1OA 1GDQA 5HMAA 2FX6A 2FOBA 2QYIA 2O8UA 1NFWA 3BIUH 1GI9B 4FU8A 3UFAA 3P8OA 1WU1A 1TIOA 5FXLA 2P3TB 1TX7A 1Y5AT 3SNCA 2GV7A 2P95A 3SI4H 1O2KA 1LCYA 2PGBB 1OWHA 1ELBA 4K69A 4YLQH 2RCEA 1KXBA 2GD4B 1N1LA 1MCVA 2H1UA 1TLDA 4ABJA 3SV8A 2F9BH 1DX5M 2BVRH 1ELFA 1A1RA 4MNVA 1SVPA 1OWKA 1ZSLA 1CBWB 2A4GA 3SNBA 2WUCA 3TGJE 1VZQH 3RXMA 4VGCB 1MH0A 5SGAE 5FX5A 2NU1E 4M7GA 2DE9A 5IDKA 2Z9IA 3FZZA 3RXOA 1C5WB 1V2QT 2UUKB 1TALA 1V2RT 3B23B 4RSPA 1P8VC 2FP7B 5FCKA 3KNXA 1KXAA 3SU5A 1RTFB 1ETTH 1B0FA 4YTAA 2BLOA 4INHA 1C5QA 1H1BA 1F7ZA 4LXBH 4MNYA 1QBNA 3B9FH 4Y71A 2A0QB 4ABEA 1O3KA 4NFEA 2QN5T 3SV2H 2QXHA 4TY6A 2QF3A 4X8SH 1AKSA 4MG3A 1P3CA 3SGBE 1OYQA 1CGJE 1UCYE 1YPHE 4BOHA 1GVLA 1UVSH 2SGPE 2SFAA 1TNGA 1O5CB 1WV7H 1YM0A 1HAIH 5JDUB 2XTTB 3MU0A 3M61U 2BLWA 1NFYA 4TWYA 2OQ5A 4CR9A 3RXFA 4JYUH 1EQ9A 1GMCG 1O2ZA 2BQ6B 1G3DA 1H4WA 3LGTA 2Z9GA 1NRPH 1GBEA 5HM2A 4X2VA 2XC4A 1NU7B 2C8ZB 1C2LA 2BD2A 2QIQA 5FPYA 1H9HE 2GX4A 1VGCB 2XXLA 1U6QA 1UTJA 1YYY1 1P3EA 3A8CA 4K5ZA 1TQ0B 2WV4A 2Y6TA 3RC6A 2VIVA 4CHAC 1XX9A 1EAIA 1LQEA 1FI8A 1O39A 1O2RA 2VWMA 2BVXH 3SO3A 1W12U 4WXIA 4FVBA 2XBYA 1F0RA 4Y6DA 1ABJH 2ZF0H 3RC5A 1BRUP 4E06H 2A31A 1YCPK 2FMJA 4YOGA 2CV3A 3TJOA 2BDCA 2WPKS 4ISIH 1LHEH 1O2GH 2OBOA 4X1PU 1GHWH 5B6OA 1C1MA 1NRNH 1QBVH 1O2TA 1C1NA 2P16A 2ZGBH 3ZYDA 2PGQB 2ZU3A 5J4QA 4JK6A 1ZJDA 2A4RA 4NSVA 1CE5A 1TA2A 3GDSA 1YCPM 5T6DA 2WPMS 3SUEA 3TU7H 4AZ2B 4ABDA 2FOHA 1S82A 3SUDA 3KF2A 1DWEH 1NFUA 4LK4A 2F9UA 3RXAA 1BBRE 4TY7A 3U8OH 4X1SU 1GMHG 5L2ZH 3UOUA 2ZNKH 3ENSB 3SV9A 3HKJB 4FU7A 4Y79A 1MKWK 2BQWB 2JH0D 2J34A 2XBWA 3MO6A 4IW4E 2XNIA 1BTHH 4I7YH 3HK6B 1TAWA 2TBSA 7ESTE 5C67A 4OS6A 4UFEH 3GYMA 1KLIH 4TWWA 2V3HH 2PKAA 1Y3XA 2XCNA 1TA6A 1UTOA 2VIWA 3SNDA 5JYIA 1UTPA 1FY1A 3FZDA 4NIWA 2UUYA 4R8TB 1MTSA 1SB1H 2TIOA 1YPKH 1JRTA 1WTHD 1C5PA 1V2WT 2BD3A 3UREA 4XE4A 1XUKA 8ESTE 2ZU4A 3F1SB 4WXVA 4B74A 2AGIX 1IQIA 1T4VH 2OQUA 1LPKB 4I32A 5C3NA 1H8IH 1TQ7B 1ABIH 2VU8E 2ZDLA 4ZROA 2O8MA 1O3CA 4XBDA 4X0WU 4B76A 2NU3E 3PLKA 2G81E 5LPEA 1ZPCA 3KQDA 2PR3A 2ZPQA 5I46H 3T5FH 1P0SH 1AU8A 1UCYK 3MU4A 1UTQA 2A2QH 3SORA 4FUCA 1SFQB 2F9NA 3ZVFA 2ZKSA 4U32A 1TYNA 4ZAEA 3MMGA 3T26A 4CRGA 3LT3A 1ELGA 2VH6A 3PWBA 3LPRA 1FN8A 1O2NA 2XW9A 1WQVH 1TMBH 1TX6A 3LJOA 4CH2B 5EGMA 2IJOB 3DFJA 3TNTA 1SGRE 2FESH 5G4BA 1GHZA 1FY5A 3SN8A 5L2YH 1GDUA 1O5FH 1GCTC 1AGJA 1B7XB 2BQ7B 1Y3VA 1EOLA 1EZXC 4F4OC 1BT7A 3SU3A 1P04A 4BTUB 1ZSJA 4FUJA 3GICB 3QUMP 3E3TA 2TGPZ 1TGSZ 1BQYA 4O3UA 3S69A 1HAZB 1DXWA 2R0KA 3ZVCA 1QL7A 2ZA5A 9LPRA 3LC5A 4HZHA 1OWEA 3QDZB 3RXSA 1EAXA 2HOBA 2LNCA 3ATLA 3P8NA 4AYVB 4DGJA 1AI8H 1MQ6A 4U2WA 2WUBA 3FP7E 4Y0ZE 3PYHA 5E2PA 1ZMLA 5JPMH 3LH1A 3R3GB 3FFGA 1C5YB 1LVMA 2ANYA 1FAXA 4JZEH 1C5ZB 1A0LA 1FY3A 1O2XA 2GKVE 3Q00A 1Z71A 2NWNA 2R0LA 3BV9B 1QJ6B 4WVPE 1AVWA 1TRYA 1Z1JA 2VWOA 1ELVA 5L30H 5F8XA 5CHAC 1YLCA 4K3JA 3QO6A 5GDSH 1EASA 4IGDA 6CHAB 1HXFH 3HKIB 4DVAU 3DUXH 4CBNA 2PTCE 2XRCA 4A6LA 2PUXB 2ZFSA 1K1IA 1UK4A 2VVVA 1LHFH 1EAWA 1K1JA 2XWAA 4YLUA 4AGJA 3IWMA 1Y3UA 2B0FA 3MNCA 3KL6A 3SHAH 2F9VA 6ESTA 3QWCH 3QX5H 1CBWC 2A5AA 3U69H 2OD3B 3LKWA 1XVMA 4THNH 5JBAS 4BXSA 1EB1H 1P2OA 4DIHH 3BTHE 2VGCB 2ZZUH 1L4DA 3D23A 2VWNA 1PPHE 3BN9A 4TPIZ 2ZP0H 1EOJA 1YCPH 2BY9X 1HAOH 2GZ8A 2J94A 2ZTYA 2OTVA 1FY8E 2FPZA 4CREA 2ESTE 2Z7FE 1BHXB 3BTKE 2Z9LA 4K8BA 2XCFA 2ZQ1A 1E37B 2BXTH 1VCPA 3TVJB 3MYWA 1HAVB 3F68H 5DP4A 1W2KH 4WY3A 1UCYH 4WMEA 2C93B 3A81A 1UO6A 5E2OA 1P01A 1KTSB 1THPB 1ZPBA 3S9CA 1J16A 1TPPA 1A5IA 1O3GA 2EI7A 1L2EA 5GIBA 1GJ4H 2GCHG 2Q1JA 3TIUA 1UVTH 3P17H 1A5GH 1TPSA 2GMTC 3SUFA 3EE0B 4K8YA 3M7TA 3FP8E 3SHCH 2BXUH 1XKAC 2CHAB 3OY5U 2FZZA 4H6TA 1MKWH 1G2MA 3VB6A 1M9UA 1HLTH 2Y81A 1E36B 3LIWA 3PMHB 1PPBH 4CHAB 1TWXB 5EXLA 1D6RA 5DGJA 5FBIA 1DLEA 2AGEX 1VGCC 1DXPA 5A8YA 3FP6E 3A87A 4HGCA 1C5RA 1Q31A 3QTVH 4I31A 3RXGA 2WPIS 2G8TA 1CVWH 1A3BH 3MH7A 4NA9H 4X6NA 4RKOB 4WJG2 1C1VH 1O2UA 3P95A 3RXIA 1FV9A 2BY5X 4YOJA 1G2LA 1P9UA 1IQGA 2A1DB 1ELEE 4UE7H 1W14U 2AS9A 2BD5A 2FTLE 1Y3WA 1C5NH 3VGCB 5ESBA 3RU4T 1FMGA 1RXPA 2ZEBA 3A88A 1V2MT 1BJVA 1EP6A 1IQLA 3K6ZA 1BDAA 1TBZH 1YGCH 2AFQB 1KSNA 3EAJA 3TGIE 1BIOA 3C27B 4UEHH 1QIXB 4I8GA 3MTYA 3I77A 4IBLH 1K21H 3GISB 4FUDA 3A7WA 1H8DH 3EQ0H 2OC0A 2G5NA 2GTBA 1UTMA 2ASUB 4BXWA 1XXDA 2FLBH 2BDAA 1F5KU 2OUAA 3SU4A 3VB3A 3BIVH 3TH3H 1ANDA 1QB1A 1GBCA 2CHAC 3RMLH 4Y0YE 1O2WA 1OPHB 1PPFE 2Y7XA 1AY6H 3GCOA 4DIIH 1MCTA 2HVXA 4Z0KA 3MU5A 1EX3A 1OSSA 3FVFB 1BBRH 1Z8GA 4ZH8A 4X1QU 4ISLA 4MPXA 4HTCH 1LVOA 2ZO3H 1OS8A 4I8JA 3BSQA 1V6DA 3ELAH 1YF4A 2GZ7A 1FPHH 1TMTH 5DP7A 3GYLB 4NCYA 1EJNA 5FX6A 1EZQA 2QV1A 1TRNA 2VVCA 2I6QA 2AIQA 1V2TT 1PYTD 1YPLH 1V2NT 1TBRH 2QXGA 5GCHG 1GBBA 1G9IE 1O38A 3EDXB 4R0IA 1TB6H 5EQRA 4AG2A 3RUOA 5ESTE 2VNTA 3PO1B 1CA0B 1DLKB 1BITA 1GJCB 1GJAB 4O03A 1GBAA 1IQFA 3EYDA 4WF8A 2BD7A 3ATKA 1GHAF 1BB0B 4ZKOU 1Y3YA 4FUBA 1DUAA 4FUIA 4CRFA 3E91A 2BOKA 1SGEE 3SUGA 1Z7KA 4AB9A 4K2YA 4Q2KA 1PQAA 1GBFA 2QA9E 4YT6H 1GBDA 1Y59T 1HAHH 4A7IB 4AN7A 2Y5GA 4A1XA 1CQQA 6CHAC 2SGDE 3EA8A 4B75A 3FANA 3PROA 2UWOA 4D76A 3D49H 2A4QA 3MWIU 1BMMH 4BTTB 1PQ8A 5TCCA 5BRRE 3S9BA 2FTMA 3TH4H 2ZHEH 1GBKA 1ZMNA 4NIXA 1DANH 1QR3E 3ZZDA 2Z94A 1QRXA 1S84A 4NWKA 5HGGA 2BD4A 3SJ8A 2V6NA 2P3FH 1HJ9A 1THSH 2QXIA 1G3CA 1GBIA 5JBCS 4ZXYH 3EA7A 4CR5A 3O8RA 1D3PB 2SGEE 3I29A 2I6SA 1PPGE 3LJJA 4MPUA 3E0PB 3ITIA 4MNWA 7GCHF 1HDTH 4DOQA 1GI3A 4SGAE 3GY8A 4UONA 1O3BA 4JZIA 1FUJA 2ZCKP 1UJ1A 1UTLM 2J9NA 1Q3XA 1C2EA 1V2LT 3ZVDA 1GHBF 4GHQA 3M37A 3UR9A 1MZAA 3RXKA 3RXUA 1KXDA 1QTFA 5DP9A 1OWIA 2AYWA 3PB1E 1GHBG 1AVGH 1QJ7B 3E1XB 4BAMB 1F5LA 2ZHQH 1C2FA 1D3TB 3QLPH 1G3BA 2P3UB 4GUXA 3T28A 1ELAA 1AUTC 2XBXA 3SW2B 1DY9A 1BJUA 1DITH 1LPGB 3NXPA 3SQHE 2GT8A 1SOTA 4GSOA 1MBMA 5HXFA 1SQOA 1LHCH 4ZKRU 1MMJN 2XBVA 1K28D 1TE0A 3A83A 4X2YA 1GMDF 1Y5UT 1SGNE 2ZFRH 3V12A 3KHVA 1D3DB 4U30A 2GMTB 4AYYB 3E8LA 1TNKA 1SBWA 1W0ZU 2ODQA 2QXJA 4XFQA 2D1JA 3KQCA 3QZQA 1ESBA 1A0JA 1PPCE 1AE8H 4FUHA 3RLWH 1DDJA 1MKXK 5JBBS 2OXSA 2Z3EA 3BTEE 1C4Y2 3AAVA 1EKBB 2OCVB 1QJ1B 3V3MA 3M7UA 1NPMA 1C2DA 2ZGCA 1N6YA 2Z3DA 4DT7B 3RMOH 3VPKA 7KMEH 1DOJA 5LPRA 1AUJA 1D9IA 1VCWA 2FIRH 3ZVAA 3BTFE 1BTZA 1NRSH 1P09A 1V2OT 1DWDH 1V2KT 3KCGH 8LPRA 3TNSA 3MNXA 2Y5HA 1HV7A 2Z9JA 1P2QA 1IQEA 2W7SA 3OX7U 4NZLA 1C2KA 4X1NU 1O2SA 1DUEA 1DSUA 2BZAA 5FAHA 4FUGA 3A89A 1ANCA 1P57B 1ZYOA 1KLJH 1HAGE 3UNSA 1P03A 3EA9A 2BLQA 1O2OA 3LGUA 4I8LA 2AGGX 3H7OA 5EW1H 3BG4C 1JMOH 1OP8A 1LDTT 1UK3A 2CF8H 2VIQA 1KDQB 2HNTC 2ZECA 1O2JA 1GI6A 1VJAU 1WCZA 1P12E 1C5VA 2HALA 3A86A 2PKAB 4LZ4B 4GCHG 3KGPA 5L6NH 1O36A 2QGRA 3P70B 4AFUA 1CT2E 3M5NA 2W3IA 1RRKA 4AX9H 1RIWB 3Q3YA 3GY2A 1J8AA 1C1OA 1WTGH 5HYOA 4O9VA 1O30A 4KKDA 2A32A 4Q7XA 1SGFA 4NSYA 1ZRBA 4DURA 1VITG 1AFQC 3P92A 3CS7A 2KAIB 1C1TA 1HBTH 1ZMJA 3LGWA 1CHGA 1SQAA 2HNTE 6GCHF 1O5DH 1GL0E 3P8GA 3H5CB 4IN1A 1T8OA 5EXMA 2K1QA 4MVNA 3KEEA 4B2CA 3DA9B 3SNEA 1A61H 2THFB 4D9RA 1P2JA 3TK6A 4PROA 1ID5H 1XM1A 1O3OA 1CA8B 3V13A 1WQSA 1AQ7A 5FBEA 1E34B 3QTOH 1QRZA 2PLXA 1EJAA 3P8FA 1SG8B 2Q6DA 1S81A 6GCHG 4IMZA 1S85A 8GCHG 3DHKH 5C1YA 1O5BB 4CRAA 2TGDA 2XYAA 1HGTH 2A5KA 1EXFA 1SL3A 2GCHF 1O3LA 1ZLRA 5GCHF 1JRSA 2P93A 1BRCE 1ELTA 1TGBA 1QQ4A 4JK5A 3MH5A 2FI3E 3TPIZ 3QK1A 1C1RA 4ABIA 1A46H 1MD8A 1PPEE 2OC1A 1OWDA 1N6XA 2BTCE 1QFKH 5IYTA 1MU8B 2IN2A 4SGBE 1QGFA 4X8VH 1CGHA 4WWYA 2AMQA 1ZHMA 3SQEE 3UUZA 1RJXB 1GDNA 4YESB 1H9LB 4AOQA 2O8TA 3GY3A 1ESAA 3MO3A 1AD8H 4X8UH 2FLRH 1MUEB 3R0FA 1INCA 1WSSH 2EI6A 3PTNA 3RXJA 1Z8IB 3VXFH 2JH5D 3A8AA 2FDAA 4ABAA 4X6MA 3BTTE 1DWBH 1YPEH 3ZZCA 5A0CA 4WMFA 5A8ZA 3E90B 3T2NA 4UDWH 5C20A 3C1KA 2D8WA 1EPTA 4F49A 3PWCA 3S7HB 1QB6A 1O31A 2D2DA 1F0UA 3A7VA 3SU6A 4D7FA 4ISNA 2ZDAH 2F9PA 1J14A 1TBQH 1H9IE 1HXEH 2RA0A 3ZYEA 3TK9A 1D3QB 2BD8A 3GY7A 4D9QA 1MU6B 2FOMB 1CA0C 1ZHRA 2JETB 4ZHMU 1L0ZA 3TJUA 4B71A 2XWBI 1DS2E 2FS8A 2UWPA 2IPHA 1GBLA 3ZZ3A 1NFXA 2ZGHA 4ABGA 2G4TA 1SC8U 1HIAB 1VJ9U 3BTME 4FXGH 1ZSKA 1ZGVA 1HRTH 1W3CA 1GJBB 3Q3XA 2ZCHP 3BEFB 4UFFH 1A5HA 1GVZA 1GCTB 1RIWC 1TGCA 2J92A 1BHXF 1P05A 4DY7B 1T8NA 2WPHS 3LONA 1YPHC 1LHGH 1LMWB 1O35A 5DPAA 1THRH 3RXLA 3NPSA 1MTVA 2IOTA 4K1TA 4B2BA 2J2UA 3LU9B 5CHAB 3S9AA 1W8BH 3BTWE 1OXGA 5H4IB 1SGIB 1BCUH 2JETC 1NN6A 3RDZA 1ZRKA 1BZXE 3A8DA 2YNBA 1F2SE 3E16B 4FVDA 2UWLA 2ANMH 5DO4H 3UWJH 4Y8ZA 3U9AH 3KN2A 2CF9H 2HPPH 4MPVA 5PTPA 1GG6C 4KELA 1FQ3A 1C4V2 3A84A 3RXBA 4BAOB 2WPLS 3MU1A 3MHWU 1GBMA 1SHHB 2FWWA 1DWCH 1K1MA 3BF6H 3RC4A 3TLOA 2FOGA 1KY9A 1AWHB 2B9LA 3OTJE 2J4IA 3SI3H 1J15A 1KYNA 2VVUA 3IG6B 3PMJA 2G00A 1LPZB 1TGNA 4H6SB 1HYLA 4NIYA 4E7RG 2GP9B 1GBHA 1SLUB 3A7TA 4NA8A 1ELCA 1ZZZA 1ORFA 3GDUA 1GVKB 4MNXA 3RXEA 5HM9A 2BZ6H 4NWLA 1JOUB 2ZFTA 4CRDA 1O3AA 1AFQB 3AW0A 1EAUA 2A7HA 2AH4X 1QBOA 4IC5A 1V2PT 1PQ7A 1XUFA 1DSTA 5DP5A 1E35B 5BPEA 2BB4A 3ATWA 4IN2A 3UQOA 1EPTB 4H4FA 5FHTA 1LHDH 3ZV9A 1FJSA 3M7QA 1RFNA 3VB5A 4TYDA 1QHRB 1K22H 1AWFH 3F9FA 3MH6A 5K7RA 2EEKA 1GI0A 5E8EH 3AVZA 3BG8A 3A82A 2BDYA 1QQUA 1UK2A 2ZC9H 3LH3A 4DCDA 1P11E 2Z3CA 5JB9S 1ZTJA 1C2HA 1SLXB 2V35A 5K0HA 4MDSA 1O3HA 1O3JA 3SGQE 3AASA 3LGVA 3ZZBA 2BDHA 2DUCA 5E0JA 1F92A 1O5GH 4O97A 3TH2H 2FI4E 1SGQE 5A0BA 3SU2A 1AZZA 2BX4A 1FAKH 1KXEA 1G32B 1RD3B 3SJKA 2HRVA 1YPJH 2ZWLH 1GI5A 2BMGB 3GY6A 2ZTZA 2ZFQH 4XDEA 2WYGA 3M36A 4GVUA 4KGAA 2GV6A 3A85A 5F03A 1MTUA 2ALVA 3SU0A 2BDGA 1S6FA 4GCHF 1BBRK 2TRMA 3P6ZB 4NZQA 1J17T 4BAQB 3B8JA 3F9GA 3ESTA 3GY4A 1GHXH 1S5SA 2ANWA 4ZUHA 1DM4B 3SV6A 2FYRA 4JZFH 1UHBB 3O8DA 5FPTA 2VWLA 2Y5FA 3H7TA 4IC6A 1NZQH 2ULLA 3E0NB 2PHBA 3VB7A 1ETRH 3GOVB 4GLYA 3UOPA 1YPMH 3S0NA 1V2UT 2KAIA 5JBTA 2WV5A 1L1GA 4D8NA 4JMYA 1HCGA 3SJIA 1FN6A 2C4FH 2ZG0H 2BY8X 1LVBA 1DICA
chains in the Genus database with same CATH superfamily
3G01A 2PKSC 4BTIB 2V0BA 3TJVA 3ZVGA 3BTDE 3BG4B 4JYVH 4OM9A 1GMCF 1MAYA 3Q77A 4MPWA 4I8KA 4KTCA 1WOFA 5C5NA 3W95A 2EA3A 3UY9A 3MH4A 1TNIA 2V3OH 1F5RA 2WINI 1JIRA 1BUIA 1A2CH 1ACBE 1FLEE 5EOKA 3HK3B 2BHGA 4VGCC 3BEIB 2A45B 4K60A 3TITA 4DT4A 1GL1A 3MNBA 3ZZ7A 1S6LA 2LPRA 2ODYB 4ZKNU 4XBCA 5T1VA 1ZTKA 2B8OH 1ETSH 5GWZA 4ABHA 2F9OA 2A7CA 1AB9C 2OC8A 2ZTXA 4U01A 3U8TH 1ZTLA 5LPFA 3UNQA 3E6PH 1PYTC 3T27A 3KIDU 1T32A 1P10A 4Z1MD 1BMAA 1GJ5H 7GCHG 2TPIZ 4NIVA 1K1NA 5DP3A 1ZHPA 1PJPA 3DSPA 1MTNC 3VFEA 3GCTG 3QGNB 2BVSH 4OS4A 4MTBA 4BAHB 4I33A 2HGTH 2NU2E 3IITA 5DJ7A 1TNHA 3MO9A 1GJ6A 2ZDVH 1ARBA 1SGTA 2R2WU 1C9TA 1HFDA 1TMUH 1GI4A 4X2XA 2OP9A 1Z6JH 3JZ1B 1ZJKA 2J38A 3M5MA 2STBE 1GBTA 4NG9H 1DE7H 3TJNA 1AMHA 1HPGA 2BDIA 4ABBA 3LGIA 3U8RH 3VG8A 1IQKA 3ODDA 2FOEA 5FCRA 3NWUA 1O32A 3RXVA 1UMAH 3F2FA 2NU0E 2BDBA 5T6GA 3RU4D 1JWTA 1GWAA 4Q80A 2RA3A 1UTKA 1QA0A 1LTOA 1LQDB 5EU8A 2ZDMA 1XUJA 1TRMA 2A2XH 2STAE 1NESE 1T8LA 2BY6X 1GJ9B 3A7YA 3KQBA 3CP7A 1NRQH 4TPYA 2C8XB 1B5GH 1SFIA 1V2JT 2FO9A 2EI8A 1HUTH 5EPYA 5A09A 5KEDA 4XOJA 2OINA 1C5SA 2ODPA 1HAXB 3VEQB 3UAIC 3GCNA 1Y5BT 2C8YB 2J5UA 3RLYH 4OS5A 4AFSA 1FPCH 2ZI2H 3PV2A 4LOYH 1DY8A 4BNRA 3LOXA 4OS2A 3TK5A 1E1QD 3OY6U 4DG4A 3GCHB 1MBQA 3M5OA 3TGKE 4OS1A 2XC5A 1HJAC 1NU9A 3OU0A 1F0SA 1UVUH 1C1SA 1FIZA 4RKJB 4A92A 2G4UA 5C1XA 1LKBA 5EQSA 1RGQA 3I78A 2P8OC 3STIA 1RS0A 3RXTA 1QRWA 2OLGA 3SOSA 1YBWA 4X6PA 1GI1A 1V2VT 2F3CE 1ZOMA 1Z8RA 3HGNA 4HI3A 4B2AA 1EB2A 2SGQE 1A3EH 5AFZH 1YKTA 4O3TA 1C5TA 3RXQA 4CH8B 3JZ2B 4OGYA 3UTUH 1FDPA 1MQ5A 2FYQA 1HB0B 1BTUA 2GCTC 1AO5A 4Y7BA 2AMPA 3SNAA 2ZGXH 1MTNB 5TCAA 1MTWA 3RMMH 1BMFD 1C2GA 1C2JA 1IHTH 3ZZ4A 1TGTA 2ZFFH 4IMQA 1VITF 5F6MA 1O37A 1BTPA 4XBBA 2GGVB 2ZU1A 5DP6A 3U1JB 1AKSB 2W5EA 2ZQ2A 4Y8XA 4FUEA 3RXDA 2Y82A 1EZUC 4OGXA 3OAAD 3A7ZA 4B73A 1GCDA 1YLDA 3LGYA 3GY5A 2ZU2A 3M5LA 3NZIA 1P9SA 5E0HA 3PV4A 1NRRH 1RTLA 2IJD1 2ZPSA 1QCPA 4HFPB 1GHAG 3RXCA 5EXNA 3NCLA 1KLTA 4J2YB 1IQMA 3MU8A 3RXHA 1NY22 3ZV8A 1Y8TA 1P02A 5C0UA 3QZRA 1BTXA 8GCHF 2H9EH 3SYJA 1CT4E 4JYTA 3SU1A 5DG6A 1NTPA 3F9EA 1AB9B 4UFGH 1C5MD 4GAWA 3K6YA 2Z6BD 4YO9A 4BANB 1AE5A 1A0HB 1O3IA 2AEIH 1C1PA 2GZ9A 3V7TA 4LZ1H 1L1JA 4ISOA 3MNSA 3MOCA 4YM9A 4CRCA 3T25A 2AIPA 4ZHAA 3D65E 1GJ7B 1DFPA 3BTQE 2QF5A 1O2HA 5AHGH 2ZDNA 3L6PA 1RTKA 2HLCA 2QC2A 4Y8YA 3BEUA 5F8TA 2G51A 1P2KA 1O34A 2PSYA 2RDLA 4ZCNA 1Q2WA 1K9OE 4QT8C 2BYAX 2PSXA 1NT1A 2QCYA 1ZGIA 3O8CA 1SQRA 3HATH 1EP5A 3UQVA 5C5OA 3RU4E 2EC9H 4Y7AA 2HNTF 2NU4E 1W13U 3RM2H 2FOFA 4MQAA 3KYFA 5FPSA 1W11U 2F83A 2ZHFH 1C5OH 2H6MA 1S83A 1UHBA 1P2NA 1AIXH 2BOHB 5T3HA 3HGPA 1OP2A 1JBUH 1GI7B 2R3YA 4WMDA 1O2MA 5F53A 1LVYA 2M2AA 3DT0H 5J4SA 4UD9H 3SZNA 3SGAE 5I25A 2HWLB 1CHOG 1ZPZA 3CS0A 2BX3A 4NA7A 1XUHA 1IQNA 1TNLA 2J95A 1GGDC 7LPRA 2QF0A 4FETA 2ZDKA 4KTUA 1IQHA 1EATA 3VXEH 3WY8A 1O0DH 3M3VA 3ZZ5A 1P2IA 1NC6A 2GDDA 4K1EA 2WV9A 2ZFPH 1SGCA 4BAKB 3MI4A 2ZPRA 1Z8JB 2ILNA 3SBKA 3F9HA 2VJ1A 4X1RU 2FS9A 1TX8A 2FXRA 1UVPA 1AN1E 1QB9A 5JB8S 2C8WB 2ZHDA 4A1VA 2CJIA 5C17A 1FONA 4Y10E 1O5EH 2H5DA 3M3SA 4E05H 2SNVA 2ALPA 3M3TA 1C1QA 2DE8A 2OBQA 2KCYA 2G52A 3H09A 2Y80A 5GJ4B 1FNIA 2QY0B 5CE1A 4ACBA 1GJDB 4OS7A 2ZCLP 1WYKA 4UFDH 3V0XA 5EQQA 4FUFA 1X7AC 4DW2U 1WUNH 2F43B 2OC7A 1O5AB 1SSXA 2YNAA 5B6LA 1JXPA 1OWJA 2WSSD 1O2VA 5DKMA 1YC0A 3ODFA 3K2UA 1IAUA 3SJ9A 3AAUA 1T4UH 3A7XA 2R3UA 3PLBA 1BRAA 4CRBA 1N8OB 2SNWA 4H42U 1OYTH 1W7XH 1C2MA 4B1TA 3DCLA 5CMXH 3DSGA 1G30B 2AMDA 4D7GA 1MAXA 1TABE 2C90B 3STJA 1C5XB 1FY4A 2B5TB 4X2WA 1TONA 1CHOF 2VH0A 4JZDH 3UNRA 2RG3A 4ACAA 4MLFB 1C2IA 1FZZA 2SGFE 2BY7X 3EGKH 1BRBE 1PFXC 4I86A 1DT2A 1W0YH 5GPIB 3RXRA 3PTBA 5T6FA 1HAYB 3UWIA 3U1IB 1C5LH 2VIOA 2P8OB 5E0GA 1O2LA 4X8TH 1O2PA 1V3XA 1BA8B 2BLVA 3RMNH 3ZZ8A 2G55A 4YT7H 3PRBA 1YWUA 1ANBA 2CN0H 1NS3A 3QN7A 1FIWA 1MD7A 1O3EA 1L1NA 5A2MH 2FX4A 1O3MA 2LELA 5TJXA 3PM3A 1G3EA 5DK1A 1SLWB 2WPJS 4FU9A 8KME2 3ZVEA 1HNEE 1SGDE 1BTWA 1SGYE 4RN6A 1GHYH 1O3DA 1YPGH 1LO6A 1G37A 1E79D 2PWXA 3T29A 1SPJA 4WH6A 1HAPH 3D62A 3F6UH 1KDQA 1ESTA 2O9QA 1BMLA 1GJ8B 5EIYA 2VINA 1BMNH 1K1PA 1S0RA 3GDVA 2CXVA 1OP0A 1H8HD 3ZZAA 1TPAE 5HIYA 3F2HA 1O33A 1Z1IA 3FN8A 2JKHA 2TGTA 2W26A 1S0QA 3CENA 2B7DH 1P2MA 1L4ZA 4Z6AH 2H5CA 3RP2A 4XSKU 3PMAB 3PLPA 1SQTA 3NKKA 3RXPA 2Q6FA 4DJZB 2SGAA 3ZZ9A 1XXFA 4KTSA 1K1LA 2VGCC 3PMBB 1ARCA 1J9CH 1XUIA 2R2MB 3KQ5A 5LH8A 3LC3A 4INLA 3M35A 2UUJB 3VB4A 1ELDE 2D26C 5IK2D 2GT7A 4Y11E 2JH6D 1W7GH 1TOCB 2TGAA 6LPRA 2CMYA 5ETXA 3BTGE 3GCTF 1OOKB 1EJMA 3FAOA 3URCA 5EJZA 2QF4A 1UTNA 1D6WA 1O2YA 3O8BA 3UB0A 1JIMA 1UVOA 1CT0E 2ANKH 4AFZA 5GXPA 2H2ZA 2VIPA 1HAVA 1SOZA 2H9HA 1IOEA 1QY6A 4ABFA 3ATMA 2AHME 5DP8A 1HJAB 3ZVBA 2M5TA 4GPGA 1OX1A 2ZGJA 3AW1A 1F0TA 2PUQH 1EUFA 3MFJA 4YOIA 1AZ8A 2P59A 3A8BA 3DFLA 4ASHA 5AFYH 1C1UH 2FODA 1K2I1 2GJGA 4GHTA 3Q3KA 1SGPE 5F8ZA 3RM0H 1O3PB 1MZDA 1O2QA 3N7OA 4A5TS 1T31A 1MKXH 3ATIA 3SJOA 1WBGB 1E0FD 1GI8B 2C3SA 4ISHH 1N8OC 3U28C 1GMHF 4I8HA 2AERH 1DVAH 1SMFE 2WHXA 1CGIE 4JCNA 3DD2H 1A7SA 2HPQH 3ZZ6A 4P02A 1C4U2 1DPOA 1W10U 1QL8A 2XC0A 2Z9KA 1EPTC 1KTTB 2O8WA 4B6FA 1TNJA 3K65B 2R9PA 1Z6EA 1O3NA 3VGCC 5EG4A 1HIAA 2YMSC 4YZUA 1TFXA 2A4OA 2PKSB 3HPTB 2PP6A 1ANEA 5ABWA 1A4WH 1AFEH 4WH8A 1B0EA 5EW2H 5EPNA 4F48B 3T62A 2GCTB 3SV7A 4A1TA 4KP0A 2H9TH 2FOCA 5HIZA 1GBJA 2UUFB 3OSYA 1YP9A 4NGAH 1O3FA 1C1WH 5AF9H 2ZIQH 1S6HA 4ZHLU 2VB0A 3K9XB 4Q7ZA 4AORA 2YOLA 2FM2A 1WAYB 2GDEH 2FOAA 3Q76A 1V2ST 3LDXH 1GGDB 1YLNA 1GHVH 3NK8A 4Q63A 2Q6GA 4ASUD 5A8XA 5C2ZA 4ESTE 4IS5A 1VR1H 1NO9H 1AVXA 1BOQA 3UPEA 3URDA 1C9PA 1QL9A 5EJLA 5EODA 2W3KA 1NM6A 2Y7ZA 1VITH 1XKBC 4AGKA 1IQJA 1T7CA 2G5VA 2PFEA 4J1YA 1H8ED 2W7UA 1PQ5A 1PPZA 5A0AE 1C5UA 1KXFA 2PW8H 4ZXXH 1D4PB 2WYJA 3NUMA 1XMNB 9ESTA 4E7NA 3S7KB 1CSOE 1SGFG 1GMDG 2FEQH 1AHTH 1SI5H 3A80A 2PTNA 1NROH 3KQEA 4AFQA 1GG6B 2VIDA 5AVDA 4Y76A 3QGJA 2ZHWH 4Q7YA 4TSFD 1XUGA 1XVOA 4JZ1A 1KMHB 1KIGH 3GCHC 1OKXA 4K1SA 1O2IA 1G36A 1QA7A 1P06A 3PO1C 2QAAA 1ZR0A 1GI2A 1BTYA 1EZSC 2ZU5A 2KCOA 1T8MA 4ZKSU 3UR6A 1FXYA 2CGAA 1IHSH 1QNJA 1E38B 5LGOA 1KXCA 2A5IA 2P94A 1CU1A 4AG1A 5C1UA 1CO7E 3OYPA 1SLVB 2BD9A 2BM2A 2GVFA 3W94A 2FI5E 3U98H 1SR5C 1VCQA 2V3MA 3UIRA 1GPZA 1TPOA 1LKAA 2O8LA 4X6OA 4ZMAH 4INKA 2F91A 4AB8A 1QURH 5CDFE 3L33A 1SHYA 2A7JA 4NFFA 3L3TA 1TOMH 1HJ8A 4CBOA 2PV9B 1K1OA 1GDQA 5HMAA 2FX6A 2FOBA 2QYIA 2O8UA 1NFWA 3BIUH 1GI9B 4FU8A 4RT1A 3UFAA 3P8OA 1WU1A 1TIOA 5FXLA 2P3TB 1TX7A 1Y5AT 3SNCA 2GV7A 2P95A 3SI4H 1O2KA 1LCYA 2PGBB 1OWHA 1ELBA 4K69A 4YLQH 2RCEA 1KXBA 2GD4B 1N1LA 1MCVA 2H1UA 1TLDA 4ABJA 3SV8A 2F9BH 1DX5M 2BVRH 1ELFA 1A1RA 4MNVA 1SVPA 3ZIAD 1OWKA 3PV5A 1ZSLA 1CBWB 2A4GA 3SNBA 2WUCA 3TGJE 1VZQH 3RXMA 4VGCB 1MH0A 2EQNA 5SGAE 5FX5A 2NU1E 4M7GA 2DE9A 5IDKA 2Z9IA 3FZZA 3RXOA 1C5WB 1V2QT 2UUKB 1TALA 1V2RT 3B23B 4RSPA 1P8VC 2FP7B 5FCKA 2JJ1D 3KNXA 1KXAA 3SU5A 1RTFB 1ETTH 1B0FA 4YTAA 2BLOA 4INHA 1C5QA 1H1BA 1F7ZA 4LXBH 4MNYA 1QBNA 2KZ4A 3B9FH 2A0QB 4Y71A 4ABEA 1O3KA 4NFEA 2JJ2D 2QN5T 3SV2H 2QXHA 4TY6A 2QF3A 4X8SH 1AKSA 4MG3A 1P3CA 3SGBE 1OYQA 1CGJE 1UCYE 1YPHE 4BOHA 1GVLA 1UVSH 2SGPE 2SFAA 1TNGA 1O5CB 1WV7H 1YM0A 1HAIH 5JDUB 3F2GA 2XTTB 3MU0A 3M61U 2BLWA 1NFYA 4TWYA 2OQ5A 3OTPA 4CR9A 3RXFA 4JYUH 1EQ9A 1GMCG 1O2ZA 4M9FA 2BQ6B 1G3DA 1H4WA 3LGTA 2Z9GA 1NRPH 1GBEA 5HM2A 4X2VA 2XC4A 1NU7B 2C8ZB 1C2LA 2K0QA 2BD2A 2QIQA 5FPYA 1H9HE 2GX4A 1VGCB 2XXLA 1U6QA 1UTJA 1YYY1 1P3EA 3A8CA 4K5ZA 1TQ0B 2WV4A 2Y6TA 3RC6A 2VIVA 4CHAC 1XX9A 1EAIA 1LQEA 1FI8A 1O39A 1O2RA 2VWMA 2BVXH 3SO3A 1W12U 4WXIA 4FVBA 2XBYA 2KR7A 1F0RA 4Y6DA 1ABJH 2ZF0H 3RC5A 1BRUP 4E06H 2A31A 1YCPK 2FMJA 4YOGA 2CV3A 3TJOA 2BDCA 2WPKS 4ISIH 1LHEH 1O2GH 2OBOA 4X1PU 1GHWH 5B6OA 1C1MA 1K0HA 1NRNH 1QBVH 1O2TA 1C1NA 2P16A 2ZGBH 3ZYDA 2PGQB 2ZU3A 5J4QA 4JK6A 1ZJDA 2A4RA 4NSVA 1CE5A 1TA2A 3GDSA 5KECA 1YCPM 5T6DA 2WPMS 3SUEA 3TU7H 4AZ2B 4ABDA 2FOHA 1S82A 3SUDA 3KF2A 1DWEH 1NFUA 4RT0A 4LK4A 2F9UA 3RXAA 1BBRE 4TY7A 3U8OH 4X1SU 1GMHG 1W0KD 5L2ZH 3UOUA 2ZNKH 3ENSB 3SV9A 3HKJB 4FU7A 4Y79A 3NRLA 1MKWK 2BQWB 2JH0D 2J34A 2XBWA 3MO6A 4FOUC 4IW4E 2XNIA 1BTHH 4I7YH 3HK6B 1TAWA 2TBSA 7ESTE 5C67A 4OS6A 3PRDA 3GYMA 4UFEH 1KLIH 4TWWA 2V3HH 2PKAA 1Y3XA 2XCNA 1TA6A 1UTOA 2VIWA 3SNDA 5JYIA 2YMSB 1UTPA 1FY1A 3FZDA 4NIWA 2UUYA 4R8TB 1MTSA 1SB1H 2TIOA 1YPKH 1JRTA 1WTHD 1C5PA 1V2WT 2BD3A 3UREA 4XE4A 1XUKA 8ESTE 2ZU4A 3F1SB 4WXVA 4B74A 2AGIX 1IQIA 1T4VH 2OQUA 1LPKB 4I32A 5C3NA 2KX4A 1H8IH 1TQ7B 1ABIH 2VU8E 2ZDLA 4ZROA 2O8MA 1O3CA 4XBDA 4X0WU 4B76A 2NU3E 3PLKA 2F4LA 2G81E 5LPEA 1ZPCA 3KQDA 2PR3A 2ZPQA 5I46H 3T5FH 1P0SH 1AU8A 1UCYK 4AC9A 3MU4A 1UTQA 2A2QH 3SORA 5GNDA 4FUCA 1SFQB 2F9NA 3ZVFA 2ZKSA 4U32A 1TYNA 4ZAEA 3MMGA 3T26A 4CRGA 3LT3A 1ELGA 2VH6A 3PWBA 3LPRA 2V7QD 1FN8A 1O2NA 2XW9A 1WQVH 1TMBH 1TX6A 1UW7A 3LJOA 4CH2B 5EGMA 2IJOB 3DFJA 3MQKC 3TNTA 1SGRE 2FESH 5G4BA 1GHZA 1FY5A 3SN8A 5L2YH 1GDUA 1O5FH 1GCTC 1AGJA 1B7XB 2BQ7B 1Y3VA 1EOLA 1EZXC 4F4OC 1BT7A 3SU3A 1P04A 4BTUB 1ZSJA 2RFKC 1NBMD 2L74A 4FUJA 3GICB 3QUMP 3E3TA 2TGPZ 3FO8D 1TGSZ 1BQYA 4O3UA 3S69A 1HAZB 1DXWA 2R0KA 3ZVCA 4B6EA 1QL7A 2ZA5A 9LPRA 3LC5A 2W6ID 4HZHA 1OWEA 3QDZB 3RXSA 1EAXA 2HOBA 1VKYA 2LNCA 3ATLA 3P8NA 4AYVB 4DGJA 1AI8H 1MQ6A 4U2WA 2WUBA 3FP7E 4Y0ZE 3PYHA 5E2PA 1ZMLA 5JPMH 3LH1A 3R3GB 3FFGA 1C5YB 1LVMA 2ANYA 1FAXA 4JZEH 1C5ZB 1A0LA 1FY3A 1O2XA 2GKVE 2WPDD 3Q00A 1Z71A 2NWNA 2R0LA 3BV9B 1QJ6B 4WVPE 1AVWA 1TRYA 1Z1JA 2IPQX 2VWOA 1ELVA 5L30H 5F8XA 5CHAC 1YLCA 4K3JA 3QO6A 5GDSH 1EASA 4IGDA 6CHAB 1HXFH 3HKIB 4DVAU 3DUXH 4CBNA 2PTCE 2XRCA 4A6LA 2PUXB 2ZFSA 1K1IA 1UK4A 2VVVA 1LHFH 1EAWA 1K1JA 2XWAA 4YLUA 1WDIA 4AGJA 3IWMA 1Y3UA 2B0FA 3MNCA 3KL6A 3SHAH 2F9VA 6ESTA 3QWCH 3QX5H 1CBWC 2A5AA 4RI0A 3U69H 2OK5A 2OD3B 3LKWA 1XVMA 4THNH 5JBAS 4BXSA 1EB1H 1P2OA 4DIHH 2J97A 3BTHE 2VGCB 2ZZUH 1L4DA 3D23A 2VWNA 1PPHE 3BN9A 4TPIZ 2ZP0H 1EOJA 1YCPH 2BY9X 3OEED 1HAOH 2GZ8A 2J94A 3FKSD 2ZTYA 2OTVA 1FY8E 2FPZA 4CREA 2ESTE 2Z7FE 1BHXB 3BTKE 2Z9LA 4K8BA 2XCFA 2ZQ1A 1E37B 2BXTH 3WWFA 1VCPA 3TVJB 3MYWA 1HAVB 2QE7D 3F68H 1W2KH 5DP4A 4WY3A 1UCYH 4WMEA 2C93B 3A81A 1UO6A 5E2OA 1P01A 1KTSB 1THPB 1ZPBA 3S9CA 1J16A 1TPPA 1A5IA 1O3GA 2EI7A 1L2EA 5GIBA 4YXWD 1GJ4H 2GCHG 2Q1JA 3TIUA 1UVTH 3P17H 1A5GH 1TPSA 2GMTC 3SUFA 3EE0B 4K8YA 3M7TA 3FP8E 3SHCH 2BXUH 1XKAC 2CHAB 3OY5U 2FZZA 4H6TA 1MKWH 1G2MA 3VB6A 1M9UA 1HLTH 2Y81A 1E36B 3LIWA 3PMHB 1PPBH 4CHAB 5CHBA 1TWXB 5EXLA 1D6RA 5DGJA 5FBIA 1DLEA 2AGEX 1VGCC 1DXPA 5A8YA 3FP6E 3A87A 4HGCA 1C5RA 1Q31A 3QTVH 4I31A 3RXGA 2WPIS 3WW7A 2G8TA 1CVWH 1A3BH 3MH7A 4NA9H 4X6NA 4RKOB 4WJG2 1C1VH 1O2UA 3P95A 3RXIA 1FV9A 2BY5X 1QZ8A 4YOJA 1G2LA 1P9UA 1IQGA 2A1DB 1ELEE 4UE7H 1W14U 2AS9A 2BD5A 2FTLE 1Y3WA 1C5NH 3VGCB 5ESBA 2WZQA 3RU4T 1FMGA 2YMSD 1RXPA 2ZEBA 3A88A 1V2MT 1BJVA 1EP6A 1IQLA 3K6ZA 1BDAA 2HVYB 1TBZH 1YGCH 2AFQB 1KSNA 3EAJA 3TGIE 1BIOA 3C27B 4UEHH 1QIXB 4I8GA 3MTYA 3KYGA 3I77A 4IBLH 1K21H 3GISB 4FUDA 3A7WA 1H8DH 2KCPA 3EQ0H 2OC0A 2G5NA 2GTBA 1UTMA 3N99A 2ASUB 4BXWA 1XXDA 2FLBH 2BDAA 2KFWA 1F5KU 2OUAA 3SU4A 3VB3A 1OHHD 3BIVH 3TH3H 1ANDA 1QB1A 1GBCA 2CHAC 3RMLH 4Y0YE 1O2WA 1OPHB 1PPFE 2Y7XA 1AY6H 3GCOA 4DIIH 1MCTA 2HVXA 4Z0KA 3MU5A 1EX3A 1OSSA 3FVFB 1BBRH 1Z8GA 2CK3D 4ZH8A 4X1QU 4ISLA 4MPXA 4HTCH 1LVOA 2ZO3H 1OS8A 5C94A 4I8JA 3BSQA 1V6DA 3ELAH 1YF4A 2GZ7A 1FPHH 1TMTH 5DP7A 3GYLB 5DN6D 4NCYA 1EJNA 5FX6A 1EZQA 2QV1A 1TRNA 2VVCA 2I6QA 2AIQA 1V2TT 1PYTD 1YPLH 1V2NT 1TBRH 2QXGA 5GCHG 1GBBA 3FOAA 1G9IE 1O38A 3EDXB 4R0IA 1TB6H 5EQRA 4AG2A 3RUOA 5ESTE 2VNTA 3PO1B 1CA0B 1DLKB 1BITA 1GJCB 1GJAB 4O03A 1GBAA 1IQFA 1E1RD 3EYDA 4WF8A 2BD7A 3ATKA 2KCAA 1GHAF 1BB0B 4ZKOU 1Y3YA 4FUBA 1DUAA 4FUIA 4CRFA 3E91A 2BOKA 1SGEE 3SUGA 1Z7KA 4AB9A 2XOKD 4K2YA 4Q2KA 1PQAA 1GBFA 2QA9E 4YT6H 1GBDA 3N7DA 1Y59T 1HAHH 4A7IB 4AN7A 2Y5GA 4A1XA 1CQQA 6CHAC 2SGDE 3EA8A 4B75A 3FANA 3PROA 2UWOA 2XNDD 4D76A 3D49H 2A4QA 3MWIU 1BMMH 4BTTB 1PQ8A 5TCCA 5BRRE 3S9BA 2FTMA 3TH4H 2ZHEH 1GBKA 1ZMNA 4NIXA 3DSOA 1DANH 1QR3E 3ZZDA 2Z94A 1QRXA 1S84A 4NWKA 5HGGA 2BD4A 3SJ8A 2V6NA 2P3FH 1HJ9A 1THSH 2QXIA 1G3CA 1GBIA 5JBCS 4ZXYH 3EA7A 4CR5A 3O8RA 1D3PB 2SGEE 3I29A 2I6SA 1PPGE 3LJJA 4MPUA 3E0PB 3ITIA 4MNWA 7GCHF 1HDTH 4DOQA 1GI3A 4SGAE 3GY8A 4UONA 1O3BA 4JZIA 1FUJA 2ZCKP 1UJ1A 1UTLM 2J9NA 1Q3XA 1C2EA 2JIZD 1V2LT 3ZVDA 1GHBF 4GHQA 3M37A 3UR9A 1MZAA 3RXKA 3RXUA 1KXDA 1QTFA 5DP9A 1OWIA 2AYWA 3PB1E 1GHBG 1AVGH 1QJ7B 3E1XB 4BAMB 1F5LA 2ZHQH 1C2FA 1D3TB 3QLPH 1G3BA 2P3UB 4GUXA 3T28A 1ELAA 1AUTC 2XBXA 3SW2B 1DY9A 1BJUA 1DITH 1LPGB 3NXPA 3SQHE 2GT8A 1SOTA 4GSOA 1MBMA 5HXFA 1SQOA 2EY4C 1LHCH 4ZKRU 1MMJN 2XBVA 1K28D 1TE0A 3A83A 4X2YA 1GMDF 1Y5UT 1SGNE 2ZFRH 3V12A 3KHVA 1D3DB 4U30A 2GMTB 5C0TA 4AYYB 3E8LA 1TNKA 1SBWA 1W0ZU 2ODQA 2L6OA 2QXJA 2D1JA 4XFQA 4XD7D 3KQCA 3QZQA 1ESBA 1A0JA 1PPCE 1AE8H 2K8IA 4FUHA 3RLWH 1DDJA 1MKXK 5JBBS 2OXSA 2Z3EA 3BTEE 1C4Y2 3AAVA 1EKBB 2OCVB 1QJ1B 3V3MA 3M7UA 1NPMA 1C2DA 2ZGCA 3EE7A 1N6YA 2Z3DA 4DT7B 3RMOH 3VPKA 7KMEH 1DOJA 5LPRA 1AUJA 1D9IA 1VCWA 2FIRH 3ZVAA 3BTFE 1BTZA 1NRSH 1P09A 1V2OT 1DWDH 1V2KT 3KCGH 8LPRA 3TNSA 3MNXA 2Y5HA 1HV7A 2Z9JA 1P2QA 1IQEA 2W7SA 3OX7U 4NZLA 1C2KA 4X1NU 1O2SA 1DUEA 1DSUA 2BZAA 3WWBA 5FAHA 4FUGA 3A89A 1ANCA 1P57B 1ZYOA 1KLJH 1HAGE 3UNSA 1COWD 1P03A 3EA9A 2BLQA 1O2OA 3LGUA 4I8LA 2AGGX 3H7OA 5EW1H 3BG4C 1JMOH 1OP8A 1LDTT 1UK3A 2CF8H 3OFND 2VIQA 1KDQB 2HNTC 2ZECA 1O2JA 1GI6A 1VJAU 1WCZA 1P12E 1C5VA 2HALA 3A86A 2PKAB 4LZ4B 4GCHG 3KGPA 5L6NH 1O36A 2QGRA 3P70B 4AFUA 1CT2E 4XRNA 3M5NA 2W3IA 1RRKA 4AX9H 1RIWB 3Q3YA 3GY2A 1J8AA 1C1OA 1WTGH 5HYOA 4O9VA 1WXRA 1O30A 4KKDA 2A32A 4Q7XA 1SGFA 4NSYA 1ZRBA 4DURA 1VITG 1AFQC 3P92A 3CS7A 2KAIB 1C1TA 1HBTH 1ZMJA 3LGWA 1CHGA 2RDEA 1SQAA 2HNTE 6GCHF 1O5DH 1GL0E 3P8GA 3H5CB 4IN1A 1T8OA 5EXMA 2K1QA 4MVNA 3KEEA 4B2CA 3DA9B 3SNEA 1A61H 2THFB 4D9RA 1P2JA 3TK6A 4PROA 1ID5H 1XM1A 1O3OA 1CA8B 3V13A 1WQSA 1AQ7A 5FBEA 1E34B 3QTOH 4Q4LA 1QRZA 2PLXA 1EJAA 3P8FA 1SG8B 2Q6DA 1S81A 2J98A 6GCHG 4IMZA 1S85A 8GCHG 3DHKH 5C1YA 1O5BB 4CRAA 2TGDA 2XYAA 1HGTH 2A5KA 1EXFA 1SL3A 2GCHF 1O3LA 5KGOA 1ZLRA 3CNRA 5GCHF 1JRSA 2P93A 1BRCE 1ELTA 2VBCA 1TGBA 1QQ4A 4JK5A 3MH5A 2FI3E 3TPIZ 3QK1A 1C1RA 4ABIA 1A46H 1MD8A 1PPEE 2OC1A 1OWDA 2J98B 1N6XA 3F0OA 2BTCE 1QFKH 5IYTA 1MU8B 3GS9A 2IN2A 4SGBE 1QGFA 4X8VH 1CGHA 4WWYA 2AMQA 1ZHMA 3SQEE 3SZEA 3UUZA 1RJXB 1GDNA 4YESB 1H9LB 4AOQA 2O8TA 3GY3A 1ESAA 3MO3A 1AD8H 4X8UH 2FLRH 1MUEB 3R0FA 1INCA 1WSSH 2EI6A 2W6JD 3PTNA 3RXJA 5FL7D 1Z8IB 3VXFH 2JH5D 3A8AA 2FDAA 4ABAA 4X6MA 3BTTE 1DWBH 1YPEH 3ZZCA 5A0CA 4WMFA 5A8ZA 3E90B 3T2NA 4UDWH 5C20A 3C1KA 2D8WA 1EPTA 4F49A 3PWCA 3S7HB 2JDID 1QB6A 1O31A 2D2DA 1F0UA 3A7VA 3SU6A 4D7FA 5EJ1A 4ISNA 2ZDAH 1MABB 2F9PA 1J14A 4HG6A 1TBQH 1H9IE 1HXEH 2RA0A 3ZYEA 3TK9A 1D3QB 2BD8A 3GY7A 4D9QA 1MU6B 2FOMB 1CA0C 1ZHRA 2JETB 4ZHMU 1L0ZA 3TJUA 4B71A 2XWBI 1DS2E 2FS8A 2UWPA 2IPHA 1GBLA 3ZZ3A 1NFXA 2KM0A 2ZGHA 4ABGA 2G4TA 1SC8U 1HIAB 1VJ9U 3BTME 4FXGH 1ZSKA 1ZGVA 1HRTH 1W3CA 1GJBB 3Q3XA 2ZCHP 3BEFB 4UFFH 1A5HA 1GVZA 1GCTB 1RIWC 1TGCA 2J92A 1BHXF 1P05A 4DY7B 1T8NA 2WPHS 3LONA 1YPHC 4P00A 1LHGH 1LMWB 1O35A 5DPAA 1THRH 3RXLA 3NPSA 3W1EA 1MTVA 2IOTA 4K1TA 4B2BA 2J2UA 3LU9B 5CHAB 3S9AA 1W8BH 3BTWE 1OXGA 5H4IB 1SGIB 1BCUH 2JETC 1NN6A 3RDZA 1ZRKA 1BZXE 3A8DA 2YNBA 1F2SE 5DSFA 3E16B 3OEHD 4FVDA 2LP6A 2UWLA 2ANMH 5DO4H 3UWJH 4Y8ZA 1SKYE 3KN2A 3U9AH 2CF9H 2HPPH 4MPVA 5PTPA 1GG6C 4KELA 1FQ3A 1C4V2 3A84A 3RXBA 4BAOB 2WPLS 3MU1A 3MHWU 3OE7D 1GBMA 1SHHB 2FWWA 1DWCH 1K1MA 3BF6H 3RC4A 3TLOA 1YY3A 2FOGA 1KY9A 1AWHB 1W0JD 2B9LA 3OTJE 2J4IA 3SI3H 1J15A 1KYNA 2VVUA 3IG6B 3PMJA 2G00A 1LPZB 1TGNA 4H6SB 1HYLA 4NIYA 4E7RG 2GP9B 1GBHA 1SLUB 3A7TA 4NA8A 1ELCA 1ZZZA 1ORFA 3GDUA 1GVKB 4MNXA 3RXEA 5HM9A 2BZ6H 4F55A 4NWLA 1JOUB 2ZFTA 4CRDA 1O3AA 1AFQB 1NBME 3AW0A 1EAUA 2A7HA 2AH4X 1QBOA 4IC5A 1V2PT 1PQ7A 1XUFA 1DSTA 5DP5A 1E35B 5BPEA 2BB4A 3ATWA 5HKKD 4IN2A 3UQOA 1EPTB 4H4FA 5FHTA 1LHDH 3ZV9A 1FJSA 3M7QA 1RFNA 3VB5A 4TYDA 1QHRB 1K22H 1AWFH 3F9FA 3MH6A 4TT3D 5K7RA 2EEKA 1GI0A 5E8EH 3AVZA 3BG8A 3A82A 2BDYA 1FX0B 1QQUA 1UK2A 2ZC9H 3LH3A 4DCDA 1P11E 2Z3CA 5JB9S 1ZTJA 1C2HA 1SLXB 2V35A 5K0HA 4MDSA 1O3HA 1O3JA 3SGQE 3AASA 3LGVA 3ZZBA 2BDHA 2DUCA 3F3BA 5E0JA 1F92A 1O5GH 4O97A 3TH2H 2FI4E 1SGQE 5A0BA 3SU2A 1AZZA 2BX4A 3N7EA 1FAKH 1KXEA 1G32B 1RD3B 3SJKA 2HRVA 1YPJH 2ZWLH 1GI5A 2BMGB 3GY6A 2ZTZA 2ZFQH 4XDEA 2WYGA 3M36A 4GVUA 4KGAA 2GV6A 3A85A 5F03A 3F0PA 1MTUA 2ALVA 3SU0A 2BDGA 1S6FA 4GCHF 2TRMA 1BBRK 3P6ZB 4NZQA 1J17T 4BAQB 3B8JA 1EFRD 3F9GA 3ESTA 3GY4A 1GHXH 1S5SA 2ANWA 4ZUHA 1DM4B 3SV6A 2FYRA 4JZFH 3AK5A 1UHBB 3O8DA 5FPTA 2VWLA 2Y5FA 3H7TA 4IC6A 1NZQH 2ULLA 3E0NB 2PHBA 3VB7A 1ETRH 3GOVB 4GLYA 3UOPA 1YPMH 3S0NA 1V2UT 2KAIA 5JBTA 2WV5A 1L1GA 4D8NA 4JMYA 1HCGA 3SJIA 1FN6A 2C4FH 2ZG0H 2BY8X 1LVBA 1DICA 2HLDD
chains in the Genus database with same CATH topology
3G01A 2PKSC 4BTIB 2V0BA 3TJVA 3ZVGA 3BTDE 3BG4B 4JYVH 1GMCF 1MAYA 3Q77A 4MPWA 4I8KA 4KTCA 1WOFA 5C5NA 3W95A 2EA3A 3UY9A 3MH4A 1TNIA 2V3OH 1F5RA 2WINI 1JIRA 1BUIA 1A2CH 1ACBE 1FLEE 5EOKA 3HK3B 2BHGA 4VGCC 3BEIB 2A45B 4K60A 3TITA 1GL1A 3MNBA 3ZZ7A 2LPRA 2ODYB 4ZKNU 4XBCA 1ZTKA 2B8OH 1ETSH 5GWZA 4ABHA 2F9OA 2A7CA 1AB9C 2OC8A 2ZTXA 4U01A 3U8TH 1ZTLA 5LPFA 3UNQA 3E6PH 1PYTC 3T27A 3KIDU 1T32A 1P10A 1BMAA 1GJ5H 7GCHG 2TPIZ 4NIVA 1K1NA 5DP3A 1ZHPA 1PJPA 1MTNC 3VFEA 3GCTG 3QGNB 2BVSH 4OS4A 4MTBA 4BAHB 4I33A 2HGTH 2NU2E 3IITA 5DJ7A 1TNHA 3MO9A 1GJ6A 2ZDVH 1ARBA 1SGTA 2R2WU 1C9TA 1HFDA 1TMUH 1GI4A 4X2XA 2OP9A 1Z6JH 3JZ1B 1ZJKA 2J38A 3M5MA 2STBE 1GBTA 4NG9H 1DE7H 3TJNA 1AMHA 1HPGA 2BDIA 4ABBA 3LGIA 3U8RH 1IQKA 3ODDA 2FOEA 5FCRA 3NWUA 1O32A 3RXVA 1UMAH 2NU0E 2BDBA 5T6GA 3RU4D 1JWTA 1GWAA 4Q80A 2RA3A 1UTKA 1QA0A 1LTOA 1LQDB 5EU8A 2ZDMA 1XUJA 1TRMA 2A2XH 2STAE 1NESE 1T8LA 2BY6X 1GJ9B 3A7YA 3KQBA 3CP7A 1NRQH 4TPYA 2C8XB 1B5GH 1SFIA 1V2JT 2FO9A 2EI8A 1HUTH 5EPYA 5A09A 4XOJA 2OINA 1C5SA 2ODPA 1HAXB 3VEQB 3GCNA 1Y5BT 2C8YB 3RLYH 4OS5A 4AFSA 1FPCH 2ZI2H 4LOYH 1DY8A 4BNRA 3LOXA 4OS2A 3TK5A 3OY6U 4DG4A 3GCHB 1MBQA 3M5OA 3TGKE 4OS1A 2XC5A 1HJAC 1NU9A 3OU0A 1F0SA 1UVUH 1C1SA 1FIZA 4RKJB 4A92A 2G4UA 5C1XA 1LKBA 5EQSA 1RGQA 3I78A 2P8OC 3STIA 1RS0A 3RXTA 1QRWA 2OLGA 3SOSA 1YBWA 4X6PA 1GI1A 1V2VT 2F3CE 1ZOMA 1Z8RA 3HGNA 4HI3A 4B2AA 1EB2A 2SGQE 1A3EH 5AFZH 1YKTA 4O3TA 1C5TA 3RXQA 4CH8B 3JZ2B 4OGYA 3UTUH 1FDPA 1MQ5A 2FYQA 1HB0B 1BTUA 2GCTC 1AO5A 4Y7BA 2AMPA 3SNAA 2ZGXH 1MTNB 5TCAA 1MTWA 3RMMH 1C2GA 1C2JA 1IHTH 3ZZ4A 1TGTA 2ZFFH 4IMQA 1VITF 5F6MA 1O37A 1BTPA 4XBBA 2GGVB 2ZU1A 5DP6A 3U1JB 1AKSB 2W5EA 2ZQ2A 4Y8XA 4FUEA 3RXDA 2Y82A 1EZUC 4OGXA 3A7ZA 4B73A 1GCDA 1YLDA 3LGYA 3GY5A 2ZU2A 3M5LA 3NZIA 1P9SA 5E0HA 3PV4A 1NRRH 1RTLA 2ZPSA 1QCPA 4HFPB 1GHAG 3RXCA 5EXNA 3NCLA 1KLTA 4J2YB 1IQMA 3MU8A 3RXHA 1NY22 3ZV8A 1Y8TA 1P02A 3QZRA 1BTXA 8GCHF 2H9EH 1CT4E 4JYTA 3SU1A 5DG6A 1NTPA 3F9EA 1AB9B 4UFGH 1C5MD 4GAWA 3K6YA 2Z6BD 4YO9A 4BANB 1AE5A 1A0HB 1O3IA 2AEIH 1C1PA 2GZ9A 3V7TA 4LZ1H 1L1JA 4ISOA 3MNSA 3MOCA 4YM9A 4CRCA 3T25A 2AIPA 4ZHAA 3D65E 1GJ7B 1DFPA 3BTQE 1O2HA 5AHGH 2ZDNA 3L6PA 1RTKA 2HLCA 2QC2A 4Y8YA 3BEUA 5F8TA 2G51A 1P2KA 1O34A 2PSYA 2RDLA 1Q2WA 1K9OE 4QT8C 2BYAX 2PSXA 1NT1A 2QCYA 1ZGIA 3O8CA 3HATH 1EP5A 3UQVA 5C5OA 3RU4E 2EC9H 4Y7AA 2HNTF 2NU4E 1W13U 3RM2H 2FOFA 4MQAA 5FPSA 1W11U 2F83A 2ZHFH 1C5OH 2H6MA 1S83A 1UHBA 1P2NA 1AIXH 2BOHB 5T3HA 3HGPA 1OP2A 1JBUH 1GI7B 2R3YA 4WMDA 1O2MA 1LVYA 3DT0H 5J4SA 4UD9H 3SZNA 3SGAE 5I25A 2HWLB 1CHOG 1ZPZA 3CS0A 2BX3A 4NA7A 1XUHA 1IQNA 1TNLA 2J95A 1GGDC 7LPRA 2QF0A 2ZDKA 4KTUA 1IQHA 1EATA 3VXEH 3WY8A 1O0DH 3M3VA 3ZZ5A 1P2IA 1NC6A 2GDDA 4K1EA 2ZFPH 1SGCA 4BAKB 3MI4A 2ZPRA 1Z8JB 2ILNA 3SBKA 3F9HA 2VJ1A 4X1RU 2FS9A 1TX8A 2FXRA 1UVPA 1AN1E 1QB9A 5JB8S 2C8WB 2ZHDA 4A1VA 2CJIA 1FONA 4Y10E 1O5EH 2H5DA 3M3SA 4E05H 2SNVA 2ALPA 3M3TA 1C1QA 2DE8A 2OBQA 2G52A 2Y80A 5GJ4B 1FNIA 2QY0B 5CE1A 1GJDB 4OS7A 2ZCLP 1WYKA 4UFDH 3V0XA 5EQQA 4FUFA 1X7AC 4DW2U 1WUNH 2OC7A 1O5AB 1SSXA 2YNAA 1JXPA 1OWJA 1O2VA 5DKMA 1YC0A 3ODFA 3K2UA 1IAUA 3SJ9A 3AAUA 1T4UH 3A7XA 2R3UA 3PLBA 1BRAA 4CRBA 1N8OB 2SNWA 4H42U 1OYTH 1W7XH 1C2MA 4B1TA 5CMXH 1G30B 2AMDA 4D7GA 1MAXA 1TABE 2C90B 3STJA 1C5XB 1FY4A 2B5TB 4X2WA 1TONA 1CHOF 2VH0A 4JZDH 3UNRA 2RG3A 4MLFB 1C2IA 1FZZA 2SGFE 2BY7X 3EGKH 1BRBE 1PFXC 1DT2A 1W0YH 5GPIB 3RXRA 3PTBA 5T6FA 1HAYB 3UWIA 3U1IB 1C5LH 2VIOA 2P8OB 5E0GA 1O2LA 4X8TH 1O2PA 1V3XA 1BA8B 2BLVA 3RMNH 3ZZ8A 2G55A 4YT7H 2CN0H 1ANBA 1NS3A 3QN7A 1FIWA 1MD7A 1O3EA 1L1NA 5A2MH 2FX4A 1O3MA 5TJXA 3PM3A 1G3EA 5DK1A 1SLWB 2WPJS 4FU9A 8KME2 3ZVEA 1HNEE 1SGDE 1BTWA 1SGYE 4RN6A 1GHYH 1O3DA 1YPGH 1LO6A 1G37A 3T29A 2PWXA 1SPJA 4WH6A 1HAPH 3D62A 3F6UH 1KDQA 1ESTA 2O9QA 1BMLA 1GJ8B 2VINA 1BMNH 1K1PA 1S0RA 3GDVA 2CXVA 1OP0A 3ZZAA 1TPAE 1O33A 1Z1IA 2JKHA 2TGTA 2W26A 1S0QA 3CENA 2B7DH 1P2MA 1L4ZA 4Z6AH 2H5CA 3RP2A 4XSKU 3PMAB 3PLPA 1SQTA 3NKKA 3RXPA 2Q6FA 4DJZB 2SGAA 3ZZ9A 1XXFA 4KTSA 1K1LA 2VGCC 3PMBB 1ARCA 1J9CH 1XUIA 2R2MB 5LH8A 3LC3A 4INLA 3M35A 2UUJB 3VB4A 1ELDE 2D26C 2GT7A 4Y11E 2JH6D 1W7GH 1TOCB 2TGAA 6LPRA 2CMYA 5ETXA 3BTGE 3GCTF 1OOKB 1EJMA 3FAOA 3URCA 1UTNA 1D6WA 1O2YA 3O8BA 1JIMA 1UVOA 1CT0E 2ANKH 4AFZA 5GXPA 2H2ZA 2VIPA 1HAVA 1SOZA 2H9HA 1IOEA 1QY6A 4ABFA 3ATMA 5DP8A 1HJAB 3ZVBA 2M5TA 4GPGA 1OX1A 2ZGJA 3AW1A 1F0TA 2PUQH 1EUFA 3MFJA 4YOIA 1AZ8A 2P59A 3A8BA 3DFLA 4ASHA 5AFYH 1C1UH 2FODA 1K2I1 4GHTA 3Q3KA 1SGPE 5F8ZA 3RM0H 1O3PB 1MZDA 1O2QA 3N7OA 4A5TS 1T31A 1MKXH 3ATIA 3SJOA 1WBGB 1E0FD 1GI8B 2C3SA 4ISHH 1N8OC 1GMHF 4I8HA 2AERH 1DVAH 1SMFE 1CGIE 4JCNA 3DD2H 1A7SA 2HPQH 3ZZ6A 1C4U2 1DPOA 1W10U 1QL8A 2XC0A 2Z9KA 1EPTC 1KTTB 2O8WA 1TNJA 3K65B 2R9PA 1Z6EA 1O3NA 3VGCC 5EG4A 1HIAA 4YZUA 1TFXA 2A4OA 2PKSB 3HPTB 1ANEA 5ABWA 1A4WH 1AFEH 4WH8A 1B0EA 5EW2H 5EPNA 3T62A 2GCTB 3SV7A 4A1TA 4KP0A 2H9TH 2FOCA 1GBJA 2UUFB 3OSYA 1YP9A 4NGAH 1O3FA 1C1WH 5AF9H 2ZIQH 1S6HA 4ZHLU 2VB0A 3K9XB 4Q7ZA 4AORA 2YOLA 2FM2A 1WAYB 2GDEH 2FOAA 3Q76A 1V2ST 3LDXH 1GGDB 3NK8A 1GHVH 2Q6GA 5A8XA 5C2ZA 4ESTE 4IS5A 1VR1H 1NO9H 1AVXA 1BOQA 3UPEA 3URDA 1C9PA 1QL9A 5EODA 2W3KA 1NM6A 2Y7ZA 1VITH 1XKBC 4AGKA 1IQJA 1T7CA 2G5VA 2PFEA 4J1YA 2W7UA 1PQ5A 1PPZA 5A0AE 1C5UA 1KXFA 2PW8H 4ZXXH 1D4PB 2WYJA 3NUMA 1XMNB 9ESTA 4E7NA 3S7KB 1CSOE 1GMDG 1SGFG 2FEQH 1AHTH 1SI5H 3A80A 2PTNA 1NROH 3KQEA 4AFQA 1GG6B 2VIDA 5AVDA 4Y76A 3QGJA 2ZHWH 4Q7YA 1XUGA 1XVOA 4JZ1A 1KIGH 3GCHC 1OKXA 4K1SA 1O2IA 1G36A 1QA7A 1P06A 3PO1C 2QAAA 1ZR0A 1GI2A 1BTYA 1EZSC 2ZU5A 1T8MA 4ZKSU 3UR6A 1FXYA 2CGAA 1IHSH 1QNJA 1E38B 5LGOA 1KXCA 2A5IA 2P94A 1CU1A 4AG1A 5C1UA 1CO7E 3OYPA 1SLVB 2BD9A 2BM2A 2GVFA 3W94A 2FI5E 3U98H 1SR5C 1VCQA 3UIRA 1GPZA 1TPOA 1LKAA 2O8LA 4X6OA 4ZMAH 4INKA 2F91A 4AB8A 1QURH 3L33A 1SHYA 2A7JA 4NFFA 3L3TA 1TOMH 1HJ8A 4CBOA 2PV9B 1K1OA 1GDQA 5HMAA 2FX6A 2FOBA 2QYIA 2O8UA 1NFWA 3BIUH 1GI9B 4FU8A 3UFAA 3P8OA 1WU1A 1TIOA 5FXLA 2P3TB 1TX7A 1Y5AT 3SNCA 2GV7A 2P95A 3SI4H 1O2KA 1LCYA 2PGBB 1OWHA 1ELBA 4K69A 4YLQH 2RCEA 1KXBA 2GD4B 1N1LA 1MCVA 2H1UA 1TLDA 4ABJA 3SV8A 2F9BH 1DX5M 2BVRH 1ELFA 1A1RA 4MNVA 1SVPA 1OWKA 1ZSLA 1CBWB 2A4GA 3SNBA 2WUCA 3TGJE 1VZQH 3RXMA 4VGCB 1MH0A 5SGAE 5FX5A 2NU1E 4M7GA 2DE9A 5IDKA 2Z9IA 3FZZA 3RXOA 1C5WB 1V2QT 2UUKB 1TALA 1V2RT 3B23B 4RSPA 1P8VC 2FP7B 5FCKA 3KNXA 1KXAA 3SU5A 1RTFB 1ETTH 1B0FA 4YTAA 2BLOA 4INHA 1C5QA 1H1BA 1F7ZA 4LXBH 4MNYA 1QBNA 3B9FH 4Y71A 2A0QB 4ABEA 1O3KA 4NFEA 2QN5T 3SV2H 2QXHA 4TY6A 2QF3A 4X8SH 1AKSA 4MG3A 1P3CA 3SGBE 1OYQA 1CGJE 1UCYE 1YPHE 4BOHA 1GVLA 1UVSH 2SGPE 2SFAA 1TNGA 1O5CB 1WV7H 1YM0A 1HAIH 5JDUB 2XTTB 3MU0A 3M61U 2BLWA 1NFYA 4TWYA 2OQ5A 4CR9A 3RXFA 4JYUH 1EQ9A 1GMCG 1O2ZA 2BQ6B 1G3DA 1H4WA 3LGTA 2Z9GA 1NRPH 1GBEA 5HM2A 4X2VA 2XC4A 1NU7B 2C8ZB 1C2LA 2BD2A 2QIQA 5FPYA 1H9HE 2GX4A 1VGCB 2XXLA 1U6QA 1UTJA 1YYY1 1P3EA 3A8CA 4K5ZA 1TQ0B 2WV4A 2Y6TA 3RC6A 2VIVA 4CHAC 1XX9A 1EAIA 1LQEA 1FI8A 1O39A 1O2RA 2VWMA 2BVXH 3SO3A 1W12U 4WXIA 4FVBA 2XBYA 1F0RA 4Y6DA 1ABJH 2ZF0H 3RC5A 1BRUP 4E06H 2A31A 1YCPK 2FMJA 4YOGA 2CV3A 3TJOA 2BDCA 2WPKS 4ISIH 1LHEH 1O2GH 2OBOA 4X1PU 1GHWH 5B6OA 1C1MA 1NRNH 1QBVH 1O2TA 1C1NA 2P16A 2ZGBH 3ZYDA 2PGQB 2ZU3A 5J4QA 4JK6A 1ZJDA 2A4RA 4NSVA 1CE5A 1TA2A 3GDSA 1YCPM 5T6DA 2WPMS 3SUEA 3TU7H 4AZ2B 4ABDA 2FOHA 1S82A 3SUDA 3KF2A 1DWEH 1NFUA 4LK4A 2F9UA 3RXAA 1BBRE 4TY7A 3U8OH 4X1SU 1GMHG 5L2ZH 3UOUA 2ZNKH 3ENSB 3SV9A 3HKJB 4FU7A 4Y79A 1MKWK 2BQWB 2JH0D 2J34A 2XBWA 3MO6A 4IW4E 2XNIA 1BTHH 4I7YH 3HK6B 1TAWA 2TBSA 7ESTE 5C67A 4OS6A 4UFEH 3GYMA 1KLIH 4TWWA 2V3HH 2PKAA 1Y3XA 2XCNA 1TA6A 1UTOA 2VIWA 3SNDA 5JYIA 1UTPA 1FY1A 3FZDA 4NIWA 2UUYA 4R8TB 1MTSA 1SB1H 2TIOA 1YPKH 1JRTA 1WTHD 1C5PA 1V2WT 2BD3A 3UREA 4XE4A 1XUKA 8ESTE 2ZU4A 3F1SB 4WXVA 4B74A 2AGIX 1IQIA 1T4VH 2OQUA 1LPKB 4I32A 5C3NA 1H8IH 1TQ7B 1ABIH 2VU8E 2ZDLA 4ZROA 2O8MA 1O3CA 4XBDA 4X0WU 4B76A 2NU3E 3PLKA 2G81E 5LPEA 1ZPCA 3KQDA 2PR3A 2ZPQA