4X1RU

The crystal structure of mupain-1-12 in complex with murinised human upa at ph7.4
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A cyclic peptidic serine protease inhibitor: increasing affinity by increasing peptide flexibility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords mupain-1-12
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1rU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x1rU01
7KMEH 2QXGA 1O35A 2H5DA 4CBNA 1O3NA 4Y7AA 5J4QA 1FJSA 3S9CA 1O2WA 3ZZ6A 3B9FH 2VWNA 4AOQA 1AO5A 4CRCA 2VGCC 1EJMA 1HIAA 3SGQE 1O3CA 4A1TA 3M5NA 5LH8A 3O8DA 3UWIA 1C9TA 4ISHH 2OUAA 2ZDLA 5A8YA 3RU4T 4O3TA 4B73A 4CHAC 1ZZZA 2GT8A 4Q7XA 1E38B 3OYPA 1HAIH 2QYIA 1GVZA 5DP4A 1GI8B 2TGDA 1TA6A 3SU1A 2JH6D 3BTTE 1P8VC 1W2KH 1AKSB 1YPJH 2VIDA 5ESTE 1PPBH 2H1UA 1EATA 4DJZB 1VJ9U 1XXDA 1SL3A 3UNSA 1GHZA 3M37A 5ESBA 2AIPA 3GY3A 1QRXA 2H9TH 1K1OA 5F6MA 4MPUA 2XNIA 2PFEA 1G9IE 1K2I1 3BG4B 1PPGE 1RJXB 1FI8A 3E90B 1D3TB 2BLVA 1PPFE 1FNIA 5JYIA 2QC2A 1UHBA 1GBAA 1QNJA 3QTVH 3ZVBA 1MQ5A 3SU3A 4AFSA 3A7XA 3KF2A 4YLQH 4DT7B 1P2MA 3LJOA 3TJVA 1SLVB 2TGAA 1QJ7B 2PTNA 1N6XA 3U1JB 1RGQA 4I8KA 5EG4A 1G3CA 4H6SB 1CGHA 1LO6A 2BLQA 2ZGJA 4RN6A 1UHBB 3PMJA 3A86A 3MOCA 3LJJA 1GJ4H 1THSH 3T26A 1FZZA 1ID5H 1QR3E 3P8OA 1O2UA 3TGJE 2CN0H 3A80A 1GJ9B 4K3JA 2A7JA 3U8RH 4Y11E 1TBRH 2GMTB 1DICA 1H4WA 4CRFA 1WQSA 1CHGA 2ZGBH 1V2TT 1HJ8A 2FX6A 1BT7A 4GCHG 4ABBA 3VGCC 1V2WT 1NU9A 3JZ2B 1GMHF 2QGRA 1DITH 1GGDC 2YNBA 3E6PH 4A1VA 2D8WA 2R0KA 2Z6BD 1CA0C 3ODFA 3AASA 4XFQA 1BRAA 2A4OA 3NUMA 1SGYE 5JPMH 3A7VA 2AGEX 2JKHA 3SU6A 4DCDA 1XUHA 1ZHMA 2XBWA 4YZUA 1L2EA 1SGTA 1NRSH 3RXVA 2NU1E 4VGCB 4DVAU 2AMPA 3RU4D 1P2IA 5FX6A 3L6PA 4YO9A 1TPPA 4RKJB 2BDYA 4JK5A 1KTSB 4ISIH 1C5YB 1O5EH 4DGJA 1TX8A 3ZZBA 4DIHH 3RXMA 4ASHA 3A85A 4AG1A 4Y76A 2OD3B 5GCHG 1C2KA 2Z3CA 1GBFA 4FU7A 1BTZA 2F83A 1S82A 3VB6A 3ZZ7A 1BMAA 1GVLA 1HB0B 1Y5UT 3GY5A 2H5CA 1KTTB 2HOBA 1ABJH 1HJAC 4E06H 3URCA 1DX5M 1K9OE 1TRYA 3RU4E 1BHXB 2GKVE 2PGBB 1QQ4A 1GJBB 2FMJA 1JWTA 1F0SA 1Z6JH 3Q3YA 1CA0B 2ZFPH 3LGYA 1ZHRA 4UE7H 5PTPA 4FUJA 3TH3H 1YPMH 1EZUC 1WOFA 5DP8A 2QA9E 1J16A 5HYOA 4NSVA 1W8BH 4X8VH 3UUZA 1LQEA 1GJDB 3M5OA 1O5CB 2Y7ZA 1MU6B 3EYDA 4SGAE 1T8MA 1J15A 1GHWH 3U9AH 1SGFG 3M5MA 4QT8C 1OWKA 1BRCE 1LKBA 2R3YA 4ZAEA 4ZROA 4JZ1A 1E37B 1CGIE 2GCTB 2BD4A 3STIA 1PPEE 2BY8X 4NIWA 2VJ1A 1SOTA 2ANWA 3TLOA 1O2PA 1S6HA 1C1NA 3RMMH 4X2XA 1TNGA 4MTBA 3P8GA 2A7HA 4FUHA 2FO9A 4UONA 3BEUA 1EQ9A 1W3CA 4INLA 1BDAA 4ABDA 4YM9A 2XCNA 3SW2B 4I31A 1BBRK 1YM0A 4D9RA 1WCZA 3LH1A 1QB9A 2BDHA 4ABGA 1FONA 5I46H 2ZFRH 2ZDKA 1JIRA 4IS5A 1NU7B 1AE5A 1G30B 2W7UA 4BAHB 1B5GH 1G3DA 5A0CA 1OWJA 4AFZA 4CR5A 3W95A 5EPNA 2FOAA 4O3UA 3F68H 3VPKA 4BTUB 2G55A 1P09A 4K1TA 1HAYB 3P70B 1YPKH 3RM2H 2BMGB 1E36B 2OCVB 3RP2A 3Q77A 5DKMA 1WAYB 3F9EA 3UWJH 3A8BA 3TJNA 1UO6A 1CT0E 2PUXB 5GPIB 3SUFA 1DVAH 3RXDA 4I32A 3RMLH 1G2MA 3Q3KA 4D7FA 2SGEE 2A4GA 3CENA 4WMDA 1QIXB 2XC0A 2ZFSA 2FODA 2K1QA 4JYTA 3LGIA 4Y0YE 2PWXA 3TH2H 3I29A 1T7CA 5C1UA 5EPYA 1DY8A 5C3NA 3PWCA 2NU0E 3MO6A 2SGAA 1QB1A 1O3HA 3RDZA 2C8ZB 1JIMA 1SG8B 1ZSKA 5H4IB 2EI6A 1D6RA 1ETSH 1SGRE 4R8TB 1BIOA 1ETRH 1PPHE 7LPRA 1MTVA 1GI6A 3GDVA 3S0NA 3ZZ8A 1EZQA 1O2QA 3GCNA 3B8JA 4ABFA 1YLCA 9ESTA 3U8TH 1V2VT 1NN6A 2P16A 2WPHS 1BMLA 1B7XB 5DP6A 1VITG 2XTTB 3SBKA 1ELTA 2C93B 3BIVH 5GWZA 4O97A 4GUXA 4U32A 5JDUB 1LHGH 1V2OT 3M3TA 1YPHC 5EGMA 3O8BA 1BZXE 1AN1E 1QL7A 3QWCH 1CO7E 2ODYB 3U69H 5FAHA 2BHGA 4R0IA 1QBOA 2BQ7B 2NU3E 1S83A 3PB1E 1IQKA 5HXFA 1YF4A 3ENSB 3ZZAA 3VXEH 1C2HA 3BEFB 2UWOA 4X8SH 2FI4E 4HGCA 1FY8E 2BVSH 3GCHC 1C5MD 2FWWA 4WH6A 1SFQB 2V6NA 1MMJN 2ZDMA 3A81A 3OY6U 5LGOA 1O3PB 4NCYA 1FPCH 1GI5A 2VH6A 1TNIA 2D2DA 1P01A 5E2OA 4CREA 1YGCH 1WTGH 3A8CA 4UDWH 4BAOB 1SR5C 3GISB 2SNVA 3QLPH 1GVKB 3HGNA 1GBJA 2OBOA 3RXPA 2BX4A 3ZZ3A 4K5ZA 1O2KA 1V6DA 4D7GA 3B23B 1OP8A 1JXPA 1Y5BT 2RCEA 5L2ZH 2ZPRA 2STBE 1OOKB 3M5LA 4MG3A 3UY9A 1FY3A 3GYLB 2PKAB 2C8WB 1Y59T 4WXVA 2Z7FE 2ZU2A 1AVXA 1NPMA 2VB0A 1B0FA 1K1JA 3KNXA 1EPTC 2HVXA 3EA8A 4FUCA 1MD8A 2BDBA 2QN5T 1W7GH 2Z3DA 1O2IA 1QL8A 1G2LA 2O9QA 2XW9A 5DGJA 1EZXC 1V2QT 2ZPQA 2QV1A 2P8OC 3MWIU 3F9GA 1MKWH 1MUEB 1KLJH 5DO4H 2A2QH 1PFXC 4OS1A 1WYKA 2OXSA 1DXPA 2Q6FA 1ANBA 2HPQH 4JK6A 2A32A 4RKOB 5GIBA 2ASUB 1C5TA 2RA3A 1QBNA 4ZHAA 4IMZA 1EPTB 4IC6A 1KXCA 3LKWA 2ZA5A 1SHHB 1J9CH 1AQ7A 1MQ6A 2OC8A 4NGAH 1MKWK 1O33A 1C4V2 1BHXF 3P6ZB 2ZHWH 4TY6A 1UVUH 2CGAA 3RC5A 1KSNA 1O5GH 3SUGA 4AZ2B 1BMMH 1XMNB 2C4FH 2HNTE 3UNRA 1K1IA 1IAUA 1EPTA 2EA3A 1S81A 1A4WH 1Z8JB 1C1MA 2CV3A 3UQOA 4H6TA 1E35B 2FI5E 2P3UB 1K1MA 1C5OH 4TWYA 1UTNA 3ATIA 1CBWC 2R2WU 1IQJA 4DURA 2CF9H 1RXPA 3K9XB 1TBQH 3S9BA 2OQUA 4GLYA 1A1RA 3SQEE 1O38A 1LHDH 1QY6A 1F7ZA 1RIWB 2WYJA 3SV6A 4XBCA 3V3MA 4NWKA 4LZ4B 3MH5A 1PQ7A 1T8NA 4OS2A 1C9PA 2OC1A 1DLKB 3RXKA 4ABAA 3MU5A 1GHAF 1XM1A 2A4RA 1MTWA 2J94A 1KXDA 2CHAC 1NS3A 1MD7A 1CHOF 2ODQA 4FVDA 4NG9H 1TWXB 1YBWA 2AERH 1AKSA 1KXAA 5TJXA 1DPOA 2OP9A 1LPKB 1RS0A 3FZZA 2C90B 1C1OA 1AE8H 3D23A 1DANH 2GCHF 2SGDE 1W13U 1CVWH 5AF9H 1T31A 2D26C 1CGJE 5DP3A 2VGCB 2FEQH 2PTCE 2TBSA 2W3KA 5AFYH 5JB8S 3RXLA 1SI5H 3F9HA 3FP7E 3SU2A 1P2NA 3NK8A 2ZFQH 1A5GH 3HK3B 2P94A 1G32B 1S85A 2VIOA 1Z8RA 1GMCG 2H9HA 1MH0A 1ZPBA 2WUCA 3TJUA 1T32A 5L30H 1ESBA 2PR3A 1C5WB 1NTPA 4TY7A 1MTUA 1THPB 4IW4E 1ZMNA 1WTHD 1SGFA 1TX7A 1V3XA 2O8WA 2WINI 1C2LA 2ZTZA 1E0FD 3SNBA 1DSTA 1RTFB 1G3BA 1GMCF 1TA2A 2BZ6H 1SGIB 1C1TA 2GT7A 4X2WA 3SORA 2ZZUH 1GBHA 4THNH 4ZUHA 2NWNA 1PPCE 1OYTH 2TRMA 4UEHH 5FXLA 4ABEA 1EZSC 1Z8IB 3VB3A 1T4VH 3OTJE 4OS6A 1JOUB 3GCTF 1GI2A 2THFB 2BLWA 2TGPZ 1AD8H 1Y3XA 2Y7XA 4DOQA 3A7ZA 3UR9A 1XXFA 1EAIA 2EI7A 1V2KT 2O8UA 2ULLA 3EA9A 4JZIA 4CH2B 2GCTC 1SBWA 1CHOG 3HK6B 1BTUA 1QCPA 1OWHA 2QY0B 1C4Y2 4D76A 4HI3A 1GL0E 3RC6A 3T25A 1JBUH 1KDQA 1ANCA 4Z0KA 5E0HA 2QXHA 1C2IA 3A82A 5JBAS 1ZMJA 1XUIA 4B2AA 1WQVH 1GBEA 1GJ6A 2GMTC 2JH0D 1QA0A 3PYHA 1YP9A 2ZC9H 3PLKA 2A5AA 1W14U 2IPHA 3NZIA 1Z1IA 3CS0A 4MNWA 3U8OH 2Y80A 2HLCA 1ZPCA 1QBVH 2AYWA 3M36A 4GHTA 2BZAA 4B2CA 1SMFE 4UFFH 1DFPA 4XBBA 1TGCA 3SU5A 3SJKA 1AUJA 1ZGVA 4Y79A 1GMDG 4XSKU 1YPGH 1UTLM 1K1PA 1W0YH 1F5KU 1EP6A 2VH0A 4ZKOU 2G52A 1FIZA 5IYTA 2FLRH 3V13A 3GY4A 1Y3YA 1ZSLA 1HLTH 4D9QA 1H9HE 1O2SA 1AB9C 1RFNA 3LGWA 1CQQA 1GHYH 1GJ8B 2FS9A 2TPIZ 4FUEA 3EQ0H 1NRQH 4TWWA 2TIOA 2ILNA 4RSPA 1G3EA 2QXJA 1W11U 4X2YA 3ATWA 1O30A 1DWDH 4GSOA 1Q31A 4OS5A 1C5XB 1QGFA 1QHRB 5SGAE 3ZZ9A 1O34A 3PLBA 3FP8E 3A83A 2ANKH 4ZHLU 1C5UA 1O31A 1TFXA 2ESTE 1GBTA 3MNSA 7GCHF 3HKIB 1LDTT 1LVYA 3ITIA 1ZRBA 1F2SE 1FAKH 2H9EH 1NM6A 2V3OH 2WV5A 1NROH 1BA8B 4GPGA 1CSOE 1C1QA 3M3SA 5FBIA 1NY22 5GCHF 1HV7A 3JZ1B 4YT7H 4NZQA 1IOEA 2SNWA 4OS4A 1Z8GA 2ZDVH 1GCTC 1ZTKA 4B71A 3AAUA 1V2JT 1MCVA 4Q7YA 4ISLA 1O3DA 4NIXA 4AORA 4BXSA 3CS7A 2IN2A 1ZYOA 1C4U2 2ZCLP 4TPYA 4K1EA 2GGVB 1AZ8A 5C5OA 4Q7ZA 2KAIA 5EXLA 1N1LA 1C5SA 3TNSA 1P9SA 2FOCA 2G5VA 1QL9A 2PSXA 2GV7A 2PGQB 1O2TA 4ZKSU 4SGBE 3MNCA 2ZF0H 3D65E 3IWMA 1QQUA 3ZZ4A 5J4SA 1LVMA 2ZQ2A 4K8YA 2V3HH 2P93A 3M7QA 3P8NA 2BB4A 2W3IA 3MU0A 5FPYA 4B74A 1NO9H 1Q2WA 3ZV9A 5A8ZA 1Y3UA 3GDSA 1TPOA 1FY4A 3ZVDA 5L6NH 3MO3A 5C5NA 3PTBA 4FU8A 5EOKA 2BD8A 2BXUH 1MZDA 1MKXH 4K8BA 1KDQB 1HFDA 4E7NA 2DE8A 4CH8B 2AEIH 2WPMS 3AW1A 5A2MH 2WV4A 4MPWA 1ETTH 1NC6A 3RXSA 3SJ9A 1SHYA 4U30A 4YTAA 3TIUA 1AHTH 2OBQA 3EE0B 1UVSH 2PLXA 1JMOH 3M7UA 1CT2E 1DOJA 2ZGCA 1MAYA 2FP7B 3IITA 1LVOA 2ZU3A 5LPRA 5TCCA 1VITF 4YOGA 1C2FA 2FPZA 3A84A 3E91A 5FBEA 3BTME 1EAWA 1V2PT 2WPIS 1NFXA 1S0QA 3TU7H 1ZR0A 2ZDNA 1F0RA 4TPIZ 1P11E 3SV2H 5AVDA 2HNTC 4BANB 3KQBA 4ZKNU 1ESAA 3S9AA 1P06A 4IN1A 1GJ5H 4NIYA 4X2VA 1BTPA 2W26A 1O2GH 3SHAH 2BVRH 3A89A 1BRUP 3T2NA 6CHAB 5EXMA 5EODA 3RXJA 2ZFTA 1XUJA 3LC3A 1BBRH 4Y71A 4UD9H 1IHTH 2G51A 4Y6DA 1TE0A 1Y3VA 1SVPA 2W5EA 2AGIX 1V2MT 2P59A 2HPPH 1D3PB 1GCTB 4TYDA 3TVJB 1EJNA 1P2KA 3G01A 4KKDA 4XBDA 5JB9S 1C2DA 1O3KA 1O2HA 5EQQA 5GDSH 2BDGA 3I77A 3PWBA 1GPZA 3STJA 2F3CE 2J9NA 4XE4A 1D4PB 1HAPH 1P12E 1DY9A 1S5SA 2GZ7A 4X1SU 2EI8A 4ZHMU 1FQ3A 3RXAA 2DUCA 1IQIA 4AX9H 2R0LA 1KXEA 2FM2A 4X1NU 4Y7BA 3T62A 5DJ7A 1TMBH 1OWEA 1QJ1B 3WY8A 1SGQE 2R2MB 2FYRA 1F5RA 1T4UH 1O2XA 2F9VA 4YOIA 1QRWA 1GDQA 3I78A 3RUOA 2G8TA 1O2MA 2HRVA 3LDXH 1P05A 2P95A 2ZIQH 2F9UA 3RXGA 2UUJB 3ATMA 2ZU4A 4ABJA 1TPSA 3ATKA 4ZKRU 4JCNA 1HAVA 1LMWB 3MNBA 1IQFA 2WUBA 5TCAA 1YC0A 1P03A 2FOBA 1O3JA 1UMAH 3E1XB 3SU0A 4DW2U 3AW0A 2A0QB 2W7SA 3MNXA 1UTPA 4CR9A 4M7GA 3SNEA 1VITH 3BTHE 2J95A 4K1SA 5DP9A 1RRKA 1SGDE 1NRNH 3ZV8A 3SN8A 1AY6H 1AU8A 2EEKA 4NZLA 5C2ZA 1HCGA 2F91A 3PMAB 3KGPA 1GBLA 1TNJA 3UOPA 1MBMA 1AVWA 1O3BA 4JZFH 1ESTA 2WPJS 3A7WA 1XUKA 1EB2A 1WBGB 3BIUH 1LTOA 3GY8A 2B7DH 1SGNE 1FN6A 4BTIB 1GBDA 3URDA 1O3GA 3S69A 1D6WA 3TH4H 2CJIA 1NRPH 1XUFA 5C1XA 1FY1A 1O39A 3UFAA 1OKXA 3KCGH 1H8DH 2BVXH 4X1PU 1YPHE 3SOSA 1ZJKA 4AYYB 1C5VA 1ZOMA 2FLBH 1GGDB 3L3TA 1BCUH 3K6ZA 4DG4A 3BN9A 5LPFA 1TGBA 2Y82A 4Y10E 5BPEA 2BQWB 1WSSH 1FY5A 1DWEH 1VR1H 1KXBA 2Y5FA 3RXQA 1P2OA 2PKAA 1EOLA 3P92A 1UVPA 4ISNA 2IOTA 4U2WA 2PV9B 3K6YA 2FZZA 2GCHG 2ZHDA 4X6OA 4UFDH 1EP5A 2UUKB 2Y5HA 5A09A 4NWLA 5JBBS 4JYUH 1FXYA 4WWYA 2B0FA 1EAUA 5EU8A 1GDUA 2ZGHA 3RXTA 2FDAA 4X8TH 1E34B 3V0XA 2PKSC 1AUTC 3LU9B 2ZCHP 1GWAA 3TK6A 2GD4B 2C8XB 2ZNKH 5EQSA 1CE5A 1O3MA 1TBZH 1ZLRA 2BD3A 4UFGH 1VGCB 1A0HB 1L1NA 3UTUH 1YCPK 2GV6A 3T27A 4WY3A 4I8JA 4Q80A 1BJVA 2JETB 3SQHE 8KME2 1ARBA 1F0TA 3BG8A 4MPXA 1HGTH 4JYVH 4OGXA 3VFEA 4DIIH 2H2ZA 1ELVA 3SZNA 1AZZA 1J14A 2BD7A 2F9BH 1RTKA 3RXOA 3QK1A 5EXNA 2PHBA 4OGYA 4OS7A 3GY2A 2VIVA 1XX9A 2QAAA 4AYVB 2BDIA 3GCHB 2G00A 3DUXH 1VGCC 1HXFH 3IG6B 5A0BA 3KN2A 4NFFA 1CU1A 3U98H 1TRNA 2VU8E 5FX5A 4Z6AH 1QRZA 1AFQB 2A5IA 3NXPA 4J2YB 4AN7A 4CRAA 2RA0A 5EW2H 3SO3A 1TIOA 5GJ4B 2BX3A 3AVZA 1HXEH 1GI3A 1O3FA 1GI9B 4FXGH 4NIVA 4HZHA 4JMYA 3ZVFA 1TMUH 4IC5A 1GHBF 2V35A 2XBYA 3QUMP 3R3GB 4AFQA 3MU4A 5C67A 4F49A 3SJIA 1ELAA 1ARCA 1BRBE 1O2VA 3LGTA 3VB7A 8GCHF 1O5BB 2JETC 4BOHA 3QZQA 1VCPA 1TQ0B 4FUFA 1TNLA 4MNVA 2GP9B 1GI1A 3EAJA 1GCDA 2A4QA 1DXWA 2VWOA 1YKTA 4NA7A 4X1QU 3E3TA 3DFJA 1UK4A 1QFKH 4YT6H 2R3UA 1PQ5A 1WUNH 1P2JA 3MU1A 3SUDA 1QTFA 1N6YA 1GDNA 1UJ1A 3LGUA 4GHQA 1JRTA 2LPRA 3S7HB 3KQCA 1P9UA 3ZYEA 3KQDA 2A1DB 3FZDA 2XRCA 1GI7B 1MZAA 1PJPA 5F8TA 3T5FH 5AFZH 2DE9A 4NA9H 3V12A 3SI4H 4NSYA 1TQ7B 1ANDA 2ALVA 2ZHQH 3Q00A 4INKA 4CRDA 1YCPM 2ZEBA 1AMHA 1J8AA 1TX6A 4XDEA 2M5TA 3HGPA 1EOJA 4LXBH 2OINA 3P17H 3VGCB 1O2RA 2P8OB 4F4OC 3UPEA 4A92A 2ZU5A 5F8XA 3EGKH 1EAXA 4BAQB 1GHBG 3BEIB 2IJOB 3TPIZ 2GDDA 1OWIA 1W0ZU 1NT1A 2GZ9A 3SU4A 1UTQA 1D9IA 2PUQH 3ZVCA 1C2EA 3Q76A 1V2LT 1HRTH 1VCWA 2Y81A 1PPZA 1BBRE 4MDSA 1K1LA 1D3DB 3SV7A 1X7AC 2B9LA 2AH4X 1GMDF 2O8MA 3M7TA 2SGPE 1SLWB 1L1JA 4I33A 3F9FA 1C1PA 2J92A 1V2UT 3O8CA 1TB6H 1W12U 3UOUA 4BTTB 4MNXA 3T29A 4A1XA 2CF8H 2BOKA 1KIGH 3PROA 3QO6A 1A2CH 1TONA 1SB1H 4O03A 3A8DA 2ZKSA 4IN2A 3RC4A 1BTXA 1WU1A 3VB4A 1ZSJA 1Y3WA 4JZEH 2BQ6B 1K22H 2BY7X 4INHA 3CP7A 1C5LH 1INCA 1K1NA 1MBQA 1TAWA 1XVOA 3K65B 3RLWH 1S0RA 1GL1A 3PLPA 1TNKA 2SGFE 2ZG0H 3QZRA 3R0FA 1AI8H 1KLTA 5E8EH 1IQEA 1S84A 2OTVA 2YOLA 1BTWA 5CE1A 3GICB 4LK4A 1S6FA 3MH4A 1L4DA 1MU8B 2QF0A 5EW1H 2ZO3H 2ZPSA 5ABWA 1AVGH 4X8UH 5HM9A 3V7TA 1EJAA 2GVFA 4VGCC 6LPRA 5B6OA 3ZVGA 1UVOA 3EDXB 1GBBA 9LPRA 5T6GA 2VWMA 1C2JA 1C5RA 1C1WH 3M61U 4ZXYH 8LPRA 2VNTA 5CMXH 2ZQ1A 1O2YA 1A0LA 1GJAB 3RXCA 1RD3B 1A5HA 1UVTH 2FIRH 1LQDB 4Y8ZA 4Y8XA 5ETXA 4CHAB 3DA9B 1V2ST 1GBIA 3ATLA 1UCYE 4I8HA 1NRRH 2ZHFH 1G37A 2BD9A 2XWBI 4B1TA 4AB9A 3FAOA 2FTMA 3TGKE 1FMGA 2XC5A 3K2UA 3OX7U 1YPLH 1YYY1 2FTLE 4WH8A 1D3QB 3OSYA 6CHAC 3N7OA 1ZTJA 1TLDA 3GY7A 2BYAX 3QTOH 1IQNA 1ANEA 3ZZ5A 2ZGXH 3LOXA 8GCHG 1P57B 1TMTH 2J2UA 2R9PA 1SGPE 1BB0B 3MFJA 1C5NH 4AG2A 3D62A 1AGJA 1ABIH 1F0UA 1KXFA 3SV9A 1SGCA 1LHCH 1AFQC 1IQHA 1O5DH 2JH5D 1B0EA 3BSQA 1P0SH 3KEEA 3UREA 1H8IH 3S7KB 4KTUA 3SUEA 2CXVA 1BTYA 3MH7A 1SOZA 3VB5A 1A61H 1GHVH 1Z1JA 2Y6TA 2FYQA 1O2OA 1O5FH 1T8OA 3A7YA 3SV8A 4HTCH 2XCFA 1TGTA 5E2PA 1O3EA 1CBWB 1ELEE 2VIQA 1O3LA 1AWHB 2VVUA 3NWUA 2H6MA 2AS9A 5DPAA 1IQGA 3QX5H 2J34A 5DG6A 3W94A 1N8OB 1TPAE 3TGIE 1BITA 3FP6E 1DWCH 1NESE 2BD2A 1XKAC 2G5NA 4X0WU 4WVPE 1A7SA 2UUYA 3LONA 4I7YH 2ODPA 1FDPA 4ZMAH 5JBTA 1IHSH 3KHVA 3SJOA 1HPGA 4KTCA 1T8LA 3F1SB 2OLGA 2ZFFH 3BTQE 3DT0H 3BG4C 1BUIA 5LPEA 5HGGA 3ZZDA 1HIAB 1OS8A 1UTKA 1OYQA 3A88A 3NKKA 1HAOH 3ZVEA 2A31A 1IQLA 2BM2A 2ZCKP 2ANMH 1ZGIA 2VIWA 2QCYA 3MU8A 4BNRA 2C8YB 2FESH 5CHAB 2F9PA 3TITA 3E0PB 3DHKH 3H7OA 2P3FH 1DE7H 1J17T 1QB6A 5DK1A 1A3EH 2A7CA 4WMFA 3OU0A 4AGKA 5A0AE 2BXTH 3MTYA 1HNEE 3ELAH 3QN7A 3P8FA 1ZJDA 1PQ8A 4I8LA 2OC7A 1RTLA 4A7IB 1O32A 8ESTE 4E7RG 3RXFA 2FI3E 4YESB 2AGGX 2CMYA 3QGJA 3GY6A 3GDUA 2HNTF 3OY5U 4KP0A 1HAZB 1SLUB 1SQOA 4AGJA 4ESTE 1G36A 1ELDE 1TRMA 5G4BA 2F9OA 1AIXH 2QF3A 3M3VA 1GMHG 1GG6B 1XKBC 2ZHEH 3SJ8A 1MTNC 3SGAE 2VVCA 2CHAB 4LOYH 4XOJA 1UTOA 3TJOA 1YPEH 3PTNA 3HKJB 4GCHF 3RXEA 5DP5A 1A0JA 2VIPA 1FV9A 1Z71A 2NU4E 2SFAA 2BTCE 4Y8YA 1P3EA 1SPJA 2Z9GA 1DM4B 3BTFE 1ZPZA 3SGBE 1MKXK 1DSUA 2ZU1A 1V2RT 5HM2A 1HUTH 3E8LA 1GI0A 1HAXB 4NFEA 1UCYK 2RG3A 1HAVB 4HFPB 1WV7H 1SQAA 1BMNH 1Q3XA 1V2NT 1PYTD 1IQMA 5K0HA 1AB9B 2BLOA 1HAHH 2O8LA 1ZMLA 2BY6X 2LNCA 1O2ZA 1DWBH 2BDCA 4IBLH 2B8OH 1SFIA 2QXIA 1FAXA 1EASA 3E16B 2FOGA 5F8ZA 2VINA 3RXRA 2XYAA 1BOQA 7ESTE 1HBTH 1NFUA 2HGTH 4MVNA 4ABIA 3F6UH 2Z9LA 6GCHG 3FANA 2BDAA 1OP0A 1XUGA 3HPTB 3MH6A 3MYWA 2OC0A 3KIDU 1CT4E 5AHGH 2A45B 5T3HA 1FN8A 3SHCH 3EA7A 1GBKA 3DFLA 4K2YA 3FFGA 2XWAA 2G4TA 2C3SA 1O3AA 1THRH 4BAMB 1GG6C 1SSXA 4J1YA 1GI4A 4B76A 2Z94A 3M35A 5GXPA 1U6QA 1H9IE 2Z9KA 1Z6EA 3PM3A 3P95A 2GZ8A 2FOFA 5EQRA 1F5LA 2ZTXA 2STAE 1TOMH 2I6QA 3RXUA 1OXGA 1ZHPA 1W7XH 2FX4A 2NU2E 4D8NA 1C2MA 3C1KA 2KAIB 1P04A 1LVBA 2ALPA 5A8XA 1NFWA 7GCHG 2HALA 2Z3EA 4FVBA 2TGTA 4AB8A 3O8RA 3BV9B 5FPSA 4CBOA 2WPLS 1GBCA 4K60A 1C1UH 2O8TA 2FXRA 2ZDAH 3GYMA 1YCPH 1ACBE 1TABE 3MMGA 2A5KA 4PROA 5I25A 3L33A 1FPHH 4X1RU 4DY7B 1KY9A 1LHFH 5FCKA 1A46H 1SC8U 1GHXH 4Q2KA 3FVFB 2Q6DA 1XVMA 3NPSA 1KLIH 1HYLA 4B2BA 2OQ5A 1ELGA 1L0ZA 1H1BA 1VZQH 2F9NA 4Y0ZE 1NZQH 6GCHF 3UQVA 2XXLA 1F92A 1OPHB 3A8AA 3A87A 1C5PA 1UCYH 2EC9H 1OP2A 3UR6A 1LKAA 4MLFB 2BY5X 1W10U 2QIQA 2XC4A 1MTSA 1QURH 1ELCA 3RLYH 2AFQB 1A5IA 2UWLA 1ZRKA 2WYGA 4WXIA 2FS8A 2AIQA 1SQTA 4GAWA 2Z9JA 1O2NA 1UTJA 1TOCB 4ZH8A 1TGNA 5C1YA 1L1GA 1O5AB 3NCLA 4A6LA 1BJUA 3A7TA 3RXIA 2GDEH 1O2LA 3SNAA 3TK9A 5JBCS 2J38A 1LCYA 3TNTA 3MI4A 4FUIA 2ZI2H 1O36A 3BTDE 1GJCB 1N8OC 2BD5A 1TALA 5FCRA 3ODDA 1OSSA 3C27B 3ZZCA 2P3TB 3SNDA 4U01A 1JRSA 2I6SA 3BTGE 2D1JA 3LGVA 4BXWA 3LIWA 3RM0H 3T28A 4X6PA 2VVVA 4E05H 5FHTA 1OWDA 1H9LB 1LPZB 3KQEA 3LH3A 1C1SA 1UTMA 1VJAU 3TK5A 2ZECA 1QA7A 5DP7A 3QDZB 1LPGB 2FOHA 4I8GA 3VEQB 3GCTG 4GVUA 5K7RA 4FUGA 2HWLB 1LHEH 1DUEA 3BTWE 1OX1A 1KYNA 1O0DH 5T6FA 2SGQE 4YOJA 2G4UA 3PO1C 1Y8TA 2PKSB 3LPRA 4MPVA 3ZYDA 1TNHA 1TYNA 2AMDA 1C5QA 1K28D 2YNAA 4H4FA 4B75A 5IDKA 4KTSA 4H42U 2PSYA 2GTBA 1HJAB 3Q3XA 5HMAA 1UK3A 3RXHA 1BTHH 2Q1JA 2BY9X 4K69A 4O9VA 1NFYA 1K21H 3MO9A 1UK2A 2A2XH 4A5TS 3PMHB 2GX4A 2Y5GA 1O2JA 4LZ1H 1EUFA 3MHWU 3E0NB 1P02A 3LC5A 1P10A 1MTNB 4FUDA 1PQAA 4MNYA 3GCOA 2G81E 3UIRA 1BQYA 1DS2E 4X6NA 4UFEH 1HDTH 1EB1H 2VWLA 1AFEH 5F03A 1A3BH 1CA8B 4CRGA 4FUBA 5CHAC 4KGAA 1EKBB 3ESTA 1PYTC 3PO1B 1GHAG 1ZTLA 1AWFH 2B5TB 2ZWLH 2UUFB 1L4ZA 5FPTA 5E0JA 4X6MA 4WMEA 1O3OA 1P3CA 3UNQA 1Y5AT 2RDLA 1EX3A 2XBVA 1ELBA 3BTKE 3HATH 3DD2H 1FIWA 1TGSZ 1MCTA 3VXFH 1SGEE 5T6DA 4BAKB 2FOEA 1DLEA 4MQAA 5E0GA 2J4IA 3SI3H 1ORFA 1FLEE 2ZTYA 4NA8A 1YLDA 1O37A 3KL6A 2XBXA 3U1IB 4ABHA 4IMQA 1GJ7B 4WF8A 1VCQA 4CRBA 3RMOH 1C1RA 1HJ9A 3H7TA 2Q6GA 1EXFA 1RIWC 4FU9A 1C2GA 6ESTA 2BOHB 5BRRE 1Z7KA 3H5CB 1DUAA 1GBMA 5L2YH 2WPKS 3ZVAA 4IGDA 1FUJA 3D49H 3RXBA 4ZXXH 1SLXB 3AAVA 2UWPA 1MAXA 3LT3A 5C20A 2PW8H 4JZDH 3QGNB 2Z9IA 2ZP0H 3PV4A 1ELFA 1O3IA 2AMQA 3BTEE 3PMBB 1C1VH 1QJ6B 4KELA 3SNCA 1P2QA 3RMNH 1DT2A 4YLUA 2FOMB 1M9UA 4WJG2 1C5ZB 2ANYA 2V0BA 3BF6H 1HAGE 1DDJA 4ISOA 4AFUA 3GOVB
chains in the Genus database with same CATH superfamily
7KMEH 2QXGA 1O35A 2H5DA 4CBNA 1O3NA 4Y7AA 5J4QA 1FJSA 3S9CA 1O2WA 3ZZ6A 3B9FH 2VWNA 4AOQA 1AO5A 4CRCA 2VGCC 1EJMA 1HIAA 3SGQE 1O3CA 4A1TA 3M5NA 3PV2A 5LH8A 3O8DA 3UWIA 1C9TA 4ISHH 2OUAA 2ZDLA 5A8YA 3RU4T 4O3TA 2KCPA 4B73A 4CHAC 1ZZZA 2GT8A 4Q7XA 1E38B 3OYPA 1HAIH 2QYIA 1GVZA 5DP4A 1GI8B 2TGDA 1TA6A 3F2GA 3SU1A 2JH6D 3BTTE 1P8VC 1W2KH 1AKSB 1YPJH 2VIDA 3CNRA 5ESTE 1PPBH 2H1UA 1EATA 4DJZB 1VJ9U 1XXDA 1SL3A 4RT0A 3UNSA 1GHZA 3M37A 2KX4A 5ESBA 2AIPA 3GY3A 1QRXA 2H9TH 1K1OA 5F6MA 4MPUA 2XNIA 2PFEA 1G9IE 1K2I1 3BG4B 1PPGE 1RJXB 1FI8A 3E90B 1D3TB 2BLVA 1PPFE 1FNIA 3OEHD 5JYIA 2QC2A 1UHBA 1GBAA 1QNJA 3QTVH 3ZVBA 1MQ5A 3SU3A 4AFSA 3A7XA 3KF2A 4YLQH 4DT7B 1P2MA 3LJOA 3TJVA 1SLVB 2TGAA 1QJ7B 2PTNA 1N6XA 3U1JB 1RGQA 2JDID 4I8KA 5EG4A 1G3CA 4H6SB 1CGHA 1LO6A 2BLQA 2ZGJA 4RN6A 1UHBB 3PMJA 3A86A 3MOCA 3LJJA 1GJ4H 1THSH 3T26A 1FZZA 1ID5H 1QR3E 3P8OA 1O2UA 3TGJE 2CN0H 3A80A 1GJ9B 4K3JA 2A7JA 3U8RH 4Y11E 1TBRH 2GMTB 1DICA 1H4WA 4CRFA 1WQSA 1CHGA 2EY4C 2ZGBH 1V2TT 1HJ8A 2FX6A 1BT7A 4GCHG 4ABBA 1NBMD 5CHBA 3VGCC 1V2WT 1NU9A 3JZ2B 1GMHF 2QGRA 1DITH 1GGDC 2YNBA 3E6PH 4A1VA 2D8WA 2R0KA 2Z6BD 1CA0C 3ODFA 3AASA 4XFQA 1BRAA 2A4OA 3NUMA 1SGYE 5JPMH 3A7VA 2AGEX 2JKHA 3SU6A 1UW7A 4DCDA 1XUHA 1ZHMA 2XBWA 4YZUA 1L2EA 1SGTA 1NRSH 3RXVA 2NU1E 4VGCB 4DVAU 2AMPA 3RU4D 1P2IA 5FX6A 1WDIA 3L6PA 4YO9A 1TPPA 4RKJB 2BDYA 4JK5A 1KTSB 4ISIH 1C5YB 1O5EH 4DGJA 1TX8A 3ZZBA 4DIHH 3RXMA 4ASHA 3A85A 4AG1A 4Y76A 2OD3B 5GCHG 1C2KA 2Z3CA 1GBFA 4FU7A 1BTZA 2K0QA 2F83A 1S82A 3VB6A 3ZZ7A 1BMAA 1GVLA 1HB0B 1Y5UT 3GY5A 2H5CA 1KTTB 2HOBA 1ABJH 1HJAC 4E06H 3URCA 1DX5M 1K9OE 1TRYA 3RU4E 1BHXB 2PGBB 2GKVE 3SZEA 1QQ4A 1GJBB 2FMJA 1JWTA 1F0SA 1Z6JH 3Q3YA 1CA0B 2ZFPH 3LGYA 1ZHRA 4UE7H 5PTPA 4FUJA 3TH3H 1YPMH 1EZUC 1WOFA 5DP8A 2QA9E 1J16A 5HYOA 4NSVA 1W8BH 4X8VH 3UUZA 2KM0A 1LQEA 1GJDB 3M5OA 1O5CB 2Y7ZA 1MU6B 3EYDA 4SGAE 1T8MA 2YMSC 1J15A 1GHWH 3U9AH 1SGFG 3M5MA 4QT8C 1OWKA 1BRCE 1LKBA 2R3YA 4ZAEA 3DSPA 4ZROA 4JZ1A 1YY3A 1E37B 1CGIE 2GCTB 2BD4A 3STIA 1PPEE 2BY8X 4NIWA 1SOTA 2ANWA 2VJ1A 3TLOA 1O2PA 1S6HA 1C1NA 3RMMH 4X2XA 1TNGA 4MTBA 3P8GA 2A7HA 4FUHA 2FO9A 4UONA 3BEUA 1EQ9A 1W3CA 4INLA 5HIYA 1BDAA 4ABDA 4YM9A 2XCNA 3SW2B 4I31A 1BBRK 1YM0A 4D9RA 3GS9A 1WCZA 3LH1A 1QB9A 2BDHA 4ABGA 1FONA 5I46H 2ZFRH 2ZDKA 1JIRA 4IS5A 1NU7B 1AE5A 1G30B 2W7UA 4BAHB 1B5GH 1G3DA 5A0CA 1OWJA 4AFZA 4CR5A 3W95A 5EPNA 2FOAA 4O3UA 3F68H 3VPKA 4BTUB 2G55A 1P09A 4K1TA 1HAYB 3P70B 1YPKH 3RM2H 2BMGB 1E36B 2OCVB 3RP2A 3Q77A 5DKMA 1WAYB 5HIZA 3F9EA 3UWJH 3A8BA 3TJNA 1UO6A 4ACBA 1CT0E 1MABB 2PUXB 5GPIB 3SUFA 1DVAH 3RXDA 4I32A 3RMLH 1G2MA 3Q3KA 4D7FA 2SGEE 2A4GA 3CENA 4WMDA 1QIXB 2XC0A 2ZFSA 2FODA 2K1QA 1YWUA 4JYTA 3LGIA 4Y0YE 2PWXA 3OE7D 3TH2H 3I29A 1T7CA 5C1UA 5EPYA 1DY8A 5C3NA 3PWCA 2NU0E 3MO6A 2SGAA 1QB1A 1O3HA 3RDZA 2C8ZB 1JIMA 1SG8B 1ZSKA 5H4IB 2EI6A 1D6RA 1ETSH 1SGRE 4R8TB 1BIOA 1ETRH 1SKYE 1PPHE 7LPRA 1MTVA 1GI6A 3GDVA 3S0NA 3ZZ8A 1EZQA 1O2QA 3GCNA 3B8JA 4ABFA 1YLCA 9ESTA 3U8TH 2F43B 1V2VT 1NN6A 2P16A 2WPHS 1BMLA 1B7XB 1BMFD 5DP6A 1VITG 2XTTB 3SBKA 1ELTA 2C93B 3BIVH 5GWZA 4O97A 4GUXA 4U32A 5JDUB 1LHGH 1V2OT 3M3TA 1YPHC 5EGMA 3O8BA 1BZXE 1AN1E 1QL7A 3QWCH 1CO7E 2ODYB 3U69H 5FAHA 2BHGA 4R0IA 1QBOA 2BQ7B 2NU3E 1S83A 3PB1E 1IQKA 5HXFA 1YF4A 3ENSB 3ZZAA 3VXEH 1C2HA 3BEFB 2UWOA 4X8SH 2FI4E 4HGCA 1FY8E 2BVSH 3GCHC 1C5MD 2FWWA 4WH6A 1SFQB 2V6NA 1MMJN 2ZDMA 3A81A 3OY6U 5LGOA 1O3PB 4NCYA 1FPCH 1GI5A 2VH6A 1TNIA 2D2DA 1P01A 5E2OA 4CREA 1YGCH 1WTGH 3A8CA 4UDWH 4BAOB 1SR5C 3GISB 2SNVA 3QLPH 1GVKB 3HGNA 1GBJA 2OBOA 3RXPA 2BX4A 3ZZ3A 4K5ZA 1O2KA 1V6DA 4D7GA 3B23B 1OP8A 1JXPA 1Y5BT 2RCEA 5L2ZH 2ZPRA 2STBE 1OOKB 3M5LA 4MG3A 3UY9A 1FY3A 3GYLB 2PKAB 2C8WB 1Y59T 4WXVA 2Z7FE 2WV9A 2ZU2A 1AVXA 4P00A 5EJLA 1NPMA 2VB0A 1B0FA 5EIYA 1K1JA 3KNXA 1EPTC 2HVXA 2YMSD 3EA8A 4FUCA 1MD8A 2BDBA 2QN5T 1W7GH 2AHME 2Z3DA 1O2IA 1QL8A 1G2LA 2O9QA 2XW9A 5DGJA 1EZXC 1V2QT 2ZPQA 2QV1A 2P8OC 3MWIU 3F9GA 1MKWH 1MUEB 1KLJH 5DO4H 2A2QH 1PFXC 4OS1A 1WYKA 2OXSA 1DXPA 2Q6FA 1ANBA 2HPQH 4JK6A 2A32A 4RKOB 5GIBA 2ASUB 1C5TA 2RA3A 1QBNA 4ZHAA 2XOKD 4IMZA 1EPTB 4IC6A 1KXCA 3LKWA 2ZA5A 1SHHB 1J9CH 1AQ7A 1MQ6A 2OC8A 4NGAH 1MKWK 1O33A 1C4V2 1BHXF 3P6ZB 2ZHWH 4TY6A 1UVUH 2CGAA 3RC5A 1KSNA 1O5GH 3SUGA 4AZ2B 1BMMH 1XMNB 2HLDD 2C4FH 2HNTE 3UNRA 1K1IA 1IAUA 1EPTA 2KR7A 3FOAA 3W1EA 2EA3A 1S81A 1A4WH 1Z8JB 1C1MA 2CV3A 3UQOA 4H6TA 1E35B 2FI5E 2P3UB 1FX0B 1K1MA 1C5OH 4TWYA 1UTNA 3ATIA 1YLNA 1CBWC 2R2WU 1IQJA 4DURA 2CF9H 1RXPA 3K9XB 1TBQH 3S9BA 2OQUA 4GLYA 1A1RA 3SQEE 1O38A 1LHDH 1QY6A 1F7ZA 1RIWB 2WYJA 3SV6A 4XBCA 3V3MA 4NWKA 4LZ4B 3MH5A 1PQ7A 1T8NA 4OS2A 1H8HD 1C9PA 3F2FA 2OC1A 1DLKB 3RXKA 4ABAA 3MU5A 1GHAF 1XM1A 2A4RA 1MTWA 4RT1A 2J94A 1KXDA 2CHAC 1NS3A 1MD7A 1CHOF 2ODQA 4FVDA 4NG9H 1TWXB 1YBWA 2AERH 1AKSA 4P02A 1EFRD 1KXAA 5TJXA 1DPOA 2OP9A 1LPKB 1RS0A 3FZZA 4XD7D 2C90B 1C1OA 1AE8H 3D23A 1DANH 2GCHF 2SGDE 1W13U 1CVWH 5AF9H 1T31A 2D26C 1CGJE 5DP3A 2VGCB 2FEQH 2PTCE 2KFWA 2L74A 2TBSA 2W3KA 5AFYH 5JB8S 3RXLA 1SI5H 3F9HA 3FP7E 3SU2A 1P2NA 3NK8A 2ZFQH 2J98A 1A5GH 3HK3B 2P94A 1G32B 1S85A 2VIOA 1Z8RA 1GMCG 2H9HA 1MH0A 1ZPBA 2WUCA 3TJUA 1T32A 5L30H 2KCOA 1ESBA 2PR3A 1C5WB 1NTPA 4TY7A 1MTUA 1THPB 4IW4E 1ZMNA 5FL7D 1WTHD 1SGFA 1TX7A 1V3XA 2O8WA 2WINI 1C2LA 3N7DA 2ZTZA 1E0FD 5HKKD 3SNBA 1S6LA 1DSTA 1RTFB 1G3BA 1GMCF 1TA2A 1VKYA 2BZ6H 1SGIB 1C1TA 2GT7A 4X2WA 3SORA 2ZZUH 1GBHA 4THNH 4ZUHA 2NWNA 1PPCE 1OYTH 2TRMA 4UEHH 5FXLA 4ABEA 5C17A 1EZSC 1Z8IB 3VB3A 1T4VH 3OTJE 4OS6A 1JOUB 3GCTF 1GI2A 2THFB 2V3MA 2BLWA 2TGPZ 1AD8H 1Y3XA 2Y7XA 2RDEA 4DOQA 3A7ZA 3UR9A 1XXFA 2ULLA 1EAIA 1E1QD 1V2KT 2EI7A 2O8UA 3EA9A 4JZIA 4CH2B 2GCTC 1SBWA 1CHOG 3HK6B 1BTUA 1QCPA 1OWHA 2QY0B 1C4Y2 4D76A 4HI3A 1GL0E 3RC6A 3T25A 1JBUH 1KDQA 1ANCA 4Z0KA 5E0HA 2QXHA 3VG8A 1C2IA 3A82A 5JBAS 1ZMJA 1XUIA 4B2AA 1WQVH 1GBEA 1GJ6A 2GMTC 2JH0D 2YMSB 3PRBA 1QA0A 3PYHA 1YP9A 2ZC9H 3PLKA 2A5AA 1W14U 2IPHA 3NZIA 1Z1IA 3CS0A 4MNWA 3U8OH 2Y80A 2HLCA 1ZPCA 1QBVH 2AYWA 2JJ2D 3M36A 4GHTA 2BZAA 4B2CA 1SMFE 4UFFH 1DFPA 4XBBA 5EJZA 1TGCA 3SU5A 3SJKA 1AUJA 1ZGVA 4Y79A 1GMDG 4XSKU 1YPGH 1UTLM 1K1PA 1W0YH 1F5KU 1EP6A 2VH0A 4ZKOU 2G52A 1FIZA 5IYTA 2FLRH 3V13A 3GY4A 1Y3YA 1ZSLA 1HLTH 4D9QA 1H9HE 1O2SA 1AB9C 1RFNA 5KECA 3LGWA 1CQQA 1GHYH 1GJ8B 2FS9A 2TPIZ 4FUEA 3EQ0H 1NRQH 4TWWA 2TIOA 2ILNA 4RSPA 1G3EA 2QXJA 1W11U 4X2YA 3ATWA 1O30A 1DWDH 4GSOA 1Q31A 4OS5A 1C5XB 1QGFA 1QHRB 5SGAE 3ZZ9A 1O34A 3PLBA 3FP8E 3A83A 2ANKH 4ZHLU 1C5UA 1O31A 1TFXA 2ESTE 1GBTA 1W0JD 3MNSA 7GCHF 3HKIB 1LDTT 1LVYA 3ITIA 1ZRBA 1F2SE 1FAKH 2H9EH 1NM6A 3MQKC 2V3OH 2WV5A 1NROH 1BA8B 4GPGA 1CSOE 1C1QA 3M3SA 5FBIA 1NY22 5GCHF 1HV7A 3JZ1B 4YT7H 4NZQA 1IOEA 2SNWA 4OS4A 1Z8GA 2ZDVH 4DT4A 1GCTC 1ZTKA 4B71A 3AAUA 1V2JT 1MCVA 4Q7YA 4ISLA 1O3DA 2EQNA 4NIXA 4AORA 4BXSA 3CS7A 2IN2A 1ZYOA 1C4U2 2ZCLP 4TPYA 4K1EA 2GGVB 1AZ8A 5C5OA 4Q7ZA 2KAIA 2VBCA 5EXLA 1N1LA 3OAAD 1C5SA 3TNSA 1P9SA 2FOCA 2G5VA 1QL9A 2PSXA 2GV7A 2PGQB 1O2TA 3KYGA 3ZIAD 4ZKSU 2PP6A 4SGBE 3MNCA 2ZF0H 3D65E 3IWMA 1QQUA 3ZZ4A 5J4SA 1LVMA 2ZQ2A 4K8YA 2V3HH 2P93A 3M7QA 3P8NA 5DN6D 2BB4A 2W3IA 3MU0A 5FPYA 4B74A 1NO9H 1Q2WA 3ZV9A 5A8ZA 1Y3UA 3GDSA 1TPOA 1FY4A 2LELA 3ZVDA 5L6NH 3MO3A 5C5NA 3PTBA 5CDFE 4FU8A 5EOKA 2BD8A 2BXUH 1MZDA 1MKXH 4K8BA 1KDQB 1HFDA 4E7NA 2DE8A 4CH8B 2AEIH 2WPMS 3AW1A 5C0UA 5A2MH 2WV4A 4MPWA 1ETTH 1NC6A 3RXSA 3SJ9A 1SHYA 4U30A 4YTAA 3TIUA 1AHTH 2OBQA 3EE0B 1UVSH 3OTPA 2PLXA 1JMOH 3M7UA 1CT2E 1DOJA 2ZGCA 1MAYA 2FP7B 3IITA 5T1VA 1LVOA 2ZU3A 5LPRA 5TCCA 1VITF 4YOGA 1C2FA 2FPZA 3A84A 3E91A 5FBEA 3BTME 1EAWA 1V2PT 2WPIS 1NFXA 1S0QA 3TU7H 1ZR0A 2ZDNA 1F0RA 2QF5A 1P11E 4TPIZ 3SV2H 5AVDA 2HNTC 4BANB 3KQBA 4ZKNU 1ESAA 3S9AA 1P06A 4IN1A 1GJ5H 4NIYA 4X2VA 1BTPA 2W26A 1O2GH 4FOUC 3SHAH 2BVRH 3A89A 1BRUP 3T2NA 6CHAB 5EXMA 2HVYB 5EODA 3RXJA 2ZFTA 1XUJA 3LC3A 1BBRH 4Y71A 4UD9H 1IHTH 2G51A 4Y6DA 1TE0A 3F2HA 1Y3VA 1SVPA 2W5EA 2AGIX 5B6LA 1V2MT 2P59A 2HPPH 1D3PB 1GCTB 4TYDA 3TVJB 1EJNA 1P2KA 3G01A 4KKDA 4XBDA 5JB9S 1C2DA 1COWD 1O2HA 1O3KA 5EQQA 5GDSH 2BDGA 2KCAA 3I77A 1GPZA 3PWBA 2F3CE 3STJA 4XRNA 2J9NA 4XE4A 3NRLA 1D4PB 1HAPH 1P12E 1DY9A 1S5SA 2GZ7A 3OFND 4X1SU 2EI8A 4ZHMU 1FQ3A 3RXAA 2DUCA 1IQIA 4AX9H 2R0LA 1KXEA 2FM2A 4X1NU 4Y7BA 3T62A 5DJ7A 1TMBH 1OWEA 1QJ1B 3WY8A 1SGQE 2R2MB 4HG6A 2FYRA 1F5RA 1T4UH 1O2XA 2F9VA 4YOIA 1QRWA 1GDQA 3I78A 3RUOA 2G8TA 1O2MA 2HRVA 3LDXH 1P05A 2P95A 2ZIQH 2F9UA 3RXGA 2UUJB 3ATMA 2ZU4A 4ABJA 1TPSA 4Q63A 3ATKA 4ZKRU 4JCNA 1HAVA 1LMWB 3MNBA 1IQFA 2WUBA 4B6FA 5TCAA 1YC0A 1P03A 2FOBA 1O3JA 1UMAH 3E1XB 3SU0A 4DW2U 3AW0A 2A0QB 2W7SA 3MNXA 1UTPA 2QE7D 4CR9A 4M7GA 3SNEA 1VITH 3BTHE 2WPDD 2J95A 4K1SA 1KMHB 1RRKA 5DP9A 2J5UA 1SGDE 1NRNH 3ZV8A 3SN8A 1AY6H 1AU8A 2EEKA 4NZLA 5C2ZA 1HCGA 2F91A 3PMAB 2OK5A 3KGPA 1GBLA 1TNJA 3UOPA 1MBMA 1AVWA 1O3BA 4JZFH 1ESTA 2WPJS 3A7WA 1XUKA 1EB2A 1WBGB 3BIUH 1LTOA 3GY8A 2B7DH 1SGNE 1FN6A 4BTIB 1GBDA 3URDA 1O3GA 3S69A 1D6WA 3TH4H 2CJIA 1NRPH 1XUFA 5C1XA 1FY1A 1O39A 3UFAA 1OKXA 3KCGH 1H8DH 2BVXH 4X1PU 1YPHE 3SOSA 1ZJKA 4AYYB 1C5VA 1ZOMA 4TSFD 2FLBH 1GGDB 4I86A 3SYJA 3L3TA 1BCUH 3K6ZA 4DG4A 3BN9A 5LPFA 1TGBA 2Y82A 4Y10E 4ACAA 5BPEA 2BQWB 1WSSH 1FY5A 1DWEH 1VR1H 1KXBA 2Y5FA 3RXQA 2KCYA 1P2OA 2PKAA 1EOLA 3P92A 1UVPA 4ISNA 2IOTA 4U2WA 2PV9B 3K6YA 2FZZA 2GCHG 2ZHDA 4X6OA 4UFDH 1EP5A 2UUKB 5GNDA 2Y5HA 5A09A 4NWLA 5JBBS 3PV5A 1FXYA 4JYUH 4WWYA 2B0FA 1EAUA 5EU8A 1GDUA 2ZGHA 3RXTA 2FDAA 4X8TH 1E34B 3V0XA 2PKSC 1AUTC 3LU9B 2ZCHP 1GWAA 3TK6A 2GD4B 2C8XB 2ZNKH 2J98B 1CE5A 1O3MA 2XNDD 5EQSA 1TBZH 1ZLRA 2BD3A 4UFGH 1VGCB 1A0HB 1L1NA 3UTUH 2IPQX 1YCPK 2GV6A 3T27A 4WY3A 4I8JA 4Q80A 1BJVA 2JETB 3SQHE 8KME2 1ARBA 1F0TA 3BG8A 4MPXA 1HGTH 4JYVH 4OGXA 3VFEA 4DIIH 2H2ZA 1ELVA 3SZNA 1AZZA 1J14A 2BD7A 2F9BH 1RTKA 3RXOA 3QK1A 5EXNA 2W6ID 2PHBA 4OGYA 4OS7A 3GY2A 2VIVA 1XX9A 2QAAA 4AYVB 2BDIA 3F0OA 3GCHB 2G00A 3DUXH 1VGCC 1HXFH 3IG6B 5A0BA 3KN2A 4NFFA 1CU1A 3U98H 1TRNA 2VU8E 5FX5A 4Z6AH 1QRZA 1AFQB 2A5IA 3NXPA 4J2YB 4AN7A 4CRAA 2RA0A 5EW2H 3SO3A 1TIOA 3PRDA 5GJ4B 2BX3A 3AVZA 1HXEH 1GI3A 1O3FA 1GI9B 4FXGH 4NIVA 4HZHA 4JMYA 3ZVFA 1TMUH 4IC5A 1GHBF 2V35A 2XBYA 3QUMP 3R3GB 4AFQA 3MU4A 5C67A 4F49A 3SJIA 1ELAA 1ARCA 1BRBE 1O2VA 3LGTA 3VB7A 8GCHF 1O5BB 2JETC 1H8ED 4BOHA 3OEED 3QZQA 1VCPA 1TQ0B 4FUFA 1TNLA 4MNVA 2GP9B 1GI1A 3EAJA 1GCDA 2A4QA 1DXWA 2VWOA 1YKTA 4NA7A 4X1QU 3E3TA 3DFJA 1UK4A 1QFKH 4YT6H 2R3UA 1PQ5A 1WUNH 1P2JA 3MU1A 3SUDA 1QTFA 1N6YA 1GDNA 1UJ1A 3LGUA 4GHQA 1JRTA 2LPRA 3S7HB 3KQCA 1P9UA 3ZYEA 3KQDA 2A1DB 3FZDA 3U28C 2XRCA 1GI7B 1MZAA 1PJPA 5F8TA 3T5FH 5AFZH 2DE9A 4NA9H 3V12A 3SI4H 4NSYA 1TQ7B 1ANDA 2ALVA 2ZHQH 3Q00A 4INKA 4CRDA 1YCPM 2ZEBA 1AMHA 1J8AA 1TX6A 4XDEA 2M5TA 3HGPA 1EOJA 4LXBH 2OINA 3P17H 3VGCB 1O2RA 2P8OB 4F4OC 3UPEA 4A92A 2ZU5A 5F8XA 3EGKH 1EAXA 4BAQB 1GHBG 3BEIB 2IJOB 3TPIZ 2GDDA 1OWIA 1W0ZU 1NT1A 2GZ9A 3SU4A 1UTQA 1D9IA 2PUQH 3ZVCA 1C2EA 3Q76A 1V2LT 1HRTH 1VCWA 2Y81A 1PPZA 1BBRE 4MDSA 1K1LA 1D3DB 1W0KD 3SV7A 1X7AC 2B9LA 2AH4X 1GMDF 2O8MA 3M7TA 2SGPE 1SLWB 1L1JA 5EJ1A 4I33A 3F9FA 1C1PA 2J92A 1V2UT 4YXWD 3O8CA 1TB6H 1W12U 4OM9A 3UOUA 3N7EA 4BTTB 4MNXA 3T29A 4A1XA 2CF8H 2BOKA 1KIGH 3PROA 3QO6A 1A2CH 1TONA 1SB1H 4O03A 5F53A 3A8DA 2ZKSA 4IN2A 3RC4A 1BTXA 1WU1A 3VB4A 1ZSJA 1Y3WA 4JZEH 2BQ6B 1K22H 2BY7X 4INHA 3CP7A 1C5LH 1INCA 1K1NA 1MBQA 1TAWA 1XVOA 3K65B 3RLWH 1S0RA 1GL1A 3PLPA 1TNKA 2SGFE 2V7QD 2ZG0H 3QZRA 3R0FA 1AI8H 1KLTA 5E8EH 1IQEA 1S84A 2OTVA 2YOLA 1BTWA 5CE1A 3GICB 4LK4A 1S6FA 3MH4A 1L4DA 1MU8B 2QF0A 5EW1H 2ZO3H 2ZPSA 5ABWA 1AVGH 4X8UH 5HM9A 3V7TA 1EJAA 2GVFA 4VGCC 6LPRA 5B6OA 3ZVGA 1UVOA 3EDXB 1GBBA 9LPRA 5T6GA 2VWMA 1C2JA 1C5RA 1C1WH 3M61U 4ZXYH 8LPRA 2VNTA 5CMXH 2ZQ1A 1O2YA 1A0LA 1GJAB 3RXCA 1RD3B 1A5HA 1UVTH 2FIRH 1LQDB 4Y8ZA 4Y8XA 5ETXA 4CHAB 3DA9B 2W6JD 1V2ST 2CK3D 1GBIA 3ATLA 1UCYE 4I8HA 1NRRH 2ZHFH 1G37A 2BD9A 2XWBI 4B1TA 1E1RD 4AB9A 3FAOA 2FTMA 4F48B 3TGKE 1FMGA 2XC5A 3K2UA 3OX7U 2WZQA 1YPLH 1YYY1 2FTLE 4WH8A 1D3QB 3OSYA 6CHAC 3N7OA 1ZTJA 1TLDA 3GY7A 2BYAX 3QTOH 1IQNA 1ANEA 3ZZ5A 2ZGXH 3LOXA 8GCHG 1P57B 1TMTH 2J2UA 2R9PA 1SGPE 1BB0B 3MFJA 1C5NH 4AG2A 3D62A 1AGJA 1ABIH 1F0UA 1KXFA 3SV9A 1SGCA 1LHCH 1AFQC 1IQHA 1O5DH 2JH5D 1B0EA 3BSQA 1P0SH 3KEEA 5DSFA 3UREA 1H8IH 3S7KB 4Q4LA 4KTUA 3SUEA 2CXVA 1BTYA 3MH7A 1SOZA 3VB5A 1A61H 1GHVH 1Z1JA 2WSSD 2Y6TA 2FYQA 1O2OA 1O5FH 1T8OA 3A7YA 3FKSD 3SV8A 4HTCH 2XCFA 1TGTA 5E2PA 1O3EA 3WW7A 1CBWB 1ELEE 2VIQA 1O3LA 1AWHB 2VVUA 3NWUA 2H6MA 2AS9A 5DPAA 1IQGA 3QX5H 2J34A 5DG6A 3W94A 1N8OB 1TPAE 3TGIE 1BITA 3FP6E 1DWCH 1NESE 2BD2A 1XKAC 2G5NA 4X0WU 4WVPE 1A7SA 2UUYA 3LONA 4I7YH 2M2AA 2ODPA 1FDPA 4ZMAH 5JBTA 1IHSH 3KHVA 3SJOA 1HPGA 4KTCA 1T8LA 3F1SB 2GJGA 2OLGA 2ZFFH 3BTQE 3DT0H 3BG4C 1BUIA 5LPEA 5HGGA 3ZZDA 1HIAB 2JJ1D 1OS8A 1UTKA 1OYQA 3A88A 3NKKA 1HAOH 3ZVEA 2A31A 1IQLA 2BM2A 2K8IA 2ZCKP 2ANMH 1ZGIA 2VIWA 2QCYA 3MU8A 4BNRA 2C8YB 2FESH 3F3BA 5CHAB 2F9PA 3TITA 3E0PB 3DHKH 3H7OA 2JIZD 2P3FH 1DE7H 1J17T 1QB6A 5DK1A 1A3EH 2A7CA 4WMFA 3OU0A 4AGKA 5A0AE 2BXTH 3MTYA 1HNEE 3ELAH 3QN7A 3P8FA 1ZJDA 1PQ8A 4I8LA 2OC7A 1RTLA 4A7IB 1O32A 8ESTE 4ZCNA 4E7RG 3RXFA 2FI3E 4YESB 2AGGX 2CMYA 1OHHD 3QGJA 3GY6A 3GDUA 2HNTF 3OY5U 4KP0A 1HAZB 1SLUB 1SQOA 4AGJA 4ESTE 1G36A 1ELDE 1TRMA 5G4BA 2F9OA 1AIXH 2QF3A 3M3VA 1GMHG 1GG6B 1XKBC 2ZHEH 3SJ8A 1MTNC 3SGAE 2VVCA 3DSOA 2CHAB 4LOYH 3FO8D 4XOJA 1UTOA 3TJOA 1YPEH 3PTNA 3HKJB 4GCHF 3RXEA 5DP5A 1A0JA 1Z71A 1FV9A 2NU4E 2SFAA 2VIPA 2BTCE 4Y8YA 1P3EA 1SPJA 2Z9GA 1DM4B 3BTFE 1ZPZA 3SGBE 1MKXK 1DSUA 2ZU1A 3F0PA 1V2RT 5HM2A 1HUTH 3E8LA 1GI0A 1HAXB 4NFEA 1UCYK 3DSGA 2RG3A 1HAVB 4HFPB 4TT3D 1WV7H 1SQAA 1BMNH 1Q3XA 1V2NT 3UAIC 1PYTD 1IQMA 5K0HA 1AB9B 2BLOA 1HAHH 2O8LA 1ZMLA 2BY6X 2LNCA 1O2ZA 1DWBH 2BDCA 4IBLH 2B8OH 1SFIA 2RFKC 1K0HA 2QXIA 1FAXA 1EASA 3E16B 2FOGA 5F8ZA 2VINA 3KQ5A 3RXRA 2XYAA 1BOQA 7ESTE 1HBTH 1NFUA 2HGTH 4MVNA 4ABIA 3WWFA 3F6UH 2Z9LA 2F4LA 6GCHG 3H09A 3FANA 2BDAA 1OP0A 1XUGA 3HPTB 3MH6A 3MYWA 2LP6A 2OC0A 3KIDU 1CT4E 5AHGH 2A45B 5T3HA 1FN8A 3SHCH 3FN8A 2J97A 3EA7A 1GBKA 3DFLA 4K2YA 3FFGA 2XWAA 2G4TA 2C3SA 1O3AA 4RI0A 1THRH 4BAMB 1GG6C 1SSXA 4J1YA 1GI4A 4B76A 2Z94A 3M35A 5GXPA 1U6QA 1H9IE 2Z9KA 1Z6EA 3PM3A 3P95A 2GZ8A 2FOFA 5EQRA 1F5LA 2ZTXA 2STAE 1TOMH 2I6QA 3RXUA 1OXGA 1ZHPA 2KZ4A 1W7XH 2FX4A 2NU2E 4D8NA 1C2MA 5C94A 3C1KA 2KAIB 1P04A 1LVBA 2ALPA 5A8XA 1NFWA 7GCHG 2HALA 2Z3EA 4FVBA 2TGTA 4AB8A 3O8RA 3BV9B 5FPSA 4CBOA 2WPLS 1GBCA 4K60A 1C1UH 2O8TA 1SQRA 2FXRA 2ZDAH 3GYMA 1WXRA 1YCPH 1ACBE 1TABE 3MMGA 2A5KA 4PROA 5I25A 3L33A 1FPHH 4X1RU 4DY7B 1KY9A 1LHFH 4Z1MD 5FCKA 1A46H 5C0TA 1SC8U 1GHXH 4Q2KA 3FVFB 2Q6DA 5IK2D 1XVMA 3NPSA 1KLIH 1HYLA 4B2BA 2OQ5A 1ELGA 1L0ZA 1H1BA 1VZQH 2F9NA 4Y0ZE 1NZQH 4FETA 6GCHF 3UB0A 3UQVA 2XXLA 1F92A 1OPHB 3A8AA 3A87A 1C5PA 1UCYH 2EC9H 1OP2A 3UR6A 1LKAA 4MLFB 2BY5X 3WWBA 1W10U 2QIQA 2XC4A 1MTSA 1QURH 1ELCA 3RLYH 2AFQB 1A5IA 2UWLA 1ZRKA 2WYGA 4WXIA 2FS8A 2AIQA 1SQTA 4GAWA 2Z9JA 1O2NA 1UTJA 1TOCB 4ZH8A 1TGNA 5C1YA 1L1GA 1O5AB 3NCLA 4A6LA 1BJUA 3A7TA 3RXIA 2GDEH 1O2LA 3SNAA 3TK9A 5JBCS 2J38A 1LCYA 3TNTA 3MI4A 4FUIA 4AC9A 2ZI2H 1O36A 3BTDE 3AK5A 1GJCB 1N8OC 2BD5A 1TALA 5FCRA 3ODDA 1OSSA 3C27B 3ZZCA 2P3TB 3SNDA 4U01A 1JRSA 2I6SA 3BTGE 2D1JA 3LGVA 4BXWA 3LIWA 3RM0H 3T28A 4X6PA 2VVVA 4E05H 5FHTA 1OWDA 1H9LB 1LPZB 3KQEA 3LH3A 3KYFA 1C1SA 1UTMA 1VJAU 3N99A 3TK5A 2ZECA 1QA7A 5DP7A 3QDZB 1LPGB 2FOHA 4I8GA 3VEQB 3GCTG 4GVUA 5K7RA 4FUGA 2HWLB 1LHEH 4ASUD 1DUEA 3BTWE 1OX1A 1KYNA 1O0DH 5T6FA 2SGQE 4YOJA 2G4UA 3PO1C 1Y8TA 2PKSB 3LPRA 4MPVA 3ZYDA 1TNHA 1TYNA 2AMDA 1C5QA 1K28D 2YNAA 4H4FA 4B75A 5IDKA 4KTSA 4H42U 2PSYA 2GTBA 1HJAB 3Q3XA 5HMAA 1UK3A 3RXHA 1BTHH 2Q1JA 2QF4A 2BY9X 4K69A 4O9VA 1NFYA 1K21H 3MO9A 1UK2A 2A2XH 4A5TS 3PMHB 4M9FA 2GX4A 2Y5GA 1O2JA 4LZ1H 1EUFA 3MHWU 3E0NB 1P02A 3LC5A 1P10A 1MTNB 4FUDA 1PQAA 4MNYA 3GCOA 2G81E 3UIRA 1BQYA 1DS2E 4X6NA 3EE7A 4UFEH 1HDTH 1EB1H 2VWLA 1AFEH 5F03A 1A3BH 1CA8B 4CRGA 5KEDA 4FUBA 5CHAC 4KGAA 1EKBB 3ESTA 1PYTC 3PO1B 1GHAG 1ZTLA 1AWFH 2B5TB 2ZWLH 2UUFB 1L4ZA 5FPTA 5E0JA 4X6MA 4WMEA 2WHXA 1O3OA 1P3CA 3UNQA 1Y5AT 2RDLA 1EX3A 2XBVA 1ELBA 3BTKE 3HATH 3DD2H 1FIWA 2L6OA 1TGSZ 1MCTA 3VXFH 1SGEE 5T6DA 4BAKB 2FOEA 1DLEA 4MQAA 5E0GA 2J4IA 3SI3H 1ORFA 1FLEE 2ZTYA 4NA8A 1YLDA 1O37A 3KL6A 2XBXA 3U1IB 4ABHA 4IMQA 1GJ7B 4WF8A 1VCQA 4CRBA 3RMOH 4F55A 1C1RA 1HJ9A 3H7TA 2Q6GA 1EXFA 1RIWC 4FU9A 1C2GA 6ESTA 2BOHB 5BRRE 1Z7KA 3H5CB 1DUAA 1GBMA 5L2YH 2WPKS 3ZVAA 4IGDA 1FUJA 3D49H 3DCLA 3RXBA 4ZXXH 1QZ8A 1SLXB 3AAVA 2UWPA 1MAXA 1E79D 3LT3A 5C20A 2PW8H 4JZDH 3QGNB 4B6EA 2Z9IA 2ZP0H 3PV4A 1ELFA 1O3IA 2AMQA 3BTEE 3PMBB 1C1VH 1QJ6B 2IJD1 4KELA 3SNCA 1NBME 1P2QA 1DT2A 3RMNH 4YLUA 2FOMB 1M9UA 4WJG2 1C5ZB 2ANYA 2V0BA 3BF6H 1HAGE 1DDJA 4ISOA 4AFUA 5KGOA 3GOVB
chains in the Genus database with same CATH topology
7KMEH 2QXGA 1O35A 2H5DA 4CBNA 1O3NA 4Y7AA 5J4QA 1FJSA 3S9CA 1O2WA 3ZZ6A 3B9FH 2VWNA 4AOQA 1AO5A 4CRCA 2VGCC 1EJMA 1HIAA 3SGQE 1O3CA 4A1TA 3M5NA 5LH8A 3O8DA 3UWIA 1C9TA 4ISHH 2OUAA 2ZDLA 5A8YA 3RU4T 4O3TA 4B73A 4CHAC 1ZZZA 2GT8A 4Q7XA 1E38B 3OYPA 1HAIH 2QYIA 1GVZA 5DP4A 1GI8B 2TGDA 1TA6A 3SU1A 2JH6D 3BTTE 1P8VC 1W2KH 1AKSB 1YPJH 2VIDA 5ESTE 1PPBH 2H1UA 1EATA 4DJZB 1VJ9U 1XXDA 1SL3A 3UNSA 1GHZA 3M37A 5ESBA 2AIPA 3GY3A 1QRXA 2H9TH 1K1OA 5F6MA 4MPUA 2XNIA 2PFEA 1G9IE 1K2I1 3BG4B 1PPGE 1RJXB 1FI8A 3E90B 1D3TB 2BLVA 1PPFE 1FNIA 5JYIA 2QC2A 1UHBA 1GBAA 1QNJA 3QTVH 3ZVBA 1MQ5A 3SU3A 4AFSA 3A7XA 3KF2A 4YLQH 4DT7B 1P2MA 3LJOA 3TJVA 1SLVB 2TGAA 1QJ7B 2PTNA 1N6XA 3U1JB 1RGQA 4I8KA 5EG4A 1G3CA 4H6SB 1CGHA 1LO6A 2BLQA 2ZGJA 4RN6A 1UHBB 3PMJA 3A86A 3MOCA 3LJJA 1GJ4H 1THSH 3T26A 1FZZA 1ID5H 1QR3E 3P8OA 1O2UA 3TGJE 2CN0H 3A80A 1GJ9B 4K3JA 2A7JA 3U8RH 4Y11E 1TBRH 2GMTB 1DICA 1H4WA 4CRFA 1WQSA 1CHGA 2ZGBH 1V2TT 1HJ8A 2FX6A 1BT7A 4GCHG 4ABBA 3VGCC 1V2WT 1NU9A 3JZ2B 1GMHF 2QGRA 1DITH 1GGDC 2YNBA 3E6PH 4A1VA 2D8WA 2R0KA 2Z6BD 1CA0C 3ODFA 3AASA 4XFQA 1BRAA 2A4OA 3NUMA 1SGYE 5JPMH 3A7VA 2AGEX 2JKHA 3SU6A 4DCDA 1XUHA 1ZHMA 2XBWA 4YZUA 1L2EA 1SGTA 1NRSH 3RXVA 2NU1E 4VGCB 4DVAU 2AMPA 3RU4D 1P2IA 5FX6A 3L6PA 4YO9A 1TPPA 4RKJB 2BDYA 4JK5A 1KTSB 4ISIH 1C5YB 1O5EH 4DGJA 1TX8A 3ZZBA 4DIHH 3RXMA 4ASHA 3A85A 4AG1A 4Y76A 2OD3B 5GCHG 1C2KA 2Z3CA 1GBFA 4FU7A 1BTZA 2F83A 1S82A 3VB6A 3ZZ7A 1BMAA 1GVLA 1HB0B 1Y5UT 3GY5A 2H5CA 1KTTB 2HOBA 1ABJH 1HJAC 4E06H 3URCA 1DX5M 1K9OE 1TRYA 3RU4E 1BHXB 2GKVE 2PGBB 1QQ4A 1GJBB 2FMJA 1JWTA 1F0SA 1Z6JH 3Q3YA 1CA0B 2ZFPH 3LGYA 1ZHRA 4UE7H 5PTPA 4FUJA 3TH3H 1YPMH 1EZUC 1WOFA 5DP8A 2QA9E 1J16A 5HYOA 4NSVA 1W8BH 4X8VH 3UUZA 1LQEA 1GJDB 3M5OA 1O5CB 2Y7ZA 1MU6B 3EYDA 4SGAE 1T8MA 1J15A 1GHWH 3U9AH 1SGFG 3M5MA 4QT8C 1OWKA 1BRCE 1LKBA 2R3YA 4ZAEA 4ZROA 4JZ1A 1E37B 1CGIE 2GCTB 2BD4A 3STIA 1PPEE 2BY8X 4NIWA 2VJ1A 1SOTA 2ANWA 3TLOA 1O2PA 1S6HA 1C1NA 3RMMH 4X2XA 1TNGA 4MTBA 3P8GA 2A7HA 4FUHA 2FO9A 4UONA 3BEUA 1EQ9A 1W3CA 4INLA 1BDAA 4ABDA 4YM9A 2XCNA 3SW2B 4I31A 1BBRK 1YM0A 4D9RA 1WCZA 3LH1A 1QB9A 2BDHA 4ABGA 1FONA 5I46H 2ZFRH 2ZDKA 1JIRA 4IS5A 1NU7B 1AE5A 1G30B 2W7UA 4BAHB 1B5GH 1G3DA 5A0CA 1OWJA 4AFZA 4CR5A 3W95A 5EPNA 2FOAA 4O3UA 3F68H 3VPKA 4BTUB 2G55A 1P09A 4K1TA 1HAYB 3P70B 1YPKH 3RM2H 2BMGB 1E36B 2OCVB 3RP2A 3Q77A 5DKMA 1WAYB 3F9EA 3UWJH 3A8BA 3TJNA 1UO6A 1CT0E 2PUXB 5GPIB 3SUFA 1DVAH 3RXDA 4I32A 3RMLH 1G2MA 3Q3KA 4D7FA 2SGEE 2A4GA 3CENA 4WMDA 1QIXB 2XC0A 2ZFSA 2FODA 2K1QA 4JYTA 3LGIA 4Y0YE 2PWXA 3TH2H 3I29A 1T7CA 5C1UA 5EPYA 1DY8A 5C3NA 3PWCA 2NU0E 3MO6A 2SGAA 1QB1A 1O3HA 3RDZA 2C8ZB 1JIMA 1SG8B 1ZSKA 5H4IB 2EI6A 1D6RA 1ETSH 1SGRE 4R8TB 1BIOA 1ETRH 1PPHE 7LPRA 1MTVA 1GI6A 3GDVA 3S0NA 3ZZ8A 1EZQA 1O2QA 3GCNA 3B8JA 4ABFA 1YLCA 9ESTA 3U8TH 1V2VT 1NN6A 2P16A 2WPHS 1BMLA 1B7XB 5DP6A 1VITG 2XTTB 3SBKA 1ELTA 2C93B 3BIVH 5GWZA 4O97A 4GUXA 4U32A 5JDUB 1LHGH 1V2OT 3M3TA 1YPHC 5EGMA 3O8BA 1BZXE 1AN1E 1QL7A 3QWCH 1CO7E 2ODYB 3U69H 5FAHA 2BHGA 4R0IA 1QBOA 2BQ7B 2NU3E 1S83A 3PB1E 1IQKA 5HXFA 1YF4A 3ENSB 3ZZAA 3VXEH 1C2HA 3BEFB 2UWOA 4X8SH 2FI4E 4HGCA 1FY8E 2BVSH 3GCHC 1C5MD 2FWWA 4WH6A 1SFQB 2V6NA 1MMJN 2ZDMA 3A81A 3OY6U 5LGOA 1O3PB 4NCYA 1FPCH 1GI5A 2VH6A 1TNIA 2D2DA 1P01A 5E2OA 4CREA 1YGCH 1WTGH 3A8CA 4UDWH 4BAOB 1SR5C 3GISB 2SNVA 3QLPH 1GVKB 3HGNA 1GBJA 2OBOA 3RXPA 2BX4A 3ZZ3A 4K5ZA 1O2KA 1V6DA 4D7GA 3B23B 1OP8A 1JXPA 1Y5BT 2RCEA 5L2ZH 2ZPRA 2STBE 1OOKB 3M5LA 4MG3A 3UY9A 1FY3A 3GYLB 2PKAB 2C8WB 1Y59T 4WXVA 2Z7FE 2ZU2A 1AVXA 1NPMA 2VB0A 1B0FA 1K1JA 3KNXA 1EPTC 2HVXA 3EA8A 4FUCA 1MD8A 2BDBA 2QN5T 1W7GH 2Z3DA 1O2IA 1QL8A 1G2LA 2O9QA 2XW9A 5DGJA 1EZXC 1V2QT 2ZPQA 2QV1A 2P8OC 3MWIU 3F9GA 1MKWH 1MUEB 1KLJH 5DO4H 2A2QH 1PFXC 4OS1A 1WYKA 2OXSA 1DXPA 2Q6FA 1ANBA 2HPQH 4JK6A 2A32A 4RKOB 5GIBA 2ASUB 1C5TA 2RA3A 1QBNA 4ZHAA 4IMZA 1EPTB 4IC6A 1KXCA 3LKWA 2ZA5A 1SHHB 1J9CH 1AQ7A 1MQ6A 2OC8A 4NGAH 1MKWK 1O33A 1C4V2 1BHXF 3P6ZB 2ZHWH 4TY6A 1UVUH 2CGAA 3RC5A 1KSNA 1O5GH 3SUGA 4AZ2B 1BMMH 1XMNB 2C4FH 2HNTE 3UNRA 1K1IA 1IAUA 1EPTA 2EA3A 1S81A 1A4WH 1Z8JB 1C1MA 2CV3A 3UQOA 4H6TA 1E35B 2FI5E 2P3UB 1K1MA 1C5OH 4TWYA 1UTNA 3ATIA 1CBWC 2R2WU 1IQJA 4DURA 2CF9H 1RXPA 3K9XB 1TBQH 3S9BA 2OQUA 4GLYA 1A1RA 3SQEE 1O38A 1LHDH 1QY6A 1F7ZA 1RIWB 2WYJA 3SV6A 4XBCA 3V3MA 4NWKA 4LZ4B 3MH5A 1PQ7A 1T8NA 4OS2A 1C9PA 2OC1A 1DLKB 3RXKA 4ABAA 3MU5A 1GHAF 1XM1A 2A4RA 1MTWA 2J94A 1KXDA 2CHAC 1NS3A 1MD7A 1CHOF 2ODQA 4FVDA 4NG9H 1TWXB 1YBWA 2AERH 1AKSA 1KXAA 5TJXA 1DPOA 2OP9A 1LPKB 1RS0A 3FZZA 2C90B 1C1OA 1AE8H 3D23A 1DANH 2GCHF 2SGDE 1W13U 1CVWH 5AF9H 1T31A 2D26C 1CGJE 5DP3A 2VGCB 2FEQH 2PTCE 2TBSA 2W3KA 5AFYH 5JB8S 3RXLA 1SI5H 3F9HA 3FP7E 3SU2A 1P2NA 3NK8A 2ZFQH 1A5GH 3HK3B 2P94A 1G32B 1S85A 2VIOA 1Z8RA 1GMCG 2H9HA 1MH0A 1ZPBA 2WUCA 3TJUA 1T32A 5L30H 1ESBA 2PR3A 1C5WB 1NTPA 4TY7A 1MTUA 1THPB 4IW4E 1ZMNA 1WTHD 1SGFA 1TX7A 1V3XA 2O8WA 2WINI 1C2LA 2ZTZA 1E0FD 3SNBA 1DSTA 1RTFB 1G3BA 1GMCF 1TA2A 2BZ6H 1SGIB 1C1TA 2GT7A 4X2WA 3SORA 2ZZUH 1GBHA 4THNH 4ZUHA 2NWNA 1PPCE 1OYTH 2TRMA 4UEHH 5FXLA 4ABEA 1EZSC 1Z8IB 3VB3A 1T4VH 3OTJE 4OS6A 1JOUB 3GCTF 1GI2A 2THFB 2BLWA 2TGPZ 1AD8H 1Y3XA 2Y7XA 4DOQA 3A7ZA 3UR9A 1XXFA 1EAIA 2EI7A 1V2KT 2O8UA 2ULLA 3EA9A 4JZIA 4CH2B 2GCTC 1SBWA 1CHOG 3HK6B 1BTUA 1QCPA 1OWHA 2QY0B 1C4Y2 4D76A 4HI3A 1GL0E 3RC6A 3T25A 1JBUH 1KDQA 1ANCA 4Z0KA 5E0HA 2QXHA 1C2IA 3A82A 5JBAS 1ZMJA 1XUIA 4B2AA 1WQVH 1GBEA 1GJ6A 2GMTC 2JH0D 1QA0A 3PYHA 1YP9A 2ZC9H 3PLKA 2A5AA 1W14U 2IPHA 3NZIA 1Z1IA 3CS0A 4MNWA 3U8OH 2Y80A 2HLCA 1ZPCA 1QBVH 2AYWA 3M36A 4GHTA 2BZAA 4B2CA 1SMFE 4UFFH 1DFPA 4XBBA 1TGCA 3SU5A 3SJKA 1AUJA 1ZGVA 4Y79A 1GMDG 4XSKU 1YPGH 1UTLM 1K1PA 1W0YH 1F5KU 1EP6A 2VH0A 4ZKOU 2G52A 1FIZA 5IYTA 2FLRH 3V13A 3GY4A 1Y3YA 1ZSLA 1HLTH 4D9QA 1H9HE 1O2SA 1AB9C 1RFNA 3LGWA 1CQQA 1GHYH 1GJ8B 2FS9A 2TPIZ 4FUEA 3EQ0H 1NRQH 4TWWA 2TIOA 2ILNA 4RSPA 1G3EA 2QXJA 1W11U 4X2YA 3ATWA 1O30A 1DWDH 4GSOA 1Q31A 4OS5A 1C5XB 1QGFA 1QHRB 5SGAE 3ZZ9A 1O34A 3PLBA 3FP8E 3A83A 2ANKH 4ZHLU 1C5UA 1O31A 1TFXA 2ESTE 1GBTA 3MNSA 7GCHF 3HKIB 1LDTT 1LVYA 3ITIA 1ZRBA 1F2SE 1FAKH 2H9EH 1NM6A 2V3OH 2WV5A 1NROH 1BA8B 4GPGA 1CSOE 1C1QA 3M3SA 5FBIA 1NY22 5GCHF 1HV7A 3JZ1B 4YT7H 4NZQA 1IOEA 2SNWA 4OS4A 1Z8GA 2ZDVH 1GCTC 1ZTKA 4B71A 3AAUA 1V2JT 1MCVA 4Q7YA 4ISLA 1O3DA 4NIXA 4AORA 4BXSA 3CS7A 2IN2A 1ZYOA 1C4U2 2ZCLP 4TPYA 4K1EA 2GGVB 1AZ8A 5C5OA 4Q7ZA 2KAIA 5EXLA 1N1LA 1C5SA 3TNSA 1P9SA 2FOCA 2G5VA 1QL9A 2PSXA 2GV7A 2PGQB 1O2TA 4ZKSU 4SGBE 3MNCA 2ZF0H 3D65E 3IWMA 1QQUA 3ZZ4A 5J4SA 1LVMA 2ZQ2A 4K8YA 2V3HH 2P93A 3M7QA 3P8NA 2BB4A 2W3IA 3MU0A 5FPYA 4B74A 1NO9H 1Q2WA 3ZV9A 5A8ZA 1Y3UA 3GDSA 1TPOA 1FY4A 3ZVDA 5L6NH 3MO3A 5C5NA 3PTBA 4FU8A 5EOKA 2BD8A 2BXUH 1MZDA 1MKXH 4K8BA 1KDQB 1HFDA 4E7NA 2DE8A 4CH8B 2AEIH 2WPMS 3AW1A 5A2MH 2WV4A 4MPWA 1ETTH 1NC6A 3RXSA 3SJ9A 1SHYA 4U30A 4YTAA 3TIUA 1AHTH 2OBQA 3EE0B 1UVSH 2PLXA 1JMOH 3M7UA 1CT2E 1DOJA 2ZGCA 1MAYA 2FP7B 3IITA 1LVOA 2ZU3A 5LPRA 5TCCA 1VITF 4YOGA 1C2FA 2FPZA 3A84A 3E91A 5FBEA 3BTME 1EAWA 1V2PT 2WPIS 1NFXA 1S0QA 3TU7H 1ZR0A 2ZDNA 1F0RA 4TPIZ 1P11E 3SV2H 5AVDA 2HNTC 4BANB 3KQBA 4ZKNU 1ESAA 3S9AA 1P06A 4IN1A 1GJ5H 4NIYA 4X2VA 1BTPA 2W26A 1O2GH 3SHAH 2BVRH 3A89A 1BRUP 3T2NA 6CHAB 5EXMA 5EODA 3RXJA 2ZFTA 1XUJA 3LC3A 1BBRH 4Y71A 4UD9H 1IHTH 2G51A 4Y6DA 1TE0A 1Y3VA 1SVPA 2W5EA 2AGIX 1V2MT 2P59A 2HPPH 1D3PB 1GCTB 4TYDA 3TVJB 1EJNA 1P2KA 3G01A 4KKDA 4XBDA 5JB9S 1C2DA 1O3KA 1O2HA 5EQQA 5GDSH 2BDGA 3I77A 3PWBA 1GPZA 3STJA 2F3CE 2J9NA 4XE4A 1D4PB 1HAPH 1P12E 1DY9A 1S5SA 2GZ7A 4X1SU 2EI8A 4ZHMU 1FQ3A 3RXAA 2DUCA 1IQIA 4AX9H 2R0LA 1KXEA 2FM2A 4X1NU 4Y7BA 3T62A 5DJ7A 1TMBH 1OWEA 1QJ1B 3WY8A 1SGQE 2R2MB 2FYRA 1F5RA 1T4UH 1O2XA 2F9VA 4YOIA 1QRWA 1GDQA 3I78A 3RUOA 2G8TA 1O2MA 2HRVA 3LDXH 1P05A 2P95A 2ZIQH 2F9UA 3RXGA 2UUJB 3ATMA 2ZU4A 4ABJA 1TPSA 3ATKA 4ZKRU 4JCNA 1HAVA 1LMWB 3MNBA 1IQFA 2WUBA 5TCAA 1YC0A 1P03A 2FOBA 1O3JA