4X20B

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
428
structure length
428
Chain Sequence
b'EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 140
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x20B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x20B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x20B01
1SA0B 1FFXB 4X1KB 4B45A 4X1YA 1RLUA 4X20B 1RQ2A 1OFUA 5MN4A 3HKDA 5EYPB 5LA6A 5FNVA 3JARB 3JATB 3RYIA 5C8YA 3HKEB 4O4IA 3C8LA 4ZHQB 3UT5B 3VOAA 3HKCA 3JASA 3WGKA 5J2TB 1RQ7A 3HKBB 5CA0A 2VXYA 1SA0A 1FFXA 4I55B 3ZBQA 5MN6A 4X1IB 3RYCA 5EYPA 4DXDA 3HKDB 5IJ0A 3JARA 5LA6B 4I50A 4ZOLA 5JH7B 3HKEA 3RYIB 5C8YB 3VOBA 4O4IB 5IJ9A 4O2AB 3UT5A 4TV8A 3HKCB 3JASB 4I55A 2RHHA 4FFBA 4LNUB 4DRXA 5EIBD 4ZI7A 3E22A 5ITZA 5LP6C 1TUBA 4X1IA 2GVIA 2XKAA 3RYCB 4U3JA 5JH7A 5LOVA 5IJ0B 2Q1XA 2RHJA 4I50B 4ZOLB 5M7EA 5JVDA 5JCOC 3VO8A 4O2AA 4IIJA 1Z5WA 3CB2A 5IJ9B 4TV8B 3WGMA 3N2KB 3R4VA 5MN5A 1W5EA 4LNUA 4FFBB 4DRXB 4WBNA 4EI8A 4ZI7B 3E22B 5ITZB 1JFFA 1TUBB 5LXTA 1W5BA 4U3JB 5LOVB 2VAMA 4U39A 4O4LA 5J2UA 5JVDB 5BMVB 4O2BA 3RYFA 3N2GA 5EIBC 4IIJB 5KMGA 4HNAA 2RHLA 3N2KA 4YJ3A 3WGNA 4YJ2B 1TVKA 1Z5VA 2Q1YA 4F6RA 3M89A 4WBNB 1JFFB 5EZYB 5LXTB 5LYJA 2BTQA 3JAKA 3JAWA 3RYHA 4O4LB 5BMVA 4O2BB 5GONA 3RYFB 3N2GB 2RHOA 4I4TB 5KMGB 4HNAB 5IYZA 4YJ3B 4IHJA 4EB6B 5JQGB 4YJ2A 1W5AA 1TVKB 1W581 4F6RB 4E6EA 4EI7A 2R751 3JALA 5LP6A 5EZYA 3RB8A 4KWEA 5LYJB 1W59A 2XKBA 2BTQB 3JAKB 3JAWB 3RYHB 4XCQA 5CB4A 5JCOA 4TUYA 3M8KA 5GONB 4O4JB 4I4TA 4TV9A 2VAWA 5IYZB 4EB6A 5JQGA 4IHJB 1FSZA 3ZIDA 3JALB 4O4HB 5CA1A 5KX5A 5LP6B 3VO9A 4B46A 4M8IA 2VAPA 5J2UB 4X1KA 5CB4B 3WGJA 3ZBPA 4TUYB 4O4JA 2R6R1 3WGLA 4EI9A 4X20A 4TV9B 4X1YB 3VPAA 3JATA 5FNVB 4O4HA 5CA1B 5KX5B 4ZHQA 2BTOA 5J2TA 1W5FA 3HKBA 5CA0B 3V3TA
chains in the Genus database with same CATH superfamily
1FMLA 4CI9A 3CMCO 3ROKA 3IMGA 2CUZA 1U3LA 3ZLJA 1K8ZB 3BMCB 4EW2A 5IJ0A 4JCOA 2DW4A 5B1SA 3EOAI 3I01M 1KRWA 1RYHA 1I9CA 4JJEA 3VM6A 1F0PA 4ENRA 2C8LA 4QBTA 1PHRA 4WOJA 2CNWD 5JASA 3VPSA 4FC7A 1VRCA 3GZNB 3CF4G 4A82A 2FJ0A 4WKPA 1ADJA 1Z2EA 5J9FA 2VN8A 1YR3A 3H3FA 2IA5A 4B6EA 3UAWA 2ZJ5A 3RYHA 3JQRA 1CZHA 4YDRA 3ZHBA 1UFKA 4E6EA 2OCCB 2G7ZA 5F73A 3BXXA 1TAHA 1CPYA 4KFCA 1PJBA 1XDBA 1WMAA 1NVVR 3EXFB 1C7IA 1XZNA 4AJEA 4O4IF 2FRVA 4HC4A 3ZE0B 4OD0A 1GXSB 5AUOB 5HUJA 2GXSA 3BSFA 3W9YA 2I2DA 1XMSA 3RS9A 1A27A 3UT5B 2QAGA 4R1UA 3EHEA 4OU4A 2EL9A 3UXYA 1QH0A 1YBMA 4XH9B 1I5YA 3Q4HB 3JAMN 4GKAA 4M6WA 2WP8J 1VL6A 2UZIR 4QGHA 3PK0A 2Z1UA 1NU1H 3UIEA 2C3MA 3ROGA 2E82A 3AQ4A 1JIVA 3NWPA 3JVEA 2ZCEA 3WXBA 3QHAA 4F5YA 1Z4IA 2H4JA 1KJYA 1CS0B 1RM1B 5EY5B 1V7ZA 2ZB7A 3M6XA 4G1EB 3RUDA 3ONFA 3EHBB 2V6IA 3V4PB 1GOTA 4LYHA 3RLFA 2BGWA 5GV8A 2VEOA 2G9QA 5C7YA 2FSHA 1FYEA 1PZEA 5BP7A 2JJ2G 3F6SA 1V9LA 2JIZD 1V7QA 4D46A 2QTAA 2P0YA 3WGTA 2IOFK 3ROMA 4FFOA 3KUKA 5COAA 2VAVA 1KYOF 3B6MA 4F72A 2RB4A 3PUWA 4C4TA 2YJ5A 1Z39A 2RKOA 4GPD1 4YECA 4EJSB 5AQEA 3V4RA 3GUYA 1ZGAA 3DO8A 4R16A 2E1PA 3SG0A 2TMYA 3FYEB 1SCKA 2V7QA 3FUTA 2R48A 3MT7A 4WN9A 1LPAB 2BEKA 4GZRB 4ENVA 5BVHB 2HO5A 1ZNQO 2HS3A 5JXJA 1RYYA 1ZRHA 1Y80A 4TQUS 1UF9A 2WPDA 1NVXQ 3DMNA 2MQEA 2ZRKA 3G9XA 3SR3A 4M99A 1ITZA 3C1OA 4AKEA 2UUAB 2XW6A 2O7RA 1Q6IA 5HIJA 1LF5A 4TTVA 3WS7A 3C1AA 1PNKA 4OREX 4MRSA 1IXMA 2XKBA 4MS3A 1PEYA 1JG6A 4C0KA 4EG5A 3F49S 1E79A 1Z5ZA 3BD7A 1GEGA 2GAFA 3UV3A 3DULA 2ZKLA 3HJTA 1Z62A 1OW3B 4BMPB 1F48A 1NJ5A 3CUUA 1JH9A 1OIXA 1QE5A 2C7BA 2OTMA 4FZRA 3T7IA 1G21A 5BYBA 3GCXA 1IYZA 3Q7QA 3A3NA 3RYCA 3UATA 4QSHA 1BMFD 4LDAA 5NULA 3TQTA 4ZYZA 2R2GA 5HBGA 4X9XA 1H2LA 2OEPA 9LDBA 2YIAA 3NGMA 1CIVA 3FYDA 4NS4A 3KPWA 4LHXA 4U0KA 2Q4BA 2W5UA 4F9EA 2PMPA 4BKRA 2CXXA 4TL9A 4IDHA 4WFGA 2NO7A 3QO7A 1JF8A 2DWOA 1EUQA 2FGKA 1PZFA 3L6DA 2G9IA 4FNOA 4HPJB 1V8BA 2MR6A 4YO7A 2ESRA 2DRIA 4EP1A 3WVNA 3T5PA 1IN7A 3D5TA 4M1OA 3QOXA 4KJZA 1JYFA 1U2GA 5D7BA 2C9OA 4RZQA 2V8BA 1EM6A 2J3IA 3Q7RA 1VHWA 4YALA 5JQWA 2AZXA 2J6CA 2V6MA 4FE4A 2XUPA 4IIYA 2QI2A 1HSOA 1Q44A 4YFVA 1DE0A 1Z45A 5KNDD 2ILMA 2C2AA 2GILA 5K2MA 3CRCA 4LRXA 1QYDA 3IVAA 1JDJA 4MQUA 1E5VA 4EJ2A 5K1XA 3DJYA 1VMGA 3FKJA 2RQ6A 5CPFA 3VSCA 2VHJA 4TPKA 4EHBA 1RSZA 4RPCA 2OV1A 3X44A 2J0QA 2ZD9A 2PZLA 3JVUA 2X15A 2H9AA 5FTMA 3DXRA 1KMHA 2V6BA 4DEYA 1DU4A 3O8DA 2QSUA 3HAXD 4MKXA 4BVJA 2DFDA 1D8AA 1J33A 1E1LA 2V0CA 3BWBA 1OBOA 4YV1A 3NX4A 5AWFC 1J1UA 1T1JA 3I8XA 2IZZA 5BN3B 4YEDA 4EI7A 1TJNA 4IOMA 1K33A 2QRQA 3PWSA 2QRLA 4CZ2A 2FY8A 4QYMA 5A9RA 1EUDA 4XEUA 5BQ3A 5JJ5A 4O4HA 3AKYA 2Z09A 5CIYA 3RSQA 4BIIA 1YKSA 4AJ9A 1BQZA 1R6DA 1TW2A 3VKUA 3QTCA 5ECYA 3SOPA 4ETIA 1ZKDA 4OB8A 3U40A 4REQA 4P33A 1QIJA 1OI3A 1KIFA 1NVKA 4FFNA 5J2TB 5F2VO 1EG7A 2VJBA 1NKSA 1BKDR 2ZBVA 3G2NA 4LGMA 1PL8A 3R66A 3C14C 3ZY4A 1NZ6A 4UEOA 3U7HB 4UMVA 2Q07A 2WIAA 4LXUA 3PRHA 1GZVA 1MB9A 5FTWA 1VBNA 3O7MA 4E5DA 4YBRA 3QNWA 2ORYA 5CRIA 5TJHA 3ZVLA 1VKOA 2I4MA 2CAZC 4PAMA 3Q8WA 4LE2A 4V0OA 2YS6A 1O2DA 4C6RA 3ITNA 3E9QA 5PNTA 1RKBA 1C7JA 1N2GA 4HN4B 4LDNA 2UUAO 4NICA 1W73A 1Y63A 4JN6B 4QDZA 1UANA 3B77A 1Z37A 5FPRA 1FLVA 3LQKA 4MCHA 1KDTA 3NHPA 3BTUA 4DS3A 2I29A 3F4BA 4ZEVA 4L8VA 1CE8A 1WZ2A 1NYLA 4KK3A 5HSGA 5DKFA 2ECQA 4URYR 1OZFA 3FBTA 1W1WA 2GJAA 2IHVA 4WXPA 1UZMA 3FXAA 4QU8A 2WICA 2AOTB 2RHRA 4Q9AA 3A1DA 1JXQA 3UYKA 3AB7A 1K7CA 2FR1A 4ZIBA 4CMIB 3G2IA 4NDNE 4OHOA 2C9ZA 2WUVA 2SHKA 1FF9A 3AF2A 1N7JA 3BJZA 4V1CI 3NALA 4D80A 3IUBA 5C34B 4DSTA 2EIJC 1MT0A 2YC0A 1ZGGA 2JNBA 2E4XA 3Q0TA 1UWKA 1K4YA 4DR7O 1KE2A 5JRJA 1Q19A 4ZC1A 5CU7A 4ZVRA 4JR2A 2DUNA 1CEYA 2X9QA 2QN3A 4AJHA 1KZ7B 1O3YA 3CYQA 2P2CA 3DW3X 5JAMA 2ZR8A 1QCYA 4ZT7A 2NNLD 4K6CA 3NCTA 4IEEA 1GNRA 1RC1A 2C0CA 3UXEA 1S1MA 3P2MA 4V2UA 4URXR 3GGSA 4DABA 3R0QA 3N9IA 2XZOA 2D3OW 2ZB8A 4R1LA 1XZPA 3BWEA 3JWIA 2VQ3A 3DE7X 4PQGA 2JASA 1Q21A 2VT7A 3KYCA 3K1AA 1JFVA 3A6JA 4Y7CA 3V8EA 4R40B 1RRPA 1NKVA 3K2EA 2D3WA 4P93A 1Q0HA 1BX1A 3EOZA 4WDRA 1O0BA 3H5WA 3OZWA 4Y6RA 4PSDA 3WA7A 4EGCB 1JI3A 2VDOB 3PJRA 4H1TA 2V65A 4RJLA 1EBFA 1Q6UA 2I6TA 3ZBHA 4WLOA 1VLJA 4X93A 4DK1A 2Q73A 3IMKA 2DSNA 2ZVQX 1PT9A 2UUCB 5BT9A 2FFRA 2HT6A 1NBMD 5T4BA 4DWOA 2SCUB 4ZK7A 2VRNA 3TNJA 2CLEB 1WSAA 2FEWB 4WACA 5JNSA 4N65A 1UBEA 1X8JA 5EE5B 1FNCA 3QELB 4JVMA 4PONA 4DANA 4MGIR 3RHTA 3WDMA 2YMPA 1ZNZA 2YY5A 3PX2A 1YJ8A 2HSDA 3E6AA 1Z2OX 2HQSC 4LFBB 2QG6A 1XF1A 1H0KA 3WA6A 2BEVB 1U1EA 4RGBA 1NI8A 4X64B 4RMGA 4ZK6A 2UXXA 3RU2A 5CB4F 1IY9A 3ZHQA 1XJCA 4WBXC 4I4IA 4L08A 4Q9LA 3EZLA 4HMQA 2FJPA 4YDHB 5HFAA 2BGIA 3I28A 1X86B 4G84A 1XTBA 3O8QA 3P7MA 3BGOS 2H7XA 2G9ZA 3R4CA 3H1FA 1KO1A 2ON6A 3J7TA 4RK7A 1AK1A 2GKSA 3U2QA 2P68A 4XDZA 5KHJA 1HMPA 1RIFA 5CA3A 3VBCA 3GH1A 3W6ZA 4X3PA 3EXG2 3K1JA 3JYPA 1EGVB 1XMVA 2PUAA 3N2LA 4ZYVA 1M6EX 4EZEA 4D3FA 4O4IB 4ME6A 3FGZA 2Q7EA 2XAFA 1FNDA 2GPNA 4FHDA 1UOPA 4JLNA 2QJFA 5JQGF 3RBZA 3AR6A 3OE5A 2XMQA 1PD1A 1BDIA 4DCSA 2F3QA 2OO5A 2V5AA 4MS4B 4QUDA 3LUPA 3GVHA 3EJ6A 1YS7A 1HFEL 2RH4A 1A77A 5IT0A 1RFYA 3KBBA 4FLYA 1WDWB 3IKVA 4HLDA 2FWIA 3X2SA 2HF2A 3SJCC 2IP4A 5BNWA 1N32O 3OJEA 3VU9B 3QNUA 3R5KA 2BFEB 4MWEA 4XVCA 1D8TA 2IU4A 4ZJZA 4YHHB 3DMYA 4JFAA 5FV7A 4DREA 2YJTD 4B7ZA 3EIWA 1B8VA 2YYEA 1AX9A 2FSSA 1CRZA 3TXAA 1PP4A 4CKCA 2CJFA 1IUKA 1BOFA 1A2BA 2PZJA 3GD7A 2P91A 3B7GA 3LO8A 3VKHA 2QSAA 1FNNA 1XOIA 1EX6A 2AXNA 2QE7D 2UYGA 3Q7TA 4MWCA 1JPNA 1W9MA 1B0PA 2GX6A 2XUOA 4MI9A 2WJIA 2AN3A 1G9SA 1ADBA 5IPFA 3DE4X 1V5FA 5AKGA 2NZYA 2X3YA 4F5WA 1COWA 2LVBA 3T4DA 1V9SA 3GROA 3VKGA 3OECA 4PZ0A 4DQXA 3UF0A 4BRUA 3IODA 4KVFA 5EESA 3T2MA 5LLTA 4DJFC 2YV1A 3EGVA 2ZIOA 3HM9A 1C5KA 2GJSA 3Q8LA 1MJGA 1U8EA 2I7DA 4DSZA 4BCDA 5JHGB 2CXTA 3D8TA 3PE3A 4D8XA 2V5VA 1W0KG 3SYOA 5DH9A 1Z4QA 2W00A 3A2LA 3KQOA 2UUCO 1AZLA 4A23A 2WAXA 4MHOA 4MQ6A 1CB7A 1WCXA 3ODGA 2YMMA 2A57A 3DHWC 3L7JA 1N5DA 1Z73A 1I4DD 4YRQA 4FGUA 4KIUA 3CEHA 4MW2A 2JLZA 4A6DA 3SQLA 1E2MA 5FPYA 1UI9A 3MIZA 1CUIA 3RC7A 1VA4A 2BZ1A 3RUEA 1V26A 2FPMA 4X64O 2F00A 2H2WA 1I6KA 3I53A 1HETA 4EKYA 1EB9A 4E21A 4AKGA 5GVSA 2GJ4A 2R7MA 1G6Q1 3HXLA 5C35A 1N2XA 3NYWA 4D82A 4WY2A 3MOIA 5JFOA 5C53B 4EHKA 2Q2WA 1EP2B 4PC7A 4M8SA 5CFOA 2A5LA 4EOGA 3NBYC 2XIQA 5K6AC 3FFWA 1E6CA 3CURA 4IXDA 1Q91A 4BP9A 4YASA 2WMOB 1FD9A 1MEEA 3L7KA 4YJ2F 1Q20A 1X38A 1U8FO 3KL2A 1J0AA 2XUAA 3RVZA 5KNCA 4KQGA 2HQRA 1U7HA 4HBGA 2HMAA 4NFSA 1JDVA 2CLOB 2W2LA 4JI1O 3LQYA 1JDUA 3THOA 1EZ4A 2H1CA 2LTAA 5KINB 4MIEA 5FWYA 2OTLV 1E7KA 5K99A 2P78A 3QWBA 4KH1A 1C1XB 4Q6GA 1TO6A 1ESZA 3JQ8A 5KTNA 1OD6A 3O4GA 4Z7NB 4NE7A 2XE6A 4DMCA 1ZD8A 1QB8A 1KBHA 2WZDA 2Q8QA 2RGNC 3FIJA 3UMYA 3TQCA 2QJWA 4MB6A 4CKBB 3WZMA 1XQ9A 2FB5A 2O05A 1L1RA 2AX4A 3EQ7A 4OFBA 1O95C 3ZTWA 3W8FA 4DR2B 3H5LA 5JDCC 5JU6A 1KQSF 3D0QA 5AKZA 4K6OA 5BQXA 2H4ZA 3ZRVA 1OQAA 5BURA 5K7SA 4GQAA 4JELA 2BCCH 3D8SA 3R0VA 5JD5A 1JBEA 4MLCA 2VRCA 4LS3A 3B6NA 2VG8A 1KKCA 1DT9A 1VHTA 3IUEA 5JD6A 3MAJA 4C2TA 2X1HA 3R5HA 1K9MH 2JDIA 3QO5A 4MR7B 5J2UF 2VP2A 4HRXA 4F91B 2KI5A 4IYRA 5T6MA 4UHBA 4NE9A 4M1WA 5KDLA 4FBGA 3MCZA 1H8HD 4TOIA 5BNTA 3HR0A 3FM9A 3EWIA 2R1VB 1Y6RA 1SXHA 4IT5A 1RHJA 2IP1A 4W5NA 5G1OA 5JLJA 3LMKA 3QM1A 3G6BA 3DVSX 2JH9A 1U2DA 3LK6A 2MSDB 3JZAA 3SXPA 3X1KA 4Y0NA 4DSOA 1LDEA 1W0KA 1LFAA 1CZNA 3COPA 1XXHA 1S3FA 3C6YA 5CBFA 1I6LA 3BC1A 2JKYA 5DHTA 1NM5A 3QTBA 2B5VA 4CF4A 3RRMA 3DMTA 2XAJA 4CEIB 1DFHA 1O8BA 4MI6A 1F3OA 1KBOA 1NVGA 2XTAA 3G71V 4HS4A 5FUXA 3ZKWB 2UYKA 3MHHC 3T7RA 2Q28A 5EKDA 3RYTC 2EW2A 2NYUA 3UTCA 4FMTA 1IOZA 4R2HA 4ZXPA 2OIEA 1XRMA 4NFYA 5C7LO 3PSAA 4B3MB 2ERXA 2P06A 2PSFA 1FYDA 1Y67A 3AIMA 2O14A 1R9MA 5EG5A 2WU8A 3MD9A 1YZVA 3BTSA 3F5FA 5KHGA 2I99A 4AXBA 2K5UA 2XNDD 1YONA 2AMYA 2DY0A 3F73A 3VISA 2MU1A 1XZGA 3LF1A 4MV8A 4H60A 1DOZA 2Y4OA 1AVTA 1R8XA 1OA0A 1WZEA 1E5TA 1Y5IA 3KQMA 2HP0A 2OM6A 1MO6A 3L43A 1Y3CE 1P7VA 1KY4A 2OUKA 3L3BA 2TYSB 5B58C 1X4TA 3QXHA 4URFA 3TLAA 2PO5A 5JYEA 2FEKA 2YHAA 2W0SA 2H1VA 3K30A 3BK1A 4LZOA 3B3QA 1E6LA 1L5LA 4MEAA 4QUHA 3I5MA 2OTLF 4Q4JA 4AULA 4J3FA 1PR9A 3E48A 221PA 1IHYA 5FT9A 3WLJA 4HWTA 1QCZA 3H9CA 4V0KA 2N9UA 4BJ6A 4C2AA 4FYMA 3CPWU 4RPJA 3AK2A 4G6ZA 4JBWA 3MWYW 4G8BA 1ZD3A 1R3KC 1YE8A 5HY2A 1JAHA 2F43B 2YRWA 4QGPA 2WINI 4WXMA 3THYA 3FZQA 3TRHA 5EWJA 4Q20A 3FOZA 3HCPA 3HZOA 3F90A 4R3WA 3LYUA 4XCVA 5JNUA 4UM5A 4G5FA 1DUIA 4Q01A 3IL2A 4GPIB 4F8JA 3TD9A 3L1UA 3SPJA 3QFSA 3ANNA 4N48A 1I8TA 4HQFA 3P0HA 4E2ZA 3WNCA 3BCSA 2B2XA 4HSGA 4CDMA 4IGGA 1S7CA 2ZIGA 1K9MW 4EENA 5BWOA 3OMXA 2AL7A 1V2GA 1Q17A 2IODA 5LBIA 2ZTSA 4QJFB 1GWNA 5FNVF 4E94A 4AJJA 4WCEV 3AR3A 2ZJAA 2P2NA 5B12A 3W4IA 3R7LA 4OHUA 3BS4A 3A4MA 3AGKA 3S2FA 1WCIA 1VE6A 3GRAA 5CB4B 1PZHA 1GZHB 1TUGA 4C4OA 1M2HA 1U4OA 3K1ZA 3SYKA 1SXPA 1URPA 2NAPA 3GZJA 3WBJA 4B0PA 3SS7X 4RTSA 4AJ4A 3LPCA 1KZ6A 2CUKA 1V4NA 1KWKA 2VNSA 5AMXA 1A0OA 1H2YA 4RJKA 1Y76B 3G71F 3ZCTA 4CZZA 3FMOB 3RT9A 3ICEA 4IINA 4S0XA 3UO3A 3W2TA 3HVUA 1WBBA 1JVSA 4WTOA 3KD2A 2X5JO 1TUBB 4BZZA 3HCAA 1QK5A 4RHAA 4LGCA 3QOYA 5IY5C 1G7RA 4LZPA 1GAXA 4OX9Y 2WLLB 3WJPA 1O94A 1W85A 4ESHA 1QE3A 4AZVA 5JQGB 2QPLA 2E85A 4ZO8A 5FI1B 2EG9A 1GILA 4NENB 1GRNA 5EUMA 3G7UA 4Y6OA 3BWDD 4PBTA 4DARA 2Z1FA 1UBUS 4BMOB 4WNIA 4O6VA 3NK7A 3H2HA 2NTEA 4DCUA 2A7QA 4FFWA 1JWAB 1QH1A 4L73A 4EYSA 3W9UA 3LDHA 2V0GA 1XE3A 3PLAC 4ALLA 4G23A 5BSVA 1WV0A 3OBBA 2IH1C 3LX8A 3QWHA 1IWPB 4I3GA 3WY9A 2VJPA 4GMGA 5J59A 3HLKA 3TUJC 1X59A 3BDVA 2H17A 4TMWA 1J0XO 3RRJA 4DRXA 1XZMA 4DV6B 4IGAA 4QYSA 1KB9F 4RM2A 4AM8A 3K96A 2GDJA 2Z9CA 4QX6A 3N8IA 4P54A 2C88A 1OZHA 5FOUA 1KVRA 1OX4A 1SM4A 4ZVKA 3ZI7A 4INOA 1K3EA 1I0LA 1P18A 3MRSA 3GAZA 3KEGA 4GWKA 1BDBA 1Q82H 1RLMA 2A5JA 1U0LA 1N25A 2BI4A 4X1OA 3B1ZA 4TLBA 4V24A 5I7AA 2X3UA 5L45A 4DBLE 4DQKA 1BEEA 1Z83A 5FI3A 4URHA 3LYLA 2W48A 4AC9A 3CC4V 1Y3BE 3KOWA 1RFGE 3OCWA 3EZGA 1U2SA 2JFFA 2IEGA 1FFWA 3T5GA 2PPLA 4MJLA 1J20A 3SE7A 2IOFA 2GDZA 4P30A 5CLLA 4FHGA 2RMKA 3DUFA 2Y1LA 1GG2A 2HAEA 2Y77A 2VYND 5IANA 1MGPA 2OCXA 1DAKA 2D54A 2RHTA 4XPIB 2OYRA 4RAOA 3NDIA 5HG0A 1X9HA 2GN1A 4Z2WA 3HP4A 1YMVA 3NU1A 1SBTA 4IIVA 4XXHA 2D06A 2WKRA 4CMEC 3WLRA 4OTZA 4OLBA 4ZAWA 3CUKA 2F8TA 4C9BA 4HAUA 2PMEA 3G13A 5FLXN 2E5LB 3I3SR 5KDOA 4LJRA 1Z4NA 2QG9A 5KX5A 2HGZA 1NLYA 4W1QA 4N8SA 3QA9A 3EDRA 1KARA 1VK3A 1T5BA 1WP8A 5F51A 2FN9A 2DJIA 2WBLC 1A3CA 3CUVA 2EERA 3PUZA 4OAQA 4RC9A 5EINA 3PIDA 3G8AA 4CR7A 3UPTA 2I9PA 3QUTA 2R9AA 1TECE 1O4VA 1U0FA 1SQ5A 2GRAA 2QZ4A 3CXUA 2YJZA 2AC4A 1NMEA 3F6PA 2UXBB 5TSDA 2EIJB 1J7JA 5K0JA 3QEKA 3C4QA 3ROFA 3EY9A 1CIJA 1N8NA 1MJNA 2QUJA 1U31A 2BYTA 2PY5A 2J45A 4GKKB 3PNPA 2WTBA 3D7SA 3QLVA 2IUYA 3N2GA 1G291 2QQFA 4YJ2B 2PGJA 2IQQA 3IQDB 1ONSA 1M7BA 4KWCA 3DZHA 4B31A 2V97A 1C7ZA 5KNBH 4LI0A 1APBA 2LIVA 5K6TA 3CNEA 4ND7A 1HORA 3WLIA 4D3SA 3PCRB 1BHQ1 4LY6A 1UXOA 4JLSA 3ZHYA 4HZGA 1QR9A 3DE1X 4ZTBA 5FH9A 1C30B 1NXTA 2HPAA 4YTEA 3AVYA 1SZPA 4D7SA 1SKQA 3STUA 3QVVA 1J5EB 1RZRD 4JWTA 3GUCA 1YB6A 4U7NA 1OWOA 2IX3A 3NPMA 3WXMA 1GRQA 2GHIA 2H11A 3CB2A 4QOEA 1DQRA 3S6JA 2JAWA 2KG7B 5IKXA 3I73A 4DV6O 2FP4A 3WKCA 2XCLA 2YS8A 3EG5A 4C3OB 3DZIA 1KC8H 4XJXA 4MW4A 1MEOA 2I3GA 3E7WA 1LPSA 4MH0R 1AUOA 3CM0A 3BFRA 3EXEA 4N41A 3V32A 3NV7A 5D5HA 3UMRA 5J2UB 5HIKA 3LYBA 1RM3A 2COUA 3HN2A 1D4ZA 2CK3D 1R5JA 4Q02A 4AS3A 5TMDA 3HB0A 1AUXA 2B33A 4NZNA 1A5BB 4RD2A 4C78A 2GD2A 5K4AA 1M5RA 3BVPA 1HXHA 4I8DA 1JDPA 1IM8A 5HWEA 1BGYH 4P4SB 4Q1FA 2JA2A 4DEVA 3DCNA 1JWBB 2QTVB 4FPXA 2BD0A 4WADA 3S44A 4DLRA 2DYYA 3A0RB 2JGRA 2V7TA 4CJXA 1J70A 4ICGA 4DG8A 3NTVA 1SHJA 5ALXA 1E94E 3FRHA 4CMJA 2O7SA 4G37A 2I2XB 4UXIA 3AFIA 2OQVA 4NU6A 1IE3A 2JZOA 3D3QA 1NF2A 4CG2A 3FSRA 4EHDA 4X1YB 2XMRA 5E3HA 3W2GA 1GZ3A 5DGXA 3C85A 1RQ2A 4HDMA 1DZIA 3MOSA 1AMUA 4UTPA 1US8A 1DTWA 1IMJA 2J48A 2QIPA 1GLNA 4BQOA 1H5UA 1XEWX 2XAUA 2CV0A 3OR7C 4HZUB 3JQBC 5K3SA 1XI2A 4G9GA 3KZOA 3TLYA 1B3RA 4M7PA 1UXIA 2AIRA 5EE0A 2O2GA 1YDMA 1Y5NA 5IK2A 3TAUA 3TE6A 5DTEA 3WK6A 5DLEA 5DEOA 4XBFA 4AF8A 2O8DB 1T2FA 4XQ9A 4QJBA 2EINC 3UWKA 4TV9F 1FQKA 3C3MA 3DG9A 5IULC 4R1MA 2GVDC 4H37A 1K1EA 2ZAMA 2WTEA 2FB9A 4KAAA 4ICIA 3OESA 1DPGA 3D3JA 4MV1A 5IG2A 5UKDA 2H1SA 3ER6A 1J95A 3ZWVA 1PV4A 3PXBA 4JJFA 4ABYA 2KW5A 3CR7A 5T67A 2ECPA 4H0NA 5BQ5A 3CWZA 1JILA 4GXTA 4H31A 1VQ9F 2C1ZA 5D87A 3RFRA 1SUBA 3OR6C 3IP3A 1CLUA 3T1VA 4OK5A 1X15A 1E6WA 1I32A 2EFJA 3HY6A 4R9SA 3MN1A 5AUQA 5THXA 5CLGA 2UYNB 1E20A 2PT9A 1MENA 1U43A 1EU1A 1SELA 4M98A 5G4LA 3U7QB 2Q99A 1A5ZA 2M6RA 1JFFA 3GLGA 1SXJA 2PLAA 2Y6UA 1SK9A 3OFSA 4QXQA 2J0UA 3T3IA 1KC8W 1M34B 4BVEA 1I4LD 3IQWA 1JIJA 4JI8O 2Q3EA 2H6LA 1YVRA 1W5AA 1XRRA 2ZE7A 3DL4A 2WP0A 1N57A 4HZ3A 3FCXA 1UPXA 4R8SA 3OZBA 1ZXBA 2G9VA 1E9EA 4GUNA 5DTIA 4JVLA 1DG9A 1VHAA 1ULHA 4BEJA 4WJZA 2ZBFA 3F7OA 3AEUA 2I67A 5H4GA 3SJBA 5FNVB 3I2JA 4QO7A 1TU0A 1WXHA 5L3SB 3E8XA 4XYMA 1H48A 3LDGA 5JI2E 5BZBA 5E4JA 4BNHA 2E5FA 4PLWA 2DH6A 2JI6A 1ZH2A 5EQFA 1QMGA 2Z4SA 1O7JA 3RW0A 3MSCA 1E0KA 1E1DA 5JR3A 3ED5A 4UAUA 4BNDA 3P9CA 2ZBEA 1YDGA 4LVOA 1U8CB 3G0BA 5IRCD 4J03A 1L4YA 2HVJC 3H42B 2ZINA 3EDMA 4P08A 3GT3A 5EJEA 5BSRA 4IMJB 1Z12A 3NH6A 3BRQA 3ISJA 1ANKA 3KJIA 3W77A 5CT5A 3EBPA 3I9OA 1DL5A 1Z6QA 3V7NA 3X1XA 5JCOA 2DYKA 8OHMA 2QGZA 1H9CA 1TEHA 1GIAA 2IS4A 3PLNA 4CI0B 1VSTA 3WRXC 3TUIC 3BSSA 3HM2A 2YI9A 1RCTE 4XDJA 4HNUA 4F96A 3L7CA 4X1KB 2O57A 2WUDA 5DHRA 4Q3CA 3NBAA 1M6VB 4RXTA 4ZVTA 2DUUA 5B4UA 2YJ6A 4DPKA 2YTZA 4UVBA 2W4QA 4MWDA 2A14A 5BV7A 7ADHA 5SZKB 3I5YA 3OW2F 3BMCA 4PLHA 4WCFC 4BFVA 4EHLA 4TRMA 1B0AA 5I7FA 4YLGA 4AVYA 4IIXA 4F4IA 2R6AA 3RUCA 2CUGA 3D1VA 4D56A 4BHTA 1KOLA 1ZK2A 3FPSA 1QYIA 2HSZA 3DPIA 3ZX5A 3GVIA 3GZNA 3I5XA 1DX9A 1YDFA 3PDJA 3U7EB 1ZN7A 1DC3A 5BUCA 2FTKA 3PNVA 3K5WA 3HABA 4DIOA 2P30A 3RS7A 3IEIA 2JCYA 3GR6A 1E98A 1C3XA 5A1JA 1YMQA 1JHDA 1JR9A 5CDGA 4WERA 4JB3A 1EE1A 5I7HA 5LA6F 4KXMA 3PUYA 3TEMA 2VJNA 4I66A 4EYOA 3EXFA 2JJ1A 4ARAA 4QZVA 1G3QA 3LPAA 4IV5A 3F5WC 1OXUA 3A4IA 2JGNA 4JP2A 4QUEA 4LECA 1V1MB 1KYZA 3R76A 1TUEA 2V54A 2AQHA 2CHQA 3UT5A 1QVFF 4LHZA 3QYPA 5FJIA 1BJTA 1BX3A 5DHUA 2HVYD 2Q0HA 2VC2B 4HQLA 2IUEA 4WFHA 1BIFA 3OIGA 5GQSA 3Q4HA 2A86A 1GA1A 2DJ5A 4Q4AA 4OSPA 4HGYA 4XLTA 3I64A 2WSSD 3OM8A 1KQ3A 4W7SA 1FJGB 1JY8A 3IE2A 4V1CA 4Y9RA 5I4CA 2GJ8A 2EIHA 4PZZA 5TT1A 2Y2VA 5D6OA 4GGMX 1OOEA 2C2BA 1KNJA 2RBKA 4F4JA 4BRWA 2FUEA 3ADDA 5BV8A 2YN2A 3M1IA 1YOBA 3C15C 3CT6A 3PV0A 4XE5A 2IV7A 2NV6A 3VYSB 4E30A 1G8HA 4C0AC 1DARA 2VDWB 4EF4A 4FYVA 3FMIA 3BGWA 2P9ZA 3CR3C 4EJSA 5ES4B 1XILA 3Q8HA 1KECA 4KGXA 1FZQA 2HWKA 5IDQA 1SR8A 3NJ4A 4TWAA 4C7KA 4O3FA 5IVPA 4Z9YA 1K5PA 2ZRBA 3ZWXA 4FFRA 1Z5OA 2WFZA 2ZQ5A 5TF4A 4CC6A 3F5MA 3LCMA 4TWJA 1D1SA 4U7GA 1TD1A 3PGJA 1NN0A 3WGZA 5GGYA 2VOJA 2VJCA 3RF6A 1C4XA 4FEGA 2FHSA 3LWRC 4MDYA 2QD4A 2BVNA 5IJWA 1R5NA 3T9EA 4Z8YA 1UJ2A 4DVJA 2HJWA 1Z0SA 4FZJA 3CX7A 2C54A 5ES3A 5DXFA 3WRWA 4BIZA 3KD3A 1Q95A 3FGNA 4K9KA 4J94A 4EVSA 2CJWB 1YBVA 4PICA 3PHIA 3ETQA 5BR1A 3ICCA 1M8JA 3F2IA 4OB6A 1E6MA 2QRJA 4P1ZA 2IVFA 3T7TA 3WLSA 5DM2A 1SC5B 4JZ2A 2EATA 2I6RA 4BKQA 1XAGA 2G70A 1SVOA 1IG0A 3PT5A 5EJ9A 3ZBTA 2HPHA 4GX1A 3U11A 4Z86A 4U7FA 2RH8A 2HS0A 5FL3A 5I9SA 5KSPA 1KR5A 3SKYA 4S35A 1QX3A 1HFWA 3A1SA 4RPGA 4QPJC 2LCIA 4I0WB 3L79A 2CV1A 4C4PA 3P0EA 4TWKA 1OHHG 1P1JA 3BREA 1EA5A 4EK9A 3N74A 3ELWA 4I6GA 1PL7A 2X6QA 4OOEA 2HHHO 3QVGB 2ONKA 3WLNA 2B83A 1QDLB 2J1LA 3LCRA 3A1UA 3BA8A 1V47A 3JTMA 4BDSA 3DFZA 3IV9A 4GMKA 3RVDA 4RL4A 3HUUA 1A9SA 5LBTA 3AVQA 2P2DA 5L7WA 3KSAC 4P81A 4ZI2A 2QN2A 3VTZA 3WBKA 2INGX 3CF4A 1VGRA 1J9EA 4R1NA 2W2MA 2FVYA 2ZRFA 1QC5A 4K6MA 3NB0A 4BKUA 2EW1A 5GM1A 2WRZA 1P2SA 2DB3A 4DR7B 3VSEA 4RZUA 5IUNC 4C6HA 4K9LA 1MAHA 2BT4A 4ZRMA 3ZTYA 2OZVA 3LGXA 1XMIA 1H2GA 2JAXA 1P49A 4PHHA 4N3GA 2AG0A 2N46A 3GRPA 3MJSA 3TXSA 2GH1A 3L5KA 3KOOA 4YV0A 3D8HA 1KDVA 1WS6A 4EB6B 1EK6A 5DX8A 3WLLA 4C14A 2CNNA 4KXWA 2AN9A 2OCKA 1P2TA 1E0JA 1FJGO 2RJZA 3IDZA 3QEAZ 2PUVA 1E18A 2AUTA 5GTHZ 5HQJA 1H6BA 2GN2A 1AZSC 2W0MA 1C41A 1Y98A 3QQ5A 2HC9A 3OU6A 1F4PA 3GBPA 1W5FA 3NZEA 1B26A 5DCLA 3KE1A 1GM5A 2PT7A 5IY5B 4DCMA 2VDJA 2JRLA 1Z0FA 3V8QA 3CVUA 4PAWA 4Y1RA 4LQDA 1GU1A 1O0CA 2FOXA 1C9KA 2CHGA 4DQDA 5EHQA 5EVCA 4DN6A 2C4NA 2VBFA 1QH8B 2HBRA 3MRTA 1H1LB 2P6RA 3TR6A 1CUWA 5GIOC 2JJ2A 2GHTA 4PINA 4RZSA 4ND4A 3W8EA 2VAXA 1ODTC 2NXCA 4S3MA 3ASOC 1ROPA 5JMTA 5F64A 4BVBA 4YAOA 2ATCA 2JFQA 3FW1A 4MDEA 4D98A 5DYIA 1NPDA 1TLTA 4CKZA 3F6YA 3PPXA 1D2RA 2OBLA 1Z06A 2YW2A 2QD1A 3JYQA 4TSFD 4YT5A 3LPLA 3D6JA 3NEAA 4XFKA 1K7SN 2PRJA 3ZCQA 4G5OA 2IDKA 3GZTB 4TV9B 3PE6A 1E9RA 1SURA 4TQ9A 1EVEA 4YJGA 1SVSA 4WT7A 2OZPA 2FVXA 5M2QA 2PA0A 2VH1A 2CXNA 2E74B 1XHLA 1E3WB 1E3DA 1YI2V 2QROA 1NU8A 3T4EA 3T80A 4AWAA 2AD5A 4TL6A 2QTSA 4IIDA 3KEQA 2XIJA 4L15A 3UO2A 3F8SA 3VHXB 3STXA 4D9NA 2ENWA 2DWQA 1TFRA 2HN9A 3Q7IA 4NV1A 1D2DA 5L3RA 4DYVA 3ZVNA 2J8ZA 1PFVA 1PQPA 2GZMA 4L0QA 4MGKR 2WWIA 5ISMA 2QJOA 1U97A 4CMIA 1V16B 4PPNA 4HEA6 2B4KA 3AHIA 4CE6A 1CBUA 3D1LA 1YQGA 4BT3A 4W1RA 3CJHB 4J76A 5EVJA 4K7JA 1KH2A 1JWLA 5FUWA 1L7VC 5A5GA 1MO2A 4HVCA 2VK4A 3RIGA 3OCZA 3ND9A 5EZSA 1K0UA 5EYPB 5GY7A 4BB6A 2WJPA 2GYVA 1QPZA 2B2NA 3D3EA 4B82A 1EP3B 4D81A 5B30A 5DIFA 2EEZA 2IW3A 4X63A 1QQ6A 5CDFE 5AK4A 2P9BA 1G8PA 1A9ZA 1KEPA 1N32B 4LC1A 1A9PA 3SF8B 3QH4A 4MA0A 3DM5A 3RREA 3QXXA 3M99B 1FB5A 1SVLA 3DMDA 3ZXSA 1G8YA 4LTDA 4UHHA 3QEMB 1HG0A 1MTZA 3KFLA 2ALJA 2W83A 2WWHA 1I3OA 3QU5A 4JBXA 1N7IA 1Z8HA 4IJWA 1DBWA 2H2AA 4DC0A 5HS6A 2WQ6A 3WR5A 5F1KA 1H9BA 3FSGD 2LJ2A 4IRUB 1I0ZA 3ZS8A 3VH3A 4R4JA 1CUFA 5AQ1A 1EA7A 4RSGA 1OYVA 2UU9O 3WK5A 3EA0A 1DAHA 3CO0S 5JARA 4R8VA 3G88A 4N8EA 3SVLA 4BNFA 2FLKA 4IJ6A 1Z2CA 2YNMC 4RACA 3RK0A 2CH7B 1RSOB 3CLUC 1MQAA 1V55C 4PEVA 1KI2A 1HDIA 3CLTC 3DD5A 2C5HA 4PO8A 3FPGA 2FR8C 2SCUA 1GUAA 3RVMA 3GRRA 3G6KA 3APQA 3FX2A 1RYDA 4GT1A 4RORA 2DPMA 3QELA 3P4YA 5EERA 3CCFA 1M2VB 2J41A 2JI9A 4ND2A 1JTVA 3SDBA 2YIBD 1NW9B 3WYNA 1Y6JA 2OY0A 3R2JA 3JZFA 1MOFA 3T38A 4RK5A 1L1FA 2QZJA 4LBVA 1T8SA 1KWGA 3QVNA 3W6PA 4P31A 1P17A 2WLKA 1YZBA 2C31A 3F6EX 3AEIA 3ETEA 5HUQA 3RGBA 2W2OA 3BAFA 3GMDA 1DIBA 2FCRA 2BKUA 1KSFX 5JISA 1AR5A 4EW6A 1MJGM 4PBSA 1TTHA 2IYTA 3T1QA 5AP9A 5EKSA 3F0GA 1C0IA 1C29B 1JAXA 2HLDD 3G5TA 2C7OA 3HVIA 3UMJA 1TD9A 3KV3O 4C07A 3GA7A 2GLUA 5LA6B 1Q86H 3AMVA 3PGLA 1ZMBA 2CHFA 2LUOA 5TQ0B 3NRJA 4RHXA 1U0GA 3GRYA 3NHBA 3O26A 3AHFA 4CS4A 5IJ9B 3WGMA 5JUWA 2GF0A 3WLMA 3TLGB 1DP4A 3VYTC 1YH3A 3CN9A 4XGKA 4MARA 1EFAA 1FMTA 4CLOA 4NCNA 2C5LA 2UYCA 5KUMA 1RHMA 1CUBA 2FMLA 2NTJA 4HN2A 4JNKA 1KMIY 3OH8A 5EC8A 4MS4A 5C0OE 2P22C 1ZGHA 4UUOA 4C3UA 3V42A 4LJKA 3HNRA 4KR9A 1IOLA 1QRSA 3LI2A 4KP7A 1XQVA 4TN1A 3A4TA 5EHZA 2BL4A 4H6PA 3EZ6A 3J81A 3ZIDA 4ZEWA 2FOIA 2ZYVX 1X7XA 3KSRA 2WVGA 4D96A 3UZUA 3OLYA 4I99A 2WHEA 3VU9A 3QJGA 1V8DA 3BL5A 2BFEA 1JA0A 2QW8A 4DLUA 4JI1B 3VYVA 2ZRQA 4JXXA 5HKLA 5A06A 5JDIC 1SG0A 1L4NA 3THWB 3AKEA 2J3HA 3HB5X 2AFHB 4IJ5A 1Y74A 1NU6A 1KK1A 3E9EA 2DFPA 5CEFA 1Y37A 4TRRA 1U7PA 1X9GA 3EFEA 1USIA 4DW0A 3FKSG 1A76A 3VYUC 3PUJA 3L46A 4E5YA 2HFEC 2BM0A 2JVIA 4U7HA 1I5EA 4LWSA 4EKEA 2EULA 4RK4A 1I94B 3PGA1 2C5AA 2FRXA 3SZRA 1ZMTA 2RAUA 4ISBA 2EKPA 1YMUA 5IVDA 3CHXA 1R4NA 1WXGA 3IT2A 1FUUA 1UK6A 5B66Z 3E9MA 4EPRA 1DT5A 1TFUA 4QUIA 4BMZA 4UUJC 1C7EA 1PQUA 4F4CA 3IEMA 3TKAA 1MIOA 3C5EA 4TWIA 2H5IA 2AZ4A 3GFTA 1UZUA 3QI2A 1T43A 3GLIA 2VDQB 2EINB 1CZRA 4XFJA 2QTHA 4JBLA 2P6OA 1Q6HA 2F9LA 5GV7A 2HMWA 3D0OA 1B8UA 1I7PA 3NC1C 1CUJA 1PR5A 3OU7A 3TLBA 2YIJA 3DNMA 2Z83A 2AN5A 3IKLA 5D7NA 2BP7B 5IT5A 5I7SA 5KUTA 4J0JA 4NZZA 3OBWA 4OMFG 3HCOA 2VZEA 3K0GA 1PJLA 3A3KA 1G8JA 2KKWA 2XITA 3DF9A 3IC5A 1WZNA 2Q1TA 2DQ4A 1QYRA 2HJFC 2QN7A 4HDQB 3WOVA 1W5SA 1O96A 1WD7A 5B64A 2V7GA 1AJEA 4XDLA 4Q9DA 4GCZA 4RANA 3DBRB 3OIWA 3GWOA 5JBIA 3OEEG 1ZINA 3N2IA 4JBGA 1P1FA 3PR2B 2V9YA 1NRIA 3AHJA 1XXLA 2ZWVA 1VIYA 2HCBA 1GQYA 2VZ0A 4A0HA 3Q9LA 1Z0ZA 1Q86W 4D6TH 4JXJA 3BIWA 4ZP1A 4INPA 1BQ3A 3IXQA 4PYNA 3E22A 2WV9A 2B34A 1P3DA 2J3DA 3HB3B 2H1WA 3T12A 4JP8A 1X70A 1QCCA 2LKDA 4D3XA 3FWNA 3AHDA 4PX3A 2ZBGA 2ABWA 2QE6A 5T3YA 1ZRNA 3KR9A 2TSYB 1SHLA 3A28A 1R0XA 4ENTA 2AF3C 1UM8A 4OPHA 2HJDA 1CEXA 2AJCA 4TLAA 3EULA 1N2CE 3KJEA 1DKNA 2GM3A 2V7QD 4DHEA 2DU8A 1ABBA 4IGFA 4TUYA 1W2GA 3RVNA 4MUNA 2Q3LA 4F60A 4ZYLA 3TTXA 1K08A 4AG3A 2WPDD 1DAIA 1CEZA 3BMNB 1VGQA 4YRPA 5KOHB 1PS8A 2F43G 1JDBC 1E6KA 2QPTA 4N3BA 1PT8A 5ETJA 3IX7A 2Y1KA 4M4SA 3B89A 4LYGA 4ZDKA 1F51A 1H3FA 3R3HA 2CHSA 4UU0A 1T8RA 2YZKA 1E79D 2I66A 5CAEB 4RPIA 2PGGA 1PFYA 4LWZA 2XYRA 2R0QC 5JJBA 4BDTA 3KL4A 3ZQ6A 5JNLA 1TGVA 3A1CA 2W7TA 4OM8A 3FKSA 3RASA 4EA8A 2JHGA 4Z3KA 4U3JB 4YCJA 2JG3A 4LG1A 2YMQA 1QGED 2DQSA 3OQPA 4FXOA 2EJRA 3S81A 4R81A 2PRKA 3NOOA 3W5SA 2KYRA 1YKFA 1I94O 1S2DA 1MU0A 5H82A 4GNKA 1E3JA 4TS4A 3SVTA 1FY2A 4KQEA 3NONA 3I62A 2QTTA 2KBFA 1YZKA 2EHJA 5L3DA 3AG4C 1XQ6A 3DYVA 1Y1RA 2W4MA 1X3LA 4A91A 2HHLA 5FOXA 1B43A 2H1OA 1QNMA 4FMBB 4IMRA 5FJJA 2CVQA 2UVQA 2COKA 4IFBA 2RAVA 3DDCA 4EY3A 2UUBB 3AUSA 4UD2A 1DO0A 1U3VA 1Y3IA 2FZ4A 4LZLA 1JMYA 3HZRA 2JD2A 2MSKA 4WZAA 5LMZA 3N4ZA 1UJNA 2CTRA 3WSTA 2IWHA 3ZKWA 1OKKA 1FYJA 3T41A 2QTPA 1JYEA 1WY7A 5A3VA 1E32A 2NPOA 1VQKV 4BV9A 1YZNA 4KL1A 4BFZA 4LJ7A 4TS1A 3I55V 1WJGA 2A94A 4WNAA 4W4KA 3OEEA 4QGFA 3PFHA 4MYDA 1CVIA 4TXNA 3DDZX 1LI4A 1BFDA 3VZCA 2ZUUA 1T2UA 3VPDA 1BKYA 3L82B 1O6GA 4M1YA 2VXOA 2PMFA 2H3EA 3S0WA 4GMFA 2ZSEA 3PQ2A 1TE2A 1OV6A 4AS1A 2CEAA 1QQAA 3Q6MA 4M9RA 2YEVA 1QFYA 4A27A 4YMIA 2QORA 2GM4A 1T9ZA 2HOQA 4NH4A 3GO4A 1WXEA 1Z6GA 2YVAA 3A1WA 1I1HA 4R41A 2GCNA 5E6UA 2A0WA 1U0OC 4ESVA 3NAZA 1NR7A 3A9CA 4GDFA 3KAKA 3OCYA 2XOKG 2ZJ1A 5L9AA 2C2WA 5ADVA 1JEDA 4P3YA 2NQTA 2JGKA 2WDPA 3KEOA 4BJ3A 2FE4A 2D1RA 2VDRB 4DUPA 4NR1A 4NBTA 4OQFA 1T3TA 1AOXA 3RW9A 3UWDA 1RLUA 1CK2A 2JCXA 2PJDA 3GI1A 4JOSA 4J43A 4ZCQA 2IK8A 4BGEA 4U8GA 4BU0A 2YX1A 5J4YA 1H2EA 5HDQA 4RVDA 3N7TA 3W7BA 3KQPA 4DVGA 3Q1LA 9ATCA 3FFAA 1I3MA 1DQYA 1WPQA 3IBTA 1XA4A 3HDVA 3ORFA 1ZITA 5AI4A 1LVUA 4ENPA 2EKBA 5D85A 3SZMA 3N59A 4JJ4A 4A92A 4ZKDA 4M87A 4DQ0A 4J4TA 5F23A 2GD0A 1QAOA 4XB2A 1DF4A 4NBUA 3KT8A 1DJPA 5AVYA 4Q3KA 3WGHA 3KJNA 1U8XX 3IHKA 3T9BA 3E1KA 3ZW9A 3G0CA 3TLKA 4EYQA 1SK8A 2PGIA 3D3KA 3RAPR 5A2QN 2HTFA 3K35A 2GMWA 3JV7A 1TTTA 1XMXA 2Z8ZA 2HDNB 4M53A 4LFAB 5H70A 2R47A 1KC1A 1VQVA 3BOSA 2XZTA 5INTA 1KI6A 2NACA 3RTEA 1F5NA 3K5IA 5TS3A 1SUIA 2PWYA 3QFHA 5KS2A 2UUBO 3ZDBA 2OMKA 4QULA 1KNKA 1VCIA 4OGLA 2XUIA 5I9NA 5BRJA 1RWKA 1VQKF 4BUJA 1PGOA 3NVAA 3AZOA 2WLIA 2WLLA 1WUTA 3INTA 2HK7A 3I55F 5ABPA 4NZMA 1Q83A 5BW4A 1Q22A 5JQGA 4WSOA 4LE1A 2IYYA 1OA1A 5IBPA 2I87A 4CDRA 2OHVA 1JKJA 1F7UA 5C1PA 2R8BA 2DZDA 3LZCA 2R00C 1HEUA 3IIKA 2ADPA 3RC1A 4ZQHA 1IHUA 3LHKA 5C8ZA 5BW6B 1DC6A 4MA5A 2XD4A 1JEAA 1IZ7A 1AXRA 1Y6QA 3M8AA 1T4CB 5IAJA 1J2YA 1L3BA 3CZPA 4V0SA 4L95C 3WOHA 3CP1A 5ALPA 4E5SA 5ALDA 3R3ZA 3CRRA 2PQMA 3TAHA 2TMDA 4Z7JA 3WB2A 4BC1A 4PO3X 2ZF8A 2ZBDA 3FOBA 1RYZA 2Q0QA 2J5XA 2B4AA 2H9YA 3D0RA 3HA2A 3ESDA 3GLFA 1SQGA 2P2YA 3VSBA 5IFLA 5DBEX 4HT3B 1GKUB 1U98A 3NK6A 1RXCA 4I5FA 2ANBA 3U56A 4L8WB 3M4NA 2AW9A 4IDBA 3T7DA 4FCWA 1X1EA 2N05A 1GAQA 1GARA 1G2OA 1LVGA 2EDAA 4DQVA 3LLUA 2Q9LA 5KPDA 3DGEC 2B35A 2VYCA 3FOEC 3A6EA 2IOQA 1H22A 3WWEA 4GWGA 3ASOB 1BCRA 2HEIA 1NVPB 1QANA 3K0AA 2RONA 3QMVA 1IPEA 2AZ2A 1WJZA 2ZJBA 3CVJA 3EFFK 3DVAA 2ZRGA 2IZ7A 5E7JA 2O2HA 4YRCA 1TQDA 2VS0A 1WNFA 3JVIA 4YMLA 1VH8A 2R5WA 2JGMA 4L6IA 4HUJA 2ZANA 2Z1DA 1NRWA 3W5UA 3O31A 1W8DA 4UDNA 2KSQA 3FY4A 3C98A 5L51A 2CVLA 2CEKA 2HRZA 5AW8A 4B7EA 5LJLA 5GTIZ 2BTQA 1EQAA 5JTUA 4XPIA 1QM5A 4GYJA 1ZJYA 3FHLA 5I7WA 2BGJA 5JSYA 2W6ZA 2ZQYA 5CHEA 4FB5A 4CLEA 2X9NA 4YAGA 1S3SA 2CVHA 4JLKA 4DUZO 4K8RB 1B00A 1AHPA 4FLEA 3H6GA 1E66A 5AHOA 3T3NA 2I1WA 3CWQA 4UCTA 2GKOA 1OZGA 1NF3A 5DEIA 2XTJA 1G8KA 2HW8A 4JMPA 2G4LA 4BEVA 4LV6A 3O47A 1YBHA 1KNQA 3K2XA 1UWLA 2QKAA 3PR1A 3S2UA 2EFDB 1E69A 4U7WA 2C2XA 1L7NA 3H5OA 4LV8B 1DWQA 1YC2A 3ICVA 4NU8X 4G5GA 1Z22A 2ID8A 4LFAO 3D6VA 3VUEA 1QE0A 3KCQA 2GNPA 3GUVA 5DJ5A 3WU2Z 4F46A 1DPFA 2BJWA 1ZCFA 3Q2KA 1Z26A 5BPHA 1PLLA 4YJ2A 4UFPA 4C7UA 1E7QA 4CKWB 2IDZA 2E89A 3VYWA 3R7WB 5CDHA 3DONA 2ISSD 5MGBA 3LG2A 1COWD 3UV6A 1FXSA 1JOYA 3CGWA 4LDJA 4MR8B 2XOXA 2HBYA 4I5GA 4IIUA 5A3RA 4NK5A 1EJ0A 2DETA 1LKZA 1WETA 3E0XA 4EJ0A 1J0EA 3AV3A 2FUCA 1C30A 1U0HC 1Z75A 4IXMA 3K9QO 1T8YA 3KZVA 4QNMA 4P4GA 1YK1A 3EVGA 4HLUC 1H0RA 3M84A 2CLFB 3KEFA 5GADl 1B2LA 2YC2C 4YAKA 2QTZA 1CUVA 2GVIA 3ON1A 1R73A 1XTUA 1AG9A 1QHHB 1EAYA 3G7SA 5DZSA 1WQ4A 5HJEA 3MWLA 3CC2V 1XL0A 3ZCPA 4HDSB 5FBHA 1M7HA 4OQQA 2JAQA 3HVJA 3RS8A 2O1WA 4CODB 2KG7A 3LIIA 4FJ2A 3VPBA 3LCCA 3FFXA 3VC1A 5DBGA 3CN7A 4ENUA 2HP3A 3BPZA 3Q10A 4MO2A 3UAVA 1V55B 1U65A 1RPJA 2X5NA 2OSBA 2VWHA 3E9RA 3MHSC 3RFVA 1V9PA 3HP1A 5CUQA 4MYSA 2ZU6A 2YMLA 4UVDA 2QRUA 4OJQA 2W2KB 2ZRLA 3RRXA 3BORA 3HFSA 1W7AA 4J3JA 5J2UA 1A04A 2I6XA 3DXZA 3EQ9A 2BLNA 4PNPA 1P6UA 2XB6A 4EDHA 2C8VA 1COZA 3PUKA 4WZZA 2WWRA 3K32A 4JI8B 1SD5A 4RHUA 2QMUA 3BA9A 1E2JA 3I52A 3NUZA 1DKQA 4S1VA 4EVQA 4PZ9A 1W36C 4QUJA 3S2EA 4NESA 4I9QA 1XV5A 5CT8A 4C81A 2WSIA 3IQFA 3KQHA 3R5SA 3S2YA 4XIGS 1P1CA 2DQYA 3E0QA 1Q82W 2GQ0A 3LUFA 4B17A 2YFHA 5L3VA 4BFCA 2ODAA 3VR2A 2FSGA 3CJQA 1X7HA 3UG6A 3A0RA 4E1BA 2XH8A 2XCOA 1J97A 3RSOA 3SSAA 1F9AA 4HWGA 1JIUA 3OT5A 4IWYA 5KOIA 3CC4F 4JI3O 5KNCD 3IGAC 1UT6A 1UAGA 1NYTA 1HLPA 5A9GA 3FA2A 1Z0AA 2PKCA 1I4OA 2DH5A 4PZEA 5SYAA 2W2LD 1GR1A 3RARA 2RC5A 2C9YA 2VTBB 1YGPA 1NXSA 2OB2A 1OV4A 3VYTB 2LW1A 4X1YA 3SPCA 2C0QA 5AOBA 3BSYA 4B40A 5FHRA 2XT0A 2H51A 1WW8A 4NYKA 2FRDA 5B7NA 4BAUA 4CRWB 5DTMA 1LC3A 2ONJA 1EGHA 1ZVKA 3OE4A 1K89A 2OBYA 2I4IA 2XYHA 3P2JA 3UFXB 4L4SA 3URMA 1HFKA 3NVIB 1NNSA 1IXKA 1SVMA 3H9UA 2J9ZB 4CF3A 2HREA 1H3NA 3GHZA 1IJKA 3CLKA 3VSAA 1J8MF 3NTUA 3AUTA 4I7EA 2O8DA 2Z9BA 4QHSA 2GCEA 2EXXA 1O6FA 5E9WA 3VCZA 2VRCD 3P10A 2AS0A 4ZVMA 5BSHA 2EVWX 4P0PB 4NPHA 4NI5A 1XTZA 2Q2NA 5DBIA 4MRRA 4AYTA 2JDID 3BHJA 3LQ1A 1I7QB 4RVGA 4B85A 3GNLA 2F3UA 3G7NA 1PQYA 5CJ2A 5AXDA 2UXCO 1SEPA 4RDXA 2CXQA 1MAVA 2CXRA 4LQ4A 4IO0A 3U37A 5IJZA 1RQXA 1O4WA 4M9QA 5JMOA 1H6DA 5GJVC 3F7YC 3A7EA 3SZGA 2HCFA 4TTRA 4XVQA 2I6QA 4KRXA 3PFFA 4I9UA 2O4UX 5CT6A 3N27A 5EP4A 4RIGA 3CC2F 2X76A 4QQRA 3IFSA 4A6EA 4B83A 4DTIA 4AROA 3P2KA 1W0KD 3T7AA 3RA6A 4EMSA 3CEIA 5AI6A 5LZ9A 2Y0BA 5L4NA 2RBGA 3VH2A 3RROA 2WFAA 2PVCA 4F4DA 3DC7A 5KMGB 4GLBA 1M34A 1K6XA 2ZSAA 5MFPA 1YDHA 4NKGB 3L4SO 3AX6A 4DO2A 2F8MA 3HJFA 2ADMA 2YC4C 1UKEA 4X6XA 2XNSA 1UJ4A 4JZYA 2B1JA 2B78A 1VJRA 4AU1A 4DMMA 4U5XA 5JFGA 1XQ8A 4INZA 1GDTA 2QD5A 1TM2A 4M2LA 3EIEA 2ZJOA 5FNVA 3NH9A 1PNQA 2OGTA 3HVRA 1V11B 2XA2A 4OAPA 4XDGA 4OSEA 1SB9A 2MHCA 1G2QA 3K58A 2CZWA 2FUG6 521PA 3T7JA 4DLXA 3OCUA 3ENWA 3S99A 4BNVA 3K6SA 1TCBA 3DVRX 3H87A 3TNYA 1MG5A 3C70A 2AHRA 4LCJA 4F4UA 2YWXA 3KOZA 5BN4A 3HMKA 1ZD2P 2PR7A 4JOBA 2H06A 3JAWA 3K3PA 2OAGA 4CN8A 2G71A 2IZ0A 5JS1A 5C5IA 5KNBA 2YXYA 3HCEA 4Q93A 2Q7XA 1ZK4A 2Q5JA 3JALB 3LWOC 1RADA 3KZ1E 3DDUA 3W5VA 4P32A 4DIEA 1IIRA 2OYQA 3D5QA 2R62A 4ACBA 5EJ7A 4HQRA 5ALHA 2CJYA 3A6LA 4L16A 4MQFB 5DN6G 1DLIA 1CUEA 3ADCA 1XPUA 4PG6A 4QGGA 5DV9A 4Z54A 4NNOA 4NS1A 3UVEA 1Y8RB 2NUAB 3VX3A 1HLGA 1KDOA 3ZD7A 4G4IA 4O4LF 1XZKA 4L0DA 3GQVA 4LFCO 2VUHB 1CVLA 3BICA 1MVNA 2PG3A 2DGDA 1ZJ4A 2GJ9A 1R50A 2GF9A 2KTVA 1NG9A 4NU0A 1RTKA 4AWBA 1U0RA 3W1VA 1VP3A 1GZ4A 4D79A 3JWHA 5ADHA 2RKWA 4OA5A 2CUNA 4NTZA 3TTUA 1O95A 2BJHA 1QHEA 3IMPA 4W8HA 1A50B 3RTGA 2XEDA 1OBCA 4RSHA 3H2SA 4L9WA 2GERA 1DDIA 3O94A 4O25A 4JPRA 3OF3A 1KYQA 4I19A 2MOKA 2LNDA 4L76A 5GZ1A 4PG4A 4Q00A 4JITA 2YVLA 3C9UA 2HFJA 3DB1A 4JJIA 3LY9A 1R6UA 1Y1TA 5DF1A 1TYZA 5EHXA 1G8AA 3V48A 3NGLA 3WDSA 2DP4E 3TL2A 3U19A 2ZTHA 3CRZA 2G0TA 1BMDA 2VTEA 1T2AA 1V1MA 4HJXA 1SCUB 4OX9O 2ZIMA 1YXMA 2HHHB 3W7TA 1VE1A 3DBHB 1OJ7A 3U44B 2ZJFA 4JYMA 1Y8CA 1FS4A 4URVR 3HWWA 2A88A 5I4IA 3ZC3A 3AG4B 5HF8A 1XL6A 2P3OA 2F1RA 3T5TA 1GX1A 4QJIA 1YC5A 2JCGA 4JF3A 4IR7A 4C89A 1CUCA 5JC1A 4C7BA 1UM9B 1ZU4A 2NWQA 5B6PA 5KYVA 1GNVA 4RD4A 2AKEA 2AR9A 4LH7A 1G8SA 4M38A 1GXSA 2F23A 3O83A 1PT5A 1Y66A 4PSUA 1O94D 1PL4A 1NRXA 2OSVA 4Q7LA 1GA6A 4JIMA 4OYHA 4G09A 3X1DA 4E4YA 2Y66A 4NH0A 3LDDA 3WKDA 2ZIVB 4KQFA 4TROA 3FLAA 3PHCA 4ZI5A 1K7DA 2IFTA 1G64A 4W7IA 3NXSA 1V3QE 4YUWA 1ZSYA 4KDFA 1Y8ZA 1LSUA 3VQTA 1CS0A 1L4FA 1BE3H 1THTA 1H2MA 4MIOA 1JHOA 5TISZ 3TGUH 3KEMA 2A1UB 1RWOA 4UDYX 4PQFA 1J5PA 3V4OA 3CUTA 1M6HA 1AQYA 3S5UA 5HBRA 1VHLA 2QDOA 1ISGA 3P9NA 2A0FA 3DS8A 2VJKA 2FFJA 4K9QA 4AL4A 5TB5A 1IAVA 4UEKA 1SC1A 5CIWA 1P19A 1LFDB 3H4VA 3F7TA 2H0AA 1SZJG 2OENG 1FS0G 5CN0A 2EBUA 4GR9A 2NZ8A 5JW6A 3EEOA 2Q69A 2DLDA 3IR6A 1T2CA 1P9LA 3E84A 3LRTA 3OZAA 3FNQA 1J7KA 1AO0A 2DBRA 2IJHA 2ZI9A 5BVHA 1TEXA 2CJWA 5EIXA 4RYLA 4MUXA 3FSEA 4P2GA 2VT6A 5G0SA 3EYAA 4Z9XA 4PAGA 4BGDA 2C92A 1D1PA 5IKEA 2JB9A 1CUUA 4HAXA 5EXEA 5KC9A 4QRHA 4Q19A 1JEOA 2VPXA 1JJ2U 4KXYA 4ROSA 3B7PA 3O90A 1S01A 4AAYA 4Z8XA 3AR8A 3QFCA 4G9EA 2A59A 1D7OA 4BT2A 4E46A 1YQXA 5TMEA 3DGFC 4NQ3A 2AYYA 1U6JA 3I8OA 2PQ6A 2CZGA 3EA5A 1BE6A 3CRAA 4B3RB 2YOHA 5CFPA 1MH9A 4MOWA 2QP4A 1VI2A 4ZAXA 3DE0X 1DBPA 1LB1B 2FUG1 5DTJA 3LFUA 3LLMA 1AK9A 2A0UA 3A14A 5CFMA 5ICEA 4C05A 1JKXA 3KVVA 5ALSA 4BY9E 1M3SA 2ZRPA 4ALJA 4ALKA 1G0OA 2P6NA 1F7YA 2QLNA 3PC7A 4MROA 4I9FA 2A9KA 3WJAA 3HJGA 3IVMA 5K8IA 3M2TA 4K86A 2I7XA 3H0KA 4IIFA 3TD4A 2H5JA 1FP4B 4OXQA 3TBFA 1Z29A 5FYDA 4E33A 5FPPA 1GL3A 4B75A 3F7MA 1POXA 3EE6A 3A9UA 4YA6A 4F6RB 4BO4A 3SSMA 1ADYA 4J9ZB 3PNBA 5CTJA 4LXYA 1GUBA 1G4UR 3WKEA 1J6UA 4EB6A 1OVGA 2R6JA 1M72A 3A6ZA 1AJNA 4DMKA 4CIVA 3BWCA 3ZLBA 4CS2A 2ZJZA 4L1KA 3QWFA 2F9FA 3OJOA 4P53A 4E31A 1O08A 2H31A 4HQOA 1JSXA 4X20B 4XYLA 4MLDA 2HJRA 1M73E 2CSLA 3VJMA 1IK6A 2AOXA 4OIFA 3WMRA 5BYAA 5K1ZA 1PJZA 2QAJA 2QY9A 2YWBA 1O1YA 1CZUA 2ZJ0A 1GSOA 1VXRA 3V00A 1VMAA 2DR3A 5A3QA 1XV2A 3PQ8A 2DBQA 5H81A 2XE4A 2ET6A 2E4AA 4UTZA 1T6YA 3HJBA 1YB5A 5FWDA 4FSXA 1MC8A 4JCCA 1UDWA 4WJKB 1SKYE 1XREA 2A58A 2UU9B 4H35A 1NTZH 3IE1A 1H1LA 2EGGA 1YCDA 3OOHA 5A5DA 3W5JA 5BN3A 4R84A 1Q3HA 3LAWA 4W6ZA 5AVRA 4HEHA 2R2AA 3M49A 1X7DA 3EVKA 1L5WA 3OUTA 1HP8A 4C5BA 4C1BA 1V41E 4MHSA 4N6GA 3B5IA 1XEXB 3RB8A 3CZAA 4W5JA 3EQ6A 1B8NA 3DF7A 2IGBA 3D7KA 3JQAB 3HA7A 2R6R1 4NHOA 5U9CA 3JR3A 1RPOA 2LIPA 5HP8A 5J2TA 5G0TA 5GP1A 5FPQA 2IBZH 3K06A 4Y9UA 3ORHA 3QTTA 4HMPA 1KPGA 1Q2XA 3PXXA 4FXPA 3FLBA 3FPEA 1LV8A 2PL3A 1INLA 3ZKAA 5J63A 4V0LA 2Q3BA 4M83A 2YXNA 3CO5A 4JT9A 1TZCA 3D4IA 4EL5A 2BHTA 3UHPA 5H83A 1ZJJA 3RJMA 2Y48A 3RBXA 4GOJA 4RFSB 3R40A 4XAQA 1IX9A 4ITRC 4MP3A 4V3BA 1QRDA 4G5QA 3T5MA 1T4BA 4KLZA 1R9GA 2IJKA 3PIIA 3LHFA 4CQMB 1SBQA 2QQGA 4KO4S 1HZJA 1W55A 4ZRDA 1M67A 3E8FA 3NHKA 1ZL0A 4WFAV 4ZVVA 4O02B 3TI7A 1OH6A 1ZC4A 5JZVA 5EXTA 1GDHA 2FWPA 1EBUA 1EDBA 3LFHA 4YIOA 2J9FB 5GMOA 2OXIA 4JUAA 4B3RO 1KGDA 1KYWA 3L4BA 1EFKA 1IU9A 3QKRB 4IUDS 3SR4A 4UUNA 2QL5A 1NRJB 3NRCA 5FUBA 2AOTA 2IY9A 4EUKA 5EYPA 1J00A 1WU7A 2A67A 5DSTA 4FBLA 3RDPA 2C0PA 3EAQA 2L0XA 2G1AA 4RQOA 1T0BA 2FN8A 3L6CA 3FDFA 2WW8A 4EY8A 2OFPA 1VQ1A 2ZRNA 2H4YA 5IASA 5I9LA 1OHHA 2HF9A 3FVRA 3TS1A 3NEJA 3E9NA 2XSZA 3C9SA 3B13B 4WK0B 3W1EA 5D8DA 1N36O 4QXRA 4LHYA 2IXGA 1T9DA 3ZGYA 2DUWA 1EDDA 2IEZA 3TM4A 3GC6A 2NXNA 1C0PA 1VIDA 3ON5A 1F20A 3HNPA 5IK2D 1M2JA 3AESB 4Q1VA 4UU1A 5D00A 2DYRC 4LOKA 4ODIA 3J81M 4JAVA 1JMVA 2WUEA 3IPYA 4OXXA 1GCGA 4C04A 3A1FA 3NR7A 3AY0A 3L1JA 1TMGE 3WKBA 1UP4A 1MPXA 1ZX3A 4GBGA 3G23A 4ZYXA 2QF7A 1RSOA 1PFUA 1EEHA 3KB1A 2HNBA 1YDWA 3RVOA 1OXMA 3IDAA 4OB7A 1E9VA 4MVJF 4R40A 2QQ5A 1YUBA 2R6DA 4W9NC 3K09A 2XWSA 2W42A 3WLEA 4G5XA 3IKJA 1DI0A 3PZRA 3D3WB 3RWRD 1QZXA 3N76A 2HF8A 4OXYA 3JQFC 4O4LB 3UC5A 4XEHA 3QLUC 3ESYA 2FA9A 1VI5A 2IEAA 4WEOA 1YFLA 2DHQA 4A73A 4OBBA 4GVPA 4Y9DA 1J8QA 4EFMA 3UJDA 1N34B 1EGMB 5C31A 1RYNA 3BWYA 1P9OA 2CCKA 4NHEA 3AGQA 1SXJD 2OZLB 1II9A 4LY3A 2JCBA 2C3YA 2ECKA 2C7GA 2ZRMA 3OQNA 3MJ4A 1ZICA 4G67A 3TG2A 3COZA 4G2TA 4EYKA 1MDFA 3R6LA 5FLKA 1EUCB 4IWXA 3QVXA 3AFNA 3AY6A 4FIZA 2YJ3A 2W70A 3KJHA 3AJAA 3ZJVA 3CLRC 2NUBA 4J1NA 4YMUA 2BEVA 2EARA 4MQEB 4XX0B 2EBOA 2QBYB 5EXSA 3CH5A 4ZAZA 2CXHA 2YCLA 4DV1O 1PBTA 1S9DA 5K3AA 3TLGA 1ODKA 2HUPA 2IU6A 1AI5A 2JW5A 3EISA 1NS1A 4HAZA 4BE4A 2UYPA 4M0DA 4JBIA 2XNJA 4AXXA 1JFSA 3CEJA 1YI2F 2Q9BA 2QDXA 4DJ5X 1W36B 1ZG3A 3G2HA 4F5DA 3B7WA 1ZSNA 1M4UA 5ENZA 4IXWA 3ESCA 3LVFO 4BT7A 5DBOA 4QUKA 2VXCA 2X4GA 1O03A 5E2BA 3FGPA 1H9AA 1LBIA 1FA9A 2G63A 3C74A 3TLEA 4TLMB 3OTOB 1SBYA 5MN4A 3P9ZA 1N8KA 3PC6A 5DM4A 1GFZA 4O4IA 1Q1AA 4F0JA 5BXZA 5FHQA 2WYWA 1Y7LA 1PVDA 1NUQA 2RHHA 3DE5X 2CLHB 2ZZKA 3A0BZ 2LR0A 1XBTA 3Q6IA 1RI5A 5IARA 1G4HA 1L4UA 2PWBA 3K72B 2AFHA 2UUPA 1JQ3A 2QOEA 4GPBA 1X8KA 1WCYA 1N2OA 4FD3A 2JC3A 1YQ9A 4L07A 3MCQA 1P77A 3KQYA 2NU7B 3ASUA 1RXUA 3AF1A 3QV1A 3OIDA 3HJAA 4DB2A 3GJZA 4Y8VA 5IUKC 1OFVA 2GA9A 1P60A 1DIAA 4JYYA 3NNNA 3IHWA 4GXQA 1K6JA 2WAOA 5AW0A 2Q6KA 2C20A 2ZVZA 4D5GA 1NJSA 4BMSA 1YSCA 1R0WA 1C8VB 5IDYA 1YEWA 2P2SA 1FS5A 4FEAA 4IWNA 4EEXA 4ZU1X 1E1QG 3VOAA 2J5RA 1MJHA 4X94A 2D0IA 4CFYA 3BN3A 4ER3A 4KMMA 1KP3A 3G49A 1RXEA 2I2BA 3S27A 1NY5A 2A5DA 4O0LA 5GAJA 3RRZA 2JJ1D 4BGIA 4DCTA 3VOUA 1IHXA 1OXSC 3ABLC 2ZVYA 3OQIB 1P72A 1VFPA 1VG8A 4LUCA 3BZWA 2XCIA 3NIDB 5CFRA 1HM5A 821PA 1BW9B 4YJFB 4X7MA 1KU6A 4BU1A 3AC0A 4K28A 5EBMC 1X87A 3PIRA 3ILXA 2FPLA 1AH2A 3EWNA 3DTVB 3ZWWA 4P36A 3SF0A 1OAOA 3JAKB 4M8LA 1BFUA 4CF7A 2RGWA 2FU5C 1PD3A 4RMIA 1AS0A 2AJLI 3EPPA 5AKXA 3CW9A 3GN1A 3D3IA 4BO0A 3L9XA 1HURA 4BZWA 4DJAA 1N34O 2LCFA 1SS3A 3ADPA 4GS5A 4IH1A 3B09A 3DMFA 2HK8A 3TDMA 4BN5A 1I2CA 4YO8A 1R9NA 2J7KA 1ZP6A 5FOVA 4HEA1 4MWSA 2JS3A 4C4AA 1MBZA 4OXNA 1I0HA 4FB4A 5TIIA 1M0EA 4LA4A 4BQQA 1R3UA 4N12A 3RIXA 1F2VA 2PT6A 3FDXA 1K3FA 4AUMA 3JX9A 4FDVA 2EIMC 3KETA 4ER5A 4BNYA 1UBOS 2D5CA 4B4UA 2A9OA 1GO2A 3MGCA 1IXZA 1V8FA 3IUYA 2PZFA 2IM9A 3CYPB 2QTGA 3ME5A 1AT1A 4P6VF 1P31A 4AIIA 1S8OA 4B7XA 4XOIA 4Q7QA 4X3OA 3WQBA 3TX2A 2EV9A 4EARA 4GGPA 4X66O 4W5RA 3DHVA 1DK1A 4H4EA 4CV1A 4IW3B 1VQ5V 1GVHA 2PHNA 3QLEA 4AJOA 3L7LA 4JODA 4KR2A 4RY2A 2AI3A 2BEJA 4K8ZA 2XTZA 3CEPB 4MWOA 2DQ0A 2ZUEA 3UOGA 4UJ5A 2P8JA 3OTOO 3SYPA 1MORA 2P5YA 5IM4F 3VTAA 4KQXA 3PKJA 1DV2A 1BD3A 3ZYZA 2IH2A 1KEVA 1Q1GA 3COWA 3HO6A 3I09A 5K3OA 2CLLB 2D1YA 3F97A 4AZ3B 4JVSB 5J5CA 4NARA 5F76A 3ZNOA 2CFSA 4B62A 1C1XA 1C1YA 2QN6A 4QNRA 4GLJA 3U1TA 1EJBA 3PS9A 4BVFA 5I4BA 3G6EV 1IMOA 4OQPA 3ZRXA 2V74B 2R8XA 4AJ2A 2X41A 1XVIA 4QICA 4ERHA 4NLLA 2NV0A 4U0JA 4YH1A 5DMHA 3O9OA 5DNWA 4D6PA 4PWYA 4UHEA 3GFRA 4CKBA 1HOTA 3FWYA 1JSCA 1P4RA 1VBKA 3TZ6A 1SIBE 3I42A 2R6ZA 4HWOA 5K3CA 3O4RA 4PVDA 4XJTA 3P0IA 1FVOA 5T8KC 3L04A 3V3TA 2VPYA 2VH2A 1UBJS 1QR8A 3T1YO 1V6SA 3CONA 1OPRA 2OFOA 2QVXX 3T5CA 1E1QA 4OK6A 3GLKA 2QGFA 4E5MA 1AF4A 2BCJQ 3WX0A 2E4YA 2C3PA 4XR9A 2CD7A 4JZKA 2K4MA 2OG2A 3WIUA 1FRZA 3R3SA 3CR8A 2O2YA 1I5RA 2PZBA 1RJ9B 2V96A 1ZOLA 1WX1A 1HT0A 1YB1A 3T99A 3D8NA 3GUZA 4MR7A 1XZJA 3KTAB 1AKTA 3NHZA 3O1LA 5E1OA 5TRTA 5LDHA 3R5JA 2NR5A 3COVA 2QTCA 5D3MB 2ZBPA 4WCFB 4HRVA 1K5QA 2Q7DA 1QF7A 3FCAA 1RZUA 1MF7A 1KMNA 1ZOSA 2R1VA 1EM8B 4QVGA 1X7YB 3P52A 1FSGA 3DZFA 1JEYB 4BBZA 2FZCA 2A33A 4JL8A 3ILHA 2I71A 4Y18A 3FFQA 3CCJV 1QGOA 2VSNA 2YBDA 4EG0A 1EN5A 3K9HA 4GXRA 2JFPA 2VP6A 1VLMA 4Q9JA 1F8UA 3I4LA 2ZR3A 3PFGA 5IXYA 5U4QA 2CFIA 2O06A 1ENOA 3EC2A 4IBOA 4K26A 1KFJB 2DR0A 3FD8A 2HR1A 2H29A 4DLBA 3EVAA 3IA2A 4BN0A 4OGKA 4CEIA 3BXPA 5LGTA 3GJ6A 4BFLA 4FFKA 1QMPA 4RKWA 3GUUA 4E0BA 2GUZB 4CIDA 5C46F 1HYHA 2C99A 2Z3VA 3AG3C 1E1CB 5KQRA 2VATA 3PJDA 3FUVA 4CH5A 1DIOB 1QFJA 1EEXB 1FXKC 5K51A 1PJQA 1QAQA 2I34A 1KC3A 2D2FA 1OFGA 3R5TA 1OLSB 2VNHA 2VHYA 1IEXA 2VQFO 1MX3A 3R9IA 5CEJA 3TZKA 4WECA 3ERNA 1L8DA 5FCDA 2JJ2D 4HNQA 1N6RA 2GR9A 3H13A 3WO1A 1VQ5F 1YL6A 3SHFA 3DZCA 5DT2A 4WKNA 3NAGA 2Z6UA 5BQOA 4ZJPA 4LRYA 5AW6A 3S4YA 2ZATA 3VI4B 4IDPA 1LQTA 2ACWA 5HNKA 2QUKA 1XNJA 1FFXB 4PDMA 1VF6C 3CG6A 1E1KA 1WAMA 4N1AA 4MPRA 5F5XA 2J85A 3CCBA 2CB0A 5JATA 3V7UA 4KE6A 1LV7A 2I1VB 3NHYA 1FBNA 3B6KA 4U2GA 1MJ5A 3K2QA 3VJKA 3P45A 3FE2A 1L8LA 3FOFC 1VYTA 1Z07A 2WKSA 3JPYA 3HXKA 5B4VA 4KC0A 5ALWA 4M0LA 4QYWA 2AQ8A 4HAMA 2PXXA 3NTOA 2JLCA 3JQ7B 5EJFA 3RE1A 2HDHA 4HNAB 3FJ1A 4EPVA 1JB9A 2F43A 4DV0O 3CNHA 1DCMA 4JT4A 5DNVA 4QPCA 1EVKA 5KQSA 1E3MA 3CQ9A 2YOFA 4NZPA 4CMHA 4LF7O 2XZDA 4RFVA 4RQFA 1XPRA 5LQMA 3ZWBA 4Q47A 2Z58A 2ADOA 2VPQA 4CLDA 2G07A 4JWKA 5FWNA 4DNQA 1G55A 2OCLA 4HQ6A 5ALRA 1P0PA 3E3LA 1NHWA 3DKKA 1G7CA 1R16A 1ULZA 3JQDA 5EK0A 1O9BA 3I2IA 2WLTA 3WNQA 4DUZB 2C9DA 4OI4A 1KZ4A 4KAJA 3JZMA 1QGDA 2ZSHA 3I30X 1XRSB 4KYVA 2ARKA 4BMXA 2XMGA 3CCJF 1T6NA 1ZO8A 3SEAA 4R05A 2QN9A 3SNHA 1DEOA 1LDYA 3DE3X 3IAHA 4OHFA 3GPBA 5CB4A 3TETA 2I6UA 4DNOA 5HKOA 4UUBA 3SQWA 3FAZA 4CW7A 4PA3A 3NHLA 5GJBA 3F3YA 4RIHA 1S02A 1JR2A 1G8GA 2FMUA 4BB0A 3E7PA 1DO8A 1Y76A 1NW7A 3GJ5A 3DTYA 4FE7A 4XGIA 4FDTA 1EFPB 3AJDA 1WXDA 2MJLA 2B61A 5AD1A 1IBRA 4X44A 1XMOB 1TUBA 3BJEA 4C88A 4X65B 3K9FC 1C9JA 1DIRA 3KJXA 1FXWF 4D57A 2UZ3A 1Z34A 1ZHOA 1VJDA 1LRKA 4O2RA 1GRVA 4YRMA 2Q1YA 4IAOA 2FC3A 3NVDA 4NENA 1GMGA 2GVZC 4LJYA 3N1UA 4X00A 3RSHA 4QU0A 1YU9A 4JI5O 3NDRA 4KAXA 3WYBA 4MS2A 2PWAA 4RVHA 5FQNA 2D0PB 4GR5A 4QQFA 1UIMA 4X8MA 2CDAA 2OCHA 1SH7A 3HYSA 1CS4C 4Z3DA 1G17A 3W7AA 5BR7A 1T8PA 1EFTA 2VPWA 3HBAA 5IF3A 5EJ4A 3UUGA 3RRNA 3HO1A 1WIWA 1H4QA 3F7NA 3B40A 2B8NA 1THGA 4GZ5A 2AK3A 3NGXA 5HA5A 4R0NA 2OC4A 1RBYA 2F9ZC 3OIVA 1LNQA 2B1RA 1KD1H 5CNIA 4DJTA 2H16A 1UXHA 2EGHA 2QL9A 2XWBF 4BMYA 2DT8A 2FF7A 2IHNA 2XOKA 4OL9A 1Z4MA 2X0IA 2ZULA 2ZSFA 1Q2UA 2IP2A 4II2A 4B4OA 3GCDA 3G2OA 3LDUA 2ILVA 1MB2A 4AMYA 4ZGWA 1AQ6A 3PEYA 5LIPA 1R1MA 4JR1A 3RPEA 4AFNA 4XJVA 1HL7A 3BDIA 1GN8A 1HTTA 4DBVO 1R6TA 1KP2A 1XZ8A 4CVNA 4PDVA 1JCHA 5CW2A 3KJGA 3O3CA 1HQYE 3S2SA 2QU7A 1YCFA 4L3OA 3C5HA 3CISA 4I1RA 2Y4NA 1VKNA 3D02A 1MA3A 5CVEA 5MF6A 4EG6A 3IEXA 3WMGA 4KQ1A 3NAMA 3G4SV 1YZGA 5B58T 2XAGA 2XDYA 1X1AA 3WLKX 4MVYA 4CETA 3T1HO 4KITB 4JI3B 3PJEA 3FPCA 4PYQA 3ZYCA 1V5EA 3N8KA 3A26A 5FP0A 1T9AA 3C87A 5KWIA 1JZQA 4N9QA 3CZ5A 3KTDA 1HEIA 3K57A 3TG8A 4RPHA 3ZHXA 1NQOA 4RU1A 2AT1A 4L02A 2QWRB 4TS9A 2DPGA 2DN9A 4LJAA 2D7JA 1G1MA 1DLBA 3M1LA 4H0CA 1B73A 5HOEA 3CKKA 3Q5GA 1THMA 5BSKA 3KCXA 2WA2A 2GPAA 3U80A 2ZR9A 2HX1A 4YJKA 3I23A 2HXGA 4XDKA 2VOEA 4P83A 1KZ1A 4CKWA 3SICE 4AICA 2DM6A 1C4OA 1LD3A 3I9KA 4TLDA 1QR6A 4LXTA 3R7WA 4M1KA 4ZMBA 3MELA 1PZMA 3APOA 5JC8A 2VJLA 4GE3A 1DLJA 3BGDA 2QSYA 2QNIA 3ELYA 4G5RA 4MUJA 1YZFA 5C3UA 4O8CA 3PBKA 1O89A 2OXEA 1ZMXA 1R5BA 4P3NA 3GPIA 4F4HA 3ZV6A 4E22A 3DV0B 3H8VA 4RJIA 1G59A 1VE5A 3TRJA 4NXNB 3UK6A 1X1SA 1Z4PX 5JRDS 2Q1XA 1F14A 1SUWA 3EZ9A 4HEQA 1CP2A 4UV8A 3HB4X 3SKVA 2DYRB 2NVUB 4F97A 1NLUA 1AI7A 1ZEJA 3WNBA 4HNSA 3IPCA 3W05A 1XMOO 1YQUA 3TSYA 4X65O 2B30A 2UXCB 3B78A 3CJTA 4JB2A 4N6OA 2JFXA 4KTTE 1USGA 4HDSA 2VBGA 1XKXA 1WWKA 4JLVA 4DRYA 1JTEA 3EZXA 2C5EA 1FUYB 3U4CA 1Z3CA 3J7AR 2QTRA 3GQBB 5BNIA 2Q4PA 2WF6A 1TM5E 4K03A 3S06A 3QEJA 5KYUB 2DUMA 3RRYA 2RHWA 2IY8A