4X20B

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 140
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x20B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x20B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x20B01
5EZYB 2RHLA 3JATB 1JFFB 3UT5A 5EIBC 2VXYA 3JASA 1TUBA 4O4JA 5LA6A 3RYHB 5JVDA 4I4TA 4O2AB 5FNVB 5C8YA 5LXTA 5JCOC 3WGLA 2XKAA 3ZBPA 5KMGA 4X1KB 4X1YA 5LYJA 5IYZB 5JCOA 5ITZB 4TV8B 5KX5B 2R6R1 5JQGA 1W581 4M8IA 4U3JA 4LNUA 4YJ2A 4XCQA 5JH7B 5J2TB 4F6RB 1RLUA 2VAPA 1Z5WA 4IHJA 1TVKA 3N2GB 5MN4A 4ZI7B 4IIJB 3RYIB 3E22B 4ZHQB 3C8LA 4EI9A 3WGMA 3JALB 4O2BB 5EYPB 3ZBQA 5IJ9B 3RYCB 2VAMA 3N2KA 4U39A 3UT5B 3JAKB 2BTQA 5LOVA 4O4JB 4TV9B 5CA0B 5IJ0A 4I50A 4ZOLA 1SA0A 4O4HA 5CA1A 4DXDA 1RQ2A 5LP6C 4WBNB 3HKCB 4EI8A 5KMGB 3HKDA 5LP6A 1FFXA 3HKBA 2Q1YA 2R751 4DRXA 3JAWB 4FFBB 2RHHA 4O4IB 5J2UA 3WGNA 4B46A 3VOAA 5EIBD 5GONB 4X20B 3HKEA 5CB4A 1Z5VA 1W5EA 1W5AA 3WGJA 4TUYA 4O4LA 3RYFB 3JARB 5MN6A 3N2KB 3JATA 1JFFA 4YJ3A 2GVIA 2BTQB 5LOVB 4EI7A 3JASB 1TUBB 2VAWA 4ZOLB 5LA6B 3RYHA 4O2AA 2Q1XA 5JVDB 4O4HB 4I4TB 5FNVA 5C8YB 4X1IA 5IYZA 5LXTB 1FSZA 5KX5A 4TV8A 3M8KA 1FFXB 4X1YB 5LYJB 4HNAA 1W5BA 4KWEA 1OFUA 5JQGB 4U3JB 4LNUB 4YJ2B 5BMVA 5JH7A 5J2TA 4F6RA 3M89A 4EB6A 3ZIDA 3N2GA 4ZI7A 1W59A 4IIJA 2BTOA 3RYIA 4IHJB 5CB4B 1TVKB 3HKEB 3JALA 5EYPA 2RHOA 5IJ9A 3RYCA 3R4VA 4I55A 2XKBA 5MN5A 4YJ3B 3WGKA 5EZYA 3VPAA 3JAKA 3VOBA 3VO8A 4TV9A 5CA0A 5IJ0B 1RQ7A 4I50B 4WBNA 3RB8A 1SA0B 3HKCA 5CA1B 1W5FA 4X1IB 3V3TA 3HKDB 4X1KA 5M7EA 5LP6B 5ITZA 4HNAB 4E6EA 4B45A 3JAWA 3HKBB 2RHJA 4FFBA 5BMVB 3CB2A 4O4IA 4DRXB 4EB6B 5J2UB 5GONA 4X20A 3VO9A 3E22A 4ZHQA 3RYFA 3JARA 4O2BA 4I55B 4TUYB 4O4LB
chains in the Genus database with same CATH superfamily
1M2OA 3UA3A 3N2YA 3DCJA 1EDZA 1TA0A 2X6TA 3DZ8A 4UHCA 2WLHA 4GXNA 1TAUA 5F64A 1ZM7A 1GUDA 1FVXA 1U0RA 3IPRA 2VDKB 4RYDA 4OF4A 5CDYA 2H07A 3H19A 3N2ZB 5F7XA 1WULS 1JHAA 4QUKA 4ZVTA 5ENDA 2VJKA 4I2NA 4CLRB 3Q0IA 1DJQA 1KZ6A 3H5RA 3LXMA 3OWHA 1J4AA 5FA6A 4DMRA 2EX3A 2PH1A 1Q6HA 3NIBA 4D6YA 4EI7A 4M38A 1I0HA 3G5LA 5C7IO 2WF5A 5HY1A 4NAUA 2H16A 4Q3NA 4WESB 3BWMA 1Q86W 4HFJA 4QDJA 2NUPB 1D5WA 2ZTMA 1XMOB 2PZLA 3IXMA 5EQTA 3OKPA 3AG2B 1U0JA 3PC8A 3TSAA 5F1PA 4KG7A 2JI4A 2FPWA 1NRJB 4YT4A 4G0UA 1EVQA 3IQWA 3KQWA 2EOAA 2FQQA 2XCQA 3LGSA 3DZKA 4OGQB 1NFRA 2ZUSA 4YCLA 5EJ5A 2Z1EA 3BERA 4ZAWA 1FJGO 4E6PA 5ALEA 4XRGA 2OPHA 2I6TA 4TWAA 3WPXA 2SKDA 1W0JA 1YONA 4PCUA 1JW9B 1MU0A 1NVDA 3N0VA 1B2LA 1NQ5A 1HNZO 4RWEA 4BWAA 3TLGA 4A82A 3ABUA 5B1AB 1DHRA 3FHLA 3DDZX 5TB5A 4FONA 5DBIA 2BN4A 3E8GA 3E20B 4JT4A 2Q0OC 5KS2A 4XJTA 3DLBA 4OUDB 4JLNA 4QGHA 1OA1A 3T0IA 4CQMA 5BVGA 2O2GA 1NYTA 4WK0B 3E18A 3WR5A 3F3KA 3RVDA 9MHTA 5LMCA 4DLSA 2E76B 4YRAA 3RB8A 1B76A 3OMXA 1SQFA 4WKGA 1PW5A 4EB3A 3O4FA 4AY3A 2WMYA 2I2CA 1H2GA 5BR4A 3SGLA 2ZBQA 1QYDA 3IT0A 3ZDQA 5EAIA 4B17A 4G8BA 1UC9A 4M60A 3L82B 1Z3CA 1BQ3A 1Z56C 1VTKA 2BYTA 4Y9DA 1GKIA 1XAHA 3N07A 4FKZA 1X74A 3ZNPA 1NOKA 4UTOA 4RZ3A 3VISA 3BIFA 5BNFA 5EKUA 1Y5IA 4FZVA 1T1GA 2PG3A 2VRCA 2QKYA 5G40A 3V8MA 4R16A 2EHJA 2H06A 3B48A 4R5MA 1G7TA 2IU4A 3AUAA 5D87A 1RA4A 2O2DA 4QJBA 1YMUA 3FPIA 4MKIA 2YS8A 3UBTA 2ZJ3A 3PNLA 1Q2UA 2C03A 3U48A 1BVYF 2PGAA 1OZHA 3EEBA 2PI5A 2OQIA 1P1BA 1BRTA 2XMRA 1KQSF 1YQQA 2UZ0A 3FD9A 4EUEA 3CVUA 1IG3A 2PKXA 1M8FA 2UVPA 4AZ0A 4XASA 5LQMA 2CD7A 5EAZA 1N8NA 5JH7F 2R00A 3ME5A 2V03A 3GQBA 3L8EA 1K5QA 3WXBA 1LBEA 3D3EA 2VZ9A 5B3SC 3SK0A 4ZJZA 4XIIA 4ETWA 2Q29A 4RHAA 1GQFA 2HHAA 4NH0A 2XR1A 1VIVA 3B13B 2PFKA 2ZUEA 1VKOA 2LP4Y 5CFNA 2POQX 4IV8A 1F3OA 5FLXM 1K4MA 1SFRA 1UWVA 2XTJA 5ALMA 2ZATA 2HU2A 4YMIA 3Q1KA 4PSDA 3UO2A 3HZHA 4ARZB 1E3SA 3MCUA 5GTIZ 1W8IA 3RUHA 4G5YA 5DULA 3LLVA 3K5NA 1BFKA 1NR1A 1C81A 3BH0A 2FUKA 4WEQA 3GDFA 2GCOA 1ZC4A 5JECA 1P4HA 5FBKA 3TF5A 3K5OA 4QG3A 4MMZB 4NCAA 2G7MC 2BL4A 5DCYA 2NXNA 2G4LA 1K3UB 2ZCEA 1QUFA 1OCCC 4YP6A 2WF8A 1M76A 1EUYA 2FPIB 4WNCA 1NBMD 4AS2A 3KHTA 2W2QA 5HKOA 1OLOA 1I2MA 3MCTA 1HEYA 2BLLA 1YTLA 1GTZA 3MTJA 4DNXA 3LTNC 3A6FA 3QHAA 2YUAA 3MJRA 4YRBA 3ZTWA 1EUCB 1X1DA 3BXHA 3AESB 5EMKA 1T0AA 2AQ8A 1L5ZA 1IZ7A 1M6VA 3CTMA 1S96A 3OY2A 2HX1A 3MIZA 3N8HA 2C1EA 3RNLA 3F0FA 2OAP1 1ZLZA 5KHOC 4DL9A 1UBCA 1W6RA 4R0MA 5ADUS 3BE5A 4C14A 4Q82A 1SHTX 2LKCA 5CYFA 2RGEA 1ODSA 1U40A 1GZ5A 4G4WA 4ENUA 3IC5A 4M0MA 4TMZA 5HE8A 3TM4A 2FG5A 1JALA 3DMTC 1N5OX 4IICA 2VDWA 3BTSA 2LW1A 4S1OA 4EMTA 1KR2A 1ZGBA 4CL3A 1ZUHA 4NOLA 2C5LA 4Q9IA 2D1TA 5LC1A 2W6MA 3TD6A 3OT7A 2AJCA 1MC4A 1FDSA 1F0YA 2V7BA 1NZ6A 1T8RA 1Q95A 3K92A 2A78A 4H35A 1OXMA 3KTFA 1JPUA 4L9SA 4HB0A 4H7DA 3PCRB 1NUPA 2OAGA 3DJFA 3WQHA 5L3GA 4S0ZA 3ZCPA 2A9HA 3TW0A 4GR9A 3ITDA 1HA3A 5BV0A 4J9VA 1KOFA 3H83A 4D80A 2QLFA 3U3ZA 4HGRA 1RI2A 2C9CA 4KAAA 1P77A 3WG9A 3P9CA 1VXRA 1THZA 2GERA 3D8CA 4QUBA 3WLTA 3UOAB 3KOOA 3WRXC 1QTNA 2Y69C 3F73A 4J80A 1QE0A 2WJ6A 3A1TA 3AH8A 1Z17A 3FTPA 3CLSC 3PNPA 3OQJA 3M3PA 2VHCA 5GJVC 1YJBA 3PFNA 1OCEA 1GNTA 1YQGA 1EJ2A 1QM5A 1CEYA 4B2YA 1J21A 2Q0XA 1YBVA 2B5OA 2XCRB 3A7EA 2UZ4A 4JNKA 3KSRA 4L1KA 4AUKA 2I6XA 2I4OA 1ZONA 4EHNA 2OO5A 4FFSA 3JVEA 1I7DA 4ZZIA 4BQIA 4KQ2A 1BJRE 4M22A 1UM8A 3N2KB 1XZBA 2Y1EA 3OC0A 3UH0A 5T6MA 4BLWA 3WX0A 3B8NA 5AG2A 4F6RA 1T5HX 3ICPA 4TX1A 1UMDB 4C5BA 3CRW1 2RCYA 4B8WA 2WINI 4LWSA 3BBLA 5IAEA 2ZIUB 1WDLA 4BFUA 1SXJB 2G1AA 1R15A 3P0EA 3GWOA 5FAKA 2DY1A 1VIBA 4ABMA 3W3AA 3EVTA 3IB3A 2PYZA 1BDMA 1OH6A 4XWOA 3QG5A 5TMDA 3KTAB 1M8GA 1F1BA 4UUBA 1Y3DE 4CH6A 4P0QB 2G17A 5JS1A 1A69A 2VXOA 1JSXA 2JAOA 3S2UA 4MR7B 3W90A 4CLOB 4IL5A 3MT7A 3IHTA 1UFYA 3HXOA 4G5OA 4XDYA 5HF6A 4DARA 1CZRA 4KXUA 3RIMA 4CS2A 5DBGA 4XVCA 4IFEA 2RHHA 2IS6A 2RHWA 2XXJA 3CXUA 4BE4A 1CXZB 3OOYA 1ONPA 2YR0A 3P94A 1W25A 2OCAA 3QTCA 1NMEA 2IIVA 2BBWA 1I2CA 1HDJA 4C43A 3JYCA 1SVUA 2AMFA 1R50A 4DXWA 2PGXA 2UYNB 2I1WA 5FULA 3THWB 4EH1A 5K8VA 1NVXQ 5C31A 3IO3A 1SHLA 2QG9A 3E58A 4HNRA 2BMDA 3B77A 4JJZA 3FTFA 1YS7A 1H0KA 4JYYA 1L5HA 5IH7A 4CU5A 3P2KA 4C22A 1IHXA 2H8KA 2A1TS 2UXBO 2A1UB 2XGMA 3F90A 5LSAA 2J3MA 2V5UA 1R1DA 5L53A 2J3JA 4WCEV 3AP3A 4JITA 1Z68A 1D6JA 1IOZA 2GETA 4Y30A 2GJKA 3EOAI 2W2LD 1ODKA 5JSZA 2VEDA 2GBLA 1GSHA 4L57A 5K3CA 2ZJYA 3BD6A 3BREA 3I34X 5KTTA 2BISA 5JALA 3HCWA 1TQ4A 2PEYA 3CC4F 2JHGA 1BDIA 5G4KB 4YO8A 5EWMA 5IMBA 1ISGA 4YAGA 4CF7A 4GLJA 4H3HB 3A2MA 5F4BA 3EHEA 1ZD4A 1HNWO 1R6KA 4HNAA 1OGJA 1C1XB 4G8DA 3LWDA 4N6OA 4I81A 1YITF 3RGWS 4MQ6A 4WVLA 3VNUA 1OU0A 1X7ZA 2A9OA 3HWX1 3COZA 3RFRA 1IV4A 2KQXA 5CTJA 3MMXA 2ZKOA 4G1UC 4FFOA 4U7GA 4PFQA 5FUYA 4DCSA 2LIVA 1C8VB 4RMHA 2X5OA 2P6OA 1IUOA 3T7DA 5TJHA 5AKZA 4EBFA 2VDLB 3A4NA 2O8CB 1Z2PX 3SF0A 3UC5A 4ZVNA 1W88B 1JP7A 1D1SA 2WD7B 1U4OA 4ZI7B 3TX6A 2X2FA 5IVDA 3D2CA 5EQFA 5BY1A 1IM5A 4KE7A 5FJJA 1OGYA 1LLQA 4FSXA 2P6JA 1SC5B 3CJHB 2P7TC 4KVZA 2VHWA 3PNQA 3EPPA 1A0OA 2QXYA 4O2LA 1S9HA 2JJ1G 4YQEA 3C6YA 4Q48A 2Q5EA 5DBEX 1A72A 3KDSE 1T26A 5ED0A 4TV8A 4GBJA 4UHHA 4J90A 2GGSA 3R8FA 2X0NA 1P2BA 1E0SA 3F6SA 4F9EA 3ZE7A 1B16A 3ZWDA 2EV9A 3C8MA 3MJVA 3I6BA 1PNMA 1Z36A 1Z8DA 2EL9A 1A88A 5JDCA 4OJNA 3ONFA 1G9XA 3VDMA 4TM7A 4LBYA 2GHTA 2CFCA 3U7IA 5CVCA 1CK4A 2GYVA 2HD4A 3ZC3A 1EXMA 3HJGA 2VCYA 5KIAA 5B58C 2Z3YA 3PDJA 1LB1B 5T41A 4TTRA 1E2EA 1HMPA 4F1WA 3CZ9A 1RS0A 3RKUA 1YR7A 3I2JA 2BMAA 1JA8A 3SS7X 2O57A 1NBOA 1BEZA 1NP3A 3HJFA 1A8SA 2XE8A 2IYPA 2TSYB 3ZRWB 1J5EB 3VC1A 1N32O 4OHBA 2IY8A 2OBLA 4IWNA 1Q21A 3L7LA 1OIVA 2HA4A 3OUSA 5I8WA 4JI8B 1DVRA 4K28A 2BW0A 5FWXB 1KYQA 4JN6B 2LP7A 3IPXA 2UXNA 3LFTA 4LTNA 2DLCX 1IY1A 2RH5A 3CPEA 4C08A 1I2BA 5A02A 2AQIA 3GGGA 1NW9B 2Q4OA 4PRKA 1XVUA 3TR5A 3WWDA 4RVNA 3TL3A 1BO6A 1ZXLA 4EX7A 1NNEA 2NSDA 4DMCA 4JXKA 2WJYA 5FOSA 1JX6A 3PKZA 4BV3A 1N3BA 3TFQA 3SY8A 2Y77A 2FPOA 5B1DA 1IXRC 4EGAA 2IYTA 5K03A 1F4PA 4UD6A 2ZRFA 2FWNA 3F6YA 3EISA 4E08A 4UQOA 3ABMB 5CLJA 4A92A 3FDIA 1EFRD 3ABRB 3WKDA 3M9LA 5GM2A 3QU5A 4LBVA 2VCEA 5J9PC 1R0ZA 4QYWA 3THYB 4BIMA 4EITA 1VL8A 4WXYB 1J9ZA 3C1AA 2I2BA 1VA5A 2B8EA 1JAZA 2ARKA 1NM5C 3OLYA 3LDAA 3FSEA 4NZOA 4IINA 5K4GA 1JIKA 3O9MA 1K9SA 1SHZA 4Z4QA 1F4VA 4CMIB 1LVHA 2YRXA 1H94A 4IJWA 1KMCA 1D6NA 3OZAA 3QNUA 3T7CA 3PWZA 4ESEA 4CDRA 1FEZA 2JJ2D 3D4BA 3C3MA 5GJCA 3DHNA 5F51A 5GINC 1RKXA 2JKVA 3W5DA 1IUKA 1H3NA 3GJSA 5F2NA 4OQXA 2B4AA 2DQSA 1IDOA 2YYZA 1FA9A 1N5DA 1TK9A 1ZGJA 5KYXA 4Y2HA 1NW7A 3COSA 2PBFA 4GKKO 3LNMB 2V1XA 4AJHA 2EEPA 5IANA 2HKIA 4NVRA 1YAHA 2X8BA 4BNMA 3AX6A 1M1NB 4WADA 7REQA 3GMIA 1R4NB 2WSSA 1P9WA 4FYPA 3GW8A 1WR8A 1T2NA 1FNKA 3FDZB 3MMZA 1P1KA 4R68A 3QFCA 3PEWA 4XVQA 4IP0A 4TTAA 4QTTB 2H9IA 2MDTA 2N47A 3OFVA 5F1YA 1AI6A 4XFJA 1X7WB 5E9AA 4EHLA 1N1MA 4DW8A 4MWDA 3FYUC 4A8HA 1WUTA 1WXDA 1YI1A 4KXLA 1BDBA 3TD5A 2O0HA 3S0WA 1KTIA 2X2PA 2I6QA 4YPVA 2J6CA 3BTOA 2D1YA 4NKGB 2PZMA 3N87A 1WB4A 3UAOA 3T15A 4C6SA 4O1MA 5FI0B 3KZCA 4YAFA 5LQSA 5EGNA 2LBWA 2QNBA 3T5GA 2VPXA 3TLCA 1XVLA 2NZYA 3HEMA 3ETGA 1ZIDA 4YR9A 3HTNA 3BORA 4V38A 1ORIA 5EJAA 4GMKA 4JR1A 2FWPA 4NBKA 1OYYA 1ZICA 3GGOA 3HB5X 5TF4A 1ZGGA 2CNWA 2PX4A 2XE6A 1SU7A 4MWSA 3G4SV 3KM0A 5TMBA 5T57A 2OCYC 3HVKA 3WB1A 2CT8A 4X92A 1X9IA 3QXGA 2CLKB 2LBPA 2CL7X 4LI3X 2E4XA 4KQHA 3WJRA 3HGQA 2WD9A 1BH6A 2V7TA 2VPWA 2YZMA 1I5OA 1OJLA 3AR9A 4M9UA 3BHMA 2CJWB 3I9NA 1X59A 1MVLA 3W3AH 5JH7A 3AL2A 3RYIA 5BRNA 1O6FA 2ZR7A 4GDMA 2K4MA 3FA2A 4YRMA 4N5HX 5KOJB 4IO0A 4A8JB 2ZAGA 1TJ3A 3FPEA 2WHEA 2PH7A 3ET4A 1XVVA 4B3IA 3GUUA 4KLNA 3OZDA 4FYHA 1ATZA 1HI9A 4REOA 5FWAA 2AN4A 4QZVA 1HDRA 5I7AA 2QLBA 1K75A 3LDEA 3CC4V 1QGYA 4KNWA 5AVWA 4FBMA 2Q8VA 4TM8A 4R3WA 2HM7A 1YF2A 4FPXA 3OE7G 2IC5A 4E5SA 3OM8A 1JE0A 3AW9A 3L71H 1KQNA 1ZK2A 4QUJA 5COBA 2GKOA 3DLAA 3K12A 3SF8A 4RVHA 4MQ4A 5FPRA 3D31A 3NNDA 3GLRA 1YDFA 1O97C 3ZJTA 1ODTC 2C2HA 4F38A 1YITV 2MOKA 1I5EA 3D64A 3SWWA 4F96A 1MIOA 5J1SB 1EZ4A 4JJEA 3V4DA 2ZF8A 4U3JB 3I72A 2QEXV 3TNYA 1PL4A 2WJVA 4ZC8A 2FAXA 4ZQFA 3T06B 2RI6A 3UWOA 1QG4A 1U3FA 1EHCA 1NUAA 3NWJA 3FB1A 3N5CA 1NUTA 4XEHA 3B52X 2WIFA 1UKEA 4CCYB 1OE0A 2OP1A 2O8VA 5IYZF 5JAZA 5BYKA 5ARDA 1C30B 5BPHA 1ISIA 1PGPA 2QMHA 3T9FA 4FM1A 2EIKB 1S3GA 1WSWA 4XUDA 2CXHA 4IMIB 2VWQA 1MJGA 1XRNA 1OX4B 4P82A 4B4KA 2YWCA 2D2XA 1KYTA 1GZSA 3QBTA 4HAYA 1XBIA 1I8TA 5JAIA 1WDWB 2BVNA 2W71A 3GAMA 1NI3A 3CJTA 2ACKA 3P9RA 4Z4GA 3N4YA 3QVVA 3ADPA 2XB9A 4DO2A 4HDKA 3EZ7A 4A2PA 1EFKA 3E15A 4M6WA 5GONB 1IEQA 2IU3A 1OCOB 4CM1A 3P2IA 1NSYA 4JAVA 4CUKA 5C8YB 4IRUB 3CNHA 1KH1A 4EFMA 1T2EA 1J8QA 4MVWA 2LTAA 1N9GB 2BM1A 2FZVA 3RJ5A 4CG1A 2DT5A 4D42A 1AGYA 3G2IA 1G21B 2AR7A 3G8AA 1EVEA 2AD1A 4AX4A 4NUTA 1C9DB 4X66B 1VQ8V 1I2ZA 3MINA 3W9YA 5G0SA 5KNLA 4Y7DA 4DIFA 3UT5A 4LXXA 5I7OA 3UENA 3JY6A 4Q19A 1YULA 2HRUA 2PZAA 3ASYA 2G40A 1KI9A 5A1JA 4RQUA 2XUHA 2GKGA 3KCNA 3NMUC 5JW6A 1NWHA 1ISRA 2N0SA 4RJKA 2PWPA 4EHAA 1SRYA 3JQDA 5G41A 3WNQA 3ZN0A 4K87A 1SVKA 4UD2A 1R3KC 4RFSA 4RMNA 5IN5A 4BWYA 4WZBB 1TZJA 5CMUA 5JZMA 3UYLA 2ZKLA 2PKYX 5A3RA 1ZSPA 1JXOA 4I4TB 5KYUA 2JFZA 2ZBGA 4MQ5A 2P5OA 1GTOA 4P0PB 2CLOB 4PSKA 5F1OA 2I6RA 2XITA 3L9XA 1T9ZA 1DBWA 3D5TA 3JWIA 4OKNA 4QLAA 3EXIB 3LFHA 1AKYA 4N8SA 2UYPA 4E21A 4KH0A 2JD2A 4OQEA 4BR6A 4DC1A 5LN1A 3FCOA 1CZUA 1RHRA 2H48A 2GPYA 2CXXA 5LZ9A 4HH0A 1E7YA 1BXZA 3MMPA 3F0GA 5I9TA 5IJ9B 4V0LA 1AJNA 2WWYA 1QV6A 3FSRA 4IDGA 4RVUA 3S1AB 5CT9A 2QTLA 1JIQA 2NUAB 3E86A 1H2NA 1W3EX 3E9MA 2QX8A 2IUYA 3ZBUA 3VCZA 1FXKB 2PL5A 4CR6A 1RVDA 1TQ2A 3F4BA 2DTXA 3GFGA 3GFBA 4A0QA 3LDTA 2J41A 3FSGD 1ISMA 1GTL1 5ENZA 4RK6A 4MS2A 5L3BA 3UMMA 2W8BC 1C3JA 1E96A 4UCRA 4G1FA 2EIMB 3DMPA 5M04A 1FUEA 3O2QB 2HS4A 2IEIA 3VHXB 2FOIA 3ABTA 2IOYA 2VF5X 3K2XA 1QGED 4HGOA 3UANA 4C4OA 4E30A 3KZXA 5EZYB 2QOEA 4E51A 4L76A 1CLIA 1TD9A 4HO1X 3GHZA 2I0FA 5ALTA 5LLDA 1QRUA 5JD4A 1QIHA 4YMUA 4FR0A 4L8GA 2JNWA 1I80A 2XXAB 3RGGA 4FINA 1U5CA 2EP7A 1G0NA 4QE3A 4KIGA 3N9IA 1DELA 4M9CA 4HG2A 1U7ZA 5C7YA 2ZINA 2EW8A 1EDEA 2WLLA 3L9DA 4ND2A 1QH8B 2WV9A 1ZH2A 4MW1A 2ZYRA 2EBOA 4G41A 1IOVA 3WLHA 1YTUA 4LQCA 1AKVA 1TRHA 3B6EA 4Q1CA 1UC8A 1VKZA 4F11A 4J6EA 3NHFA 1OPXA 3D6MA 3OX2A 1W52X 2FLKA 4BO5A 1LRKA 4CUZA 1GDHA 4PPYA 1AQYA 3TVYA 5A4FS 4P4UA 4RLHA 1FF9A 1ZR4A 1S7CA 4CKCA 3BJIC 3PUZA 3THXB 4MW8A 4FJ2A 1NVPB 1LBTA 4HS9A 2XWBF 3S02A 1GZ7A 3MUOA 2HSWA 3FFAA 1GO3F 3H5VA 5AVQA 1Z5PA 4KODA 4TV9B 4QQFA 2F1HA 3WYEA 1I2AA 1DC5A 1NBEA 4POAA 4JJFA 3HU3A 1IULA 4RJ2A 1HTTA 4X65O 4LXTA 1GV0A 4QJFB 1CQIA 1P7PA 3AG6A 3D7LA 3FBTA 2XKJE 4ER6A 4UARA 1XTTA 4QDOA 3AQIA 3RE1A 5CVUA 3DCNA 4BFVA 4F4HA 1DTOA 4GI3A 1RHKA 2WTNA 5I45A 2I3GA 5JV5A 2L18A 2DQ0A 2W6NA 1YL7A 2FPMA 2ZRGA 4MITA 4C7UA 4M1YA 1E6LA 3COYA 2B4TO 1P18A 1NMZA 3JRNA 3HABA 3KC2A 2ECKA 5DCUA 1M54A 5LHIA 5HUQA 1T36B 4D45A 4ZJPA 3F3YA 5A9SA 3NVIB 2Q6OA 3C8HA 3ZWWA 4KI7A 5IKEA 1SRQA 1U0FA 1ZSNA 1DPFA 4OLHA 3OZSA 2QU8A 2ZJ2A 1F7UA 3W4KA 4S3MA 4TRNA 1ZESA 4F91B 5JS2A 5CBHA 1RXSA 5IKPA 3OEHA 2EU8A 4QAQA 2LXNA 3R3XA 2RKBA 3O0TA 4MTXA 2ZK7A 4JTAB 2P8JA 2NXCA 3MN1A 3CF0A 4NX2A 2H1SA 1IXMA 2ZVQX 1ORWA 3E61A 2JEZA 3LYUA 1BFUA 4HWGA 5FJ4C 1FYVA 3GXBA 3VU1A 1OKKD 3RVSA 3FJYA 3AJ8A 1X0VA 4MW6A 5AVJA 5F76A 1U0EA 4WL0A 4XYEA 2W00A 4ZZ1A 4ONEA 4UXNA 2FPXA 4W9RA 4RDCA 1EP2B 1AF7A 3MWJA 4FNAA 1YRHA 1LCIA 1VHLA 4GT1A 2QJ1A 3SXPA 3LY8A 3PQ6A 5FOVA 3TOZA 1RWNA 1NW5A 2QRVB 3P4UA 2AZDA 4GSKA 1E1MA 3B6JA 3S27A 3GJ8A 4O2BF 1OTYA 3PG5A 3UK7A 1JT9A 1Y6JA 1C14A 2B34A 2C4VA 1SU6A 5KAMA 3OONA 5DGXA 1CVIA 2XDYA 4XX1A 4UQLA 4S2EA 2ES4A 2RIPA 5BNTA 4ZZ2A 3NM6B 4DR3B 2AOWA 2IL1A 4YCCA 4ZARA 4DIMA 2C9BA 4YJ2B 3ZEIA 1EMDA 4QT4A 4ICGA 2TMGA 4B4DA 7AT1A 4JOBA 4HMPA 4FEAA 1RQ7A 2ZYSA 3FBWA 5CA1B 4LRQA 5BW8A 1EPUA 1S3JA 3C9TA 3AZPA 1KKDA 1NT4A 1VQ4F 2YNMA 5FPKA 1XE3A 1F5SA 2QW8A 5J2TF 3G6BA 3WK6A 1CSEE 1BJTA 2XB4A 3MZ0A 4NEHB 4TSFA 5CA0F 4URYR 4P7FA 1UAAA 2C3YA 1OTXA 4WMLA 1WG8A 3RS2A 3UKDA 2GT1A 1Z6TA 4FM2A 3EBPA 2XNHA 3I5AA 4D4MA 2VQEB 3IJ4A 1VHTA 3ABKB 1PD3A 2Y1OA 3KEQA 1HNXO 3IAS6 1Q0SA 3U1BA 4O4IB 4ZCIA 2EKQA 5KUKA 1ZKDA 5LHGA 2GASA 4N82A 2VHEA 1F1JA 1KIAA 4GL2A 3SM3A 1EFHA 2WT9A 4FHGA 4UDOA 3CCUF 1LSUA 2R1TB 2DTDA 4AMUA 4IIUA 3BMQA 4YO7A 3LUJA 3PGKA 4P1ZA 4A23A 3ZOPA 1WU8A 3N5KA 3OZXA 1Z16A 2C5SA 1GN8A 2P8SA 3D8TA 1HEUA 1IZ8A 3GRUA 3G9QA 2OYQA 1GKKA 1P0CA 4BKOA 3N76A 3J81N 4HDOB 3N86A 4U8HA 4PLYA 1S9DA 3OGCC 1Q82H 2UXCO 2YINC 4DQKA 1NN3A 4UFNA 2ZREA 3CA8A 4KBFA 3A14A 3FVQA 1LU9A 2DCUA 1KSJA 4R9SA 2CKDA 3EGWA 1RCTE 2NSHA 3CN7A 3KYDA 5DH9A 2D8MA 2WU4A 3MDSA 1XYVA 3JQ7B 1ULBA 5TJ9A 3Q8MA 1T9AA 4U3FH 4MGIR 4C4RA 1C7ZA 2Z2KA 3M4JA 3H1JH 3RS5A 4ABTA 1D2EA 2G8LA 5E9JA 1ZOOA 1G6OA 1DT9A 3O8DA 4S24A 1G291 1UXHA 4ZDIA 5TY0A 3RTDA 1NY6A 3HKDB 4TYQA 4C20A 4R8MA 4FCWA 1EFUA 3O3NB 3UY4A 1ZC3A 1CUGA 3B6KA 2WVJA 1EUDB 1WVMA 2JASA 2YIVX 1GPJA 2ZJ7A 1E2UA 2O23A 1ZGHA 3ZZTA 1AK2A 3REQB 1PR3A 4GBMA 4X1KB 1HO3A 1NULA 1BMFA 2V1DA 3AT1A 3RVNA 2IEYA 3D54A 5IJ0A 4L5JA 2PA0A 2QRZA 3IOEA 2IF0A 3RTBA 3EK2A 2E3CA 1BVUA 4B84A 5FL7D 3D7NA 3U09A 4NABA 1JKXA 2J9YB 3GJ5A 1VKHA 4OJMX 1ZMTA 1XB2A 1M0EA 3GT0A 4B4UA 2VL7A 1TI7A 1NBAA 2YUIA 1LLFA 4JOQA 2BI4A 4EPVA 2CTQA 1FFBA 3GBPA 3NJ4A 1XPOA 3HYSA 2DWOA 1RXEA 1VH8A 5AVSA 2J32A 1JU3A 1CLUA 4PDVA 3WIEA 3G88A 4CBVA 3C3SA 3C39A 4X64B 3PPIA 4MLPA 2GLUA 4G4SO 4OBBA 4CL0A 4QBIA 5A2QM 3H42B 2ODTX 2R5FA 4D3FA 1VHWA 3H5AA 4PLHA 3BE4A 3OIVA 4LRSB 3AY7A 1LUWA 1V5IA 3K5WA 2IYYA 1ZM4A 2OV2A 3EA0A 1VXOA 2CY0A 4GEKA 3VPSA 5ENVA 1ESCA 1SCKA 1E89A 3MWDA 1RNLA 2W5UA 1QQTA 4LF4B 1Z5ZA 2F1IA 3HK2A 3DYVA 5B30A 1KEKA 1OHHD 3PUJA 4KR6A 1KL7A 2BKAA 4PFKA 1L5SA 4Z6KA 4C1NA 2PUVA 3HI6A 1U7DA 2ODQA 3P96A 1Y76B 1AOXA 3N6VA 4LOIA 4LSGA 1IM8A 1VBNA 1IATA 3BA8A 4LV8B 1BE6A 1E20A 1QORA 1Q7RA 1JG3A 5TARA 3CCJF 4MRMB 2Z2XA 2VF8A 3LUPA 3AIMA 3PX2A 3OKCA 3LTEA 5J23A 4MUJA 4YI5A 1QJCA 1NTZH 3VR4D 1RJ9B 1FD9A 1V8PA 4WBNF 2WZCA 1E9CA 1G3RA 1CUWA 5EHQA 3GCXA 3AK3A 2KWIA 3APOA 2R6CA 3U5ZB 4J11A 1N5KA 2QD1A 1TZKA 2GLZA 2FGYA 2WIGA 4JOCA 3WGTA 4OM7A 2F8MA 4F9FA 1AP6A 2IXDA 3SLKA 4HHEA 2PQ6A 4GBED 1YOBA 4DDWA 3SYPA 2D5CA 4RGYA 5IYZA 2G77B 2W58A 1KXJA 3FDJA 2XYQA 3H8JA 2QPLA 4X54A 4JBYA 4CT4B 1UFOA 3VO8A 4UBKA 1XEAA 2V7QA 4XX0A 1KFBB 1NATA 3TL2A 4E13A 5C37A 3NAGA 1VB3A 4DV3O 1AUPA 4FFRA 2K9PA 3VVLA 3QTTA 1GL7A 5F78A 3OETA 3NTQA 3AG1C 1DAKA 2DAPA 1XYGA 2HRRA 4QQ8A 1F12A 5CFZA 1VJ0A 1U6JA 1GK9A 3KFLA 4BAGA 2HRBA 1YUMA 4RSHA 3EEOA 3VH2A 4U02A 4IMJB 3IE2A 2VDUE 3KQOA 3UXHA 2WAMA 4ARBA 3KBBA 3K5PA 1SWWA 1VCMA 4CIVA 2JH8A 1YB2A 1MAAA 3D3IA 3SJCA 2HH9A 1B73A 4RGVA 1TADA 1P2VA 3EIEA 4FYIA 2EARA 4AJJA 3OOSA 1K8YB 1DIOB 3NNNA 1JNXX 4PGAA 5BSTA 4YI3A 5KJ6A 2PE5A 2PZEA 5DYTA 2HP8A 2FG7C 4HMOA 4JLVA 3DE1X 2BEVA 1JEQA 1SKAA 2AI2A 4HZGA 2P5SA 1XWIA 2A3RA 3CV3A 4RQFA 2SCUA 4LF9B 4FLVA 4CTOA 4N5IX 2OBYA 4BO7A 4H1VA 3W05A 4LE0A 2OCCC 3IUSA 2P79A 4O1HA 1BQ0A 4GUDA 3J81M 4FK5C 5EFOA 2QW1A 2SECE 5LZ4A 4BNWA 1HR0O 2BFAA 2WY2D 4X3CA 1E9SA 1PNTA 3ZQUA 3VPDA 1JVNA 3I09A 1EN6A 1KMIZ 2ZITA 1QHFA 1HQYE 3A3KA 4GPEA 1XZJA 3EWSA 2R48A 4RYLA 3UB4A 2Q1YA 4MO9A 1C4OA 1ZL0A 2PXCA 1JVSA 4GX1A 1S5LZ 2X8LA 4P4TA 3X2FA 3AVWA 3UCXA 1OCRB 4CJXA 1XKXA 4HNQA 2VSNA 3RAJA 2BD0A 1P81A 3P27A 1M73E 1BQEA 4N8EA 4R6WA 2GPTA 1BSMA 1GTSA 1YUNA 1VQ4V 4P3YA 3TXAA 5LKRA 4Q9LA 3TLMA 3E70C 3HB4X 3OJEA 2J46A 2MMCA 4ZYZA 1RFLA 3D59A 2IHKA 3ML0A 1GPKA 1YQNA 2YCBA 4ZYWA 5EJ6A 1E1RD 4BV9A 3TSOA 1NJ2A 5A4AA 1KDRA 3HUFA 1T1JA 2N1BA 2MINB 1J6UA 1KMQA 3X1DA 3K0HA 2P69A 3M1IA 1GRJA 5JHHB 2OQVA 3ND9A 3Q3EA 4WTOA 4OGLA 4ZAYA 2JG3A 3CCUV 2BMVA 3I2GA 3HXQA 2ZIAA 2ZVJA 3LYBA 1VBMA 2RGNA 3E7WA 5AVTA 1II0A 4MZXA 4LF7O 4Q37A 1Q19A 2GOYA 2EFGA 1BA2A 1IBKB 4A4DA 1QV7A 2FZ5A 1YVUA 3HO1A 3GRRA 4QXAA 2RI1A 1ZM3A 2A3NA 1NDHA 1QRAA 2O0LA 2MTBA 4I50B 3PSAA 3FTNA 2HO4A 3W79A 1Z7EA 2Z2ZA 2ZB3A 4QU9A 3O74A 3HADA 3NEJA 1Q92A 1TTQB 4PC7A 2Y1DA 4PVDA 1PT9A 2HVKC 1KO1A 1FMLA 1JG7A 1H2XA 3R9KA 4AS1A 4IDOA 1GQYA 3LOUA 1XRGA 2IV2X 3OQOA 3HZRA 3UOGA 5E1AC 2PJDA 2C3OA 2GHIA 3HB1A 2WKPA 1USKA 4KOEC 2JD1A 1QP0A 3AETB 4H3KB 6GPBA 4RK1A 3RJ9A 1XDSA 3I5YA 2ORYA 2YI8A 4DB2A 2A33A 4BGIA 1P49A 3Q5DA 2ZB4A 1B6SA 4BFXA 3RVJA 4DUGD 1Z07A 3ADDA 2UZHA 4MYCA 4RF5A 2H17A 3CRAA 1XTZA 5LP6B 1HSZA 4AN4A 2V4ZA 2IH2A 1Q1EA 2KW5A 1HDCA 1ADYA 2X7JA 4O4JA 2BFWA 5IZCA 2QQGA 2Q2NA 4R0NA 4Q24A 4UJ5A 4FILA 2NIPA 3R7AA 2HUNA 4Z4FA 5ITZB 1Q43A 1HRDA 2ZDQA 2M6YA 2CFTA 1KFCB 1DEHA 1HDXA 4BLUA 1ENPA 5CH3A 4QQRA 5G3ZA 3GP5A 3DDHA 3DXRB 4AECA 3B09A 1VQKV 4RA6A 1YC5A 5J40A 4YJGB 1KY3A 3F7TA 2CSLA 1I1OA 4CCWA 4QVIA 3PDIB 1Z4QA 2OFOA 3EQ8A 4UFOA 4UUMA 4PTLA 2HLDA 1ZGAA 3G0CA 3TLAA 1OFTA 2R79A 2ZBPA 1FS4A 2WHPA 4FIDA 4B81A 2FEKA 5DV9A 3WYNA 1YZTA 4L3OA 1EXVA 5HYVA 2Q9CA 3EGXB 2J5BA 1G5PA 4G85A 3LH5A 4X6UA 3VDNB 5IYBO 2Y1FA 3IC9A 3VV2A 4YRFA 1J2TA 1MJ5A 2O14A 5DMHA 1C5KA 3O2NA 2O52A 3JW8A 1BWRA 5CFRA 3E23A 3L6BA 5BWNA 2QUKA 3QMVA 4AMZA 4N39A 3COPA 1R6DA 1FQJA 4ZAFA 2HP0A 3BCRA 1RXVA 3ZDCA 1ZW1A 1PTJA 2HP3A 4V0KA 3WGQA 4B47A 3ILVA 5AKIA 1A76A 1W2WB 4FFBB 5AK6A 1VPVA 5KSPA 2QTNA 2PFGA 2BFCB 1W85B 2ZYVX 1T4CA 2I6UA 2REXB 2HREA 2NYVA 3Q3GE 4G5XA 4IQ8A 1VQVA 1JB9A 2JGAA 4QO7A 2G1JA 4KXMA 4B3MB 5EJIA 4KUEA 2GEFA 4V1CI 4X1YB 3R5HA 4KAJA 1HC7A 4ZQGA 1PX0A 3M6XA 3CCJV 4KLZA 5F9HA 1UJBA 2ZU0C 4OXKA 2H2GA 4MO2A 4D4IA 2CWDA 2ISCA 3ZV6A 4W5RA 4C82A 3JQ8B 2F43A 3G0IA 3TZQA 4QO8A 2RAFA 3F78A 5K3DA 4DY6A 1B7GO 1KFEB 1V8OA 3OT4A 1PZEA 4O2BA 4BIIA 3TRFA 1CUBA 1ZAKA 4J0KA 4GUNA 2E4WA 3OPYI 3BY6A 3PUWA 4JSRA 1UMKA 4FLMA 2HGZA 1SBIA 5FNVB 1N2JA 3T1NA 1PSDA 5HKLA 4DIDA 1KVTA 4JBLA 1EK0A 4CKYA 1EM8A 1JEDA 3JWPA 3LVFO 4CIAA 2Q9UA 1L5KA 3QEMB 1ZNXA 3MEQA 1UL1X 1QYIA 3GJZA 1ZQ1A 3A11A 1DPGA 2ATIA 2GN4A 1I4OA 5AKKA 3X2SA 1I24A 1H05A 2OIGA 4JJAA 2VNKA 3TW6A 3D2LA 4PGHA 2YHBA 2QV0A 3EZNA 1E79G 2OIEA 5J2TA 2C8KA 3JQ9C 1CUEA 2C00A 3GWGA 2IY7A 1ZCBA 3FZYA 4BXOA 4PZAA 1N2GA 1FSPA 3GHHA 5CA0A 1ZI8A 1DT3A 3ADBA 1T5IA 4Q7MB 4M37A 4PZYA 1C9JA 3A1VA 4GGPA 4R05A 2XDAA 1DQRA 1H2SB 4DMLA 4YMGA 1NVVQ 2C78A 2PS1A 2W90A 3LPMA 4GBGA 3C5VA 1JLKA 3BJEA 4KXYA 1XNQB 5DTJA 2YMMA 1DQSA 1X7PA 4ME6A 4XIJA 1VPTA 3N2EA 3DXZA 4QARA 3SFTA 1GNVA 1QAQA 1E9FA 2ISSD 3RUDA 1PR4A 3IPAA 2RHGB 3JSAA 3FD8A 4HVCA 1EFLA 4G0XA 3WC4A 2C96A 4D0NA 3ITEA 3FM9A 3CVYA 1KI7A 5E7JA 3WGJA 5K7SA 3G02A 2CLFB 3OECA 4NXNO 3MRVA 4JBGA 2IHNA 2P7HA 2O7NA 4L73A 3D43A 4XUEA 4WDQA 4RCZA 4C6TB 2FRDA 4F8YA 3CYQA 2FZ4A 4EYSA 1EINA 1A8QA 1U1EA 4HBGA 1YIJF 1W2BU 4DR7B 3KIZA 4D4KA 4IXWA 2OGWA 1G4UR 1CQWA 3TI7A 1MB3A 4ASUA 1MN6A 3D6FA 3IP6A 4LHWA 5CBPB 1ZITA 1F4LA 3L4BC 2CLMB 4RXMA 4QTZA 2WFMA 2O2SA 2UUBB 3DZBA 4OM8A 2FWMX 3QXSA 4X7MA 4ND8A 4B76A 4Z3OA 3K31A 1ZJ4A 4H18A 2PGNA 3CX5F 3LG2A 5DISB 3A37A 1G7SA 2XQFA 4OA8A 1T0UA 2UZ1A 2ZYAA 4YMSA 3RANA 2HFJA 2CWJA 1QC5A 4KBYA 4GH5A 4JQYA 3UZUA 1XJQA 1SQ5A 2VTBB 3OE1A 2HHHO 3OCUA 4X00A 3CWQA 1ZD9A 2O0MA 5CEEA 2QMEA 1FSGA 3QOWA 4CMGA 4LYYA 2QSUA 1S4MA 2F4NA 2ZTUA 2NU6B 5C5EA 1N33B 3MW8A 3MWEA 3D8SA 1ZJ5A 2Q7XA 4IFBA 2E49A 1DBPA 3OH8A 4QOFA 3BXEA 3H2YA 3HPLC 4BNNA 3AHJA 3PC4A 2IJJA 1VBKA 2W7TA 2B20A 5GM1A 4FFNA 2ZSUA 4Z54A 3IA7A 3ZLBA 1VE7A 2PO5A 2G28A 1T5EA 4YRQA 2CHQA 1KJ8A 1PG2A 1UWCA 1KEEA 3NANA 1V5GA 4R3UC 1NKDA 3DBVO 1P2FA 3V48A 4UCTA 5IF3A 2QN8A 3FHJA 4OLAA 3Q7RA 4P8RA 4J7JA 5F7OA 2JIMA 2NN3C 1XMOO 1CY4A 1ZIXA 1LH0A 1EVYA 2F90A 2AA3A 3FBAA 3OIFA 4BNVA 5H68A 2W9XA 1NIPA 1I5RA 3I4FA 1TW2A 3MGAA 5EG5A 5CDGA 4TTPA 3QPBA 4FFKA 4Z49A 2IYZA 3I5XA 1L4HA 3KHSA 2X23A 3AB3A 3FGNA 3NWPA 5I9LA 1KYVA 3NHBA 4W9NA 2QT1A 4M7RA 3WJQA 4L78A 1VF5B 4FE7A 4CH4A 4D46A 2XLBA 4TTQA 1S8AA 4K88A 4A0RA 2DUMA 3F5QA 1JHYA 3IEQA 1RWQA 4PA7A 1QO0A 4F86A 1IV2A 4LSZA 2C9YA 4LY0A 1IZ9A 4I3HA 5CM8B 3FXAA 4L50A 5JXGA 4D9GA 1ZVMA 3RDPA 5LWQA 4UM9D 3ZWYA 1OJ7A 1H2MA 3KKNA 4LTDA 1N1GA 3QWBA 4UXJA 5IYCO 3GLIA 3C45A 4HSEA 4WBNA 3U3MA 1I1HA 2J8ZA 3T3HA 1RTTA 3L02A 3A9WA 1EUQA 1BOFA 4MUHA 3I76A 1PV4A 5L3ZA 3TCXB 1EN4A 2WTBA 1PFQA 2O5EA 3GEEA 3FNHA 2YVLA 5IARA 2BHNA 4OHUA 1I7PA 1IBMB 1DX9A 2UXDB 3BXOA 4MAMA 2G83A 1L4YA 5I9MA 1ISFA 4I1UA 2IXTA 4EY7A 4HUJA 4OFZA 2HJGA 2HSJA 2ZI9A 2QTBA 4MQFA 5H5NA 5J47A 3P97A 3LQFA 1TF7A 1VYTA 4D9IA 3RU3A 3QVGB 3EMDA 4X5OA 2WJ4A 2CLEB 5DBOA 2EBUA 1V26A 1D03A 5L7TA 4E4EA 2ILTA 1TZCA 2DBQA 2IZ0A 4HY3A 4EB6A 1ORTA 3OQIA 2YZKA 2PYIA 3BZWA 4ATNA 5IABA 3DNMA 3WDMA 1CS0A 2CN1A 3OLVA 1GCAA 1H2LA 1D5AA 4S35A 4ZOAA 1NQOA 1BU5A 1BQ4A 1X87A 1MABG 3IHWA 2KPOA 1JIIA 3JX9A 1DNPA 2Y66A 1K92A 1VQPF 1YR3A 1RLMA 3CMCO 5H7XA 1AI5A 5FH9A 4LXYA 5DVZA 4FWBA 1Q8RA 1QWSA 2YHIA 3P9NA 3R8XA 3TQFA 1NAHA 2WG2A 3U1TA 2PL3A 4YBRA 1W49A 5AMXA 1N0VC 4NH4A 1ZNQO 3MXOA 1X7HA 2N75A 1N6RA 2VPYA 1BROA 4NVPA 3S8YA 3KR1A 2O1SA 3VX3A 2B8WA 4D02A 1EB8A 3ZN2A 2FMIA 3ULKA 2HF9A 3J7AR 2CLHB 2BGGA 5DRTA 3GVCA 3E5NA 3RTGA 1ZXXA 5CNKA 3JQAD 4UREA 2JAWA 5H8WA 4WF9V 3TDKA 4AN0A 1GPWB 1TT5A 4XTCS 3KQSA 1PJAA 3V8EA 4BVEA 3IERA 3ANXA 3S1LA 5CVEA 4FVMA 4IWYA 3TOSA 3HSSA 3NTRA 1SPBS 1R18A 3D7KA 3KXKA 5A1TA 2QG4A 3E22B 1XT6A 2CK3A 3M5CA 3WYCA 3AG4C 3NWOA 3TIGA 1FJ2A 5BORA 3ZIUA 4JGGA 1ZX3A 1FRVA 5CM9C 4R7ZA 1DBSA 2YI9A 3DXXA 3QYAA 3VYSB 2GYUA 1N3LA 3K6RA 1T2FA 5LL6Y 1QLWA 3MSXA 2HIGA 3V2HA 3WO1A 3UUGA 5DYNA 1JQKA 4E5DA 2WZDA 3U4CA 3RBZA 1E1YA 3AM4A 4EJ6A 4AKIA 4UNRA 2FPGB 3QWHA 5B1OA 1RAIA 3G13A 4DOMA 2A6PA 4OB6A 1KK3A 4MQEB 1O95D 3KAPA 5CDFE 3NVKE 1M8KA 5IKMA 1NW6A 1VLQA 1VMIA 3A0BZ 3ABLB 2X0LA 3HJNA 2QE7G 4FFLA 1WA8B 1LJ8A 3I1YA 3RK4A 1QHGA 2HS0A 1JHVA 5F7ZA 3KB6A 4NBTA 3R7BA 1FJHA 4A1FA 1G63A 1S4QA 4G84A 5ALWA 3BT7A 4UE2A 4Y67A 1AF4A 2CNOA 1X4TA 2QP3A 4F1KA 4HN9A 3I7TA 4W1RA 3H9VA 1Y9EA 5KI6A 3UK0A 3W2GA 5IWAB 2NPOA 1NMYA 2JZOA 1YIJV 5G1NA 4ERNA 1IJKA 1TYCA 4J0JA 5CT5A 1X9HA 1R0SA 2JLXA 1VSTA 1X8KA 5H82A 1Y1RA 3NASA 2NW6A 5IEJA 4HEQA 3KKKA 4AQYO 1OCZB 1EJ6A 4OQPA 5F73A 3S2SA 1WPQA 2D5AA 2W6JA 2VG8A 2FUCA 1R4MB 4PR0A 4JP2A 2MR6A 2PEZA 4PYKA 4PYRA 1WNFA 1USWA 1PU2A 4QOSA 1WB7A 3HL0A 3TCNA 3SPJA 3NOOA 3WDSA 3SR3A 3NWEA 2XOXA 4JTDB 1KHTA 2GA8A 3DMTA 1YDGA 3ZNOA 4UPVA 4WUVA 4E1VA 3IVRA 5BV7A 2VH5R 3D2BA 1CEZA 4U7DA 1JIUA 3E2PA 3SZRA 4MULA 1BGVA 1E1NA 3ETLA 4ZOEA 3A6DA 3KKZA 4ZODA 1FL9A 1P2UA 1H65A 5JNUA 5EJEA 4RVCA 5C4MA 4PLGA 1E5XA 1RRVA 1QCYA 3QTYA 5P21A 2I76A 1JEAA 1XNRB 2P9JA 4PWZA 3P5SA 5KC9A 3REGA 4EFDA 5KNCD 3MAGA 3V8PA 3JD0A 2C1XA 4NLLA 3I1IA 3FMVA 4TVOA 3IODA 3QW4B 2CNNA 3ZQKA 3STTA 3UCSC 4PGGA 3WLOA 2EVWX 1QG0A 4TQAA 2D2FA 2P4KA 1L4EA 2E5FA 3WRXA 2PGOA 4EKYA 5ALNA 2PT7A 5CDFA 4MYHA 1R3UA 1ZCZA 2QJRA 2V9CA 3GEHA 1OBHA 5K0JA 2MW2B 3PWKA 3K6JA 2W48A 2L6LA 5CB0A 2I7CA 3TTWA 4BU1A 1II8B 3V97A 3TCUA 2P4EA 2NSYA 5L7WA 3HUUA 2X1LA 1YU9A 5EESA 3FX7A 4B3TO 3P2MA 4MGZR 3UHAA 4CC6A 5EWRA 3FKSA 3TKLA 2DBYA 2JDIA 2WNHA 4F04A 3CX3A 1TQHA 1M66A 3N7UA 4KO4S 1IOLA 4GXRA 4GI1A 4MKRA 3UYKA 4UBMA 1QZZA 4DS3A 1TCCA 1PZFA 3VJMA 4ZT5A 1JHZA 5KOIA 4LF6B 1IY2A 5BW6B 3E05A 2Y99A 1N36B 1PJCA 3PLRA 2BFFA 4DSAA 1H2AS 3CRMA 2AJBA 1EQ2A 1JYSA 2HYIC 4TXLA 4NIMA 3GLGB 4BIOA 1RFYA 1YWGO 1RXWA 1QVGU 2HJVA 3LX8A 1ICEA 3WHPA 3HQ4O 4JJKA 4GWKA 5T3YA 4FIPC 4FWIB 4PG8A 5ALYA 4D3XA 3VZSA 2Q1SA 2BHLA 5KQSA 1R0LA 3KWLA 1B3RA 3INNA 3BGDA 1A27A 5AW1A 4JIMA 2J0EA 1AHIA 1KKMA 5DCWA 5FBZA 1Y8ZA 5FPTA 4EHDA 3FKJA 4G0NA 1PUIA 5JY1A 2WLIA 2Q3JA 4G9GA 3C6KA 2QGZA 4E2YA 2DXIA 4KWEA 1V55C 3KYIB 4QUEA 4OVKA 3B8EA 1ZZGA 5T8KC 3R0IA 3ZE6A 4MAFA 3SDSA 4RS3A 3JAWA 2GZ3A 3KYCB 3PEVA 3ZV7A 5CNJA 1MQSA 3EULA 3GHYA 2Z6QA 2DPYA 4OK5A 1DAEA 3E7XA 5KKNB 3GAFA 4GPZA 2Q3MA 4EUKA 4HP8A 5FFMA 4FZRA 2VTEA 3GRZA 4RF3A 4HQFA 1HLDA 4S1NA 1PF7E 1F8GA 2EJVA 3V1YA 5FPPA 1R4ZA 3A9VA 3A3PA 4F4FA 1GPBA 2F8TA 2E4UA 2O5CA 4JWKA 5KNDD 4JUCA 5DI9A 1XEXB 1LPAB 5KPDA 5KTSA 3V3KA 3LPNA 1IE3A 2LCFA 3VOTA 1QGAA 3I9KA 1Q0TA 4C1BA 2OCIA 4IDAA 2GSDA 3AM1A 2RH4A 2OG2A 1DTWA 5EJMA 4F4UA 5J58A 1C8BA 3LY5A 1PWYE 2P67A 3LQ2A 3FAVB 1VQPV 4RLQA 4HYYA 3B7WA 4LWQA 3FPHA 4CIDA 5FUWA 5AVOA 2QYHA 2J67A 4P4GA 4EHBA 4O4JF 1G2IA 1NRWA 3D4OA 1TUEA 1RKVA 1XTIA 1H8HA 1Y3CE 3CMMA 3OSUA 3AVOA 9ABPA 1A9XB 3HL4A 1D1PA 5CHYA 1Z82A 3AONB 1K2VN 5EIHA 4B7ZA 2P2GA 4MS4B 4HLCA 2OBBA 6REQA 1MABB 1CDEA 5B64A 5EWLA 5I7RA 3E0QA 4XSHA 3X3HA 1NW4A 3B7PA 3OTHA 3MTAA 3K0AB 2D2CB 3KVVA 2FSFA 1U94A 1V39A 5EC8A 5CFQA 1VMDA 4ZVUA 4W8OA 5AM3A 4B87A 2F00A 4JI8O 2MCFA 4WINA 2NO6A 4P7GA 4RDIA 2GD2A 3TGWA 5HIAA 3QBDA 1VJ1A 1M90W 3DSQA 4ITVA 1ENOA 1GITA 4BP1A 1JRLA 4MKHA 1H38A 1P0QA 4R1OA 1OH5A 4LMRA 1YXMA 2LKDA 3KOUA 3F5SA 2V6GA 1DX6A 3K0BA 1IEWA 4LV6A 5FL3A 3T80A 2XRYA 5GY7A 3E8HA 4ZMSA 3JALB 3P4YA 3QY9A 5C4IA 5TGTA 2AFHB 3DV0A 3DKIA 2PMBA 4RD3A 2WKSA 4WHMA 3VOUA 5IFKA 3LP8A 5E9WA 4IOLA 1FKAO 2WNSA 1PEDA 1Y8CA 3HM2A 5CLFA 2O8EB 3RBAA 3ZWMA 3RPEA 3GZNA 1L4MA 2DJVA 1QTRA 3CZQA 3OZFA 1Q0QA 3MGBA 1X92A 4LNUB 4JPRA 2BGJA 3FX2A 1UBLS 5DLYA 3WFJA 3RYTC 4F93B 4G25A 1G5FA 3G2QA 5U4XA 3DL2A 4Z9YA 1MQAA 5DTMA 1N0WA 4ARUA 4BT3A 5F2EA 5DYWA 2P9FA 3KXLA 4BT7A 3OR6C 4PC3A 1PNOA 1L7PA 1CLEA 2JGIA 3IVGA 2W37A 1D2CA 8AT1A 4MUNA 1AZTA 4L75A 4D7TA 3LC7O 1V54B 1J23A 2YSUB 5KMGA 1SVLA 1OWPA 2VBFA 1P44A 3LQ1A 3KQKA 4LFCB 2HGSA 1YJQA 3AG3B 5C34B 5BOSB 3BWDD 2BSXA 2Y05A 2FVYA 1BDJA 1DOZA 3EXHA 4RTRA 2YJ4A 3R7WA 3ENNA 3ZV3A 3LUTB 3E8BA 2O3RA 2QTOA 4C9BA 3STVA 3AF0A 3WI7A 4NXMB 5JOQA 3K35A 1KWGA 2F3SA 3RIHA 4A6EA 4ZYXA 5CU7A 4JLWA 5DT2A 3H6HA 1E6EA 3M34A 1HG0A 5IAKA 1XDUA 1XWFA 4MV6A 4WZAE 3OEYA 1PLJA 3CH6A 5L3FA 2YWEA 3ZK9A 2AN9A 1Z0FA 3WAKA 3ASUA 1NQWA 3VYTC 2IEZA 2FDCA 5EVCA 3JAMA 5IJXA 3QVUA 2HB6A 3HO6A 4TVBA 4RXTA 1XIVA 1GRNA 3PRHA 3MOGA 1YL6A 4I7ZB 2FEOA 4YX9A 1RWVA 2TECE 3OZVA 5JTTA 1Z0KA 4EPWA 1TOAA 4M0UA 2YQ5A 5FLYA 4FNMA 1Z08A 4G0WA 3JZDA 1LPMA 4MB0A 2BFEA 3LP5A 2FPLA 1I3CA 1K86A 3JASB 1LK7A 3AEXA 3QPUA 1DKRA 4W5OA 1P1FA 5EPEA 2I7VA 3P0RA 4L4RA 4NCBA 3KLPX 2BRUA 2QRJA 4FZ3A 3TLEA 3WA7A 3T12A 1V1JA 1PZHA 4X62B 3M1XA 4IH4A 4R51A 4B8ZA 3IKLA 3T7IA 2WSMA 4K6MA 4MLZA 1XA4A 3LHFA 4NYIQ 3FG9A 3ESYA 2QZZA 3RSSA 2XQKA 4DR4B 3H0EA 1HK7A 2CLCX 4RNCA 2Q8QA 2IYXA 3AFOA 1PNQA 3EEIA 4H4EA 1WCV1 1PNLA 4GYJA 4MUMA 5JMTA 1A5TA 1T2VA 1A7AA 4A8PA 5C5CA 4C0WA 2AZXA 3EUEA 4OIFA 2WU0A 4X89A 4JXZA 2YV4A 4B6EA 4BYGA 1HDGO 2X7XA 1TK2A 5EEHA 3AKYA 3Q41A 1BMFG 2ATKC 1T9DA 2YJ5A 4LXGA 2ZIWB 3O9VA 5K0FA 3GVHA 1EBUA 1S01A 3EY9A 4YHHB 3E8XA 5J2UF 3WMXA 1QJ4A 1Q15A 4DQLA 3RKSA 2XJ9A 4DGQA 2P22C 4QEDA 2FYTA 1DKLA 5H2FZ 3IP3A 3K0EA 3OIDA 4UVHA 2AVNA 1V5EA 5COAA 2VKTA 1KJQA 4FLWA 4WZAA 5ITVA 3TW8B 2R4UA 5F2OA 4PIPA 4BW5A 4HQOA 5L4LA 2EZOA 4RM3A 2AOTA 1EK5A 3QX9A 4ND3A 3VBBA 1JAIA 3CZ4A 1P8JA 3KDAA 3AK2A 3NHJA 2NNLD 2DPXA 3ZWBA 1JSLA 1EQAA 1X1BA 4IZ6A 1KMHB 3QFRA 2GSWA 5KSOA 1KDOA 2XUQA 2O2JA 4BVTA 1AVTA 4PELA 2A58A 1H0HA 2QW0X 4FFVA 2QWRB 1JR6A 4YRKA 1X42A 4IDPA 1H1LA 4Q7EA 2D62A 1OYVA 3IP7A 4UVAA 1LSSA 4QPKA 3JARA 3ZNNA 5FI3A 5K9ZA 1WKCA 2QDXA 5ECWA 3UJ6A 3PQ3A 3OURA 8ATCA 1S6YA 2NUTB 3C8UA 4EF5A 2QRMA 1U8ZA 4UCXA 5K3EA 4OUKX 2EG9A 3AU9A 3P9XA 1I3MA 1U2DA 4H7PA 4ML3A 4RXUA 5JWRA 2EX0A 3QYFA 3FPCA 3DKPA 1I9GA 1WY7A 3BK1A 3IAXA 3QWAA 4GP6A 2HHLA 1L7VC 3M6IA 4XKJA 3CU5A 2FXVA 3S2FA 4FNGA 1EFVA 1PI3A 4GRIA 1WXHA 1AKMA 2HQBA 3QTLA 4K0KO 1SUPA 1Q90D 2WLNA 3BABA 3PCTA 4NBUA 4EB8A 4L6IA 1MXHA 2WLMA 2PVPA 4PPGA 1EVLA 3WXMA 3C5CA 1GXSB 3VU9B 2YH2A 1H4VB 2RNBA 4U0JA 4X66O 4JLKA 1I3KA 1ZD3A 1XHFA 2XHBA 2GEBA 4XD7A 2O2HA 4LVNA 3FAKA 1KRWA 3OZIA 1ZFNA 2VPIA 5JISA 1Y4MA 1E8MA 1WD7A 4FZ5A 2PX6A 2P3SA 3WJ1A 4AX8A 3GJ4A 1NVAA 4BFZA 2VAMA 2Z8YA 3VYUC 4UU1A 1ILWA 3Q7QA 3P19A 2WW8A 3UXMA 1FX0A 4EPXA 1Y3FE 1W0JG 2VZ0A 2GXAA 5BRJA 3FPJA 3HSYA 3B1ZA 4F7DA 1CULC 5HM8A 2QN3A 1VK3A 4BNKA 4YXFA 4BY9E 4JI5B 4G0YA 3FE2A 2YFYA 1JGTA 1PDOA 4C7KA 2R4QA 3KZ1E 3VR5H 4Y9SA 1LVGA 6CHYA 1JSRA 1HKHA 4UHKA 2HY7A 3M6WA 1R6NA 2QWNB 2QN2A 2JCYA 3PHHA 4CMEA 3HBAA 2W8ZA 3UJAA 5EUMA 4R01A 4V3BA 4JL5A 2FR0A 4CN8A 2ZNJA 1NJGA 4E14A 2XQGA 5IBRA 3HU5A 1UPCA 5CJ2A 2W4QA 4LFAO 1F20A 2RAUA 3C9RA 1FRNA 5D3MB 2YIBA 4G5RA 4J2TA 4GLFA 2C42A 1H93A 3GARA 1DKPA 3JR3A 3DB1A 2QTGA 2WQ6A 5AQ1A 2Q7EA 5EA2A 2R87A 4REQA 5KJCA 3NYQA 3UKOA 4XI9A 3GAZA 1QP7A 2NV2B 1Q11A 5AM0A 2ODBA 1E1QD 2GJSA 4J1SA 1I0LA 1BCSA 4UNNA 3SVZA 3NVMB 3BTUA 4YPFA 1IHOA 2ZI7A 4QVGA 4JB0A 3NHLA 2Q45A 3JAKA 4DYDA 3ZH2A 4NJMB 2BOBC 1ZU4A 2HPZA 3MC1A 2V6MA 2B9EA 4RHYA 2V7VA 5BYAA 5JSQA 4LYFA 5IY5C 4GOXA 1U2PA 2ABWA 5SZIA 1JMVA 2QM0A 2FSGA 4B6SA 3ZHQA 1J8MF 3KRTA 2TYSB 4OHVA 1NUHA 4CKWB 1DJOA 3V4LA 4DJJA 2AI3A 1MJGM 5EZ6B 4P2BA 1P39A 3I92A 1GTMA 2OWEA 2ZBRA 4FSHA 1FP4B 4B34A 2VUUA 5ICCA 3PFWO 5HX7A 2GD1O 1G38A 3G85A 3UMBA 1W5AA 5K51A 1WVIA 1M2GA 1A9QA 3KKQA 2JFVA 1QG2A 2PS3A 3ELYA 5HBRA 2MHCA 3V1KA 4XOIA 5LGNA 1YZHA 3IAEA 5FAXA 4PFJA 5JSKA 3HRKA 1YR6A 4OHRA 4KR0A 3BICA 5B4UA 4H9GA 3O03A 1Y0BA 1NOJA 5KX5F 2JA1A 1AZWA 4FJCC 4DKJA 4PRYA 1DB3A 1SULA 2GBCA 2LPMA 1UFKA 3IFXA 3RIEA 3NIDB 2EIJC 2P2ZA 1BD4A 4GOOD 1YGYA 1P84F 1QIJA 5FQOA 3EHDA 2GN2A 4IFTA 2J0SA 2QI9C 2MJLA 2QB5A 4QJ5A 1ZOIA 1P3JA 2C5EA 4KTTE 5AW8A 1CF9A 1VLLA 3A3OA 2VJLA 1XOUA 2GK7A 2Q4RA 4MJLA 1TM7E 3C5HA 1BEUB 5HFNA 4C05A 5EP3A 1K5DA 2FFQA 5JS7A 4KMOA 5FBLB 3COWA 1J06A 3EFOB 3SSOA 4UBLA 3E9RA 3NEPX 2FW8A 1A9ZA 1K5PA 2J3QA 1WZ2A 3QF4B 3CX4A 4JI4B 2B83A 1RRFA 1NKVA 2XAFA 3A1UA 5TISZ 1AH2A 2WAOA 3K16A 3ILSA 4GECA 4JI2B 1L6IA 5DP1A 1KERA 3ENWA 5CHEA 4C6HA 1NQUA 4WN9B 1IUPA 1KU6A 1M34E 5F77A 4CLEA 2EZUA 5AK5A 3GLTA 2ZB7A 4MWCA 3BYQA 1YS6A 5DGIA 1RM1C 2A0KA 2UYYA 5ITWA 3GGJA 1SCUB 4OI1A 4WLOA 3LCMA 3KSBC 3ZVKA 3JAMN 3BMNA 2G5CA 5CFPA 5TIIA 1GFIA 1MD9A 4YP5A 3O4JA 4A7PA 4F4CA 2DMXA 4FGWA 5H59A 1G2OA 2NT4A 3E8SA 4W4LA 4ZAGA 3ZGZA 5CEJA 5EJ7A 3UAGA 5K3SA 1WV1A 4NTXA 3IUBA 4P80A 1ZR2A 3G2JA 5DTQA 4IT5A 1AXRA 5HCNA 3C3TA 4P6VF 1KWKA 1APBA 4ETIA 5AI5A 4QDXA 2X4DA 1RI5A 2C8JA 4ZU6X 3TQQA 4MMXB 2V3CC 4K35A 4HCJA 1YI8A 2G80A 2W2MA 3FWYA 4KVGA 3FYTA 4V1CB 2QAGB 4I0XA 3GLKA 3O8BA 3TRJA 3K8QA 1YVWA 3VPHA 2IODA 1KGSA 2B1QA 3CVJA 4HBNA 4L9RA 1XTRA 4D4GA 1DDOA 1RKQA 2GUGA 3AOEC 2CDAA 2C3PA 5TS3A 2CVLA 1VL6A 1F3LA 2BGUA 4C87A 2DWCA 3OPYB 5LU8A 2VHXA 2GEJA 1E6MA 1P7ZA 2R8RA 3LDHA 3ZHRA 4UBOA 1NH2D 1PVVA 4WEOA 3ZDYB 4M8NE 1SXQA 5HSGA 1O6ZA 1SURA 1EZJA 4CKEB 2D00A 3G8CA 3JVDA 3I83A 3LY9A 3UV7A 3MD9A 4BAZA 5EHXA 1GN3A 2LUOA 1MT3A 2E1PA 3WYGA 2QIOA 4OHMA 2JIBA 1SQVH 2I4TA 2JJYA 1IXKA 4BBZA 2OWOA 1YB7A 3KOYA 1YOVB 4NF2A 1RJWA 2AIZP 3ASOC 4ZPJA 3KB2A 3AF3A 2GPJA 4YJHB 2B1JA 4BRZA 4YWJA 4R2WA 2E21A 3ETHA 3EVZA 3D5EA 3CLVA 3EFBA 4A2WA 3UFBA 1QB8A 2O6HA 2F43G 1H48A 4PSCA 2EDCA 2VI5A 2VQEO 1YZNA 3U5TA 4HDNB 1M34A 1RRGA 1NL3A 2HC9A 1LPSA 3FSJX 5FLKA 2ATXA 1UP4A 5E6UA 3UAWA 3FZNA 1IXSB 1HM5A 2QVYX 3M9XA 1M2OB 4MEJA 4R9VA 1CQJB 3NUQA 1GM8A 2L26A 4DV2B 3WAJA 2WJIA 4K8OA 5FPQA 2ZBEA 4UCUA 4PAMA 3ZGLA 4KYIB 4YQYA 3DGFC 2H4WA 4M9RA 4FMPA 2YV1A 1K8QA 5FLEX 1Z0ZA 1TA4A 3T41A 2EHDA 1Z37A 2R6DA 4E0BA 4M7WA 1QIEA 1JPJA 2GA9A 1X38A 2IIBA 3TLJA 3FYHA 1RPNA 5FPHA 1JWBB 4IIBA 4S0XA 2PWZA 4L5AA 2EQ5A 3VNVA 3L4SO 2R97A 4EUNA 3TNLA 4AWAA 4Q4AA 4JXXA 3EXG1 3WJ7A 3PTZA 1EZ1A 5HOQA 5A0FA 1OAPA 3C87A 3U4IA 1MPTA 4LZPA 4X7BA 4ZBMA 3QKRB 4G4VA 4O5OA 3NALA 2H52A 1FK8A 2IX9A 2Q1TA 4FOLA 4JP3A 1MB4A 4BEJA 1UOEA 4WA8A 2WWHA 2WUVA 3EVFA 2Q7GA 2R8ZA 3VKUA 3SDZA 5DX1A 5HM6A 1W4ZA 2YDEA 3GFQA 4EZIA 3OUTA 2ZDIC 3AKDA 1YHQF 1BE8A 1YJNF 4PN3A 5E79Z 1KD1W 5FQNA 3UPDA 3K0SA 2PLNA 2RMKA 1IQUA 4RAIA 3DGEC 4EL5A 2RH8A 3C4QA 1QGZA 3TLGB 4DJFC 5FFFA 5LQNA 5JHGB 1ST2A 2WPDA 4DJAA 3LX5A 2R70A 1CP9A 1M33A 3KJGA 4FGSA 5DLEA 3OD4A 2E7ZA 4N1AA 5BQ3A 1N8KA 4GXTA 1JAYA 2H4ZA 3QJ5A 4CQMB 3PGMA 5BVGB 2XJ4A 4JHXA 4L6AA 1QYXA 3T8YA 1DAGA 4HQ6A 1DAFA 1KDVA 1K5SA 1TCBA 3T61A 4YCNA 1NWCA 3L79A 2JEYA 2VBCA 2I1QA 4YV2A 3ENZA 1U8EA 3U3KA 3B1XA 2GUZA 2C4NA 4GWLA 2VRBA 4GVPA 4DADA 2QZJA 4RIEA 5KKAA 3T9EA 1JN1A 5FV4A 4AT1A 2WWGA 3WPWA 3DHWC 4ID9A 1G1MA 2NUBA 1W29A 1G7RA 1NV8A 4X97A 4MDYA 1N2OA 2XUOA 4DQUA 3HXTA 4C07A 3CC7F 4MV3A 4X64O 1ELOA 1K8ZB 4NDAA 1Z6AA 1GQQA 4KXRA 2N46A 3U9TA 2CUTA 3EAFA 1P4JA 4JEUA 3VNBA 3DC5A 1XX6A 1T4DA 1H42A 3IIMA 3N2LA 1ACLA 3LL4A 3GRAA 1U2EA 4MRAA 5FF9A 5DX8A 2ZRCA 4WY8A 2BKVA 3GLIE 3OEWA 1HPLA 1SMKA 2PSSA 4LF4O 4LE2A 4AZ0B 3R75A 5J2UA 1RHMA 3D7SA 4TN1A 5TPWA 2CKMA 2F1OA 1DTSA 4A6XA 5SY4A 3GQBB 2EGHA 3DE3X 4IJMA 5A4DA 1PD0A 4UHEA 3GUYA 3LYLA 1D7OA 5HQ3A 5KYYA 4PHGA 3BK7A 4UHFA 3IGFA 4MPRA 3ORFA 3NNSA 1EZZA 4LTMA 4PQYA 2BZ1A 1ZJYA 4Q3OA 1Z2NX 1V7PC 3OQMA 4D9NA 1JIVA 4XIGS 3L77A 4BQFA 1DIHA 4PG4A 4Z1MD 4G37A 2V7GA 5NULA 4V2IA 2GH1A 1PV2A 2JEOA 3KSDO 4RM2A 3DDNA 4TMFA 2M98A 4DV6B 2XPCA 2P40A 4BT5A 1A2OA 2QP4A 3T3NA 3FYIB 4LCUC 4I3FA 3PQCA 1K7XB 5K8IA 1E59A 2UZ3A 3VYRB 5B36A 1XTQA 3CXRA 4NTYA 1ECPA 4BNTA 2GCOB 4L74A 4B35A 1Q7BA 3RSCA 1SCAA 2VH1A 4D1YA 2OB1A 4NMMA 1T9GR 2C20A 3F3MA 2W4MA 1DGSA 1ORVA 4J9YB 3H2KA 4J16C 2II6A 4PVCA 4EEZA 1WL8A 3AW8A 4A0HA 3DR5A 2QJWA 3WP0A 2N74A 1VQNF 1GL3A 1JX9A 1U7UA 3SZ3A 1Z4IA 4MW5A 5KA5A 5JXIA 2HCBA 5DEOA 3AEYA 1G6HA 4F5EA 3WJAA 4DBLC 4DTIA 2GM5A 2Y27A 3SEZA 2WI8A 3FOEC 5HJEA 3ADCA 2G1KA 3T1OA 2I7DA 2N1MA 2JFOA 2HUPA 3QWFA 3MLBA 1J7HA 1R8SA 1CJBA 2OL4A 1M6VB 4GU5A 5ILGA 2Z3VA 1ULZA 2IXFA 4I1SA 4P3NA 1EK6A 3PZRA 2VAPA 2GCPA 2JB9A 1CZNA 1DEOA 1W2BF 3Q15C 4UOEA 5F12A 5BWLA 2BO1A 2OHIA 4MKGA 1LZKA 4XWTA 4ZVMA 4AZWA 4IQ0A 4Z0TA 1DAIA 1QS0A 1M6WA 1EP3B 3MT0A 3OX4A 4CTMA 1E6CA 1IH8A 1T25A 4I8XA 1Z2AA 2FX2A 5AUPB 5FOXA 3EPKA 2ODMA 1GVNB 1Y8RA 3MUNA 4I19A 5BXQC 3MDOA 2B9ZA 2IBSA 1ZH8A 4RTKA 4L07A 1ZI6A 4UHJA 2Q27A 3BD9A 4L3WA 1WA5A 4B85A 2JIRA 4H17A 4KQ6A 4O4LF 4LF9O 4LY3A 3N4ZA 4Q4HA 4ZT3A 4IBOA 3WQQA 4URHA 1Y7PA 4X63A 1F6DA 4KDFA 2O9JA 1GILA 1SUEA 2ID4A 1VCNA 1GCOA 1TAEA 2E2WA 3VH1A 1AKTA 2H5IA 4MEBA 2QRNA 1N7HA 4I6EA 1NW8A 2OENG 2WSSG 5CX1A 2QMYA 4ZHQB 3E48A 1KYXA 2Y48A 1BTOA 2D3OW 3HV0A 1GZUA 1G1AA 3QA9A 5DSZA 13PKA 2FK8A 4DXHA 1P80A 2D1SA 4MWOA 5JJLA 4CCAA 4DV1B 2JRLA 3GZJA 5K8LA 1AKUA 1GQRA 1NDQA 4YV0A 4MKFA 4LNHA 2JK0A 3G0HA 5C5IA 2ROQA 4DCUA 4OPAA 4MS1A 5IXJA 1KDPA 3NV7A 2BEUA 3U0OA 4GO1A 1DLBA 3GBSA 3K5LA 1LBSA 4KRXA 4LQDA 3CM0A 4YRPA 1XRLA 1N78A 4BB9A 1TKCA 3U7HB 1PJ8A 3U16A 2OGZA 4EX6A 1OZ0A 4DLYA 3CCBA 4XFKA 2JD0A 2Q4TA 2REQA 4F6RB 3H2HA 1ZMXA 1HQCA 4AUMA 1E0JA 3V9AA 1QVWA 4DA8A 5I7EA 2UYJA 3LUFA 4LWSB 1R6UA 5LZ7A 4GX5A 2GXSA 5IT4A 4N5LA 3RADC 3G3EA 3A1FA 3R6DA 5DASA 2WTAA 1XKLA 1QLHA 2Y67A 3ID6C 4UFPA 3Q85A 4W63A 3WIOA 5ABPA 4G8JA 2Z8YM 1IBKO 4L5YA 4QEKA 3FLBA 4XGIA 1ORRA 1DAOA 2DCMA 3F5TA 2JJMA 1AKNA 3O4HA 4G97A 2Q6IA 2QLNA 3IIKA 3NT5A 3VNAA 2HK7A 5CB4F 2Y93A 2D59A 2H00A 2ZSAA 4KLRA 2DQZA 3EZ9A 2ZOSA 2WWVD 3BKWA 4PX9A 3WL3A 1Z38A 1M8JA 4WNYA 1XLTC 2H59A 4UAUA 4HNSA 4XW2A 4CRWB 4IIJF 5K1XA 2DWUA 4RFVA 1OBOA 3K7EA 2PXXA 2TMKA 4QSHA 4JT8A 4LWPA 1ORDA 1JSZA 3BEHA 1FDUA 1FVFA 2GF2A 1ODFA 1QLNA 3PIRA 5AJUA 5T4BA 4F84A 4UBIA 1ODLA 4HAUA 2FWAA 4IF6A 1RPAA 2ZE5A 3VVCA 1RMYA 1O54A 3SLRA 4B2IA 2BFBA 3SGIA 3NFRA 1FS5A 1Q1BA 4EAQA 4LJ9A 2IE8A 4M1EA 5H6RA 2F1JA 2P11A 2B21A 3IEUA 1V1RA 2BOCC 3NU1A 3LPAA 3V1UA 3HNOA 5KX5A 1JD1A 5JSZB 3JD3A 2RK4A 1OV9A 3K94A 1G20E 4D6TH 4XUCA 5KVAA 1GN4A 1GX1A 1RPTA 2AF4C 1KZ7B 3ED1A 2YY7A 4YIHA 1TKAA 4QLOA 3L7DA 3CYPB 4QDKA 1PKXA 1BWQA 5F3WB 4QGBA 4DT1A 2WLJA 3HWWA 1XRRA 1U1GA 5EWMB 4FMDB 4X7PA 1SAYA 3AUFA 3JYQA 4AW9A 4M9SA 1WCWA 3ZDDA 4QPNA 3LO8A 3DL4A 3K03A 5JO0A 5IAOA 3GRKA 1L3CA 1S8FA 2IW3A 1TVKA 4JEHA 3RT1A 3QJGA 1UMBB 2IH3C 4Y7CA 1WPGA 5B2EA 4BLSA 1X7ZB 2VPQA 3FRHA 4LGYA 3H13A 5MDHA 3HCCA 4DF3A 1LSJA 2J9ZB 1T0JB 5EPUA 1KAHA 3CC7V 4WGFA 1ZD5A 4A15A 4CGZA 5B1SA 2MK3A 3JZMA 1R6VA 2GM4A 4CF4A 5CG1A 3WWOA 3Q88A 3W5JA 4BRUA 3AG7A 1UBEA 5JI3E 3G17A 1PF5A 2IZ1A 2ZUWA 3EGOA 1Y6GA 2Y0IA 4DLRA 2I7TA 1V2HE 3KJFA 2BCJQ 4PM4A 4P54A 3MBKA 4TV8B 4JB8A 3SU8A 3QPWA 4J2HA 4PQFA 1KO5A 3GWZA 3RC9A 4PJ0Z 3GAAA 2OOSA 4B7EA 2Y6VA 2PSHA 4CLDA 3V4VB 5KVSA 3SICE 3UJ9A 4KQKA 2O8DA 2V65A 4OQZA 3DTYA 4XVRA 5ICEA 3DFZA 4ENQA 4Q12A 5E1MA 4RQOA 3H05A 2OFPA 521PA 5TPZA 1SUWA 3NMUF 2P3OA 2BEWA 4B3MO 3NM4A 2DKNA 3OEED 3OFNA 2I29A 1LLCA 2NP7A 3T3IA 2VR1A 4BV2A 4G1MB 5KHLB 5LUAA 3CNBA 3GD5A 1SZDA 1Y1PA 3RRXA 2O7VA 3MLEA 3MIIA 2ZM5A 3UG7A 1XZ8A 3R6TA 4QGPA 4X71A 1G20A 1I7SB 4P08A 3FKSG 3K70B 2JDIG 4FWTA 5DGDA 3W6OA 4MAAA 1FP7A 3OZTA 3F71A 5BSWA 3X1YA 3NC0C 3KT0A 3VSEA 1DBVO 3ECCA 3PTAA 2G5TA 3AM3A 3ZO8A 2BT4A 3ZCRA 1YRAA 1QIGA 1G0OA 4ALKA 1VQLF 1FQWA 4Q6BA 3ZY6A 3ZWPA 4BQRA 1ZISA 1WKVA 3IR9A 4MB2A 4J0HA 1RIFA 2J1LA 3FFWA 2X22A 5GTDA 3RK1A 4YMVA 1S8NA 4OP2A 2JVDA 1GZ0A 5DCLA 4WCFB 5DNYB 3KU4A 1ZEMA 4BRSA 2XNKA 3INGA 2QVLA 3FI0A 1T24A 1HOXA 4IFIA 1VZ3A 4IEFB 1KZ4A 4P4SB 1M72A 4AKSA 5BV1A 5GANK 3WWZA 1XTBA 2YL2A 2Q9BA 1OQAA 2VWJA 2VJPA 2VT3A 4H59A 3KUUA 3G0OA 3ZLUA 3D6JA 4I55B 4IWXA 2O2ZA 3PHLA 5HKAA 2BE3A 3EW7A 1UPFA 4Q1FA 2R66A 2VK8A 1PWZA 1XNQO 3IELA 1AN0A 3OHSX 4O8CA 1YZBA 2OOKA 3AILA 2N04A 1GEGA 3EIWA 4KFMA 4MHOA 3AG5A 4H3VA 4ZV7A 2BMWA 2L0XA 1S02A 2MU1A 1WUKS 3CR7A 5L6MB 3MT9A 2B7BA 3BH6A 3ZE0B 5KQMA 4B7CA 5AJTA 3PZBA 3EMKA 4EHIA 1LF0A 3ZQ4A 3KFXA 3QKTA 4M21A 3SYOA 3NB0A 1XHZA 5A71A 4FDUA 1HL7A 1KQ3A 4RH0A 1XXHA 4N3BA 4YXWA 1G8GA 4RJLA 1VF6C 2UDPA 3LPDA 1HBJA 3BIOA 1DG9A 3A9UA 2AXEA 4GPTA 1S2IA 3HDGA 5KJ1A 1TIKA 2RGRA 1JFVA 3SS9X 4TUYF 1LPNA 1QV9A 2CLIB 5H9CA 5HFLA 5IXYA 1Y1SA 3ZD8A 2IYQA 4CIYA 4R1QA 3AK1A 2ZSHA 2CWWA 2H9YA 2DUWA 5A5DA 1OJHA 3C98A 2C4MA 3AFHA 4Y18A 3CEPB 4B33A 2ZWMA 3Q6IA 2IG8A 2YJ3A 2H8GA 2A9JA 1W5SA 2GWHA 1IB6A 3ZYCA 3UWMA 1LK5A 1SQXH 2W83A 4L85A 4BO8A 4JVLA 4TN5A 3SYRA 2OM2A 3FIUA 1L4LA 2BTQB 1H8HG 4EI2A 1LLUA 1JSCA 1Y4AE 4I4CA 3CW8X 3ZIAD 2W6IA 3G2KA 4C7OA 2AUMA 4LRTB 4TKVA 3F97A 5EBLC 2YZGA 2JI6A 2BP7A 1GNQA 1P6QA 1ZIOA 3VR5A 3D6AA 1K8RA 4MRNA 4RABA 1VHDA 1C1DA 2BKEA 1JLSA 4QIWF 5I3CA 1D2MA 3UMFA 1O58A 2FF5A 4R8KA 1JFLA 5JCJD 1FYEA 1ZVVA 1TPYA 3CG0A 3GVXA 4CM5A 1DKQA 3O1LA 3K73O 3O65A 4ZTBA 1PGQA 3QE2A 4CTJA 1WAMA 1R4AA 1KXZA 4IGKA 4BP3A 1ZI9A 3KXIA 2DHEA 5HFJA 1TIBA 5JS6A 4DW0A 1J5EO 3WKEA 4N47A 2E75B 3E5HA 1LDGA 2RDCA 3NPMA 4LKRA 5K0NA 1Q1ZA 2W6ZA 1UEXC 2Z2JA 4D44A 2W11A 1GNRA 2Q5IA 3U7QB 2M2IA 1QVGF 3DKKA 1AC5A 2Z9DA 3OEHG 2AL7A 4QPDA 1CV2A 3EC7A 5FV7A 1RLTA 2XBMA 1QVZA 1A82A 3JXEA 4UMEA 3HY4A 1MRZA 5IKOA 3BDIA 3CRNA 3W5VA 5FWYA 4FMCF 1RWMA 3HB9A 2VP5A 1DKMA 4IRMA 1R9MA 5C1IA 2GFQA 4LHVA 4GLLA 3L7CA 3BXZA 3KZKA 2ZYDA 4B71A 1FCJA 2NU9A 1V7QA 3L06A 1PS9A 4UDNA 1LUAA 5B1HA 4EUSA 1J70A 4KAFA 4ZZ3A 1JLMA 3O8CA 4P31A 4NCKA 2HBQA 2X5NA 4F4LA 1USVA 1QKIA 1KE2A 2JAUA 3RSOA 2CE7A 5JH7B 4OU4A 3AVTA 3PPVA 4QFCA 3HR4A 1QFSA 3RYIB 4OREX 4MCIA 3L7MA 2CMFA 1YRBA 5GPBA 3AP1A 2A5JA 4ZU1X 3LBFA 3FZGA 4IIYA 5GINE 4KEAA 4PZLA 1YD7A 4Q6WA 2Z0AA 1G8JA 2ZIZA 1W75A 4PA6A 4UXIA 4ES6A 1LDMA 2FN4A 1HT1E 1X77A 2ZAUA 2UVQA 4BAUA 3VHLB 4RKQA 4OV6B 3U17A 2IK8A 4DCGA 1XNGA 1I3NA 4LN1A 5KJEA 3ICQB 3ABIA 3U9LA 5K1ZA 4NYJR 1TJYA 2G6BA 2Y71A 3KJIA 4GRDA 5DHUA 4DSUA 1UFQA 2VXCA 2OHXA 2B4RO 1LPBB 4LQL