4X20B

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
428
structure length
428
Chain Sequence
EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
molecule keywords Tubulin alpha chain
total genus 140
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x20B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x20B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x20B01
4HNAA 1W5BA 4IIJB 2RHJA 3VOAA 5CB4B 4B46A 4X1IA 3WGMA 5IJ0A 5FNVA 5MN4A 4IIJA 4DXDA 3VO9A 2VXYA 4U39A 3RYHB 3E22B 3HKDB 4U3JB 5LOVA 4O4JB 1RLUA 4X1IB 4YJ3B 3RYIB 5CA1A 4X1KB 1SA0B 4O4HB 4LNUA 1RQ7A 4ZOLA 1TVKB 3VO8A 3N2KA 5C8YB 1FSZA 3HKCA 4YJ3A 5CA1B 5IJ0B 5BMVB 5GONA 3HKCB 5JVDA 4B45A 3UT5A 4DRXA 5IYZA 5GONB 1W581 4O4LA 5MN6A 4I4TA 3E22A 3HKDA 4ZOLB 3UT5B 4X20A 4DRXB 4WBNB 5MN5A 2RHHA 3WGLA 5KMGB 3JARB 5JVDB 3JATA 4X20B 4WBNA 4ZHQB 3HKEB 1W5FA 2VAPA 5IJ9A 3RYCA 3RYIA 4FFBB 2BTQB 3JAKB 4LNUB 4ZHQA 4TUYB 4YJ2B 5EYPB 4EI7A 5LP6B 2RHOA 3VOBA 3WGJA 4TV8B 4TV9B 5J2TA 2VAWA 3RYHA 5LP6A 2BTOA 5LXTA 2XKAA 1Z5VA 3RYFA 4TV8A 3JALA 1W5EA 4X1YB 3VPAA 5JQGA 5IJ9B 4O2AA 4I4TB 4F6RA 3N2GB 1JFFA 5JCOA 3JAWA 5JH7B 3JALB 4O4JA 2Q1YA 3R4VA 5LA6B 1JFFB 1TUBB 4ZI7A 5JH7A 2Q1XA 4F6RB 1TVKA 5KX5A 5LA6A 3WGKA 5J2TB 4FFBA 2GVIA 4X1YA 5EIBD 4I55A 4YJ2A 2R751 4O2AB 2BTQA 3JAKA 4I55B 3JASA 1W59A 5KMGA 4IHJA 4EB6B 5LYJA 5CA0A 3HKBA 4TV9A 2VAMA 3ZIDA 5CB4A 5J2UA 3N2GA 3M89A 3N2KB 5C8YA 1RQ2A 4O2BA 2R6R1 4IHJB 5LP6C 4I50A 3M8KA 5EZYA 4EI8A 4M8IA 3RB8A 1Z5WA 5IYZB 4O2BB 3JATB 5JCOC 5EIBC 5CA0B 5LYJB 4EI9A 4O4IA 5KX5B 3WGNA 3JASB 1TUBA 4ZI7B 5ITZA 1W5AA 4E6EA 4O4IB 4HNAB 3HKBB 4XCQA 5JQGB 3ZBQA 1SA0A 4O4HA 1FFXA 2XKBA 2RHLA 3HKEA 5ITZB 5LXTB 3CB2A 3RYCB 3C8LA 5BMVA 3RYFB 5FNVB 1OFUA 4U3JA 4EB6A 5LOVB 5M7EA 3V3TA 3ZBPA 4TUYA 5EYPA 5J2UB 4KWEA 3JARA 5EZYB 4O4LB 3JAWB 4X1KA 1FFXB 4I50B
chains in the Genus database with same CATH superfamily
2XWBF 3LVBA 3EEYA 1M66A 4I9NA 3LCMA 3PRKE 4FMBB 1P6XA 3RGWS 4EY4A 3DTTA 1IPAA 3PQ8A 5FPQA 4IV5A 3KT8A 4OH7A 3TEMA 1H2KA 1Y6XA 4XDJA 3BWVA 1FXSA 1RP1A 4MI3A 3WWEA 2XT6A 2AYXA 4CLOA 2VS1A 3UFXB 4BQNA 4WEQA 4ZQIA 1IJBA 4IOJA 2R6AA 1L7AA 4O25A 1B8UA 1T1GA 1NMZA 3BHMA 3MSCA 1G20A 1QQBA 2ODBA 4OX9Y 1GZ3A 2XDQB 1ZMXA 3C6BA 1D2GA 4HGPA 1P5FA 3I6YA 3TR6A 3WNBA 4RK4A 2VQDA 5DN9A 4ZXPA 1MIOA 3ILHA 2QE7A 3LBIA 4LF6B 2P27A 3THWA 2JEYA 2BZGA 3PU6A 1JDJA 3T5CA 3STYA 3ADDA 1EN5A 2IP2A 1GV1A 4ZOLB 3F5WC 4DRXB 4WBNB 3CF2A 1EM6A 3AF4A 1N2CB 3RVSA 1IBRA 3TQCA 2A9JA 3TTWA 1SUIA 2NSHA 5KWIA 5JMOA 5LHIA 5JSYA 4FDMA 2EG9A 2QLNA 2ZSUA 1O8CA 1XAJA 3OQIB 4QXRA 1UZMA 3DXYA 5KYGA 3E0XA 1M5TA 5F1OA 3CINA 2WAYA 3FUXA 3LU1A 4YK7A 2IHKA 2FR1A 3SJUA 1OZHA 3SOPA 4EDFA 5KNBD 1E1NA 1A2BA 4R84A 1KZGB 4Y7CA 2IC5A 3TE7A 1R0CA 1NNLA 4JL8A 2J9YB 5B4TA 2JA2A 5AJZA 3SYAA 1QHFA 2R1ZA 1KK3A 5EESA 5B1EA 1K6MA 1Z5VA 5JJKA 3R3SA 1O89A 4DG8A 4G4YA 1DIBA 2JFHA 2XGJA 4IDOA 5E2IA 4BJ3A 5FI0B 5B8FA 2A9PA 3IMGA 4MR9B 1G8MA 3CISA 4JDPA 3A28A 4RJIA 1O58A 1NX6A 3MFYA 4Q05A 1CR4A 4J7AA 3R9WA 2BM0A 3F2IA 4X85A 2O8CB 1AS3A 2VWQA 3PNKA 4BDSA 5IJZA 5K0BA 1UBSB 4X8OA 1JX9A 1U6JA 5IFKA 4FZ5A 1THTA 4UKDA 4UCWA 2PVSA 3CBGA 4ACBA 3NNDA 2P2GA 2FF7A 2GBIA 3JQPA 3N8IA 4N7RA 3C8UA 1TJPB 4NBWA 4DW0A 1HDEA 1YRQA 2IJKA 3GARA 3Q11A 1KPHA 1MC8A 2MMCA 3E27A 4QNNA 2HZ7A 3NRJA 4ROSA 3I23A 1IAVA 4Z0PA 3CNQS 2KLHA 4UUNA 1CUVA 2GJ9A 4J0IA 3AVXA 1MF7A 4MNTA 2B2NA 3TL6A 1EFAA 2J0UA 2O2GA 4RK6A 1PT7A 4PCVA 4JYZA 3IO3A 4QDJA 2VRCD 2X0EA 3DE3X 1V54C 2DFKB 3DO8A 4NMMA 3UFXA 5AVWA 3GWKC 3R40A 1NNUA 3E8MA 1PE0A 1Z38A 1P1FA 4BBPA 2II6A 5JNLA 4EI9A 1JU9A 4KK3A 3VQWA 1J4AA 3PZRA 4BCCA 2IOQA 2OBXA 1EESA 3KZKA 1NQ5A 1O1YA 4LDPA 4NCNA 3W7UA 2GAOA 4BNUA 4WMLA 4L4ZA 2PX3A 4WLUA 4C89A 4ZGBA 1XD2A 1P62B 3HL4A 2FSHA 2Q41A 1JX6A 5JNVA 1USIA 1XDSA 1R3JC 4DQXA 3IAUA 1UDCA 3D4PA 2OHFA 1SHTX 2XVYA 3NT4A 4BGDA 3A9TA 3THXA 1AP6A 5ERYA 1KRHA 2F6RA 1AMOA 3GYBA 5FL3A 3R9IA 2ZYRA 3TDNA 4U2KA 3RVLA 2UXBO 4TQGA 1P5ZB 4O4LB 3OEEG 5HFLA 1V5FA 1NZJA 2DRIA 2P0YA 3AH8A 1M34A 1JPUA 1E1KA 2IKSA 3B1XA 3FPKA 4LE2A 4MI1A 4P4GA 1XBLA 2LKCA 4DCSA 3AVYA 3FAVA 2CXOA 4QGAA 4DRYA 3CH5A 3QPDA 3IKJA 5J2UF 2JI7A 2V96A 3D2CA 3L1JA 1CZUA 2FWIA 1XMQB 4YCBA 4ZXFA 3G67A 5DHUA 2L17A 4E4RA 4FNOA 2XV1A 2BT4A 2EIHA 2VZEA 3I72A 2C3YA 1AQLA 1CQXA 1ZOPA 3U40A 2YWDA 5GZ3A 2YYYA 3KTFA 2ACWA 1SZCA 3BERA 4LJ7A 1K6XA 4P93A 2ZT7A 3N6RA 5JHGB 3VAAA 3NHLA 2EWCA 1CF9A 2GFQA 3PQ2A 4PS1A 2Y9PB 4X3PA 5ALHA 4MCHA 5TPZA 4BLOA 5HUHA 2B8EA 3RSFA 1UM8A 4EIWA 1IDOA 1XDUA 2NPIA 2PSHA 1GRQA 5F9FA 3C4JA 2YOHA 2PKYX 4HVAA 5DGCA 4TYWA 2IS4A 4UE3S 3H2IA 2DGDA 3A0UA 1LTKA 1GN4A 2AZDA 1E63A 3D7RA 3KZMA 4YMHA 3JAMA 3W2HA 2M6YA 5LB2A 1V9PA 3I2KA 621PA 1G2QA 3AK2A 4NATA 5JSKA 4KLAA 4EQ6B 1SKVA 3OY7A 3T9EA 4F4IA 1LD3A 2IUTA 3OZEA 2A5GA 2PGGA 1ORDA 2I7VA 1ZICA 2ILVA 2QG4A 1YCGA 2QMQA 3A3YA 4AG6A 5FJIA 4K1LA 2DWPA 1IHXA 2VCYA 3GGJA 1Y7PA 3HH8A 1R6NA 1WX1A 2BGJA 3KOZA 1SQSA 3TQRA 1L4FA 4A0QA 1G4HA 2X23A 4YJ2B 3KOWA 1JVMA 3K9SA 2VH2A 3OHMA 1LUWA 2A5LA 2VYVD 4G5FA 2BEUA 4ZT6A 2ZB2A 1TTTA 3JSLA 2KQXA 1XALA 2BR3A 2ZROA 5J1SB 1GLVA 2WJAA 3CNNA 1ND6A 4NS1A 4NMLA 4AS2A 3ETJA 4LSZA 1U8AA 4KTTE 1LB1B 2FEPA 3Q85A 3I52A 3ZC3A 4YRKA 3V1KA 1SUCA 3LA8A 4NENA 2OYQA 1W0KG 2F67A 1HFEL 5T4EA 1M0EA 5A05A 3NEAA 5FUYA 3U1VA 2AZXA 3DFUA 1GGEA 4WKCA 5GIPC 3NTVA 4MTXA 3GVCA 2QAIA 4HX2A 1PR9A 5AKLA 1TU4A 3KNZA 5FYDA 3H1GA 3I9NA 2EIKC 4R9NA 1W96A 4CV2A 3GQBA 2CZWA 2AIZP 2C4WA 5KQSA 2O8FA 4GM0A 4ENRA 4LGVA 2EHJA 3OCVA 1EFRG 1RYNA 2BTQA 3JAKA 4RVFA 5EG5A 5HFMA 1CEQA 2XSZA 2LW1A 5JJEB 3CLHA 4WLVA 2QG6A 3RUAA 4M87A 1ZUHA 4ATNA 2JK5C 5E8JA 4OHXA 4OXXA 1YVPA 3DXRA 4MYUA 5ALYA 4YXFA 2CVHA 5AJUA 1ATIA 1N0VC 3C3YA 1YS6A 1XZQA 2P79A 4DQVA 2G9NA 2QRVA 2GEKA 4X9XA 3PIRA 1Q5PA 4O2LA 1CUDA 3EGXB 3INNA 3P2EA 4WUVA 3SM3A 1NUAA 3WP1B 3WQHA 4DW8A 3IUNA 5FFFA 1U2PA 5C1IA 4RLQA 5TB5A 4RTQA 4NAVA 3CS5A 1QH8B 4CGZA 4GW3A 3MCQA 5DCYA 4O4IB 2NSLA 1NYRA 2BGRA 4QGPA 1EE1A 2EKDA 3GLUA 3OCJA 2O20A 4FMDF 2P4HX 4IUYA 1A4RA 1OR8A 4ER3A 4JU8A 5JC8A 4ESOA 5BV7A 2G4LA 1ZAYA 2B6HA 1RCFA 5HZGA 4AL4A 4GT1A 1IJEA 2C57A 1DTEA 1H2HA 2AN1A 2NU6B 3IUMA 3JRNA 2FPLA 5JAZA 4LF7B 1ISRA 2O3QA 2O9JA 5EINA 3UJNA 6Q21A 2ZM6O 3O9MA 4KDFA 4ZYYA 5L53A 3FHOA 3BTSA 4AULA 5CLJA 5JS1A 1N3LA 3GH1A 2WWWA 3DYVA 4RJTA 3F5TA 3K03A 5HBGA 5FPOA 4B82A 1OROA 3AJ8A 4X3CA 4OXIA 5ALQA 5H2FZ 4EG5A 1BD3A 1SCDA 2B7CA 4OQNA 4OJTA 5FLXM 1AF4A 4EZEA 3U09A 3UPTA 3GOHA 5JDCC 3BQMB 3DE7X 3KALA 3ZRWA 2JI8A 1DO8A 3DZDA 1KQOA 4Q6WA 3RHTA 3VV3A 4XM0A 4AG3A 1K27A 1CQZA 2NZVG 3TJTA 2AC4A 1JE0A 2QRUA 5ILQA 4I1RA 4F72A 4MQ4A 3BGWA 1JG3A 2WPNA 2Q8QA 3FUUA 1AGRA 4MWCA 4UAJA 4YRZA 1A9ZA 4K6CA 3ACBA 1E61A 1JQKA 3HUDA 2XWQA 1J5XA 2GFHA 2P35A 2UDPA 1KDTA 1R18A 5J40A 3NXKA 3LHKA 4BX8A 4JQSA 4YJKA 4K3VA 2COUA 1KA9H 2JCYA 2WM3A 2ZKIA 4MR7A 3USES 2CXUA 1ZD8A 2XCQA 4TPKA 3WGLA 2MW2B 1UANA 1W47A 4DHWA 1FSPA 4FLUA 1SC5B 1S8NA 4RM3A 3NK6A 1L5HA 5EGSA 1TRHA 4D3SA 4DG9A 4RZ2A 1FXVA 2HMTA 1VQNV 4RTRA 1T6YA 1PL0A 4HN4B 1RAGA 4LZZA 2VCHA 4RPHA 3QE0A 1J97A 1A5ZA 4KMMA 4R68A 5BW4A 5CCEA 4E15A 3F6EX 4QTXA 5K8VA 3RG2A 821PA 1XZIA 2F48A 2FR8A 3TM5A 4BNLA 3HVUA 1GZ4A 3QEBZ 2NZXA 4ITRC 1K4MA 1ZD3A 3P0FA 1LX7A 1X7DA 3T54A 3V7QA 4IWNA 1QVRA 2C2KA 1KP3A 3P52A 1USVA 3TL3A 4A8JB 4J80A 2F3RA 3U3MA 1MTOA 1NATA 2J4FA 1FMJA 2Y6VA 3RI3A 3RKUA 1FXKA 3TLAA 1WB8A 1DQYA 1DLBA 1GEEA 2CEAA 4KP4A 3MT0A 3F8TA 4UXHA 1DRKA 5IVDA 3M6FA 4O2AF 3O8OB 4MPTA 3EHDA 3ZW9A 5DZSA 4M99A 4DV3B 2NU6A 2SKDA 3TD2A 2YV5A 5GZ1A 2IUFA 5K8TA 4D9FA 2AKAB 4WK6A 3VR1A 4DCPA 3K8YA 3CE6A 2INGX 5DBIA 4IIYA 2RB4A 1KL7A 2O57A 2O2SA 3D2LA 1CRLA 1S3FA 1QOZA 4BCDA 2CKDA 2E37A 3AUFA 1QLJA 2RBKA 3PG5A 1DRVA 1XTRA 2JIZG 3MDSA 1AB3A 1N5MA 1XXHB 1EP1B 2I4NA 2OORC 3F47A 4RSRA 4YLGA 3WKCA 3WSWA 1U3TA 3KFVA 4EUKA 3RSSA 1QH8A 4P7JA 3NFRA 3FYEB 3EGXA 1O96B 2IKQA 4GIBA 4XIYA 2I4TA 2JVKA 4I50A 4CG1A 1OX6A 1W2BU 4B3XA 1RYDA 4B84A 1YCHA 2PHNA 3ZI7A 3QWBA 1J8YF 1MHPA 3WRXC 5SZKB 2BFDA 1IHUA 5DWVA 1DC5A 4GL2A 4P0QB 3CZ4A 3GAZA 3IEIA 3SYCA 1WPXA 1J8FA 5EZ6B 2O8CA 2RGGA 2C5FA 2PUCA 4YASA 2NO4A 1G1XB 3DMDA 3HUTA 4HNAB 1A7AA 4I81A 4MVRA 4W4LA 3SYKA 2CD9A 1OCRB 4JQCA 2WYHA 1DKRA 2FYUH 1E9FA 2CB0A 2XUGA 3ZV4A 2FOLA 2WLLB 2B8JA 2WZDA 3A6JA 3BICA 5FNVB 1CY1A 4U3JA 1GPWB 2ODTX 4FC7A 4BVBA 1YHYA 1JIKA 1WMFA 1XRPA 1GG5A 3OMAB 1LQUA 3NJ8A 3A2MA 2C3UA 1QJ4A 4OGWA 4IICA 1CFZA 2RSLA 4P36A 2XDWA 1FZQA 1Y7TA 4TRNA 4YO7A 2HMYB 3ZWBA 3GRFA 3S55A 3SI7A 1B3RA 1GPLA 2H85A 2JL1A 5E7IA 4LTNA 1I1NA 1YK1A 2HSWA 5IJ0A 2OSVA 5H5JA 4B74A 3MT9A 1J00A 3EAFA 4IXNA 5JO9A 4HOYA 5KVQA 5CA3A 3DXXA 2Z57A 5LOVA 2B8TA 1D5WA 4V0MA 1G6Q1 2ODNA 4O4HB 2PI5A 5BT9A 5B6PA 4FVMA 2EKQA 5K9ZA 1FXKB 2G38A 3K6JA 5DEIA 2O8EA 4EY5A 3AG3B 1B74A 1FEZA 2AV6A 4HDKB 1E3MA 4GKJB 2HBRA 1U3VA 2GYYA 4YRRA 3MRSA 3CEAA 2R7LA 5C1BA 5FV4A 5KYUB 4YI3A 1VC2A 4F04A 5MF6A 4ZHSA 2CDCA 1G8YA 1SVOA 3PPYA 1IIRA 1U7TA 1V3UA 4MEJA 2A1UA 4X1OA 1E4EA 4IVNA 4QE3A 4AMVA 1QQAA 3Q5EA 1KOLA 1ZW1A 4Q19A 3G8BA 2Z8ZA 3EOZA 3COSA 3UAXA 1QDLB 4QGGA 3LP6A 3LK7A 8GPBA 4UDYX 1EFKA 2O3RA 3VMMA 2QY6A 4EUEA 2F8LA 1TAEA 3HUUA 3UENA 1SRRA 4G4WA 7MDHA 5ICEA 2H4ZA 2QTMA 1EGVB 4W1SA 3TD9A 1NQWA 3L02A 2PE5A 1QVFF 4G84A 1Y48E 1AKTA 3FWYA 5FV7A 4TMYA 2EIMC 4TUYB 1NXXA 3L9WA 2ZYHA 4GE3A 4GG1A 1UMCB 4TV8B 4WGGA 1THZA 4AMGA 4BNHA 5D86A 2E4UA 4AJ2A 3BEHA 2C1EA 5HWSA 4HQLA 2XWPA 4NFSA 4HXEB 4BX9A 4J7UA 1Q7TA 1ZP6A 3D1JA 1ZM7A 3FCAA 3ZS8C 1QCDA 1MB9A 1JJ2F 4IBOA 1ICIA 1I94O 1EXNA 2GAFA 1QTNA 2IE8A 3L77A 4JP1A 4XQGA 4CQMA 3GI1A 4KITB 2YY5A 2Q1YA 1A7JA 3ELBA 5CCXA 3CC4V 1JWAB 1Q0ZA 3CU5A 4ZI7A 1N8RH 2DECA 3MINA 4Q37A 1YTLA 1MEEA 5KUTA 2VDMB 5C5IA 3FWKA 4QQNA 1RSZA 1MA3A 2BAGA 1KKCA 3KB1A 3FY4A 2W2TA 4Q00A 5K5EA 3KIPA 4J7CA 4O2AB 2IXGA 4Q7JB 1ZINA 1GN8A 3LK6A 3HUEA 1SPBS 3QXGA 5J47A 4RKYA 4RTNA 1VP3A 4KQKA 4P9NA 2DBYA 2UYCA 1CVLA 2D2XA 1MSDA 3L0DA 1I4DD 4OBBA 1ODLA 4BTEA 3MBKA 1ZUD1 1DLJA 4H08A 1ZGCA 1NRJB 1QIEA 5EBLC 2QM4A 2IX9A 5FFMA 4KPEC 1CJMA 3K8ZA 4CKXA 1MOSA 3RT7A 2C3PA 1I4TD 4O4IA 4TZ6A 1NU1H 3IDSA 1M6VA 4HO1X 4B09A 4NYIQ 3K79A 4LKRA 3TOXA 3RG8A 4UQLA 4YAUA 3GO4A 1DV2A 3T5TA 4B9AA 1A04A 2JDIG 4O4HA 4M1OA 5EXTA 2UZHA 4LFAB 1GG2A 1R6XA 2H4HA 3OU7A 1JMVA 4NYMR 5E4TA 3OM1A 5TX7A 3SDZA 2RAFA 3VSDA 3DEKA 3LYBA 2G5CA 1UPFA 2AZTA 1VQ4V 2QJRA 5AHOA 4ZI7F 2RJNA 5L3FA 3V3TA 1E62A 2H8GA 3TR5A 4AURA 2IJHA 3DXRB 3RFRA 2CBXA 3PDWA 5E3JA 3UV7A 5D5HA 2XXAA 2FL4A 2P06A 4AQYO 1PGOA 1TPZA 2PRZA 2Q2OA 2XMQA 3RTBA 3ITNA 5JJNB 4CN8A 3OZTA 4EZIA 2EGHA 2QW0X 4M8KA 2WJIA 2EKLA 2YHBA 3IAFA 2GF0A 4K2HA 4KV7A 4ZVKA 5JD3A 1IY0A 1P9OA 1PZEA 3G8DA 4GP7A 4QJIA 1CY2A 5I7OA 2NTYC 2XI4A 3JYPA 5ALVA 1KY2A 1PV2A 1GPDG 3K12A 1ZK1A 2XE6A 3W7VA 4DR3B 3VYUC 3OZDA 1E99A 2ZUSA 6YASA 4TZZA 3D9QX 4TMKA 4UHHA 5C7IO 3V4FA 4YTEA 3K8QA 2NTNA 3JZDA 1WOMA 2RB5A 1L4UA 4IIXA 3SJCA 1UKEA 3HKCB 1NLFA 5BV0A 1K92A 5ULLA 4J0DA 4L7QA 4YRNA 2P69A 1Q3HA 3VNRA 3VVCA 2IU0A 2JEUA 1EJ2A 3BUSA 1L1EA 2OAGA 3O92A 4E2LA 1XZAA 3OX1A 2VJCA 4CMCA 5CH8A 1P7GA 1IE3A 3ON1A 2BEVB 4B40A 4C82A 4ETWA 5E1AC 3Q88A 4G25A 4BNIA 1NVPD 1CZLA 4G2TA 3JARB 5AOCA 1N8SA 2XDQA 2NU8A 1JAYA 3U56A 4X20B 1LJ8A 3D0OA 5FTMA 3DV2A 3K2XA 1Z2AA 1HDIA 1H2MA 2AUTA 2C3MA 4K6KA 5LGNA 4IIEA 4H17A 4AJPA 3EORA 2JAQA 2AXTZ 2OLKA 3M6AA 1OC4A 1ZVJA 1IDN1 4D9JA 4Z53A 1ORTA 3GOQA 2DJVA 3E3AA 1U0FA 1A8PA 4RORA 4TWKA 1P7PA 1Y5MA 1CTQA 4EKDA 4DUZB 1NLYA 2VHZA 3LKBA 3ZHCA 2JANA 2JNBA 1JKMA 4O2AA 1SOWA 1G21E 3V7YA 4JTDB 4RDHA 5JZBA 2A9HA 2YJNA 4MV9A 4OKNA 1Q7BA 1FMTA 1WW8A 2ZIVB 3GJ3A 5G2OA 4Z1MG 3KT3A 4CI9A 3HA3A 1P49A 4QDZA 4ADSG 1X7XA 2ADPA 3A1VA 4IQ0A 2A3RA 1XRMA 1SCJA 1P2UA 3WGKA 3PCRB 3QBVA 1KF0A 3MAAC 5LHHA 2DPMA 5KBYA 5SY4A 2JKVA 1XOUA 4D41A 3LC2O 4GKKB 4Q01A 4I0WB 3MTIA 3H5TA 4BLPA 5AK0A 1QK5A 1SKQA 1SIOA 3ER6A 4PTYA 4GHWA 3MELA 3OFSA 3LHSA 3FMIA 4OP3A 2Q7DA 3E05A 2DMXA 4CEHA 1VG8A 2H7YA 4J6FA 5HGXA 1I32A 1NVBA 2NUPA 1PSZA 2IDJA 2QGFA 4HLNA 1AKWA 1E2GA 2XMDA 4P3OA 4P80A 5EFOA 2B21A 3VI6A 3Q8WA 5FPPA 2B4YA 1AZWA 4OATA 3AQ4A 1UODA 3D6VA 3QVTA 3A3KA 3AC0A 3FLEA 4US0R 2DJ5A 5ALSA 2HA5A 4YONB 3B6JA 3BA6A 1YXBA 3AVPA 4QNHB 2QYHA 3LHDA 2YUAA 3GDFA 4IKEA 3G9TA 2ZAIA 4E6EA 3CF4A 1VARA 1JHPA 1NYLA 1Y1RA 2H16A 1ZS9A 2OHXA 2QHXA 1BT8A 1EJBA 5DM2A 1XQWA 1ZJ4A 1ZIPA 3L01A 3W2GA 4DLTA 1JEDA 3LDTA 4YP6A 5BRJA 4BZZA 5K7SA 2C29D 1A77A 3N05A 1TYEB 3ZV3A 3LYLA 2OT5A 3FETA 3RODA 4HUTA 1O6ZA 1NN1A 1JWLA 3K53A 2Q0OC 3GFPA 3SC3A 2XCTB 3H1LH 2HQOA 4P22A 2AR0A 3BRWA 5KOHB 1BXKA 1W5SA 4IJVA 4GO1A 3SLRA 4OPMA 3IHLA 4UZSA 1GTRA 5CTAA 3OCCA 1G5QA 3O4VA 2AEJA 3ZCCA 3R7DA 3HCCA 3NI2A 3O0TA 1SVLA 2F4NA 3VR4H 4UUJC 4NBNA 2M7WA 3CC8A 3SFTA 1Q21A 4YP0A 1JBQA 2VXCA 3D5QA 4QAJA 3WLLA 4Y2RA 2R96A 1QYWA 2J6IA 3KLPX 1EXMA 2OZEA 3IAM6 2EHDA 3BPSA 3JW8A 4MUMA 4QPZA 4REMA 1KI1A 2Y48A 3LSUA 1W87A 3U16A 4YXWG 1BQ0A 1RM1C 1OX5A 1TOAA 2AJBA 2JFBA 4CUKA 2HCRA 2WZBA 1K73H 1Q1AA 3D01A 1Z2CA 3QMVA 2V1DA 4GDMA 4XWAA 4FZ3A 4RIFA 2HX0A 2JGAA 1F9EA 2RH9B 3C98A 1NKVA 3I58A 4FFLA 3NOXA 4MQFA 4QX6A 4HDRB 3RAPR 1K5GA 4R05A 1DARA 2QMUA 4D4LA 4DIEA 3HS3A 3CCVV 2AOTB 3T7RA 4D9KA 5A1JA 2NR5A 5TJHA 1OBFO 3NV7A 1DIRA 1L5NA 2EKPA 4WUTA 1HV8A 5BMVF 4R81A 4NXMB 2XRYA 3GEBA 3MJ4A 4YCNA 1EGMB 2RI6A 3OPXA 4KXMA 5DYTA 1GRCA 3AJRA 1GZ7A 5CFZA 4R98A 4DLSA 1CUAA 1O9BA 3KCQA 4FMCB 3PHGA 4LHWA 4YV7A 2PN1A 4AKTA 4JNKA 3CKKA 3IRVA 3BDAA 4YC7A 3T7TA 4FFBB 1EX1A 2CK3D 2Z09A 1M6WA 3GRUA 3TLCA 4R2XA 5KPJA 1JH9A 4P3XA 5E7JA 2P8SA 4ZYUA 3V4RA 3NIWA 5IANA 1RE0A 5KU7A 5T5QA 3GVXA 2V59A 1W4LA 1TM3E 1BKDR 1YL5A 2WHRA 1FFGA 1IEWA 3CSDA 4PCUA 2X0IA 1G3RA 1KJ9A 4HZGA 1XCLA 5E6RB 2RH8A 1O6GA 2PGLA 3F5FA 3HWWA 4RESA 2TMKA 1FSSA 2V97A 2E82A 2WWXA 3BZUA 4B3RO 4ZQGA 3U7IA 1KYVA 4XGNA 4CLHA 4FQ5A 1J2JA 2POCA 4D3DA 5AM4A 2WLSA 2YZGA 4RFLA 1JFLA 1PEYA 1UCFA 3IS3A 4GLFA 5EMNA 1E8MA 4ZCQA 2WLLA 5CYOA 4FPXA 1GL9B 1ZY2A 1DINA 5HSGA 1BDIA 2UUOA 4LJRA 2NVUA 4ACAA 3LE8A 2JG3A 1BTOA 2J08A 5JATA 1L8AA 2WZCA 5JBNA 5K0JA 1YUNA 4L5JA 1PD0A 3RW9A 2PAFA 4YV1A 3T7AA 3CW8X 2CTPA 1STOA 1PHPA 3W8RA 3O4JA 4WZZA 3F0FA 4M1YA 3CCUV 1MJNA 2A06H 2GXAA 2DCUA 2UZ0A 2V8BA 1QGYA 4QPKA 3UKOA 2OO5C 3GN1A 1D03A 1ID1A 1FYWA 3DULA 2C2BA 4P2GA 1HDJA 4URWR 3W4IA 4HXYA 4DWJA 5KZMB 2ZE5A 5KAMA 1U8XX 3DZIA 3BDVA 1BXRA 4KMRA 1RPOA 3AR5A 3GVMA 1Q0UA 5KX5B 1XJQA 4S2UA 4BO8A 3WGNA 5BUZA 3I5UA 2PUSA 3PNPA 3ZWDA 2ZDGA 4PSKA 1B14A 4GI3A 1S2IA 4TVBA 2V7PA 3ICOA 5FR1A 3FX7A 4P35A 4F5ZA 4CQNA 4AS3A 4M4SA 4GX5A 2PMCA 4IH4A 4TS1A 3GLKA 2C4VA 3LYAA 5LUAA 2I3ZA 1Q3TA 1RU3A 1Y80A 1RS0A 4PO9A 4ZC8A 3FOWA 3HZOA 3RUCA 4PDVA 4MWTA 5EYPA 1E2HA 1P72A 1GQQA 1C7IA 4Z8XA 1Z28A 4JV5O 1SRQA 3E5RA 4MDYA 3TFOA 1VKHA 2JBAA 1T2NA 2PR2A 1DXQA 1SUDA 4B81A 3H7IA 4URVR 3HMQA 1G2IA 3OQ1A 1R1DA 3UUEA 1K08A 3FR7A 1SKYB 2EBWA 3HEMA 3NC0C 1FSGA 2XE7A 4H4EA 4LUCA 3TQFA 4GOMD 5B7GA 2HUNA 5J4LA 4HTAA 3C8DA 4IJ5A 5FTJA 4PRKA 1VRCA 4R1PA 3SM9A 3UN1A 3G02A 5A9GA 4GUNA 2DYSB 3CRAA 3LWQC 1ECBA 1TF2A 5CA1A 2ADMA 2XIJA 3B1ZA 5H83A 4BECA 9ATCA 2CJWB 3WP0A 2VHCA 4NTXA 5LQUA 4OIMA 1CRWG 1XEWX 1LLQA 2GK7A 3GWZA 4J3JA 4PTLA 5IXJA 3UMRA 2R86A 4HQ6A 1WCIA 2ID7A 1CIPA 4BB0A 5FWNA 4RH3A 1TUIA 2I5PO 1UR5A 1Z18A 2FPPB 4WE3A 2IUUA 2ZAYA 4KJXA 5TQJA 3Q0IA 1AXEA 3HFRA 3HRHA 4TSFD 5KKNB 1RFLA 5KYNA 4BIUA 4YP9A 3RRJA 2J31A 1WTAA 1Y4DE 1Q86W 3AK4A 4JXZA 2XR1A 1F4VA 1PF7E 3GPLA 4NRDA 4TV9F 3MWEB 4ZOQI 5DDIP 4ARSA 3ABIA 1YJQA 3CLKA 3O4HA 1QH1A 1I6WA 2BKVA 4JJ4A 4OFZA 1Q95A 3VR5H 1XHEA 1YQWA 2DP4E 1JHOA 3HBJA 4JA0A 4TM8A 4AHCA 4F71A 2GVDC 4JOSA 3QU4A 1VBKA 4OGGA 4PICA 4BZQA 1KC8H 3QVNA 1CN7A 4MULA 4RK1A 2GAJA 5CDSA 2ERYA 1WD5A 4M0MA 2IZ7A 1P81A 1U2QA 1M6NA 2ZIFA 3WPXA 5CT4A 4H7FA 1FNSA 4WADA 2P2LA 4QHSA 3FJ1A 4E2YA 2R6JA 4ZC1A 1T8YA 5ALKA 3VPDA 3B8HA 1MORA 2JHGA 2ZR8A 2TRSB 4N0DA 2A4MA 5IDVA 3VDRA 3J80A 5COBA 3LXXA 3LFTA 5FTNA 1GFZA 3C3JA 2X2FA 3CURA 3W7BA 2FNAA 3PYLA 4ZT7A 2GBFA 3VJLA 3QE4A 1MAWA 1EWKA 1M56C 1YIOA 4B79A 1ZL8B 2JI4A 2XA9A 3VR3D 4DREA 4EY6A 4B08A 1E9DA 3EGWA 3L72H 1AMUA 2GCEA 4M3NA 3A14A 3CMEF 3BKWA 4AJNA 4EMBA 4EYKA 3ZDBA 1OXSC 1DUVG 4ZBMA 3BULA 2C5LA 3Q9SA 1OTYA 1JLSA 1DX6A 1NT4A 2Q99A 1Y42X 3EVZA 4X41A 2VAMA 1DJQA 4ETMA 1GN6A 3O65A 1E59A 1JYFA 1Z2GA 2R11A 3LUJA 3N2EA 3L2OB 3HCWA 2CDRA 5LGTA 2C78A 3E7WA 3IQDB 4KV9A 3W5SA 3H0EA 3VZCA 3AHJA 4JEHA 2JHAA 3Q3JB 3WK8A 3LCVB 4YUYA 4HQKA 1ML4A 3K0SA 1E3LA 3L93A 1L4LA 3ZWPA 4LYGA 4UD2A 3SE7A 4MA0A 4LVOA 5EOVA 1UMBB 2R5WA 5CG2A 4L74A 4WJZA 1U80A 3L5KA 2ZQ5A 1XCPA 3DGEC 4MRVA 2MYTA 2Q9LA 4UM7A 1ZUNB 1MMMA 1WSDA 3A3NA 3W8FA 1H2GA 1NVWQ 1M9NA 3D64A 2FR8C 1W41A 3NWEA 3O2NA 4LCEA 4XIGS 1FS4A 1U8CB 3CO5A 2CSLA 5BWNA 4ASUA 3P8ZA 4P7BA 4V0SA 3HMKA 2QMHA 5SYMA 4EHNA 3T4ZA 1I13A 2VPZA 3BF8A 4GXTA 2AIFA 1UEIA 2HEIA 2MOKA 5DXJA 5CDTA 1WPQA 2AOWA 3JQGA 3DVAA 3AO0B 4QOGA 1JR6A 3I55V 1D07A 3WLMA 3E8HA 1RAFA 3PVCA 1PQWA 2GEDA 4KH0A 3M1YA 2FEMA 3IEXA 1NTMH 1LFDB 3FWZA 1QCEA 4F2HA 1Q43A 2AFIB 5CJ2A 4DR2B 3L40A 1KORA 3MAJA 4GZLA 1GNSA 1V2HE 5IDJA 3HBNA 3LT2A 4E5MA 1CZHA 4DL9A 2WLNA 5EI5A 3PDJA 2KLBA 1BDMA 1JNYA 4KN8A 1L8OA 1KGSA 3O9ZA 2GASA 2G9RA 3R3WA 3R7WB 4EEXA 4KXRA 3IC9A 1NQUA 2GEJA 1ISJA 5AD1A 1BA3A 3EB9A 3ABLC 2W43A 5ALPA 2HQ1A 3ZU2A 2ZI3A 3TYXA 1VJ1A 1YZTA 2HNKA 2HVJC 3SSNA 2K6GA 2Z30A 4NMWA 4Y0VA 5AVQA 3DDZX 3MSXA 2F3PA 2G80A 3LXRA 1TM4E 3WC4A 1UFVA 1DG3A 3DVSX 1OSNA 1G8KA 3HPRA 3SFZA 2WIAA 4JHXA 1SBQA 4H0CA 1EZJA 2RMKA 3FAKA 3LTEA 3RV4A 3R66A 4RH1A 3PQCA 2BR5A 4Q15A 3AGPA 3EN0A 4A1OA 1H2NA 2FW1A 5BR8B 2NUPB 4PO8A 2N9UA 3ODPA 3ZDFA 2IQ5A 4ZYWA 3E70C 4UPEA 1CNEA 1LH0A 1UKYA 1ZKDA 2GO7A 1QLHA 3VU1A 4V1CI 2CYAA 1ZUWA 3FYSA 1GPAA 3C5EA 2IEDA 1XU9A 1YR6A 2HJWA 1YJ9V 2Z3WA 3ACCA 1R6BX 3NH9A 4H35A 2ZBGA 4L08A 3S4YA 121PA 4MQUA 3W5VA 1ELOA 4GXRA 4U63A 4ECAA 4PV1B 1EUCA 2JIZA 4NONA 5J5AA 4E30A 3BB1A 3GY0A 4C7XA 5KJFA 1BWQA 4JNCA 1ZWIC 5EK0A 3LSQA 3N53A 2GILA 4ZREA 4YREA 1ZISA 1AZSC 4RQAA 4WV3A 2W70A 1TUBB 5JOQA 3NBYC 3EFOA 1EWQA 2SBTA 5J2TB 2C9MA 4ENSA 1E77A 1YB7A 2GPTA 2DH6A 2HEPA 3AY6A 3OCZA 3R7WA 2GEVA 2Z6QA 1ODKA 4BHTA 4TSFA 4J0CA 1Y76B 4GZ6A 5GIPE 2PUWA 3ABSB 2OLJA 4U7NA 4HRXA 4PPYA 2HRRA 4KQ1A 2JLZA 1PFUA 2VH5R 5DX1A 4Y1RB 2HFEC 1CDEA 4HWPA 4D9IA 1JN0A 1LJUA 3G8CA 5AKZA 1BDBA 3HPQA 4DR6B 1CUWA 3U3RA 5J43A 3QG5A 5DTIA 3ABKC 2VDWB 2PYDA 3D8RA 3R2JA 3OFNG 3SHFA 4L0CA 1EJ6A 5CMLA 3MRVA 2B8NA 3LV8A 1ZLXA 3Q6IA 1E5VA 2B25A 2Z1MA 4R2IA 3OBWA 3FYCA 2IGBA 1WB9A 3MFQA 3AFIA 5HTKA 1EHYA 1KQ3A 2A3QA 5K3SA 1NUHA 1ZRNA 2CMHA 2XUQA 5FPKA 1J25A 2O7NA 3C9RA 3U9TA 2K7FA 1ZN7A 2YVUA 3ZBQA 4X92A 1C14A 4GSLA 1EB8A 4JGIA 4C87A 3TE6A 2PWZA 2ZSFA 1SOAA 5ITZB 4QXPA 4UHCA 4WNIA 2OXTA 1YHQF 1J2YA 3PNYA 3D54A 3HDGA 5B3SB 1MOZA 1RWPA 1ZD4A 3A3PA 3A6LA 4W1QA 2GWRA 4MICA 4C76A 4AI8A 3GUHA 5AHRA 3EARA 2AFHE 5ALRA 5FUXA 5IG2A 3NBAA 4ARCA 1CP2A 2QF7A 1GTVA 1M72A 2VZLA 2WVGA 4OGKA 4RPLA 4ARZA 4DC1A 3CH7A 4IYJA 1ID8A 2XYGA 3FMPB 4DBLC 3R09A 2O23A 1DXYA 1EA7A 2W6OA 3TZLA 4OTZA 4YY3O 4ZKEA 3V6LA 1O96A 5DBFA 4YCAA 1XVLA 3V33A 3PCXA 3BPZA 4WFFA 5E8RA 1XD9A 2EL9A 2V7QA 3NM5A 2X1MA 3H01A 2JGFA 4GQBA 1XVTA 2QLMA 3A26A 4J1QA 4F91B 2QWQB 3OICA 4ZO9A 4BIIA 5A06A 2FHPA 2J87A 2ALEA 2ZSAA 5AJYA 2XXAB 4BVEA 2BFFA 5HP8A 1HE4A 3CV3A 3NO4A 4C2AA 4YECA 3CCSV 2Y69B 3OR6C 1N7HA 1RQLA 2AWNA 2Y1FA 3CNBA 3OE4A 4ITUA 3PHHA 5TC4A 2XEXA 1QANA 4CCAA 1G4UR 4M1QA 4DLAA 4D4HA 5FI1B 3AFMA 1FW6A 1GQFA 5B7PA 2A14A 2X1LA 2GNOA 3L7AA 3KYJB 2IEAA 3H5LA 3KB2A 5HDBB 1GPJA 3S70A 4YRIA 4QYIA 3BM5A 4TRRA 2FW6A 2H3OA 2VKTA 1FJGO 2A67A 3C85A 2YZ7A 2O19A 1NE7A 3WYBA 3T7DA 2KKWA 3EBPA 5LBTA 4NAUA 1U90A 3X1YA 3KSZO 4OU5A 1EQUA 2QENA 1N1EA 2CHUA 1O94C 3KWLA 2GZMA 3C16C 2ETXA 3HVIA 3L7DA 4OQFA 4ZVOA 2ZDIC 3ZIAA 3Q8MA 1FPQA 5AVJA 2JCGA 2BSXA 2ZRFA 3I05A 2PZAA 1SBHA 2YJ3A 4IZHA 1P9NA 3OLCX 5LA6F 1OHHD 1FFCA 2XUJA 4LYAA 1IN7A 1D4FA 4ZA2A 4C7JA 3GC6A 3RTEA 4CNBA 5BXQC 3REFA 3BHPA 1T9DA 4WKOA 3VPGA 5K99A 2RGUA 1G8HA 3M6LA 3MTEA 5AMXA 3E8BA 2QTVA 1EUZA 3BA1A 4BV3A 3AYXB 4CQLB 4FEAA 2GTAA 1QVVA 1OMOA 4DUZO 2QE7D 3AMVA 3CWBH 1BSVA 1MAAA 3HY3A 3S99A 1UXJA 2WE7A 3IMCA 2Z3ZA 1K0UA 1QFYA 4MGEA 4DIBA 4DIFA 1B7GO 3G71F 1MBZA 2QN1A 4JUAA 4GX1A 2FE4A 2ZXFA 4NJEB 2Y66A 5F33A 3NGXA 4B2LA 4CMGA 2X76A 2OV6A 1Z5OA 4MTLA 5AWFC 3H1BA 4RULA 3WB1A 1W88A 2ZJ7A 2VK1A 4MW9A 5CB4A 3LCJA 3PL5A 1GARA 1NOIA 2DYYA 4K87A 4PHHA 5C31A 3UKDA 5I47A 2ZSJA 4R9SA 5FCDA 2IVFA 3DFKA 4ER5A 5KWJA 1YGYA 4F3CA 3JQBC 3FTDA 4BNMA 3E5HA 3JZAA 3FHJA 1U9JA 1HT0A 1SCIA 3X44A 5JT1A 2R0QC 5IU6A 2VP2A 2WYVA 4LQLA 5CVDA 4M7RA 4GOLD 2EX1A 3W1WA 4B3SO 4PWTA 1UZAA 3T5BA 3EY9A 2WD7B 1Z68A 2JJ2D 4CH5A 1M1KH 3IPXA 3KL2A 4G27B 2FGYA 2NO9A 4ARBA 1BDHA 3ZNQA 5CYFA 2A1UB 4G5RA 1XWWA 2CUTA 4LOLA 4XLLA 1R3IC 2QGNA 3I4CA 4PONA 3ZU5A 4LF8O 2E5WA 1ZHHA 2FSIA 3BWDD 4Q7LA 3SAJA 3DBLB 4WQMA 2F4VO 4ZODA 3QLVA 1H47A 2HCJB 3B13B 1UC9A 4CEIA 3GLHB 4QYIB 3ER8A 4L16A 5T4HA 4WLOA 1CUYA 1QS0B 1ECGA 4RF5A 2YFKA 1KVRA 3M6IA 2PUHA 4U0JA 2YOFA 4EB0A 5A3SA 4NJMA 1T29A 3D6NB 3EMDA 4ZO8A 1Z13A 3DDCA 3WSVA 3JYCA 4BU1A 4IV8A 2V5UA 4B35A 4DLLA 1X7ZB 4D4IA 3KB8A 2DETA 2OBFA 4MT8A 2BI4A 4G8CA 3CD6V 4GYWA 1MNGA 1E20A 1P44A 1B6RA 1RLJA 1U0GA 1WSAA 1GYQA 5DI9A 1M8PA 1RWXA 1PCXA 1ZL2A 2QL5A 4QUEA 4R6XA 1FSZA 3C8ZA 1PS9A 1UP6A 2UAGA 3GPCA 1V41E 3WJPA 4FXPA 2V7QD 2KHZA 3B7PA 3IV6A 4WLNA 1YZKA 4QFCA 5JTUA 1YFKA 2H7CA 5AK6A 1P1JA 2XECA 4ZT2A 2P2YA 5KAIZ 4O1MA 4A6DA 4ZJPA 4BRUA 1YR3A 4ZANA 4EB8A 1I24A 2ODPA 3ONNA 4EG1A 1KKLA 2BL4A 2DFLA 2LRHA 3NHJA 5DBHX 3TMAA 4LBWA 3T34A 1K5HA 4M1WA 4YALA 4DQUA 3UHAA 3QA9A 5FL7A 3FZYA 3GCGA 4RXUA 5EP4A 3RRNA 4BQQA 1DF4A 4L6AA 1O0BA 3ZCSA 4ER7A 1Y1KE 5G3ZA 1OB5A 4J9ZB 1WDMA 1JB9A 4YT5A 1NVAA 4KCGA 3OD5A 3PD0A 1RKXA 5EYPB 1IPEA 2CBGA 3LWRC 2PO7A 2RC5A 1ZMBA 4QM6A 4KI7A 3N27A 4LHXA 3DAYA 1OAOC 1U2RA 6PFKA 1QRTA 3CUTA 2AKEA 1PWYE 2C4MA 1E7SA 2DUUA 1W93A 5T6MA 3TGWA 4YDQA 2O3UA 2BKLA 1GGFA 1E7QA 1LBEA 2Y68A 3D43A 2UV8A 1WHTB 3N8KA 4FCVA 2EP5A 5AI0A 1SFRA 2JGEA 3OGCC 2OHWA 4L8WB 4EB3A 2WTUA 5SY6A 5JCOA 2ZRLA 3WAGA 1XHOA 1CC1S 1T6ZA 2PM8A 4L2IA 3MN1A 3GUYA 4MVJI 1S3GA 3EH2A 3OKPA 3O2QB 4OQLA 1KGDA 2EBFX 4ZD6A 4MLPA 2REQB 4KKVA 4EL5A 1NR7A 5KB3A 1VSTA 1QRDA 2HGZA 2XAAA 3HLYA 5I9MA 2L42A 4W1PA 5BT8A 5AI6A 1HNZB 1ZAKA 1CG6A 3D1VA 3SLKA 3LDDA 4D6XA 1SGWA 3WGGA 3SG0A 2ZT9B 2PEYA 4J1TA 3A2LA 4RJKA 2GX6A 4I3HA 3IUSA 2WNIA 1IEXA 2QTCA 2A0UA 4H31A 4G1VA 1CETA 1DWPA 3RU3A 2WLMA 4RUFA 1RIFA 1T8SA 1E94E 1VBNA 1Y9EA 4PX3A 4FJ2A 1T5EA 4BW9A 4PNZA 4X54A 3EFBA 1Z5WA 1YDMA 3E9YA 4C1NA 2QK4A 5AESA 3OHPA 3C1TA 3DUWA 3FVWA 1WWKA 2ZYDA 5EJ8A 1GAEO 5JCOC 1AKMA 1Y66A 1N77A 4UEQA 1DCTA 1TAUA 2WFAA 3ASZA 3N8DA 5K2OA 1J7HA 3WNVA 1E7MA 1K7EB 2HD4A 2PLNA 1FBNA 2V98A 4WESB 4PA9A 2JW5A 3THXB 2FRDC 1RFGE 4M0EA 1P7ZA 4UQPA 3QY0A 2BSKB 4JJ8A 5D2CA 3FVRA 1CB7A 2WLJA 1AQ6A 4XUEA 3RVZA 2M2IA 5BWLA 5JI2E 2NQTA 4YGYA 1Q74A 3IPRA 4LZPA 3RBAA 1EK5A 3SQOA 2GA8A 4R6WA 5DXAA 4FC6A 2XD9A 4NYMQ 4EWLA 4CKZA 3PHBE 3GFVA 3VQXA 2W8BB 4JASB 2ZE7A 3QWAA 4Q21A 1ZIYA 1QFMA 4DYDA 2BN4A 1NX9A 4Q39A 3WNCA 1BROA 1YIJF 1I3NA 3HADA 3I30X 4RV4A 4BCBA 1UBRS 1IN6A 1ZX1A 1YE8A 3KVRA 4HC4A 1JEQB 3CMAV 1BQ4A 4F4FA 4DXDA 3L8DA 2X19A 4NZNA 3STUA 3EGIA 2FY8A 3CNOA 1JBKA 1IY9A 3CG4A 2CVLA 4FT2A 4UVEA 1HP8A 4LHEA 1XF9A 2EJRA 1FDVA 3TW8B 4XDKA 3ZMTA 4Z4HA 3BWEA 4F3NA 4IX1A 4ZKDA 2OIGA 1MX1A 2CFSA 3W6UA 3Q4GA 4HDRA 1I0ZA 4COKA 4INZA 4ND4A 4E1AA 1I8TA 4MS3A 2V8OA 2UXCO 1VHTA 4MARA 4Q9NA 1KKMA 1V2GA 2DT5A 4S35A 4EG4A 4PLWA 3VYWA 1IURA 2CN1A 5BPHA 4M7WA 3SJCC 3ZGNA 1Y3CE 4EW6A 1R5BA 1C41A 1BVRA 2NTEA 5C2JB 1SCBA 2ARKA 3DR3A 1JXMA 3EWNA 3UWSA 4YY3B 4UE6A 4PI2A 2FZCA 1KQSF 3JCMM 2YC0A 2RAPA 5HZHA 4NBTA 1T0IA 3IUJA 1N6KA 3CSXA 4ED9A 3OTWA 1EHCA 5HY0A 4ZKIA 1U7XA 5CX1A 4UUBA 3RV3A 3CUVA 1SC6A 1XCMA 2B35A 5ALXA 7MHTA 3AEXA 4JODA 4LBYA 4JP8A 1FFTB 4RWZA 5AYVA 2QMOA 4JZKA 4Y6OA 4DLNA 5H81A 1FUYB 4OFXA 3P3NA 3LY9A 2EDCA 4MINA 3QTBA 5IC6A 4K8OA 2FDCA 2X4GA 3G17A 4OHWA 4IUCS 5CM9C 5FPSA 2YC2C 4LG1A 2OZLB 4DFDA 4JC5A 3S0YA 1SAYA 2F3QA 4NL4H 3RJMA 1OFIA 2A58A 3Q8HA 1M57C 1VI6A 2C7GA 3C1OA 4P3KA 5TQ0B 3HDYA 1YR8A 2H9IA 3RS8A 1D5NA 1W0CA 2OUKA 16PKA 2V7XA 1XQVA 2B9ZA 1D5AA 2Q5OA 3PC4A 2QORA 4JBIA 4NESA 3GG2A 1GZHB 1K8QA 4LBVA 4PX5A 1D7AA 3INTA 5DGIA 3FMGA 4PQYA 5T8KC 1GRVA 1FCJA 3GYGA 3KTDA 4N5MA 3TTXA 1K5SA 1JNXX 1N6HA 1JT9A 5HY4A 1B93A 2Z9DA 4HDAA 4KXXA 2HA2A 4E2FA 2QN9A 3DNPA 3K0BA 5E3IA 4LNAA 2Z3YA 3WV4A 4ILEA 3P4YA 2IYAA 3JD4A 3H11B 3L07A 3WYDA 2COKA 1MC1A 3GJTA 2GJKA 3N4ZA 4KO3S 4UNPA 2C31A 2E48A 3UCFA 2ZIEA 3OEHA 4YRBA 5KKAA 2PU7A 1AOXA 1CQIB 3VISA 3WLNA 3CCQV 1J42A 3FZGA 4M6WA 5JASA 4O2BB 2AB0A 2R5FA 2HSGA 3USZA 1V55B 3LWVC 2R7NA 3ZEAA 5ECGC 3KZNA 4P08A 4DNQA 5FORA 1ZMTA 3AONB 4A8JA 3FD6A 3R1IA 4UTNA 1WXQA 1Z6GA 2UVQA 3WO0A 4RY8A 5JADA 2ZD9A 3FIUA 3P9IA 4KXNA 3BGDA 2BGLA 2DHCA 4BO7A 1DMSA 1JIJA 2OCIA 4YRMA 1HFWA 5FO1A 1MQSA 3CC2F 1NMUB 1PR1A 3WQBA 3DLPX 3VNVA 3PIIA 1EVIA 3WOVA 3HCEA 2GD2A 2HJRA 4JX9A 4A6XA 4DXHA 3PDCA 3C5WP 2PK3A 1JZTA 3OOHA 1ZQ9A 2PH7A 2IIBA 3UF0A 1OTXA 3A4IA 4KQ9A 1ZXXA 1BGVA 3SZUA 3W04A 3ERCA 3ANTA 3B9BA 4L73A 2CEKA 5B12A 4B43A 2PGNA 3VPXA 2D00A 2RARA 3DONA 3UJPA 4LXQA 1FE8A 1A9QA 5JZ9A 2ZUUA 2P90A 5H0IA 1KD1H 1RPJA 2XLBA 1OGIA 2JEXA 3NHYA 1RXEA 3UV6A 4EMSA 2XA2A 1YT5A 1TFRA 3Q9UA 2CJWA 3QGMA 1G5PA 2HRDA 2JAUA 3AIIA 3I5AA 2DQZA 1W4ZA 1Y4SA 1NPYA 2BIFA 1RLTA 3OZIA 3PP8A 2P9QA 3QUCA 3S2ZA 1VIBA 3HKCA 1M1KW 2Q5LA 1VP7A 4X7BA 2HG5C 3EG9B 4JENA 2GT1A 2PYIA 3QPAA 2LCFA 1Z0UA 4ME6A 2IGTA 5CAEB 4B3CA 5JS2A 4E1VA 3WK9A 3P0EA 3KLNA 4WJKB 1T5DX 4BFYA 4JI3B 2C54A 4G8BA 5KYXB 1AR4A 3QI7A 1SELA 1T5LA 2VQ6A 3U19A 4YLEA 1RPNA 3KJFA 3TXXA 1HY3A 4JLDA 3C6QA 3CTMA 1US6A 3ZMUA 1HR0O 1T8WA 2AFRA 2UUPA 5P21A 2IW1A 3C3TA 1W19A 2Z2YA 3KV3O 4GEKA 4RA9A 1AZLA 2PMPA 4ML3A 4QXMA 2P11A 1P45A 1G98A 1BGYH 2VTEA 1RNLA 3T0GA 2NZJA 1FFWA 3HFJA 3QXSA 3MCZA 1TCCA 2WV9A 4XB6B 1DFGA 1NVGA 2X5KO 1ZR4A 2QMYA 4EHBA 1W85B 5LP6B 2I8CA 4GZ5A 3CRZA 3EWIA 4BRZA 4Y1GA 4LV8B 1EX9A 2Q3JA 2XOKA 5AJHA 4R9VA 1CU1A 2XXBA 1GGHA 3K0AB 3GX1A 1MG5A 1QG2A 4QFMA 2VHVA 4PG6A 3H9QA 4AP6A 4RUKA 1R0KA 1BG6A 4Y9UA 1EP9A 4I5IA 3BEDA 2W0MA 3K0AA 4KFCA 4MVJD 3DZCA 1SBZA 4MS1A 4RA6B 1WD7A 4F46A 3DBLA 4XR4A 5G41A 1KOJA 1GCUA 1V5WA 2KBEA 2AN5A 2QV7A 5A9RA 2GDJA 3R0QA 3KSBC 1JLLB 3LXMA 4XD7A 2BFPA 4DIKA 2C9CA 2X9QA 2XVZA 4EH1A 5HQ3B 3C70A 4OI1A 3K1JA 1WUIS 2NV0A 3GLFA 2GBGA 1G9TA 5IT4A 4GFDA 3EUWA 3PDHA 1VMGA 4EB6B 1C1XA 2JVJA 4YH1A 3A9WA 4CKBA 3ZQ6A 5KU1A 2XQKA 1T5SA 4MB2A 3MAQA 2GMWA 3DZ8A 1Y9AA 1RJFA 1ZIDA 3W05A 1OVGA 1V48A 2R85A 5DBGA 2RHCA 3TFWA 1WETA 4FFOA 4BLQA 5B3JC 2CE4A 1QU2A 2QX7A 3ELCA 2BFEA 1WB6A 2WYUA 2FWAA 3IOYA 4OIFA 5T4BA 1P2GA 4TSFG 1CJSA 2VJMB 3FNFA 1DQPA 1BXZA 1V11A 2PA0A 3GFRA 3MMNA 4MZXA 1L5KA 1JQLB 4H60A 3QO8A 2GZHA 2H9YA 4DNOA 1T6BY 4N23A 4ABTA 3KV1A 4NG5A 3PNVA 3VPSA 3WMGA 2X8BA 1ZW6A 2QA5A 1F2VA 4B6PA 3CS3A 1YB1A 2V6MA 2HRUA 3QBEA 1DQSA 4WFQA 4UV8A 4YMIA 2GOYA 1LCIA 2ZUDA 4MO9A 4MUIA 2H6EA 3GEGA 3IAM1 3UAOA 5K8UA 5L3GA 1ONBA 1L4GA 1I9CA 2EILC 1MA1A 4HAIA 2K5UA 3V8QA 3GLTA 2OCCC 4CPDA 2YIBD 1FFSA 3T3MB 1E8DA 2G88A 3G0GA 2AMYA 2F8SA 1JHRA 2OO7A 1V54B 3D4NA 3IVGA 2JD1A 5EKUA 4QOFA 3URMA 2XZLA 1XREA 1HW7A 2C2ZA 3JVEA 3MHPA 4IS3A 5ELLA 4TYNA 1SCNE 1XEWY 4QSMA 5JV5A 1W34A 4OJQA 2W71A 1QG0A 3MMSA 1BEEA 4Q4HA 5AJTA 3TUJC 4JB2A 4AN1A 2ZPTX 4QATA 1RLMA 4DAEA 3K71B 2DE0X 1LTQA 3UO3A 2PX0A 3U80A 4BO3A 3O74A 4CMKA 3L79A 4FN4A 5E2AA 1I2ZA 1L5RA 4KDRA 1ZN2A 1ORHA 3LDAA 4OYYA 3UOWA 2EAUA 2J6BA 4FGSA 4GP6A 4ID9A 4D96A 4P4NA 4YT8A 2REBA 2IU4A 4I6GA 3JSXA 3UXHA 2CWDA 3QFSA 3VSEA 1G18A 2EINB 4EHHA 1A96A 1G7TA 1X52A 1T8PA 3PUHA 3ST7A 4IQ8A 3J80M 2ZTHA 3U4QB 3UUWA 2IX3A 2I2BA 1V1JA 3BJMA 1ODIA 2CMDA 3L7JA 4LDZA 4NH0A 4LMBA 4HVTA 2H3EA 5AW0A 3MW8A 2Y67A 8AT1A 2HV9A 3IJPA 4GOKA 2RQ6A 4J41A 1JECA 3B40A 1SXHA 1Y8CA 2WJVA 3D2AA 3FSEA 4JI5O 2CVOA 4JQZA 1GZDA 3IE2A 1SHUX 2RHWA 1Q6ZA 2YWJA 1P80A 3OBBA 3OJWA 3T1CA 4RDXA 4RS4A 6NULA 1WVIA 4XRRA 1E3DA 5JVDB 2P9BA 5T3UA 3MRTA 1BWSA 2VHEA 3F71A 4D3YA 3K5WA 2W5UA 4F56A 5JDCA 5I4BA 1VHAA 1RWWA 3CLUD 4UCTA 4IH1A 2JFVA 1YJWV 4PJ0Z 3DE5X 4QPPA 3LOQA 5L9AA 4CMIB 1EDEA 2BFEB 1OLXB 2JLSA 3T7KA 2H8EA 1E2UA 1G5TA 4LA4A 3VAYA 1WL8A 2JJYA 1VGVA 1II9A 4GPIB 4PZAA 3LFUA 2EX4A 1NVVQ 2QSAA 3ETQA 1JI0A 1FU7A 1XZNA 2RGDA 3ESDA 3OMXA 1J07A 2HGSA 4JVLA 5HF9A 4IGIA 4ZYLA 1E9EA 5L3SA 2PA3A 1HXHA 3I0ZA 1J20A 2O5EA 3R9KA 2FPWA 2YUTA 1GSOA 2I6RA 4MR7B 3ZJ4A 1OY1A 2C83A 3N2GB 2QTFA 5CBHA 2HXSA 3R5HA 2ZB7A 3FUCA 2GVNA 3IEUA 3KAKA 4IIUA 4KN5A 4UHEA 4WN9B 5F5NA 5AFSA 3VTAA 4PHTA 3VNAA 4DJ5X 1JG2A 1G5IA 1KOFA 2R1VA 3SVTA 5CX4A 2BCEA 4GICA 3J81k 3UJHA 1PR6A 3FTFA 1Q7EA 2R6CA 2A1TR 4Q66C 2C4UA 2GSMB 3BF7A 3L7CA 2GKSA 1DBIA 2WI8A 1Y0BA 4JLNA 2B94A 1FX1A 2PANA 3VCZA 1LLUA 4DEVA 1OXXK 4LXIA 3B2QA 4G0NA 1JU4A 3V34A 1EFPB 1NQAO 1T0BA 2A9KA 1YZYA 1SIWA 2FMTA 1JHUA 3KFLA 1RI1A 1GNTA 1FVOA 3L7IA 4LXXA 2YYAA 1HQYE 1T34A 4CMJA 4RQOA 4E08A 1A9XA 4LMPA 3AVVA 1JRLA 4RYLA 4HUQA 3K9FC 3TIIA 3UEOA 3W4JA 1Z6QA 2ICAA 4A23A 3SCZA 4MX8A 3ZWOA 3IERA 5FNZA 2XUIA 4D0LB 1SC4A 1DEKA 4FYKA 1TM1E 3K30A 5CA0B 3ENWA 1IQ0A 2QX4A 4JYCA 1FNJA 1R10A 2VKQA 2WD7A 3D02A 3O8OA 3QEOA 2IUSA 1WS6A 5JCJA 3X1DA 3UCSC 2FE1A 3O2SB 4PNEA 4HKTA 4RVDA 5SY9A 4FWIB 4KPYA 2JFXA 4MDEA 2C0CA 5ALLA 1ZUIA 3E8GA 4TWRA 1LTHR 3K1YA 3I01M 3KZOA 4TMWA 4AECA 1KMNA 2PY6A 1DADA 2FC3A 1A2KC 1T5TA 2BMEA 4MR8B 4E21A 1V26A 5C37A 2UU9B 1AI4A 5JW6A 2OXIA 3PV0A 4L72A 3JD1A 4RDCA 2HWYA 3GJRA 4PSUA 1VQ5V 1ODTC 1DELA 2C20A 1YITF 3PWTA 3ND9A 1DWQA 1O6CA 4QUJA 3TJRA 4GSYA 2YIBA 2ZWPA 1K33A 1G5FA 5I5EA 3VPFA 3H8WA 1AKUA 4WCFB 3NHRA 4DIOA 3CLRC 3E4DA 1MUUA 1N2CE 2NXJA 3GAMA 4PGMA 1EGAA 1OCOB 3ZP4A 1FDWA 1QQ7A 1JUDA 3TOVA 3GLSA 1V16A 4YBZA 5CLFA 3N2KA 3ZWQA 3RIHA 2KI5A 4FX5A 3WBKA 1VYUA 1T1RA 4C7KA 3S3XA 1J1ZA 1WKBA 2OSBA 3AEYA 4FYVA 4XD2A 1QZTA 1J8DA 3KLBA 1CULC 4JELA 4EDHA 3RTAA 4NR0A 3I56V 4AZ3B 1QB8A 2J5BA 3TW0A 4KHZA 1AGYA 5I8PA 5LQNA 5CBKA 3ANSA 1GNQA 3A32A 3GUVA 1T1EA 3TVDA 4BVGA 4MUAA 1H48A 3BMCA 2PBLA 4OM8A 1GM7A 4ZVUA 1LC0A 4HDCA 4NE7A 5HJ7A 2A2ZA 2YXEA 2NN4A 5EBWC 2FX5A 4XEHA 4EG7A 4NI5A 5IJ9A 4IUBS 4GI5A 3C3BA 1CDOA 1U63A 1SKYE 1R6UA 3Q3IA 1QAQA 2ONCA 2NYVA 5ES3A 3SX0A 2WDPA 3UJ3X 5JARA 1AQJA 1N5DA 3S2IA 4ALNA 1U3CA 1BVUA 3W8DA 1DRJA 1NYQA 2CLIB 4L75A 4EKWA 3PWKA 4L2IB 4B47A 2VXOA 4EPTA 1XV2A 2Q21A 2HF8A 1V6CA 3MHTA 4KQCA 3ZQ4A 4Q20A 4K3AA 5L3VA 3EC7A 1C7JA 2Q3FA 1BFUA 2FN8A 2CFIA 2WG0A 3ESYA 3H2KA 1MZEA 4Q4JB 4RK5A 4B7ZA 1GYRA 1U2SA 5AKKA 3S3WA 2H2GA 4A15A 1QR8A 2LUOA 2NN3C 1ZL8A 2ZPUA 2AJ8A 3M1IA 3KUXA 4OGQB 1E3SA 3K09C 1EN6A 1EU1A 1NF8A 1VQLF 3IDAA 2FQWA 4PYMA 1KMCA 5GTIZ 4NULA 4EW1A 2A92A 3F1KA 4E31A 4RTOA 2HRZA 5DHTA 3E82A 3CP1A 2JHPA 1DAMA 4MIKA 2C2OA 4DJDC 4Z86A 4B5CA 3JASA 1E32A 1RRPA 1YV9A 2VTDA 3EQZA 3F6RA 3NUZA 3ZWNA 5KWEA 1KRXA 2OZPA 2PWBA 2EW2A 2O1WA 3A36A 1QQ6A 1W8IA 4HRAA 3RS9A 1P4SA 4H0NA 3TSWA 4C3VA 1QB7A 4CQMB 1E2BA 3KEGA 2EW8A 2EKBA 2GD6A 1ZD9A 3QV2A 3NORA 4MDHA 4N0MA 5EKDA 3VJMA 3U60B 4NS4A 3OVMA 3RRYA 4QULA 2Z83A 1ZUQA 3GJZA 3OP1A 1U28A 4ZVMA 3CCCA 5NLLA 1ZM2A 2YMPA 4ND5A 2PG3A 1KBZA 1JPJA 2YHIA 1M76A 4HZUA 5IPFA 3TCUA 4FHZA 2JFYA 1MO5A 1QLEC 4BRSA 2Q68A 4EJSC 5F3WB 2JEZA 2YTZA 1XNQB 3AKDA 1PQ4A 3M33A 4JGGA 4DJEC 4NU5A 5JNUA 1H5NA 1KSHA 1QO0D 1S02A 2AFIE 2QUJA 1T5IA 3ULKA 1AQYA 3CX5F 3LQFA 5A62A 1QHSA 5M7EA 1NI4B 3D8HA 2WJ4A 2AZ0A 1SUPA 4MS3B 4R8CA 4EKGA 4W8GA 2JCVA 2WQZA 4IPTA 4RA9B 2WM2A 2GO1A 3ESXA 2LD4A 3ND5A 3IILA 4PZYA 3EIEA 3QRWA 1IWPB 3R5FA 4LVCA 2HRYA 3QVOA 3REGA 5H6QA 1E3QA 3CKLA 4LE0A 5FLEX 1I94B 4DXAA 4ZZ3A 1S72V 1CUSA 3E8SA 3FPJA 4RPJA 5BPFA 1B2LA 4GLBA 4KQIA 4CR8A 3WS7A 1E0AA 4FFRA 4U39A 4IOMA 2FPSA 4URZR 4FILA 5B1SA 3UC9A 1CUBA 2C7RA 4R8LA 2HZBA 2D8AA 4C0HA 1C3LA 1O0SA 1Y4UA 1NY6A 2DFVA 3NHAA 1X9GA 3PNOA 1MXFA 4FOOA 4RHTA 4PI0A 3L6BA 4OGFA 2C92A 5IXYA 1EQAA 2OTJV 2QJ1A 4UUPA 1C30A 3KWFA 4TWIA 3W9YA 3IXLA 4F0JA 1P0MA 1EBFA 1Y3HA 3G2PA 2BVNA 5GONB 1SOUA 3WIDA 1E6CA 4RL6A 5EXPA 3O9VA 1KI6B 1TPYA 4JT2A 4ZOBA 3E22A 4AJEA 4X95A 1QZUA 2VP4A 3WJAA 3LNMB 1JDBC 2PWAA 4LWSB 2K9PA 2OTMA 2BDUA 3NYRA 5HKKD 2MIIA 3CNHA 3TSCA 1NDHA 2FZEA 4CF6A 5FAXA 1RAEA 3PE3A 2HHJA 4LJKA 3T1YB 2H4XA 1B1CA 2NUTB 1NMSA 3F90A 4J43A 1OLXA 4QO8A 1MV5A 2WUGA 3JQ6A 3RCBA 3WXBA 2FAXA 3U6KA 2HFJA 2D0IA 2D74A 1N5JA 3KJZA 4R69A 3RVKA 3TBKA 4Y3UA 4D8VA 1I4OA 3ABLB 4N41A 4PYQA 1M93A 3ZNNA 2VAWA 3JTMA 2ASVA 4JDUA 4OI4A 1YMQA 4Q1CA 4RKWA 3WYCA 4EABA 4R0NA 2EYQA 1JA1A 3OFJA 1WCYA 1XDZA 3A6EA 3T12A 1GPMA 2JFGA 2AK3A 2E0IA 2X9VA 3FVQA 4MUBA 1S6YA 4ZGWA 2DKNA 4G1FA 5H68A 3SY8A 1IQRA 1HDZA 3ABUA 2IOFA 4G2NA 1DXHA 4Y6PA 5F1KA 2AA3A 3OPYA 1EXVA 3A1FA 3UHFA 1RP3B 2H5IA 2QSYA 4D1YA 4TTIA 4TKMA 3D1LA 4RQTA 3BA9A 1YVRA 3CRVA 4IL5A 2FGJA 2ZT8A 4JAVC 4XEUA 2CB9A 2EWWA 2RBEA 2AX4A 2VDQB 3H9VA 5F9HA 3C3WA 3UAWA 2WT8A 1DBRA 4JC0A 1J1IA 3GRVA 5EC2C 3NC4A 2PS1A 3RRMA 5AVMA 2J0QA 2W2KA 4I7ZB 1YJCA 4H3VA 4FNAA 1XR3A 2EX0A 3IQXA 4TMFA 3TQSA 3IAHA 2BMWA 5DB4A 1N6PA 2I4OA 1NBEA 2FWJA 5K0LA 4KE6A 4KR7A 2AGAA 1L9XA 1PJ8A 1QM5A 3HXPA 3FFMA 1LVHA 5EJ7A 1HX7A 5AM3A 1A69A 2ZJ6A 3DC7A 1RRKA 4QO7A 2CNKA 3FOAA 2VPYA 2NTVA 3QJGA 2D1FA 3ON5A 2O59A 1XTQA 2QGZA 1OA1A 1IBLB 2P9EA 3R24A 2A59A 1A8UA 2FU5C 3U5TA 1VLMA 3QSYA 3I9V6 4TVSA 3V8EA 1Z6TA 2BZSA 3PFKA 2XF8A 1KETA 4DMFA 1DIAA 3IHKA 4LWSA 1NBIA 2WIDA 3GJ0A 2NU7B 1CE8A 2C88A 5FOXA 1JI3A 5KSYA 5GY7A 4EFBA 4W9MC 4YDRA 2BLLA 4MV0A 3LT4A 2WJYA 1VQ9V 2RK6A 5CPFA 3RJ9A 3OM8A 4H7EA 1I7FA 3ADKA 2QKYA 5K0FA 4FUQA 1XLTA 5KSOA 4OA8A 3CRRA 1LWOA 1AQNA 2WUEA 1L5WA 2YI9A 2PZEA 9ABPA 2VPTA 1MNAA 2ZSIA 3QNWA 1WABA 3S8MA 2BOCC 1R6DA 2DMRA 4J94A 4U5XA 4EPRA 1O7JA 3G6EV 4KG7A 4DBVO 2Y1XA 4I9WA 1S7CA 4ODIA 2O5VA 5AW9A 1P7BA 3IRUA 2WJZB 3KUCA 1YRWA 2YXPX 4C6TA 2CLHB 3C8HA 2ZIOA 1W48A 1W1IA 1MGOA 4BY9E 1N9GB 4KUGA 2VJLA 3V80A 1E98A 2QYOA 4XTCS 3ZS9A 5JD4A 2IPLA 3I6ZA 4RENA 3B8NA 3F5MA 4OK6A 1Q92A 4LJ6A 3L9DA 3OLZA 4F3YA 3TJMA 1R1MA 2JJ1D 4FS8A 3RF7A 5AXAA 1QQTA 3H3JA 2GAIA 2GLTA 5FBKA 1CJVC 4HG2A 2B6NA 1ZD5A 3BBLA 1XKTA 1E79D 1VGRA 3JZMA 4RYDA 4ZRMA 5HKOA 2AXQA 1D1SA 5L3ZA 3DZFA 5D3MA 3GH3A 1B41A 3ITKA 3O7WA 1QH0A 3GZNA 2EFJA 3W3AH 2OCYC 2VJOA 1TMKA 2VNAA 2E3CA 3PUWA 4ARAA 1O57A 1GAXA 4ICIA 2CYBA 4L7VA 3E2PA 4F4JA 3I04M 3WDKA 1JMKC 3I3SR 1XRGA 1DWUA 3SVZA 3DA8A 1NAHA 3HA7A 4UU1A 3K9GA 1DIHA 4IP0A 3AL0C 2F4VB 2UYHA 4HPJB 4B75A 1ULUA 4R40B 4QA9A 1FFEA 1U8ZA 4ZEMA 2V9CA 3OZ7A 4TROA 5C4MA 5M5BA 3TUZC 2HUPA 1U9CA 4HQFA 4I6EA 2CGOA 2FR0A 1R37A 4GZRB 2FX3A 4KQJA 5F7ZA 3R77A 2GUZB 3Q9LA 4BO2A 4D98A 3JS5A 5C5EA 3DEFA 2JK1A 2Q4BA 4ITVA 1QGDA 4BT7A 1BNCA 4D80A 4UPDA 3B7WA 1P19A 3TLBA 1Q84A 3ZBTA 4BKUA 3AESA 3J7AU 4O4JA 2ZXWB 3SGIA 1WF3A 2G0NA 4MW4A 1UFRA 2KBFA 1KO1A 1UKCA 3HB5X 4J2TA 5FFNA 4DMHA 3UW1A 1HDRA 2HCFA 1XGKA 2BFOA 5C3MA 4YWHA 5CBPB 2HS0A 4DY6A 1BMFA 1BOFA 4IW3B 3TFQA 3HNPA 3CMEV 4TYQA 4I9UA 4C7OA 3V42A 3VX4A 3OE7A 1T2DA 2OGZA 3AUXA 5IDWA 1Y3BE 1U7DA 3F8WA 3L82B 4GH5A 3HXMA 1GDTA 2CV0A 4EKYA 3ZU4A 4FFKA 2B9VA 4GAEA 3G68A 2DAPA 3LX5A 3HA5A 1Q1EA 5D3KA 2QWPB 4P4SB 3U7QB 2JFPA 3CCFA 4BNGA 1QF7A 4HT3B 3MF4A 4KPFC 1S96A 1IK6A 1BZYA 2V58A 1EUQA 3RABA 1M75A 5TXGA 2KW5A 3ZGZA 4UNRA 3HJUA 4FFWA 3WA6A 4HQNA 3ENZA 3KB6A 3HNOA 5B55A 5KTTA 1E69A 3DP9A 3FNBA 4OU4A 2C97A 3WIBA 2ZRCA 3KQNA 2BRUA 1IBMB 4C3UA 2OV3A 1OGYA 3QQ5A 3DLBA 2CW5A 4HAOA 4OYLA 2VYVA 3RREA 4QHYA 3SS7X 1RSOB 2YWHA 2ZBRA 1OH5A 2JAOA 4GKJO 1ZQ1A 1N0HA 2IA5A 4E5UA 4EUHA 1I3OA 4OP2A 4CC5A 4DA8A 8MHTA 1H4QA 3IR5A 2W2XA 4G4GA 1S4MA 1BFDA 2R6ZA 5CW2A 2GDZA 4MQBA 1TU0A 5L7TA 4W7IA 3B8MA 1ZHFA 3NPAA 1LQ2A 2VHTA 3ILVA 4QGSA 2NT3A 3DLAA 1WXDA 1CT9A 1U2GA 2K87A 1JKIA 3OPMA 4TQAA 3HRKA 2HLDG 4A2CA 4ZJYA 3KVVA 3LPNA 2VSYA 2UYNA 2ZQYA 2B4TO 3M2PA 1RKVA 1NN0A 4MI9A 1XV5A 3U4HA 1S5JA 1P2FA 4XB1A 3VOAA 3AJEA 4D4GA 1T4BA 3Q1KA 1GG8A 2XAFA 5BV1A 5TQ0A 5A02A 2IOFK 3QENA 5DN6D 1RZ3A 3EVTA 2IS1A 3II6X 1VQ1A 2VP3A 3ASOB 2ZUWA 4II3A 3LPLA 3TNDA 4G4JA 5AW7A 1IUOA 5DHQA 1N36O 4FBMA 4LBEC 2HHHO 2JD2A 5C8YB 4R1QA 2HP0B 3IQIX 1K6EA 3LBFA 4NSNA 1HEYA 4CF7A 3ZD7A 4KBGA 5GONA 2OR3A 3R6LA 2CZGA 5LM3A 3S8YA 1EG7A 3FFBA 3Q5DA 2ZJ0A 1SKAA 1RWVA 3HPLC 2BBWA 1DBSA 2XB4A 2AH5A 3DV9A 2ARHA 1K2VN 1RYBA 3PRYA 4UCOA 1XZDA 1RLGA 3HVRA 4X8AA 3S7ZA 2Q73A 1VXRA 3ZIAG 3L8ZA 2MWMA 3B9RA 3RPEA 2LCIA 2YJ4A 5ED0A 4ZTBA 3QYJA 4WZBA 3RWBA 4DYVA 1XZLA 4LCJA 4LPKA 4D9CA 5BNIA 4DLRA 3WVNA 2HH9A 1UBTS 1FOEB 4MAAA 3AKEA 1PJTA 4FYXA 4JL6A 2QL7A 3H5VA 1I10A 3KQMA 1X8LA 4BQSA 2ZM6B 4Q9LA 1ZRHA 3QKSB 3TLGA 3IT1A 3TOCA 2QP4A 3GJ4A 3MTAA 1Z16A 2PBFA 2W6ZA 3QP9A 3T8YA 3RW0A 2PZMA 1GO3F 1Z4IA 4LC9A 5A6VA 2OV2A 3V4ZA 3D0RA 1MH1A 3P71T 5J4VA 3WDLA 1IULA 3FGPA 4MEAA 4OFBA 1Q19A 1MABA 2AR9A 2HSDA 1OIWA 2IY8A 3SSAA 2EQ5A 2BTOA 1N4CA 3QX3A 4EA7A 1D7OA 3ONDA 5CTJA 3L7QA 1FYVA 1KFEB 5IUNC 4UVBA 1VL1A 3DKRA 2G7MC 4JI2O 1NVUQ 3FW1A 4JI7B 2QAJA 2HMUA 1IIBA 3FLAA 5I9SA 1XMIA 1OUMA 2R87A 1V7CA 3OJOA 4QBIA 1OI3A 4TN1A 1EG2A 3GLIB 2CJXA 1KMHB 1GTL1 3GLHE 1MW8X 4EG8A 1EUYA 5CIQA 1Z0ZA 4YDSA 2QAGA 2WIFA 3V4VB 4BQEA 1UAYA 4PLZA 5EQTA 3O90A 4GCZA 1GGNA 1JDBB 1E2LA 2P77A 4Z1OA 3IKMB 1QH1B 4LS3A 4CVNA 4UD6A 2XQIA 3A1NA 4LRWA 4U4AA 3WMEA 5LDGA 3G1WA 3HYNA 3HBLA 1U11A 1P77A 3I53A 3UGJA 2J30A 1TK9A 2XY4A 1I7PA 3N2GA 2RDCA 1RWKA 2DWQA 2YYZA 1IOVA 1PL4A 1SU7A 2IDZA 3AY3A 2RHMA 5DCUA 3ZTWA 2C2GA 4N49A 4BW0B 2B3TA 5IM4A 3I0NA 1HEIA 1K9VF 1BVHA 2WM8A 3LWDA 4JEIA 4N39A 5D1NA 4UM8B 5DASA 4AB1A 4GMKA 4KMOA 1XT6A 3JAMM 1UINA 1WR8A 1AXGA 5IJAA 3TRIA 1H22A 2HS4A 1V1RB 3PRJA 3BGVA 1QHTA 4UTOA 5K4GA 2CJFA 3CX4A 4LOHA 3I56F 4JP3A 5E7QA 2ZIZA 3LPCA 2BHRA 1RXVA 221PA 4X64B 2QLBA 4XIJA 2CNNA 4L8LA 4PN3A 3K0CA 1WUTA 2CDBA 4CRWB 1K8AH 1B0ZA 3E8FA 2YR0A 4C0BA 4Y98A 2VP5A 2K1EA 1AHHA 4U7PB 4Y0NA 3ORQA 4BT4A 1PLKA 2FFQA 2LBPA 3H1PA 4WPGA 5DK4A 2XGSA 2QD2A 2G83A 5FLXA 1OFGA 4LHYA 1AQIA 4QYXA 4U7OA 3V1LA 2JAPA 2YN0A 2YY7A 4AS1A 4R7CA 5BSUA 5KS2A 2HLPA 3U48A 3VZPA 2Q3HA 1I6MA 2JGKA 2LXNA 2OAEA 3HAXD 1OYYA 2GXUA 4I9QA 3INRA 1AP5A 3NBKA 4FKBA 4NPCA 4XJTA 3AQIA 1PG2A 3EW9A 1VQOV 1XBIA 1ZLYA 3RS7A 2VF5X 1FRZA 1H6CA 3V7FA 3WYFA 1XEQA 4WVLA 3GD7A 2P30A 3CUUA 2J0EA 3J81M 2LV8A 3RVJA 4GPAA 1A50B 3RH0A 4PY2A 3JQRA 3R3JA 3ZN1A 4LZLA 1F8FA 3KCYA 2YXLA 1Q14A 3MD0A 4C14A 2H6LA 1K7XB 1TQHA 2BC9A 2OP0A 1TU3A 1OCZB 2P75A 2HIGA 3AI2A 1O97D 3OPYB 4KFUA 3DOEA 4RY0A 3DH0A 5FP0A 3WGUA 1WO8A 3HR7A 3UT5A 5A5EA 2O2DA 2AMTA 1S9DA 2X7JA 3OT4A 2LQTA 3KAPA 1RM4A 3PC8A 2BM9A 1K7DA 5M34A 2ATCA 1IUNA 4FP9A 5TF4A 3I62A 4Q4DA 3B3FA 3PA6A 2B34A 4OQ4A 2X4IA 4Y9RA 4BNTA 5JISA 3TR0A 3S2SA 4HNTA 4YBRA 4B4OA 2RGEA 3ZE8A 1ZN9A 3OQMA 4CKWA 3V1MA 2VQFB 4Q12A 5FDFA 4YMVA 2HKOA 1RJDA 2AVDA 3MGAA 4QYSA 3TAUA 4MLCA 1RTKA 2D1RA 2R6GA 3A4VA 1QO9A 1DFHA 1ITZA 3JXEA 4ZO6A 4AW9A 1PYGA 4FBLA 2JLUA 3KE9A 2QKAA 1K86A 4E11A 2GN1A 4G1UC 4JJAA 4K05A 3H1IH 3SR0A 4D8YA 1DJPA 4W5TA 1BC5A 2FLWA 1Z7EA 4RKQA 4DSAA 1WEHA 1VECA 4XVHA 2CC2A 3K70D 3EXIB 4G36A 4LIPD 4KQWA 5IT9M 4DILA 5DYYA 3OTIA 2H18A 1NI8A 2OHHA 4Q02A 4E3WA 3P0ZA 1MABG 3JALA 5ITWA 5FPRA 3FB4A 2IYUA 5DI3B 3OIWA 1G8JA 3IJ5A 4CR6A 5INTA 3UIEA 2L82A 1VQ5F 3L0PA 4CETA 1KMIY 2V1UA 1KJJA 1Y1PA 2ETVA 2QUBA 1U5BB 4O33A 5KHAA 3SF8A 2Y4TA 2Z8YM 1XVIA 5E0KB 2KM1A 5CT8A 5ELXA 1B00A 2R84A 4FFBA 4J0GA 5FH9A 1MD9A 5DTQA 5SV2A 4DCOA 2IW3A 4HYEA 2ZANA 4TL7A 4ZCIA 3P5BA 3L7YA 5C4GB 1GT6A 4J03A 1I36A 2CXRA 5D84A 2H1SA 4J0KA 1YI2F 3OM0A 3N5KA 4KUHA 5HCNA 2A88A 5AH0A 3ZYCA 1DO0A 3N0RA 4TTVA 1HQKA 1NKSA 1ZGAA 3A6PC 2ZT5A 2B83A 1CB0A 2HNAA 1J0EA 1YRHA 4OHMA 4BQFA 4G0VA 5A0FA 3QH4A 3WLQA 2EP7A 4PYJA 2NO0A 4HS9A 4UHFA 1GKYA 1EFRA 2J9GA 2FEXA 3JU3A 4CDNA 4JI8O 1U81A 4NYJR 1JQDA 3NTQA 3FFTA 4EPXA 5CFMA 3THYA 2F7SA 2IBSA 3L84A 1QCZA 1TJ4A 2P0EA 2XJ9A 1ULBA 4PDRA 1R88A 2P3LA 2ZRKA 3ZEDA 3C7CB 3EY4A 4P34A 3U7EB 4FLEA 3ROPA 2BHNA 2ZYGA 2PH5A 3L4BA 4PBSA 1EUDA 1OYOA 3T5AA 4A8HA 3JQ8B 2DFPA 4IQ4A 1W76A 3QE9Y 4RHCA 3ZOKA 1LF0A 5GINC 3CMCO 2J9FB 3G1TA 2I4IA 4NG4A 3MOSA 4R8MA 4BMPB 3C8LA 1USWA 1RRVA 3CPEA 1EB9A 1HRDA 4G09A 5FOQA 2YRFA 2EOAA 1L5VA 1G42A 1MDFA 3OIGA 1HNWO 2FTKE 3RJZA 4AZVA 5LWHA 3I42A 1KEEB 2BJWA 4DCCA 5CEFA 3IVAA 3RS2A 4ZCLA 1M7HA 1O95D 3LGAA 3BFJA 4HNVA 1TF5A 4YS6A 3UWPA 3FYHA 4I1OA 5ECYA 1E7KA 1I30A 2YXNA 1V1MA 1TEZA 1Z35A 3TKAA 2HLDD 3SN6A 3MQ4A 3CPSA 5CAEA 1KOGA 2FTKA 1PRYA 1SKBA 1MZFA 5CBFA 4NOKA 3WYNA 1E1DA 4I50F 3GGDA 1PQYA 4O8CA 3U62A 4K6MA 1M90W 2BHLA 3R7FA 3KKOA 5TR9A 5LQMA 1TE2A 4CL2A 4ZOLA 1LUAA 4OV6B 1CD5A 3SX4A 3HWSA 1E1CB 4WIAA 2WZQA 9MHTA 4YJ3A 2CVPA 4LXGA 3KZVA 4G28B 2EEZA 4TMTA 4TRJA 2BFCA 1NW6A 3ACDA 4H1UA 4I4NA 4PA6A 2YFYA 5EXXA 1FRNA 5LMUB 2JBWA 3M3HA 4HAUA 4Q47A 5I4IA 2BZ0A 2ET6A 3IESA 3X1KA 3B60A 3IAEA 3OLXA 2V6BA 5ADVA 3IGFA 3WGHA 4D3ZA 3RTGA 1IM2A 2ZAMA