4X20B

Discovery of cytotoxic dolastatin 10 analogs with n-terminal modifications
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
428
structure length
428
Chain Sequence
b'EIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Discovery of cytotoxic dolastatin 10 analogues with N-terminal modifications.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Structural protein/inhibitor
total genus 140
structure length 428
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4x20B03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 4x20B02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 4x20B01
3V3TA 1Z5WA 3RYIB 5LYJB 5M7EA 3JASB 3RYIA 5LYJA 3JALB 3JASA 5LOVA 1JFFB 3JALA 5LA6A 1FSZA 3WGNA 1JFFA 3E22A 1W59A 4YJ3B 1W5BA 5EIBC 5BMVB 4DRXB 4X1KB 5BMVA 4DRXA 4ZI7B 4X1KA 5CB4B 4ZI7A 3ZIDA 4O4JB 4HNAB 4O4JA 5CA0B 1W5AA 3JAKA 4HNAA 5CA1B 2R751 2RHLA 3JAWB 5CA1A 3WGMA 3JAWA 4I55B 2XKAA 5MN5A 4EB6B 5JCOA 4I55A 3N2KB 4EB6A 5JVDB 5IJ0B 1SA0B 3HKBB 3C8LA 4EI8A 2BTQB 4F6RB 5IJ0A 1SA0A 3HKBA 2XKBA 2BTQA 2BTOA 4F6RA 3RYCB 3WGKA 5JCOC 3VO8A 5LP6B 4IHJB 4YJ3A 4O4HB 4TV8B 3VO9A 5LP6A 4IHJA 5ITZB 1RQ7A 4O4HA 4FFBB 4TUYB 4TV8A 5ITZA 4TUYA 4FFBA 3VOAA 2Q1XA 5CB4A 4EI7A 5EYPB 2VAPA 4TV9B 5MN6A 5EYPA 4DXDA 4I4TB 4TV9A 5LP6C 5IYZB 4ZOLB 4O4IB 5CA0A 5IYZA 5EZYB 4ZOLA 3JARB 4O4IA 3ZBPA 5IJ9B 3RYFB 5JH7B 3JARA 2RHJA 4XCQA 5IJ9A 3RYFA 1RQ2A 5JH7A 4M8IA 1TUBB 3N2GB 3R4VA 3N2KA 1TUBA 4IIJB 4WBNB 5JQGB 5JVDA 5J2UB 5J2TB 4IIJA 4WBNA 5JQGA 1W5EA 3WGLA 5J2UA 4EI9A 3RYCA 4U3JB 5J2TA 2RHHA 4YJ2B 3RYHB 4U3JA 4U39A 4YJ2A 3RYHA 2Q1YA 3HKDB 3JATB 3M8KA 2GVIA 3HKDA 3JATA 4B45A 4X20B 4I4TA 4O2AB 5LOVB 5EIBD 1FFXB 1TVKB 3CB2A 5LA6B 4X20A 5LXTB 3WGJA 4O2AA 5LXTA 1TVKA 1FFXA 5EZYA 5C8YB 5MN4A 4X1YB 5FNVB 3E22B 2RHOA 5C8YA 4X1YA 5FNVA 4ZHQB 3UT5B 4KWEA 3ZBQA 4O4LB 3HKCB 4LNUB 4ZHQA 3UT5A 3N2GA 4I50B 4O4LA 1OFUA 2R6R1 3HKCA 3VOBA 4E6EA 4LNUA 3RB8A 3M89A 4I50A 2VXYA 5GONB 4X1IB 5GONA 1RLUA 3HKEB 3VPAA 4X1IA 5KX5B 4O2BB 1W581 3JAKB 3HKEA 1W5FA 5KMGB 5KX5A 4O2BA 4B46A 5KMGA 1Z5VA 2VAWA 2VAMA
chains in the Genus database with same CATH superfamily
1YZBA 4QM7A 1Z17A 2H1FA 1N36B 3AHHA 2Z8XA 3AUFA 1KSHA 2O0KA 1QUFA 2G9UA 1LDEA 1WUYA 2G0AA 4ND4A 2JAPA 3MGKA 1HEIA 3D2AA 4YR9A 1L9KA 2QEQA 4W9MC 2ADPA 4UFOA 4EJSC 3LPLA 4DLTA 3SLKA 2J6IA 4Z3OA 3M70A 5EB1B 2WDZA 3HK2A 4P2BA 2XECA 4OB8A 3ASZA 3C3XA 3RC2A 4XVUA 2HQBA 2O1EA 3LUHA 3ML0A 4O5OA 3E1YA 4BLSA 1Z8DA 2PT5A 2R8PA 4G6ZA 1ODKA 4DUPA 3HU5A 1A8HA 4KMOA 1NKVA 5BN5A 2RGNA 3SYTA 3R7AA 3IEVA 3E22B 3PE3A 3PQ7A 4P22A 2RIPA 5I4IA 1THGA 4X1IA 3NMUC 2ITDC 3NRCA 1YJ9V 2PK3A 4CQNA 3EDRA 5B1BB 4RZHA 1IBSA 2I6GA 4NB5A 3OZEA 3QX3A 2QLBA 5CW2A 1YI8A 2BOBC 3M0EA 1XU9A 3GCXA 1M2VA 5HUJA 3MTAA 4FEGA 4ZKEA 3ZWAA 4OYYA 3OT7A 3AXSA 4UMFA 5BV2P 3PPXA 3P5SA 2NTJA 3K05A 3SXUB 2K6GA 5K1XA 1MO2A 2VUTA 3AILA 5ITVA 1ROPA 5JWPA 3DVAB 4IJMA 2CLIB 3ASNB 3MBIA 1Q57A 4L4YA 3UT0A 3ILVA 2QLLA 5ESRA 1CP2A 3QMVA 3NHWA 4DPLA 4R50A 4EECA 5CX1A 5BV0A 3D5QA 3GDHA 3ZMZA 1EZJA 1JR3A 4D6TH 1DLJA 4AUEA 2Q6IA 1B3RA 2A7WA 4PR0A 4UBJA 2RKBA 3DDNA 4ASUD 1W36C 2C4MA 4PYNA 3HA2A 1N5RA 3QH4A 4QXQA 2DFKB 3CF2A 4NABA 1N1DA 2XCUA 4XGIA 3GJRA 3AKZA 3KYBA 2G7ZA 4ALIA 1QHHB 4UPDA 2Q0QA 1ZJ6A 2QX7A 4LF6B 5AK5A 4DA4A 5KHHA 4MRMA 3U1VA 3ILSA 4DSZA 1AMOA 4ITVA 4F9EA 4FK5C 2V4DA 2AZMA 3SHOA 4MB0A 1ZHHA 5C1OA 2ZYRA 2ZU6A 2F3SA 3NKFA 3W9YA 1LK5A 1XQVA 4PGHA 4BUZA 4WCDA 2OEPA 4ZCMA 4Z0NA 2XW6A 2B3TA 4B81A 3IOMA 3M5CA 2CV1A 2AX3A 3C3DA 4C04A 1Y3FE 1JMVA 3VISA 3USES 1TKAA 1L5ZA 3PFBA 3UAOA 4MKRA 3UT5B 2DPHA 2JLVA 2P4UA 4CHTA 1E2BA 1H2HA 2X4LA 3W7XA 2WJVA 4I1OA 5HVNA 4YDSA 3EJWA 3L07A 1EN5A 1J9EA 1XMOO 3ONFA 3BMNB 2IGTA 1R0XA 2XRYA 4RPLA 4A8HA 3JD4A 3K1ZA 2FG6C 3L1UA 1SIWA 1QU7A 4UASA 3MINB 5EVJA 4KO3S 1VMKA 1EK1A 3OIGA 2XEXA 1DO2A 1ES9A 2WQ6A 1IDSA 4N6OA 5AXCA 1ZK1A 1Q7RA 3WYGA 2JCYA 4ZU6X 1ZICA 1MXHA 3IUEA 3DFFA 2DTDA 4D7SA 1M72A 4G0XA 2A3QA 4MVUA 1E2IA 3R5KA 5CB8A 2GHYA 4Y6RA 1M76A 2GN2A 5H82A 2DQSA 1GIAA 5EQTA 3UK0A 3Q1KA 2JKYA 3UK1A 1JNYA 4NMMA 3V1LA 3RK1A 4MTFA 4DQUA 5IBPA 4HDNB 3UUFA 1B43A 1AQIA 1COWA 5K0JA 4KL1A 1KQNA 4KAAA 3U9LA 2HPHA 3CMMA 1J0XO 1QUEA 2DPMA 4WUTA 3KCNA 2H00A 4IRUB 1NUTA 4LRWA 5MGBA 4LP8A 3RLFA 4XSVA 1GO2A 1KMHB 1DMRA 2DTXA 2OBXA 2QIOA 1LBIA 3G67A 3RVNA 5I4BA 1XPRA 1G42A 3N2EA 3OWXA 1IB6A 1P2VA 3EIQA 4R8LA 2P9JA 3D4OA 1DU4A 4E2WA 1ISJA 5T4HA 3MJRA 4UDOA 3PR2B 2BGUA 3DP9A 3HXQA 3MB5A 4PLFA 1J2JA 3ABUA 4UCWA 4BQNA 4RTJA 1H8HA 1OVGA 3T5BA 3EGDB 3VSDA 2FX3A 2HYDA 1ISIA 3U9TA 4GLXA 2K1EA 4MMXB 3BHJA 2RB4A 4O2RA 1MBZA 1AR5A 4NR1A 1SZXA 4Q00A 3WQBA 1UZUA 4I2VA 4QA9A 3L6UA 1WOMA 2Y0BA 3KKMA 2IHKA 3H1KH 3G89A 3GMTA 1OMOA 1GHTA 1NW9B 3ETLA 3SZOA 2YXYA 2VCHA 3Q3IA 2X1HA 1V8PA 1V9LA 2PH5A 3WDKA 4ZVMA 2ZYUX 2PPLA 1JB9A 8GPBA 1F2VA 1SC3A 4I36A 3HHPA 5DCYA 1I36A 2PZGA 1R18A 1H1LB 3H5WA 2DUJA 3PXAA 5AT1A 4Z4IA 3TZKA 1H4TA 4OG2A 2ZR9A 1GNQA 3MF4A 3WKCA 3UBTA 1EBFA 2OQVA 2CFTA 4O25A 1QNLA 5KSOA 4WLUA 2Q7HA 4NVPA 4I5FA 3WMGA 1WWKA 2KGWA 1X7OA 3E58A 2HWXA 1EUCA 3WIUA 3EE6A 5I48A 3TAHA 3GI1A 5JCZA 1QVWA 3CX7A 5JYEA 3DQPA 1T0BA 3LZCA 1YUMA 2G70A 1KNKA 2NSLA 1YRYE 2J3DA 2YW2A 3II6X 4R1NA 1VQNV 5H5NA 3P30A 1G0NA 2ZPAA 5F3WB 4TTQA 1NQTA 1LNQA 4QLAA 1QFZA 4RH3A 4O4LF 4V38A 4ER6A 2XH8A 1YK0A 2G6TA 3C43A 4LV8B 2BM1A 2E5FA 4QAQA 1FX0A 4RYDA 1E8DA 1TD1A 1Q1ZA 2BI7A 4JBGA 4QQRA 1YJCA 3NBKA 5KOHB 3D8CA 1Q11A 2R9VA 4JI0B 1BGXT 1GN9A 1KR2A 3Q9UA 4DC0A 3T80A 3FZGA 3IP9A 1KKUA 4UCVA 4HH0A 4WJZA 3KD2A 4TQGA 3DBHA 2QU7A 1FJGB 2GTSA 1H65A 1RWMA 1VG9B 5B58T 1FZTA 4XB6B 5IDWA 2NU7B 1P17A 3HKDA 4F0JA 1YDXA 1NN5A 4KO4S 2UDPA 1IPFA 4BLOA 1XZBA 4GPZA 4Q3LA 1QHGA 3ZHTA 4LNAA 5CBPB 3LLSA 3OO1A 4J2HA 3GEDA 2OHOA 1EGQA 4RVCA 3QXJA 4M7WA 4GSYA 4G0YA 5IJAA 4W5QA 3RJ5A 4NSNA 1U2GC 1UADA 3ZLVA 3SYNA 4MGHA 1P60A 5JTUA 1JDUA 3BMCB 4YRSA 1WA8A 3HB0A 2D2VA 2EZ4A 5HPYB 5FI1B 3X2SA 3LW8A 3AY3A 4QYIA 2YJ5A 4B7CA 1LPOA 1MW9X 4AY4A 3M3DA 5CVTA 5FRDA 3LK6A 5CFNA 1SBNE 2FK8A 1UH5A 4K3UA 1TT5B 5CFQA 3TZHA 2QWOB 3L0CA 4NL4H 3CIFA 4DV0O 3RF7A 2H4FA 4AROA 2WJ6A 2WWGA 4RHYA 1IHOA 3DMPA 2Y93A 3QEAZ 3MTEA 2ODQA 5H3HA 3Q0TA 4X89A 1OIWA 1A96A 1EHYA 1BH2A 1YI0A 4D4JA 4LX0A 2WDPA 5C34B 4NS4A 3NXSA 3AX6A 5LA6A 1FSZA 4MCIA 1JFFA 3ETQA 2E1PA 4JTAB 4R3UC 2J3EA 2VDJA 1U3LA 1OFIA 4ARUA 1KJJA 2V8BA 3OM0A 1WETA 4F92B 2B8JA 2YXPX 5JYCA 3K92A 1WCWA 2X7HA 3HYCA 3JRXA 3DOFA 4DABA 3EOZA 2Y4OA 3K20A 3W3ZB 3KG2A 3ASOB 2VDRB 1T3TA 2A92A 4QLBA 2HWWA 5B2EA 1MT3A 1KZ4A 3JYNA 1ZL8B 4FNGA 1ZI6A 2UKDA 2D8AA 2VHUA 2J3QA 3MGCA 2OD7A 4PYIA 4JLDA 4NYIQ 1IPAA 2DC1A 4DA9A 3VU1A 1Y8RB 1DOAA 2YRWA 2D0PB 4DLAA 1E0KA 3QSGA 5DTEA 2J31A 2CKDA 5C5CA 3EDQA 5J2UF 1QRAA 4QTUB 3PFFA 5A05A 2SKEA 4RADA 4DREA 1SD5A 4GQAA 4LFAB 4NCJA 3DZGA 2FP4B 2V7GA 4OQ4A 1QSGA 1C3JA 3GVXA 2Y1CA 4YMWA 3BUSA 5LQDA 5FOQA 3GLFE 4F46A 3EODA 3ZJTA 5IF3A 4DDTA 3H8WA 2EX3A 5CA1B 1DQSA 2NSYA 5EAIA 1SBZA 2PSSA 3G5LA 4E5UA 5TIIA 2QF7A 3BORA 4MVJM 1TPYA 1QXSA 2BD0A 3LUPA 2IEIA 5COAA 2P11A 3K3WA 2VP6A 3OR6C 2CDNA 2OFFA 1Y4DE 1ESDA 4WK6A 3VR0A 1J90A 4UEJA 3T7TA 5DHTA 3UMBA 3Q0EA 5HQTA 3LKBA 2OV4A 4AW9A 2XT6A 5KA5A 4NY1A 2FA9A 1TCAA 4JJ8A 1HSZA 3V32A 3AUYA 1J5EO 1Q0LA 2I4IA 3ORFA 3VO2A 1EXDA 2XTJA 4AS3A 4TSKA 4QGPA 3B51X 2XUFA 3PDJA 1WB4A 4LH7A 1H8EG 1SXJB 2PL1A 3OAAA 3CF6R 4IYJA 2Z5FA 5A2QA 3QG5A 3H75A 2H4XA 5HS6A 5KX5B 1LJLA 1TF2A 4EJ0A 1ZMBA 3FMPB 4KR2A 4RHTA 4F9GA 1XEFA 1HE3A 2AKAB 5EK0A 3FKJA 4NAVA 4KQFA 4X62O 4EYKA 1UK6A 2QVXX 1MFZA 5AKJA 4YFVA 1CVIA 4EARA 1L7QA 2Z30A 2B35A 3MK31 3AGQA 1YCIA 1K9MH 1P1RA 4I9HA 2H7VA 4FD2A 2BFPA 4LZZA 2IEDA 1CUAA 4NCXA 4BMPB 4TUYB 5E1MA 4R0NA 4W5JA 3L6CA 2GVNA 2HDNB 4UPEA 4KITB 5AKZA 3IMKA 1HWYA 5ENDA 5K0NA 4RKYA 3WGLA 2Z1EA 5CNMA 1IQUA 5J63A 5I9IA 3OEHD 3RD5A 2AF3C 4MDEA 1G16A 1GCIA 4QEDA 1C4OA 1KAQA 1DIRA 3CB2A 2ZM5A 1LFAA 3AOGA 2YQ5A 3EARA 1KFKB 5BOSA 3N0TA 5E8RA 1V11B 2YYEA 4EHKA 4H13B 3AY6A 2IHBA 4A0SA 4PZPA 2GDZA 2V9YA 1CS0A 4Z7NB 1XVVA 3VR1A 2UXDB 2XNDG 2O2JA 4WADA 1DIOB 4RTSA 3AK3A 1JHVA 3OZTA 3VOTA 1T0UA 4EO4A 2OBMA 2VZLA 4FILA 4B2YA 1KETA 2Q5FA 3D02A 1SQFA 3WGKA 4QUEA 2XB9A 4PN7A 2QN3A 1XD8A 3H5VA 5I45A 1IY2A 3TIXB 1JY8A 1KR5A 1DHTA 1BMDA 2F67A 3WSVA 2R8YA 2J0EA 1PWZA 4D9JA 1XZEA 1XR3A 3G7UA 3F1LA 4X9QA 2PZFA 5LP1A 1OBFO 4J0JA 4V0KA 1CYEA 4YJHA 4NFHA 3D6MA 1DUVG 3CJTA 2QL5A 4ZFNA 2NSHA 3C24A 2FG7C 3CN9A 4XDGA 1NJGA 3R8XA 1WMFA 1AGNA 3NT4A 1BKYA 3AL0C 1HDIA 3WYBA 4KR9A 2FU5C 3E2PA 1USUA 1OAAA 4Z86A 5HBGA 3I64A 1QH1B 2QV7A 3PR1A 1ISRA 3B1FA 1ZHFA 4GBJA 2AJDA 1OH6A 4QVGA 3PHGA 2NXJA 4BN0A 4M1WA 2VOJA 3OCZA 3AFHA 1BS2A 1N34O 2VYVA 1G7RA 2NIPA 1A88A 5M29A 3TQRA 4HDKA 4OBBA 2IW5A 2X3YA 5IT4A 3CCLF 5E7MA 1RXIA 1OA0A 1L5QA 4YHBA 4EMUA 4MQBA 4YRAA 3B82A 3O9OA 3S7ZA 1XIVA 2A5JA 1D4AA 1B3BA 2P2ZA 3DD1A 4RZQA 5HIMA 2XA1A 4NE2A 5EMKA 5KYNA 1G8AA 5FNVB 2A88A 4BASA 3CCFA 1WB8A 1HQDA 2OR3A 4IVQA 3IRVA 3D2BA 2AMLA 2FZCA 2H0AA 4RFLA 3WYAA 1HDRA 2BGLA 3N74A 1CEQA 1N32B 4CCWA 2X86A 4YYZA 4HDRB 4MI9A 4U2EA 1RXSA 5ECGC 3QU2A 1VGRA 2Q4EA 2XCLA 1F7YA 3NK6A 1N5LA 3NAQA 1B1AA 4A8JC 5HRAA 4D4KA 4PPGA 2Q3MA 1V41E 1ISHA 2R0QC 2WFLB 1UBCA 5EUBA 2JGMA 4K46A 2PL5A 3L6EA 1DVRA 2FB9A 3OZFA 4M1KA 3U16A 5LFAA 1JV2B 2JHFA 2R2AA 4PLWA 1C3OB 3EISA 3FOFC 4PONA 3UA3A 3QVGB 1LPNA 4A27A 4FX5A 1CRPA 2CK3D 4C0WA 2P5TB 2R5WA 2NYAA 3JQEA 2WLLA 3F7OA 5FWXB 1EZVH 1VQLF 5KTMA 4B0PA 1P4AA 4WGFA 2H9YA 2FMTA 2GPAA 1OUMA 2CEAA 3F3KA 2R9AA 3O0DA 1EFRA 3TZLA 2DBVO 4AP5A 4Y2PA 1NQ3A 4RLSA 5CLQA 4ZO9A 1AI6A 5HTOA 2XOKG 5IYBO 2QAIA 3TOXA 1QLEC 1JDBB 2VTDA 3QKIA 2XXAB 4OL0A 3HYTA 3PVZA 4X93A 2B4YA 3TRJA 1UXJA 2BYTA 1NWHA 1P2SA 5AM2A 2GN9A 4H7FA 4BGIA 1BW9A 5AJWA 2AZXA 2ICAA 3IIJA 3BA9A 1AD2A 3KQKA 4MW2A 3L4BA 4R2WA 1AS2A 4E5DA 1P4RA 3MLEA 4YAGA 1K06A 1UAYA 3ZBHA 2V6GA 4F5YA 3W5SA 3PQ4A 3W5BA 3VPDA 3G5AA 1Z4OA 2B8WA 3KLPX 1M8JA 2ETVA 2ENUA 4BO5A 1YFZA 1RI4A 3VR2D 1LLQA 1M56B 3LS2A 2IKQA 1Z74A 3ISTA 4RPKA 4LOHA 5B3AA 3N75A 2EZ9A 2HF8A 2ZB7A 1FFXA 4RK5A 2CLDX 3G2OA 1YZYA 3RTBA 3K1YA 1EZZA 2OMKA 2VSYA 4URUR 4G89A 3S70A 1K5SA 1DC3A 4GR9A 3WWYA 1FE8A 4X91A 4AJJA 4NMWA 4RJKA 3COZA 2A5LA 3RTDA 2XKKA 5HCNA 1WMBA 2UXCB 1H69A 5J3JA 3UJ9A 1C3EA 2LBWA 2RGYA 2F4VO 2FWAA 1IZ0A 3BXOA 2CHGA 3LIPA 3ABIA 2JNWA 1J9ZA 1YR7A 3PIIA 4C8IA 4YUZA 3THSA 2WWHA 1GCUA 2O3SA 4LC0A 2ZUTA 4X44A 3OQ6A 4C87A 3HB1A 3O8CA 1VLLA 1TZKA 3TR5A 4HQKA 1IEXA 3AFNA 4OXXA 3T3IA 3ZCXA 4Q9LA 5AJZA 2Q99A 1QU9A 1RI3A 2XXBA 3RB8A 4A15A 4UVEA 5JO0A 4M9UA 2O7QA 4Z7QB 3ZJ5A 4IILA 1KEZA 1PZNA 2GCPA 1QH9A 3KTFA 4Y8VA 5DXFA 1VL5A 4YY3B 3MJFA 2OP1A 3ZVRA 1K27A 1PEAA 3AW9A 1KAOA 4I50F 4DNFA 2HY7A 2R8BA 1QP7A 2BP7A 1AKEA 4N4AA 2HIAA 3AFMA 5B7PA 2J6BA 4WCFA 3JYOA 4Q9JA 1AXEA 2OM6A 1WP7A 5DBIA 3ROFA 4HWKA 4ZI7F 4KACA 2JJ1A 1RKVA 5FHRA 2HXYA 1RYZA 3CB4A 3Q8KA 4J07A 3PF8A 2ZUBA 3GVMA 2JAOA 4MS4B 2O8FB 3IA2A 3E9YA 4KMMA 4DIFA 3B1KA 3ZZNA 1HLGA 3PTLA 3IT0A 2RARA 4ZA2A 5A4JA 3DEJA 2FPGA 3DV0B 1E98A 1J0AA 3QIVA 1HQKA 2V1XA 3AT1A 5J4LA 1IUOA 3A6KA 4D43A 5TPWB 2VHYA 3UJHA 5IU6A 3SQMA 3BXPA 2Q2WA 3O7WA 2GWRA 2B3DA 1AB6A 4B6JA 1E1LA 1OTYA 2N3ZA 2VSOA 3MOGA 5F9HA 1Z6GA 4RO2A 2GT1A 4Z0HO 1QE5A 4HEJA 1DFGA 3U49A 4MW6A 1N9ZA 5K3SA 4UKDA 1V3QE 1QQ7A 5H16A 4RQTA 3FDJA 1IQ0A 3B6MA 1U1CA 1PDOA 3BFKA 4QO8A 4DR3O 1G21E 5ECDA 1VJ5A 1W85A 4L76A 2L19A 1YZQA 1QHEA 2NZVG 4IZIA 1GPNA 2RGXA 3TQHA 2R7KA 5HM8A 1DAKA 4AO8A 2CTQA 4XQ0A 2PLNA 2GDSA 2MMCA 4WL0A 2WIDA 3TBFA 4L74A 2X0FA 1WS6A 4GQBA 4ZKDA 2O2YA 1KYTA 1RYMA 4PA9A 4Y7DA 3ZWKA 2V6MA 1R1MA 2V7WA 5F2KA 1IXSB 2K5UA 1QYXA 4O63O 3KX2A 4YO7A 4YHHO 2V8OA 3DMTA 4X8OA 1K08A 5JAHA 4N5MA 4QJFB 1RAHA 1E3WA 5EIBC 3ZP4A 1C9JA 1FMTA 4HMPA 3TLEA 5FPKA 2WAXA 5F1PA 1ONIA 1S7GA 2WHPA 2C4KA 3RADC 1Y98A 2CHUA 2EF0A 2PUJA 4ZJUA 3A4TA 2I34A 5IJ0B 1Y9EA 4D98A 4DSAA 1Y8QB 4R68A 3GBVA 2PL3A 2WINI 1KOGA 1U98A 2PKWA 5JXWA 3JY6A 2W9XA 3EDYA 3SJAC 3J81N 1N6IA 4L5CA 3DVSX 3AVYA 1TXGA 4GM4A 1NX6A 2RGRA 1FD9A 5TF0A 3RVRA 3UUEA 2C3YA 2N42A 4QXPA 3AGKA 5JCJD 2C4VA 3W9UA 4CCYA 3JQ9A 5ENVA 1COZA 3APOA 2HU8A 4JVLA 2CLLB 3CWZA 2C57A 5HKKD 3E0QA 3SY8A 4XDZA 3ZX6A 5I7RA 1DAMA 4QASA 1AUQA 4AN0A 3N7AA 4KHPB 1ZMOA 4XD7A 1W49A 3DC6A 2VIIA 3V1UA 3MWEA 1XYYA 2XUPA 3TVYA 1MABB 4PA6A 3B1WA 3V1YA 2P78A 3EEBA 4XDHA 1BD3A 1M0TA 5DX0A 3IUSA 4ND8A 3O8LA 3C74A 1M66A 3KB8A 3ZXYA 4TVBA 4R6ZA 1L5SA 3CE2A 2YKGA 3QLVC 2Y6VA 3P2YA 2K7ZA 3F0DA 4ZOLA 4PM4A 1JKJA 4K9MA 4EHBA 4RD1A 2AQHA 4CDNA 4JY7A 4R31A 1IN7A 1VCNA 3CVXA 2C59A 4ATNA 2ZKLA 1SCJA 3VBBA 3FRJA 2VJLA 5BNTA 3NHKA 4H6WA 2CVHA 1WUJS 2X4DA 2G3YA 4CXMA 1X2BA 3EJ6A 3PCTA 1JGTA 3R5FA 2HF7A 3HO8A 1L8DA 3AU8A 3RU7A 1QHTA 1K63A 1QYVA 1UAGA 3CLTD 3R8CA 1ZEJA 2BMVA 4IGIA 3FTCA 2YWJA 3GLFA 1AXRA 4HGZA 1RI5A 3QYPA 5K51A 2Z5VA 2ZJYA 2Q21A 2QY6A 2C5LA 2QW1A 4RUFA 1NRXA 3OM9A 3WQHA 4DV2O 1CQJB 3W8NA 2PVSA 2QT0A 4DMGA 2XITA 4FFDA 2F1KA 4MUXA 3B3FA 3H1FA 4FKMA 2XYPA 3H2GA 4WNAB 4LJYA 2RGCA 4YDHB 4MPTA 3N2GB 3BFJA 4KGVA 5BT9A 4QREA 2DBRA 2JGIA 3JVHA 2OCYC 3NJRA 2HDHA 4CLXA 2HF2A 5B1SA 2B2NA 2Q6LA 2VH5R 4N5LA 2H2DA 1LPMA 2EWCA 5DI3A 3S4YA 3QBTA 1RS0A 4G4SO 1GP2A 3LY8A 1WTAA 5GTIZ 5CBHA 4C7BA 4K0KO 4BR6A 5FQOA 3CH6A 2PM8A 5JISA 3M81A 4YCNA 3SZ3A 3GEHA 1M6NA 3FYCA 1Q0TA 3DFIA 4RXMA 5H02A 2DJVA 4JB0A 2R8RA 1YTUA 4X66O 5LJIA 5D85A 4JKOA 4KH1A 2XDAA 1C7ZA 3W3AA 4N5DA 2JBAA 3SQDA 4IXNA 1JQAA 4WJLA 1TIKA 5JAQA 3K15A 1JZQA 2EU8A 3WLHA 4XGRA 5DXAA 1P5RA 1HE5A 4S3MA 4ZVUA 4KIGA 3HQ4O 3MCWA 2AFHB 4RIFA 2D4HA 1AC5A 4BTLA 4TV8F 4NI5A 4RA9B 4M1OA 3DM5A 3BCHA 1VCIA 5CHEA 2JH9A 2V5VA 3EF1A 3T99A 3NU1A 4F1WA 3SGIA 4AG5A 1CRWG 4JLMA 1EIWA 5MN4A 4OH7A 4C4XA 3HG7A 2ISSD 4HAZA 1SWVA 2H1RA 1Q7YW 5K0BA 3TE6A 3U61B 3QTBA 1KMQA 4CS2A 1XWWA 2G36A 1NC3A 5I7VA 3VI3B 2IEGA 1VPTA 5IKEA 4BCBA 4B3FX 5EEGA 1W0KD 5JS2A 2IOYA 3N76A 1XI1A 4KXVA 4K9PA 4KQWA 1ZCJA 1HDOA 4QPZA 3V4LA 2OCKA 1CLUA 2AG6A 3DVQX 3R74A 1VPDA 4RYLA 4TQDA 3T41A 1GITA 4JQZA 1JU9A 4D3XA 1FSFA 2DT4A 1HO3A 5I6DA 4DR5B 3OF2A 2PEYA 4PANA 3D6VA 4TQUS 1I94O 3FNFA 3FDIA 4HADA 4X64O 3QK7A 2G4CA 2FPSA 2GHTA 1SXJD 2WJZB 6AT1A 1DXOA 2B37A 3DTTA 4NBLA 3CEIA 2WHXA 3NFRA 1F17A 5MFZA 2B9VA 1MX3A 3ZV6A 5JMWA 3KEMA 1GNVA 2QTWB 5AVTA 4GX0A 4WEOA 2LNDA 5LGTA 4MW9A 1WVMA 2VQEO 5IBCA 3KQQA 2OO3A 1HKUA 1SKQA 5DW0A 3E5MA 3I6IA 5DPMA 1RBZA 1X80A 4DV6B 1W94A 3B4SA 1NY5A 3OKCA 4URVR 3URMA 2C3OA 1M1YB 2ZT6A 3GLHE 1U3PA 3KQTA 4H1UA 5JT1A 4DNPA 2K7FA 5DHQA 1QV9A 1NM5C 4FJ0A 1I2DA 2RDCA 1TQHA 1ZINA 4TLLB 2XCSB 2GFHA 3UAGA 1S0UA 3X3HA 1TAUA 1KA9H 1HY3A 2DW4A 3VR5D 3DZDA 3VZRA 4Z9AA 3I28A 1O6CA 3AF5A 4A6DA 2WB2A 4FCCA 2QMUA 1EWTA 3PNSA 1PD1A 2H5EA 5E3IA 2V6BA 4S35A 3WL6A 1LK0A 2XGOA 1DE0A 3GCGA 3P2EA 2PUFA 3FNHA 4LF5B 3CVWA 3UMMA 2C9DA 2IYOA 4CW7A 1AI4A 1IZ9A 1FS5A 3S6JA 2E87A 3HBMA 5IUJC 4QDUA 1XAJA 3N59A 5LQMA 2C2AA 2FQYA 4P33A 1ADBA 3VZPA 4YRPA 4CODB 2BO1A 2J9RA 4LYEA 4IXTA 3PWZA 2FX2A 1BEUB 3IPAA 3AEZA 3A3NA 3BMOA 1CZUA 1Z6QA 3LWZA 2IYQA 2RGDA 3UJ7A 1W4CA 3UBMA 2OQRA 1N9GA 1E7QA 2QQ0A 3LC1O 1XYGA 5EJIA 1J33A 1N6HA 5JY1A 1H0SA 4MYSA 4GYWA 3VHLB 3C6XA 1JECA 5C1BA 1R4NA 1KZ1A 3HWSA 1P49A 2ZYIA 1EG2A 5DNUA 4DXAA 1DEXA 2Y71A 2CUZA 4OX9B 5KWIA 4RDIA 4RWUA 3QF4B 4NU0A 3IR9A 1PBNA 1Y33E 3DDHA 2J46A 1P75A 2Y1KA 2IQIA 5J4HA 4ZBMA 1YHYA 2I4OA 3ITDA 4G8DA 4RTMA 3C3KA 1UWCA 4MHTA 1XMQB 5CTAA 5JS6A 3HB3B 5GJVC 4GR4A 4N0EA 3O8RA 1SQ0A 3KZOA 4Z53A 3WG9A 4F4FA 5LLDA 2FZLA 4REQB 4G4YA 4D1YA 3KL2A 2C3MA 3L82B 2QIPA 2V59A 3ACBA 4BBZA 4E2ZA 2JIBA 2GO7A 4EYSA 5E7QA 1DC4A 3TQCA 3FMFA 4MUHA 4P1ZA 3IC9A 4CEHA 3CNOA 3OA2A 2EYQA 2LPMA 3KU1A 5L3DA 4BP9A 2P2NA 1KY2A 1NXTA 4DLLA 3ZGLA 1JG6A 1E8MA 1D2HA 3LA8A 3W5CA 1I7NA 4MQUA 3ENNA 2P7TC 1EBOA 2X4GA 5BSRA 3FLAA 3KSUA 3VKVA 1UXOA 2PO7A 3ANYB 4UFPA 5EPEA 2V58A 3DKRA 5DN6G 3H2HA 5JWOA 5HM6A 2P9HA 4X1KA 4CV1A 3DHWC 4MYTA 2I67A 1BX0A 4ES6A 4UULA 2Q2NA 2CGEA 1CLIA 2BHRA 3Q40A 1HM5A 1DV1A 3IOBA 4OXSA 1HR0O 1CRLA 3LU1A 1SOVA 1ZN8A 3HYSA 4A6EA 2QRUA 1MEJA 2NVOA 1PV2A 5F7JA 3IDQA 3NUQA 4EFMA 1KECA 5EIAA 5EJ2A 5U4XA 1BROA 3RM3A 2AOXA 5KJ6A 3TZCA 2HEPA 1E4VA 3SMQA 3TW6A 4OXIA 4OGWA 4MMYB 2XSZA 5IULC 2D2XA 3WWZA 1OCCB 5C3UA 3E2EA 3OQOA 2QMQA 1XTKA 4HTFB 1I2AA 4KQMA 5LC1A 4E5YA 3Q3CA 3V42A 1Z63A 4FHCA 3OPNA 4PFKA 4R1MA 2IJGX 4PDVA 1DBIA 4OAOA 1Y7PA 2QR2A 1OLXB 2GWHA 1ADGA 4I6EA 4G1CA 3ZU2A 1WO8A 3VOUA 1J22A 4XWKA 1BXGB 3F47A 4Y2QA 5P21A 2DR0A 3CEAA 4LGVA 4ZC8A 3ZWOA 3DOIA 1Z4NA 1GZSA 2RMKA 3N0VA 2HQRA 3Q7TA 4CKEA 3WAJA 4WBNA 4IS3A 2I8AA 2SICE 5JC1A 4EQ6A 2R1TA 1UKZA 3KJFA 4F4LA 4XIGS 1PXWA 3G59A 1J42A 3QFCA 3E8BA 2BOVA 3GG2A 3AKYA 3K94A 3BEDA 5DTJA 2XAAA 2OY0A 4GNRA 4KVGA 1PVDA 3KPYA 3SHWA 5FXMA 2E3CA 4ZJZA 4JLVA 1USGA 3JQAB 4FDMA 1YKSA 1D04A 3SBXA 2WVJA 2UZ1A 2W2MA 1B2LA 2E82A 1NVXQ 4Y2HA 3IR6A 2OZLB 3OM1A 5TVKA 3BN3A 4XDYA 1ZQ9A 2HQSA 1Z7GA 3W6ZA 4IJKA 4KUEA 3PX3A 1G5FA 5AMXA 4HEHA 4H4DA 3KQHA 3N2IA 1UBUS 2C8VA 5JSFA 2O6LA 2J4DA 3WL8A 2VJYA 2IEZA 4U3JA 5HFMA 4U2KA 5DW3A 1CULC 3FZQA 6Q21A 1U7XA 3C7CB 2G8NA 4YWJA 3KKNA 3KQLA 3SYMA 4QBFA 4C4OA 3ZX4A 2VH2A 1NVEA 1I7SB 1Z6YA 4E6EA 5EXXA 1WP9A 5KDLA 3THXA 3LWRC 1ZVQA 5DO9A 4J2TA 1DUSA 4IDCA 5REQA 4FLEA 2IF2A 4K9QA 3R7WB 5HS4A 3D7SA 3CX6A 4CYMA 1SUIA 5A04A 1JBKA 2W2KB 1ZM3A 4KLAA 3F7YC 1XU7A 2DHDA 1CNMA 4NQZA 2WA1A 3VR4H 3W78A 3I72A 4A10A 1E0DA 2F1MA 3VAYA 4BNHA 3GPBA 1WPRA 3EF3A 5TSDA 4ZAZA 5LNK6 5JR3A 1G7TA 4JJ7A 2I3AA 2CXSA 4K6CA 4YS6A 5E7JA 4XIYA 1LU9A 2PKQP 1PZFA 4J9ZB 5FA6A 3AIIA 1VQ8V 4CN9A 4BW5A 1NQWA 3OSUA 2AXNA 3E9RA 1NJ1A 3T7AA 1A9XA 3F6YA 3T7JA 5I4KA 3ZIUA 3ZD8A 1FBTA 1ZUNA 5T8KA 2ZRNA 4JBIA 4TMTA 3PUJA 1GGFA 2IEBA 3BCRA 4LWOA 2GDJA 4EEQA 4MYDA 1THMA 4B5CA 4JP3A 5A62A 3AP1A 2HFEC 4PJ0Z 4EZEA 1NVVR 2JFQA 2WR8A 2CH7B 1AI7A 1M8FA 1DWPA 4CE6A 1MX9A 4Q4HA 4URXR 5HWSA 3RJMA 1F6WA 4HLUC 4FMDF 1KP9A 2H1OA 4NH0A 1NSYA 2Y6UA 1ODJA 4FI3C 1D5CA 3TETA 3L71H 5IKMA 1Y4AE 3PQFA 3I9NA 3VYWA 1QFMA 2O2XA 3CGWA 2PMFA 4NPHA 4OQLA 2ATVA 2YXNA 4ZV7A 1USIA 2BGGA 3M5PA 3GUUA 3O92A 1BE8A 4IOKA 1XCMA 2VYND 4FBMA 5LZ5A 3EPHA 3DOOA 1USKA 2XTAA 1G2IA 5EZYA 5JD3A 4YAOA 3ZO8A 2QVYX 3EVNA 1VRCA 3TLBA 1KIAA 5IAGA 5I7UA 3I23A 3QOFA 4CT5A 2CMFA 3ZVLA 2OSBA 1TEXA 2G9VA 1EX6A 5A6SA 3CMAV 3J7AR 3EG9B 1OCRC 3K03A 1T5IA 1KKDA 3RASA 3MJDA 4BT2A 2V03A 1Z0FA 1U80A 3CYFA 4DUGA 1DX9A 1G1AA 3JV7A 4UE3S 3VA7A 4KQIA 2ENWA 3O74A 5KCZA 3KUDA 5IDYA 2P7IA 4OHYA 4C0LA 1P73A 4H2DA 1E7YA 5ALFA 4L7VA 1OFTA 2BGIA 1F4PA 4FEEA 4JJZA 4QJBA 4MDHA 3DXYA 1CPYA 13PKA 2II6A 4O08A 1ZNXA 3MQ4A 1Q3EA 3JWJA 3PEYA 1PWHA 4FZVA 3P32A 1WW8A 3A28A 4JLPA 4D0LB 4HXYA 2VTVA 3QKSB 5L3BA 2Q50A 3A4NA 3W4KA 3ZBQA 5TQ0B 4D80A 4B3JA 1XEXB 2OXEA 2LIVA 1Q7EA 2RGWA 1SB8A 3B8EA 4INJA 3NO4A 3QG1A 4Z5XA 4LRQA 4DV7O 1UP4A 1HE1C 4AJ9A 2EZUA 4YCBA 4EW6A 2ZTSA 1SOUA 1I5XA 2QG9A 4E5PA 4L07A 4BFLA 3K53A 1PQYA 2AG5A 4NTXA 3LX6A 1O9HA 4KNWA 4EF5A 3RFUA 1VE5A 3U7RA 5EUQB 3R65A 4FTWA 4IQ8A 4LR3A 4UDYX 1N8TA 4NAHA 3EDCA 4GXNA 1X42A 2OZVA 3OE1A 4DBVO 5DHSA 5MF6A 4YVFA 4WOKA 4YACA 2G08A 3DEYX 3ZCRA 3TX6A 2DWUA 2G40A 3Q7EA 4HYTA 4BN4A 2C4TA 4FNOA 3L2OB 1Z88A 3QI7A 2BMDA 1E1RG 3Q9LA 4B8YA 3GGGA 1YFKA 2HVJC 5DN6A 2X9NA 3OM3B 1QCZA 2Z57A 4OHCA 4R9UC 3T5TA 3N39C 4FLTA 3OZSA 3TLJA 4AO7A 2VJPA 2AF4C 4B4UA 5BYKA 1BCRB 2QTVB 1EVJA 3LPCA 5IKXA 2ZSDA 2HBRA 2AC2A 1PT6A 1Q3TA 3HGTA 2HP8A 3WGOA 1JHAA 1DEAA 3Q2KA 4U7TB 4QOIA 1Z45A 1H2GA 2FZ4A 4X3CA 1PU2A 4I55A 1B04A 2AEFA 3DUFB 3MBMA 3NM5A 2YX1A 5KYWA 3PDIB 1NJ6A 1JXQA 2L0XA 1JHOA 1GOTA 4G1UC 1HYBA 4C4ZA 5KYTA 4UUJC 1V3TA 1I8TA 1EESA 3TZBA 4BPRA 3SC4A 2QWQB 4S1PA 4N48A 4U39A 1A9PA 3WGQA 5CH3A 3FGNA 3OLQA 1E9FA 3L6OO 3TBHA 3S28A 3CF0A 3SYRA 4B3CA 16PKA 3JSAA 3QPWA 2ATEA 1OX4A 1LWOA 1MXFA 3CCJF 4DCOA 2JPDA 1R8YA 1TOAA 1MZVA 3AZOA 3BEHA 4L8WB 1FS4A 2C42A 2OHGA 5ILOA 1S01A 1E6CA 3A05A 3GLHA 3OCXA 3LY7A 4YJ3B 4F4UA 3SHFA 4YRGA 3B8MA 3A3KA 6LDHA 2GZ1A 1KMIY 2R1VA 2QAGC 3GOHA 5JVDB 4RIIA 5JI3E 3DDSA 4C43A 3A1SA 5E2AA 4B8WA 1SG9A 4IJQA 4KGZA 3H99A 3PFKA 3ADDA 5CLGA 1V8ZA 1NQ5A 3A58B 3Q8LA 1XCGB 3EAQA 3VAAA 1JLLA 3BRWA 1TUBB 5LHHA 2EJCA 2CDAA 4UOEA 1SQ6A 2GPYA 4NESA 2GUGA 4EW3A 3JWIA 4EH1A 5F77A 3IIMA 3A0RA 3PN1A 4ZIBA 3BZWA 4QE3A 3O9ZA 4AS1A 4LZPA 3K1AB 2PT9A 1R4ZA 2ZYVX 1D6SA 2VPTA 3HCRA 4NZNA 2Q8QA 3RUPA 2WSMA 1KI1A 2FWJA 2H6LA 3QVJA 2IX3A 5K4AA 2QRLA 5ALNA 3DZBA 1ZOPA 2AHRA 4FFWA 2R6AA 3A1DA 3UA4A 2IUEA 1NLZA 4I0XB 1O77A 2XZDA 1E2QA 1KEVA 5IY5B 4YV2A 5LA6F 4PI2A 4R9SA 4OUDA 3HB7A 4Y3UA 2RAVA 3WK7A 3FFMA 5C9ZA 5A06A 3OW2F 1WNSA 3AONB 2GN8A 2WEKA 4HCJA 3G2LA 3CCQF 5JJLA 4V0OA 5IX8A 3EVFA 4H0FA 1LS1A 4QYXA 4U9HS 4AJOA 2DPGA 3GVCA 2C9CA 4D0RA 4YIHA 2YYSA 4X8HA 2BFBB 4IR7A 1H22A 4LQLA 4P3OA 3LH5A 5FOSA 4J94A 5ES3A 5DNWA 2IG8A 1NNI1 2IUSA 2I22A 3N28A 4HX2A 4GZ5A 4HFNA 1I9CA 2VSXA 2OZPA 2XGSA 1MO6A 3LBFA 4NYKA 1OV9A 5DMHA 1P6QA 1C14A 1CWUA 4OD0A 1JPJA 1FF9A 3UGQA 3TGUH 1W35A 2H3EA 4U7PB 2DUNA 2E3JA 1KQSF 1ML4A 4KGXA 1VFPA 1E18A 4N5IX 3DZJA 1UBSB 3L73H 3KUKA 4NJMA 2FEMA 1NI8A 2I55A 5HW0A 1Q7CA 4XWYA 1CN7A 3T4UA 1QHSA 4I2NA 3RIEA 1KAEA 4FYXA 5JEDA 1XZFA 4NZMA 2IHYA 5GTHZ 3U6KA 4N8EA 3QU4A 3C3JA 3F6SA 3A27A 1KYQA 1E0JA 3X1MA 3WYEA 2WLHA 2CV2A 2FZGA 5CG2A 2NX2A 3ZLJA 2JIMA 4RL4A 3EFOA 3U3XA 2GCOB 5JXIA 2RC6A 3VC3A 3FPAA 3L72H 3REQB 1XRQA 3F0EA 1AQNA 2XB4A 1SBCA 1ZD9A 1M75A 4KR3A 3K6KA 1FRZA 4NFYA 4YIPA 4DL9A 1O94D 1L4HA 1D2RA 1U94A 2MSEB 4HRYA 3SZGA 4BP8A 1A5AB 4RDCA 1HDGO 5DHPA 4YDQA 1SZJG 1SETA 1RLIA 3ZP7A 4L0QA 5G4KA 1IZZA 3ROQA 1OJHA 3O26A 5LDGA 4E1AA 4YRFA 4MNTA 4BY9E 4CKWA 2DHRA 1T1JA 3AP2A 5FORA 1SU4A 4MT8A 4NZOA 3VPBA 1MORA 4PCUA 2J45A 3AFGA 3HJTA 2DLDA 3B6JA 5TDHA 2RB5A 1Y48E 2ORVA 2DY0A 2C20A 4LPSA 1XLWA 3HBFA 1LDYA 3WNBA 1E5QA 3FCSB 4HD8A 4H7KA 1V47A 5CU7A 5JU6A 5H9CA 3UW1A 1SZCA 3SYOA 3QF7A 2GH1A 1QAQA 1PZHA 1IURA 1ZYUA 3VSEA 3WC4A 4KRXA 4OVKA 1TEZA 3RABA 1I33A 1VTKA 1KAHA 7REQA 1C4WA 2OLJA 5ERXA 1YO6A 2VHZA 3IQDB 5BN3A 4IDEA 1RWXA 3D4NA 1ZL2A 4JB3A 2O5EA 5FTMA 2B4AA 5B1OA 4L4SA 2JFWA 2P6OA 3ZOZA 2QWPB 2PMWB 4MP8A 3CD6F 1XTSA 1RRKA 1Y0BA 2OBYA 3GT0A 1N1MA 2WIFA 1CCWA 1JR2A 1R6UA 4M22A 1Q90D 2FZVA 1EDZA 4PSKA 1G5PA 2WYVA 2EFHB 3ABLC 3A6LA 2Z2JA 5CITA 1E5LA 5L3SB 3JS5A 2SECE 1W8DA 5J4YA 1H2EA 2V5AA 4LJ7A 1EXWA 3S02A 1VIDA 5D8DA 1IBMO 3OE4A 1OB2A 1H2AS 1VQ1A 4EGFA 1ITZA 3OUFA 3UQZA 4XLTA 5FBHA 1YJQA 5DYNA 2GJ4A 4HNVA 3VSBA 3HKEA 1UKBA 2HHLA 3P96A 2YWEA 4G0PA 4UREA 3GA5A 2WBLC 4A16A 5HZHA 4ETNA 3LYAA 1U63A 3AUUA 1J8YF 5K8IA 1RAFA 2QTRA 3A36A 1Y3AA 2PUBA 3TG2A 3VU9A 4EYOA 2I5PO 3G2MA 1SA0A 2CE4A 3NKVA 1TO1E 4IHJB 1EP9A 1QCDA 2GZMA 4U9UA 2XEDA 4Y2UA 3I30X 4DJEC 4B17A 4FGSA 1VJRA 3SZLA 3DF9A 5A4IS 4NWOB 1NZJA 4K9LA 1GM7A 1B0ZA 2H7CA 1ESNA 2RCVA 3WLLA 1Z4MA 4QE9A 2AR0A 4PI0A 2FRDA 3UO2A 1BGWA 1R15A 1RTTA 5BYAA 3D00A 1N6NA 2KG7A 5AHOA 3LUDA 4X45A 4CU2A 2HQ1A 1GL9B 2X9LA 4NIMA 1PK9A 2QLNA 3OD5A 1XAGA 2PV0A 2ZIUB 4PLPA 2OTJF 1W5TA 4X3OA 1MTZA 3DSQA 3ZKWB 1J0CA 3PC3A 2M1XA 1LH0A 2LIPA 4B8ZA 4KXLA 1TB4A 1UL1X 4NF2A 2QDOA 2IE8A 2ZYTX 3UM9A 3TD9A 3AG7A 2ZOSA 1E79G 1HH4A 1AF7A 4YAKA 4C6SA 4WXPA 1K92A 3FRHA 3CCMV 3Q4GA 1AA6A 5IE9A 3PZBA 4J1TA 4F06A 1TKRA 1UC4B 3NEAA 3VNAA 4B4WA 3ZJVA 4LJLA 3JQBC 1XWFA 1XTVA 2NPOA 4I6GA 5H3LA 3IP3A 5EC2C 4RK7A 3UMVA 3ZNOA 2WJIA 5K9ZA 2XD4A 1FTSA 2LRHA 3PICA 2AN1A 3EFEA 3JQAD 5LBUA 3RWOA 2O8VA 5IBQA 3TNDA 2HA4A 3UWDA 3TZ6A 2B99A 1AKYA 4RAOA 3Q9NA 3K9QO 3M4JA 3FDZB 2BZSA 1AR4A 1YS4A 1W5BA 2IELA 4QJIA 2Z9DA 3CRMA 1XZMA 3KV1A 1ZMXA 2O3QA 2QROA 2IYZA 4CM9A 3HC7A 1ORIA 4ZVOA 1JFRA 3AP3A 1Q0QA 3J80A 1UFOA 4AYXA 2QA4V 1ACJA 4LOKA 1N2OA 3L49A 3SEQA 1Y6GA 2REQA 4E5NA 5KAMA 3EVBA 4WZ6A 1L3CA 1JS1X 1B00A 2JCVA 4LC1A 2O2HA 5CW1A 2OHIA 2YHIB 2RBGA 1J8VA 3IBGA 4YJ2A 3BS4A 4FFNA 3H1PA 2VDPB 4F71A 2ABWA 2I54A 3C6KA 1U2EA 1K89A 1JA8A 4DF3A 4I5DA 3I55V 1JZSA 1LZKA 4RMHA 4WFQA 1RWBA 1R6BX 1VL8A 2C2ZA 1SVSA 4PZ0A 5WRFA 3UCXA 1TAGA 4MUNA 3INNA 1YITF 3RDPA 3UOGA 4YJ2F 1PNLA 4LXXA 2FFJA 3IVRA 2FH5B 4XDJA 4M54A 2CLHB 4YUVA 3U3RA 1M1KW 1XZDA 1M7GA 1RJEA 1HGXA 2O8CA 1O1YA 1YS1X 2WNSA 2V4ZA 3OCYA 1RYDA 1R5OA 4HNSA 4DLPA 2D2FA 4OJNA 1IK6A 3RS2A 1J49A 4NOJA 4RE6A 2YWXA 4Q20A 4I99A 4M9XA 1H2MA 2MR5A 3AV3A 3TSCA 3CNNA 1S3IA 4BUCA 2PUTA 1KC3A 1TLLA 4IGEA 1L6RA 4CI0B 4OREX 2W8ZA 4RACA 3K12A 4BIZA 3O2QB 1N3YA 4LVOA 2OCAA 3KJEA 4F7WA 2B7BA 1IY0A 2Z1UA 3LWDA 3VYSB 1ZR2A 2ZWVA 3BDVA 1I3LA 3IAM6 2ZRMA 3H87A 2Q46A 2WHYA 3PYMA 3AHGA 1W48A 2GASA 4O2BA 2B82A 1TK2A 5CT6A 6ABPA 5B1IA 4GBGA 3QKRB 3VDQA 4HBGA 1G8SA 3GVIA 1KK0A 2HHHB 3C45A 4Q4LA 5DNAA 4NKRA 2YVLA 1BS1A 4BJ5A 3N2LA 1Y63A 3AJAA 2PLFA 3AIMA 5CM8B 1USWA 2QLMA 4ZI2A 1H8EA 1M57C 2JEZA 5E8JA 1OYYA 4ECEA 1J95A 4K9SA 4YP1A 3R7LA 1KNQA 4FDLA 1DCTA 1KHTA 4KJZA 5KBYA 4A5UB 1U0TA 2HAEA 2GUZA 1HDCA 1Z0UA 1X94A 1NGSA 3BDIA 1XF9A 4IZOA 5HK9A 5DISB 1GG2A 5AWFC 1WDMA 4ER0A 3KL4A 2YASA 3CP1A 3ZZTA 2BC9A 4ZHQA 3L40A 1IZYA 1EFDN 1FUUA 4QQFA 2VXYA 1GPLA 1KBHA 1AK1A 2EIKB 5IN4A 2G5TA 2YL2A 4OXRA 4BQFA 5EESA 1EWKA 4N8SA 4JP5A 1A1VA 4I8XA 4Y1RA 1T9ZA 4RM2A 3BL5A 5AVUA 2FFRA 2MTBA 3MUFA 1WMAA 3UJCA 2YC0A 3HUDA 1AT1A 3MHPA 3BILA 5FOUA 3KQSA 1EVIA 1GT6A 4B6SA 3RTAA 4AG3A 4O4HB 3SOPA 4J42A 1CJMA 3F1KA 4L02A 1QNFA 2XNDA 3EVDA 3MYRA 3JSLA 3GW8A 4KPGA 3WLAA 1ECJA 3OTHA 1ENPA 3B70A 3WZMA 3PA8A 2QRNA 4ZZ0A 1EH5A 1FPMA 3EC7A 4AX4A 2P4EA 5J2TA 3OCVA 4V0ME 3NYQA 3KEQA 3LGAA 1KEUA 1I1NA 3DXRA 2G71A 4R05A 1QZUA 1LLCA 3OFNG 3FYUC 3SS9X 2RBKA 2ZRFA 4JJAA 5FX2A 3GUHA 4TX1A 3F96A 2QRHA 2FFBA 2IRWA 3SGLA 5SYAA 5JDIA 3DOUA 3CSXA 4JR0A 1IEWA 4Z2WA 3DLAA 3KLOA 4Q4JA 3AV0B 2Q8VA 3AF6A 5DGDA 4MPJA 3TUJC 3U4MA 5J2TF 1NL3A 3HN6A 3KYDA 4TWIA 4MVWA 2CNWA 2WZQA 1C8LA 3P9IA 1H94A 3UK7A 4DLYA 3T95A 5LNK1 4ZVNA 2VPPA 2JH8A 1L5OA 1J24A 3DSRA 2B8TA 1RWQA 4AMYA 2BFAA 1NR5A 1J09A 1VIBA 1Y5MA 1CQWA 1MSWD 4F5DA 2X6RA 5DYTA 1UXIA 4IIHA 3NEPX 3LNNA 4ZJPA 3O85A 2D1QA 4AMZA 5EWMA 2FPPB 2BLLA 4U7FA 4A9AA 2AMFA 1ZJ4A 1JJOA 2X7JA 4FDTA 1NXQA 3KQVA 2NU9B 3ZN2A 4POAA 4BC1A 3ZY2A 4HH4A 4W5RA 4FKZA 1R9NA 1RFGE 2G8LA 4PRKA 4EPTA 4UCSA 1ISSA 1EAMA 2CCJA 1DRJA 3SHTA 4GKAA 3T1YB 3F4LA 3OCCA 3VQVA 4AKIA 2X9VA 3CCEF 4NVRA 1P19A 2WWRA 2UZ0A 2FZWA 1ZK0A 2BJVA 4G5SA 3D4BA 3JAKA 1XI2A 1V1JA 1JMKC 2C5AA 1E1YA 3NVKE 1PJLA 3JAMA 3DVRX 3LKDA 4BNVA 2OZKA 4U2FA 4W1RA 4RIHA 2V7EA 3UGKA 2IBSA 2R87A 2XJ9A 1NSFA 4LE0A 4P36A 1RVV1 4NCAA 4JXXA 3O21A 1I6WA 2X22A 4LDJA 5I7SA 4DYDA 4BNWA 1GYQA 3D3WA 1ZUWA 3AOEA 4FFKA 1BVUA 1ECGA 2GLUA 4B3HA 5CBGA 5H4GA 5KREA 1KTIA 4S2UA 4NP6A 2POQX 4ZOLF 1CKEA 4PLHA 2A30A 4BNFA 2GBLC 4HAOA 2A1UB 3JPWA 1Q84A 3KEFA 4MCAA 4QELA 1ZO8A 1C7IA 4C05A 3ZEAA 1N8SA 5FPQA 2XBUA 4J90A 4DMKA 3K6SB 2BE9A 2P4HX 3TW0A 2DXIA 1DDOA 1UEXC 4QBIA 3IJPA 2M7WA 4P3PA 3OTIA 3TEFA 3KE1A 1E79A 3CLSD 1I30A 3W7VA 1V26A 3GLKA 3CE6A 1BZKA 5CVVA 3OPMA 3R3WA 1A97A 1W0CA 4K9NA 4CJXA 5JJ5A 1P1FA 5KUKA 1I32A 4EKYA 3QXGA 1WZ2A 4BV3A 1S89A 3UGTA 4FFBB 4RD0A 1SESA 3QQPA 1D4ZA 2FQWA 3MGGA 4LY6A 3AG1B 1N4AA 4RHUA 2XOKA 3N8DA 4WLVA 1M0EA 3GT7A 5IHXA 5E6RB 1GD1O 4IOLA 3P27A 2R25B 2BHLA 2WB4A 2VS0A 2GZ2A 3L1IA 1YVWA 2W7TA 3B1JA 3DLBA 2IHUA 4ZYUA 4AJLA 4OQFA 4PLVA 1Y9AA 3DNFA 3K5HA 3KSAC 3WS7A 1S1CA 4X65O 3WK4A 2YMQA 3AZPA 4TMZA 4GPTA 2JGFA 1KYWA 2GLZA 3I4LA 3LNMB 3OJFA 5JZ9A 5A3QA 2C0PA 4KO8A 2I4TA 1PD3A 1H48A 2AD1A 4XOIA 3D6HA 4RULA 2PX3A 1ZIOA 4TYMA 4QQ8A 2GCGA 1Q12A 2FR8C 4BMOB 4CZZA 2ZKOA 3ZXIA 5TB5A 3AEKA 2CLEB 4LSWA 3ZE6A 4TXMA 1L3IA 1K4DC 5B7GA 4PIMA 1FDSA 3F49S 1L5FA 2ASEA 1OX6A 3E4DA 4GE3A 4BFVA 3E9DA 3M84A 1K75A 4TGLA 1Y1SA 4BDSA 4A0QA 4JOQA 4EGAA 4D4GA 1XBIA 4LF7O 3SC3A 4V1CA 2YIMA 4H27A 4J0FA 4QOSA 1R0LA 2YBDA 3FB8C 1P0MA 1SZDA 4F9FA 3DXZA 4R1LA 2ACWA 1UK8A 5KTKA 1QH8A 3N3BC 4MWGA 4CMBA 2DT8A 4J16C 3I01A 3JALA 2ONJA 2NW6A 4XPIA 5IBRA 4CBCA 2CNLA 1RRMA 2WT4A 1DJMA 2GSMB 5DTMA 1EFUA 1HYEA 1Q5OA 4A6PA 5GM1A 3B5JA 2CMDA 4NWIA 2ECPA 3GFGA 4ESVA 4JI1O 3GDOA 4QWWA 3K2EA 4MKIA 1FJHA 3PFCA 2O23A 3L0YA 4ZYXA 1X7WA 4FN5A 3C48A 3E9EA 4RKEA 3PGKA 1Z6AA 4H33A 2BSKB 5AW9A 1IPHA 3IIIA 3O65A 3PC8C 4FMBB 3H0KA 2HLDD 3LP6A 2FGJA 2CCKA 4F38A 4J0KA 1X2EA 5EQFA 3HJFA 2IDKA 1G8YA 1CEYA 3IEUA 4MKHA 1QZZA 4R01A 4FOOA 3AESB 5DEDA 3OBBA 2A9OA 1SKYE 3KQMA 3SZUA 4LG1A 3ZJUA 3IXQA 4R7TA 1D2GA 2YZMA 2BM9A 4RSMA 3GIDA 2JDID 5KJFA 4MUIA 1E6EA 1T36B 2E6KA 3EXFA 3W7UA 1QBKC 5JMPA 3HO1A 1XMIA 5TJHA 5FYDA 1AA9A 4Y0VA 3A0BZ 4MTGA 3V8MA 3GHHA 1H1TA 1D1TA 5FI5A 1YRWA 3QFRA 4ZPXA 4BKPA 3D8BA 2IXTA 4JZGA 4BE9A 4HB2A 1YRHA 1E9RA 4Z1MG 1REQB 4DCCA 4JI2B 1JJVA 2VHCA 2GF0A 2QEXF 4XYLA 2ZAIA 2OUKA 1NVAA 4TLDA 4E1BA 5AW1A 1Y3BE 3LQ1A 4RVDA 2UYNB 1DWOA 5AM4A 2QM8A 1LQ2A 1RJ9B 4UVGA 2H8PC 4JTDB 1JL3A 4WF9V 2ZKIA 3F7MA 1RQGA 1OPRA 2AC7A 2AZTA 3M6XA 2G77B 3CUWA 4MQFA 2UUCO 4W5NA 1OZAA 4G5QA 1F48A 2Q7EA 3VQWA 3T1OA 1M8GA 2Z5GA 4L9SA 3TSAA 1JLKA 4B7EA 6PFKA 3QMPA 1E9CA 2FFQA 1EM6A 4H7PA 5EJ4A 3FOEC 4ZYYA 1JHRA 2FSGA 5ALRA 2CD7A 5KC9A 1D2MA 1Z38A 1JKMA 1HMYA 1Q77A 4XIFA 3GT4A 5EYPA 1XLTC 4LF9O 2CXUA 1BYIA 1KYIA 3OFNA 4LN1A 3MJVA 2V55B 1Y1PA 3OTOB 2EILB 4DTIA 3C4QA 1NRIA 1VP9A 4TSFG 3GRUA 2Z0MA 3IAXA 4Q15A 3KPWA 4X1YB 4PYQA 1G2QA 1XOIA 2QTAA 1WKVA 2EKDA 4ZYZA 5T5QA 4RH1A 1OAOA 3RK4A 3P94A 4O3FA 5M34A 2XUQA 5LUAA 5FTWA 1UBTS 1XZPA 2NOAA 1GO0A 3N5CA 3GNQA 5DGXA 5IJZA 4QPPA 3FFQA 3DEZA 2ZD9A 4CFYA 3IE2A 1UPBA 1W55A 2C95A 3RV3A 2V6JA 1R0ZA 1UPTA 5ICSA 4FGZA 2XAQA 2IYWA 3PPWA 4JGSA 3I0NA 2GTAA 3KNZA 2ZANA 1D4FA 3FWPA 1NQOA 1K9SA 4X3MA 3DLIA 3OJCA 3TWOA 3WWDA 3R5JA 3FPEA 3A4VA 3N27A 1SK9A 1DCKA 1QKIA 2CNKA 2P3OA 3BSSA 5B3SB 4RTRA 3Q6IA 3RRZA 5DI9A 1OI7A 3AEYA 1P7BA 4PSCA 5EO3A 1NJIH 2VTBB 1LLFA 3JWHA 1Q1QA 3KTDA 3LBIA 4IYHA 1SZQA 3ZW8A 3R6GA 1Z5PA 1QDLB 4Q9NA 3HVIA 1ZCBA 2OWOA 1UZLA 3C0KA 3RC8A 3OICA 2X9QA 4DMMA 1RXCA 3FW1A 4YJDA 1M2NA 1NTOA 1V8OA 1YDMA 4M8NE 2EW1A 3WAKA 2FN9A 4GSKA 4U7DA 1CUCA 5KNDH 2JCSA 3T06B 4PCVA 2ZR2A 4CI9A 1ICEA 4F4HA 4UCOA 1X6VA 3IEWA 3CXCF 4BVSA 1EE1A 4MV0A 4M1MA 1HNNA 2XYRA 1RHQA 3EHEA 1G5RA 1C9MA 2OB2A 2OECA 4CPDA 2FWPA 1LS6A 3BGOS 3SPHA 2CFCA 3SIXA 2RSLA 3BY6A 3KT6A 1BD4A 2TMDA 3LVRE 3MMSA 2I7VA 3B6NA 4KUHA 4CIXA 1QYCA 2O2IA 4MEJA 5C46F 4ER3A 4MSUA 1XZIA 1J39A 5K7SA 4DMUB 1WR8A 3E7WA 3PJGA 5K3FA 1O57A 3EFBA 4O0MA 4CVNA 5GZ6A 4ZANA 1XKTA 4QIWF 3SSNA 2QNBA 4MP3A 1KYVA 2H8KA 2JRCA 1JYEA 2Z1MA 3ZDQA 4DHWA 5AJYA 1LNZA 2QZ4A 2HG5C 2IXBA 5T6BA 1GSIA 4YCSA 4WZBE 4BWFB 5DM6V 1GZVA 5TJ9A 3DC2A 1CE8B 2P9BA 3AHDA 3COSA 4CKXA 4F96A 5J4VA 3D1LA 4ENRA 3ZPXA 1M7BA 4BNJA 3AG4B 3QE4A 1PL0A 4GNKA 3QW2A 1SBIA 3QHPA 1M8PA 1TZCA 1DG3A 1EYZA 3QWBA 3H17A 5IS2A 2IL1A 5GP1A 2EXXA 4EABA 2W4IA 3HFRA 2EZOA 1X74A 4PC6A 1S72V 1W30A 2X7XA 3F67A 3GLQA 3GRAA 4BU1A 1JIJA 4EKIA 5K03A 1TVKB 1EX1A 4W4KA 1Y42X 5K45A 4WBNF 2CSLA 3MVEA 4HAVA 5JNTA 2RG7A 2OHXA 1VQ6V 5JADA 1YF3A 3IQWA 1TX4B 2K1SA 1CY1A 2V0CA 3FA2A 3IJRA 4ECAA 3L8MA 3FKQA 2FZ5A 2G5GX 4CEIA 4F3CA 1MO4A 1SC9A 1RXUA 1XPOA 1G21A 3ZV7A 4NQRA 1Z34A 1J2YA 2HI0A 5I3ZA 1YHQV 4D92A 5T57A 2XAUA 1M5TA 3FDXA 4Q18A 1O03A 3G2PA 1ODTC 3WRWA 5KYXB 2ZSHA 4XIJA 1MH1A 2M6KA 1ZM4A 4C7XA 1VBMA 1C0LA 3RC3A 2Y69C 2WLKA 3DLHA 5I3CA 2O3JA 2GZHA 3HR0A 4EF4A 3ZDAA 3K0AA 1YRBA 4ETWA 2VS1A 5D84A 4ZC1A 3JQCA 4V0MA 4Q1CA 5C1PA 4J11A 5ESWA 1ODLA 4G4SP 1PHPA 3B8NA 1NVPB 4TKZA 2FZEA 2DTEA 1AG9A 4KWHA 4R8MA 1OU0A 2I87A 4F21A 1GN4A 3VOBA 2V1UA 4OMUA 1VJ1A 2H31A 5C32A 1N5MA 4LY0A 3GN2A 1JI3A 4J75A 1E9EA 3ZI7A 2J0UA 3DA8A 5JSYA 3D8HA 5CEEA 4DEYA 4RSGA 3GLIE 5K3AA 3NOQA 3T9BA 3EZYA 4MV3A 3OFSA 2ECOA 5EIEA 1YC2A 5ICGA 3ESCA 1W4LA 3HO6A 4WXRA 4BWGA 5CVCA 2VR1A 1CUUA 4KXFB 2Q9BA 4AO6A 4TVKA 3ECCA 3IP8A 1MZFA 1JQ3A 3MUNA 5K0ZA 3MBOA 1IM2A 3G9UA 3CPJB 1MQAA 3NAGA 1FL9A 4WY2A 5H59A 4JPRA 5ALXA 3A2FA 2H94A 1A9OA 4US1R 2GBGA 1AJEA 4YQEA 1FU8A 5G0VA 2FMKA 5T67A 4JASB 1KO4A 3W2GA 3GQVA 4ZXFA 2OCCB 1O95A 5L7TA 1T3GA 5E1BA 2L2QA 2XZLA 3IQXA 4XW2A 3PC7A 1NTZH 1MX5A 4ND6A 2W43A 1PYGA 4E3WA 4ISCA 3R0XA 3K9GA 4DMRA 4OQEA 1CXZB 1SVIA 5F78A 3ICEA 3DKIA 2VSFA 2XCRB 3RVLA 4QBKA 2MQEA 1Q86H 2ORWA 5EE0A 4XX1A 4MPPA 5AW0A 1B41A 3AVQA 3D0RA 2X5KO 4G4GA 4TKUB 1GQQA 1T9AA 3ETEA 3E8XA 4Z2YA 4Z1MA 2RJZA 2BTQA 1CV2A 2BUAA 3C14C 1IRXA 1QU2A 4S1OA 5HY4A 4FPPA 2ARHA 5E0KB 2C2WA 5C5IA 2F6RA 1I5YA 1QRRA 2NXNA 2XAFA 4NYMQ 4QOHA 3DNMA 4PDLA 1KYZA 2EAUA 1NT2A 4DY4A 4NHOA 3F0GA 2IVZA 3EYAA 2R44A 4XVRA 3WLTA 3L04A 1SBTA 3FBGA 3ILXA 4JU8A 2ZPTX 4RCYA 2QK4A 1KI6A 421PA 1XQYA 4XR9A 3S81A 3PRYA 1Q6YA 2P4KA 2AN5A 4NRDA 3QVNA 3F6BX 5EZYF 4B4VA 1R37A 3CSDA 4YRBA 2WLMA 1YRAA 1YVPA 1P5HA 3FMOB 3N8NA 4RD2A 1YQNA 4M9ZA 3RUFA 1GG9A 3A6DA 2ORED 1A9ZA 4AULA 2FF7A 4JI5O 3K9AA 4CH4A 4FWBA 1IOWA 3LYUA 2RJ3A 3DGEA 1ONPA 5LCXA 4MP6A 2NO5A 1VKJA 5EKSA 3D36C 3KZXA 3NNDA 4GM1A 4YRLA 1TUGA 2GNAA 2F3PA 1L4BA 1T2VA 1KI9A 1P7WA 4KEAA 4Q19A 4KE6A 3TG8A 4NMXB 5D51S 4WKOA 2AIZP 3NYIA 4C2AA 4D5EA 1LDBA 2ZGVA 3DCNA 3RVPA 3ZMVA 1W5EA 2YW9A 1PUIA 3PTAA 4ND5A 2QQFA 3A6JA 3IAM1 1CY2A 1PT5A 2OORA 4DR2B 1Z56C 2NN3C 1M5UA 4LVCA 1D2EA 2J6HA 5AHRA 3EXHC 5AKEA 1JG4A 1TW2A 3IURA 2VP3A 2PGOA 3N0XA 2BI4A 3C5EA 3OSZA 1NULA 4HDAA 5H2FZ 1PR3A 4C9BA 1C1DB 2W70A 3I2HA 3F6CA 2G25A 4JWKA 1IZ3A 4DIEA 2H4WA 2YDYA 5AUPB 5KTRA 1FYJA 1VBKA 3N2KB 4MRSA 4QG7A 5FOWA 1L4MA 5ISMA 1TCBA 1YA6A 2TRSB 1UR5A 1OFUX 1ARZA 4ILKA 3B7WA 2EJRA 4BB6A 1XDUA 3I2GA 2NN4A 1RRFA 4L3OA 1T2FA 3R9WA 1PNRA 1DAPA 2XADA 2Y77A 1J20A 3KQOA 3K0SA 3TW8A 4JAAA 2XV1A 4G9EA 2FY8A 1M6WA 1VJGA 4YT5A 1CZRA 1TMKA 3TNFA 3GJYA 4RDHA 3S0WA 3K14A 4L7QA 4IRMA 5K6RA 2FMHA 5DBEX 3AWDA 1NBWB 3VHRA 3PIRA 1FXKB 1YZLA 4LJSA 1AGPA 3TW4A 2ZI4A 4C6HA 1XZLA 3BXHA 4OHRA 3AYXB 1Z5NA 1F7UA 1NBMG 1YZUA 3G82C 4KI7A 1UPGA 3N05A 3AJ8A 4DIKA 4CIBA 3C6YA 4BFSA 1VHQA 2PSHA 2XNSA 2GJ8A 3NTXA 3OX3A 4I55F 1CY0A 2OHWA 3LVBA 4HH1A 1IULA 4N49A 4QJ3A 3V48A 2ADQB 1VP3A 2ASVA 2CBZA 4MIOA 2IXEA 5FA5A 5JFGA 1KO1A 4B71A 1PGQA 2Z5LA 3BK1A 4EB8A 4NOKA 4D4IA 1US6A 3BGIA 2XYGA 3SZRA 2BHSA 3UH1A 3T0IA 2YHAA 1BA2A 3IJ4A 3DBLA 4MXDA 3RNLA 4Y1EA 2QTBA 2JAXA 1XJ0A 4L16A 1YJWV 1XRJA 4PS1A 1F2UA 2QLJA 1M10A 4Q4DA 3FTNA 3UJPA 3B3QA 1Q82W 2BFDA 1J8DA 3HACA 3JCZA 5I47A 4LS3A 3IUQA 5DDIP 4W6ZA 3LDFA 1VEWA 2UUBB 2V7QG 4GKKB 3RWBA 5CBFA 3O90A 2IPXA 1RQ7A 3STHA 2YV3A 3I3FA 2AFIE 3NDBB 2P8JA 5L7WA 3CF4G 1MCZA 4YI3A 5JQGB 2V7BA 4QU0A 1HFWA 1U0EA 3HMKA 4WRRA 1FJ2A 2GN6A 1WABA 2XDQB 4XVCA 4IDBA 1G17A 1H2BA 5JD5A 1RADA 1TA8A 4KPUA 2G1UA 3EQ8A 3C9TA 4C14A 3VNVA 1EVLA 5IZCA 2YJ6A 4BV2A 1Z06A 2LDBA 1LSSA 2ZP1A 3B77A 4IEEA 2P9FA 1Y1TA 1U7WA 4P0QB 1GTVA 2NZUG 1ZRNA 2BCEA 4FYHA 1AJQA 4KDCA 4JEIA 5TXGA 4JI6O 3EXEA 4Q4AB 1X7XA 3QLUA 1Z5ZA 3RLIA 4BNMA 4DQ0A 2ZJBA 3IE1A 1OBOA 1U9IC 1YDGA 4K6FA 5SYMA 1T5SA 2NNWB 1JA1A 4QDJA 2GZSA 2FW6A 1G8GA 2HLHA 1PL8A 3ZCCA 1XJQA 4PDRA 2C0QA 2HVKC 2GKGA 4Y30A 1KH1A 2OMEA 3R3SA 3EW9A 3OECA 3KBBA 5EJAA 1ZH8A 2PGAA 4LKOA 4B83A 4LRXA 3I5AA 2WU4A 2JIQA 3OLZA 2HDOA 3GFTA 3UTDA 1OE0A 1VE1A 3S68A 2Q4TA 3UPUA 1FXSA 2P9TA 4WNYA 5DIFA 2DYRB 4NNJA 5ALUA 5CH5A 1VLQA 1ZUHA 2FSVC 1GAEO 1LZLA 4QXRA 3C3MA 1YDFA 1YL7A 4UVCA 5FEMA 1ENZA 5KNCD 3V55A 1S8AA 3CM0A 1FMCA 1M6VA 5PNTA 4L85A 1O4WA 4EJSB 1JVSA 3INGA 3TLAA 3DGFC 4BWVA 5EKUA 3ON1A 2B5VA 3QEKA 1YIJF 3WLFA 2XZPA 4K81B 2QXTA 3SI7A 3WP0A 3MDSA 1C9NA 1ZI8A 4YAWA 3U31A 4YV0A 1B8NA 3MAGA 1UJ5A 4G1EB 5KNDA 2EZPA 2OBLA 3A0HZ 4BRUA 3LPDA 1TEVA 1Y74B 3N6RA 1M1NA 4D9NA 2HHAA 4ZDWA 1NS1A 2R66A 3QE0A 3TDNA 4O2AA 4RKRA 3ESYA 1T6NA 1RXEA 3BKXA 3SQWA 3EVCA 2RAPA 4FT4A 1JHXA 2C9BA 4MWOA 2BFEB 1BQ3A 1VP7A 1ENVA 1PO7A 4F2WA 2VHXA 1NVKA 2F1HA 3V2UA 4KFUA 2AVDA 4C08A 1K6MA 2HTEA 3BHMA 1JFVA 3GF4A 3Q98A 2E4XA 4L5JA 3HDGA 4WFFA 3Q10A 2DBYA 3H4MA 2RHLA 221PA 4EBFA 1DIAA 5LBQA 3V2IA 2HP3A 3UPDA 4IIFA 1ZD5A 2OVBA 1ZD2P 3R6DA 4TMKA 5HY0A 4M0UA 1T4MA 4DYVA 4G1MB 4CTNA 3K0CC 3FGZA 4N76A 4GPD1 3RYFB 4Q37A 1CUSA 1HF3A 5CD9A 5JSQA 1K4CC 1CUHA 3ZUGA 4Y0AA 2Q4BA 1WZCA 1YGYA 3T5PA 1G41A 1N92A 4EBBA 2DE0X 5C80A 1FEZA 4FCVA 4S1TA 4GMGA 1Y6RA 1R0WA 3HXLA 1Z3IX 2H7YA 1WHSA 8ADHA 2EFYA 1I4WA 1W36B 2Q4DA 2AKEA 2OBFA 1IVNA 1P2GA 4EY4A 3NRBA 4H1WA 3ZOPA 3VDNB 3E5NA 2VC2B 3CXUA 3UC5A 1QVAA 1GXSA 3LMKA 5F1OA 3QJYA 4FGWA 4QRIA 3H0CA 3I53A 5L4SA 3F8TA 1WXIA 2HT1A 3L75H 3WQRA 3THYB 3D3NA 4WZBA 2P6MA 4OQNA 5HY2A 3CC7F 1Z0AA 4LF8O 4C1BA 3SQLA 3GUCA 3A1UA 1PN3A 2OYRA 2OENG 1E9AA 1SOWA 3GUVA 5E2IA 1MJGM 2DH6A 1ZKDA 3P0ZA 4UU0A 3LHKA 4FQ5A 1LSOA 3FMVA 2EIMC 1YZVA 4PV7A 1P4SA 1XZAA 3NHSA 3CRVA 2HWUA 2Q1YA 4IDGA 1SC6A 2GTIA 1SC1A 2ZJ5A 5FPPA 4WSOA 2FOLA 5KKAA 1MO5A 1Q1EA 3STWA 2FFAA 1QKKA 1MA1A 1NMUB 4PAQA 1JHYA 3DYBA 1R3DA 1AZLA 1ZRHA 2EINC 3GHZA 3S0YA 4TT3G 4KIWA 4HX9A 1OLSA 3PFWO 3HDQA 3SKYA 5SZHB 3OKAA 3RGWS 4U63A 3RU2A 3SK0A 2JFFA 3W2HA 4O4JA 3UWSA 2H1WA 3HJBA 1M2OA 4R40B 1WD5A 2B5UA 1NOIA 1E1RA 3U3OA 1C7EA 2Y0PA 3KWJA 4A3SA 3VR4A 4HFJA 3GYBA 1CLEA 1FFSA 1JU3A 2DYSC 2F1OA 5FWYA 1QTQA 5FJIA 1KOLA 2F66C 3ZWWA 1GPDG 4GWLA 4Z4QA 1JKXA 1WDKA 2IVFA 2DYYA 4F9TA 3G17A 3SJQC 3AR8A 4KV7A 3GROA 3PKZA 2X15A 4RS4A 2C5EA 1DMSA 4R5MA 3E82A 1HRKA 2KTUA 3DC7A 2WYWA 3HRKA 3CIOA 3DOHA 3WBJA 3T7RA 1K8QA 4QT0A 1BVYF 3IB6A 3GLIA 5ALMA 4UHJA 5AKGA 3ISVA 4MVXA 3HJHA 2WM2A 3TGWA 2BGWA 3QO8A 4DNXA 5LWHA 4XWGA 5KYGA 4DMHA 2P2CA 1E1CB 1CP9A 3C3WA 4CUZA 1AR1B 4KU4A 3BXGA 3H04A 4Y9RA 4E46A 1JRLA 3GPLA 3UCEA 1IIBA 5EFZA 3MGBA 2GPTA 4L0CA 1KPHA 2OCHA 2ZRPA 3AVTA 3O8NA 4Q47A 4KSCA 1TJPB 3MWGA 2R5FA 1UPUA 1EFVA 1P0QA 5HE8A 4IIBA 2WAMA 4KVAA 4DUYB 4FUTA 5FLEX 4LK2A 3AEQA 1DTWB 4RC9A 3GD7A 1YBAA 4TTJA 4ER5A 4P4TA 4QHTA 3M4XA 3RIHA 3RHTA 2RH9B 3VSCA 2HMWA 4A26A 1W0JG 2OT5A 3IQZA 4TXHA 4FIZA 2GX6A 2B34A 4B3XA 2PE5A 4N3NA 2AZ4A 3S3WA 1TA0A 1XMPA 4HAMA 2AGAA 1CY7A 3OIYA 4GH5A 2RAUA 5BSHA 2I80A 3CF4A 5BN4B 4LWSA 3IBFA 5I7FA 4LX8A 5GJWC 2NQTA 1NVPD 1T0KB 4RZUA 3QNUA 2KLBA 4OI1A 1PS9A 1WEHA 2WWFA 3H8VA 1YB4A 2HXSA 1GQFA 5TX7A 1Z13A 4EAQA 2FVXA 3SWWA 1WULS 3AVXA 1HL3A 2XB6A 3M9WA 2NV0A 1JQBA 3NC0C 3AY0A 1YJ9F 1G291 1MAWA 2WNIA 3CWBH 2QRGA 1H4SA 1MV8A 2B1RA 5D3QA 1LLUA 3IQIX 4RSRA 5BNZA 4YYEA 4HMQA 2ZYSA 4FM2A 4JX8A 2X2FA 4INAA 1RQNA 4JOBA 1AH2A 1NDQA 4G36A 3TPFA 3BVOA 3NZEA 1TPZA 5HQ3B 4L2IA 2GBFA 4YGYA 1PL6A 3OT4A 3JAWB 2PY5A 4N03A 1PM9A 4JIGA 1Z22A 4NBSA 4LCUC 1JVNA 4EG3A 1Z39A 4NQ3A 1DG1G 4PLCA 3O8DA 3OA0A 3COYA 4BLUA 4LXIA 4RLQA 4PC7A 4BKRA 1PBTA 3CA8A 1UMCB 4C7KA 2ZG6A 1P39A 2BEUA 1SVNA 1XE3A 1GSOA 2DQ4A 2BV3A 2O3TA 3L1VA 4ZEOA 3CZ9A 3RFXA 5KTTA 3NVAA 3NP7A 1GUYA 2FGYA 5F2EA 4GD3Q 3VO1A 3FM9A 2GR9A 3OJEA 1GGMA 1XVIA 5I7EA 2BR5A 9ATCA 3AFOA 2CUKA 3N4YA 2R65A 3RUHA 2QJRA 2PHNA 2QI9F 3PXBA 1PJRA 1I2BA 4L4RA 2FZKA 4O2BF 5DE3A 1QVVA 4OP3A 2ID9A 2YSUB 4UMEA 2KMLA 3H5TA 2ZUDA 3GZNB 3OQIA 1MB4A 1IOLA 3O4JA 4PRLA 2GHRA 5F3RA 3CEPB 4OHUA 3LQRA 5EL0A 1PJAA 2H0RA 2EKLA 2HJFC 2CVLA 5IH3A 2DPLA 3VR3A 4FLXA 4EB0A 4RUEA 3DO5A 2HLNA 2AOUB 2D7CA 5HKLA 1BMFG 5AVQA 1PLKA 2AUMA 3KU4A 4JT8A 3WYFA 3U7IA 1KEWA 3K5IA 3KALA 1RE0A 2PUCA 4M0KA 4AFNA 4NX2A 4M1TA 4N3GA 1XTZA 3H2IA 3GDGA 2HV9A 1CFZA 3A9UA 2GMWA 1H2NA 4OF4A 2C5FA 3ONEA 4AJHA 1Q83A 1KRWA 2FXVA 3KT0A 1YZHA 2AHYA 5HF9A 4ZHQF 2HP0B 4ARAA 4YJFB 5EE5B 5D6OA 1KZ6A 4LSGA 2H2HA 4US0R 3U4HA 1PFUA 3COWA 1Q3HA 2EJTA 1PE0A 2R6GA 3ZCSA 2YHBA 4Y6PA 4L9WA 3D8SA 1E3IA 4V0NA 1A27A 1N25A 3TJTA 1FLAA 2NUPB 4P83A 2HMAA 4KWCA 1CUZA 3H2KA 3L6RA 3K9SA 1QGYA 3AG6A 1AMUA 1NYTA 4S1WA 3EEQA 1DGQA 5KC8A 2VUUA 1LBEA 3R09A 2CFRA 4DR7B 3S2FA 5M04A 1GCAA 1U9YA 3F3YA 2W8BA 4EY7A 1DRUA 4MWDA 4MS3B 4FLMA 3C3BA 2YY5A 3R20A 5LDHA 2P06A 4JHLA 5FB3A 1U04A 2C5BA 4NARA 4M1EA 3MJHA 5FADA 4UDXX 3T5CA 4OHBA 4ACBA 4UZSA 2BFFA 4KTVE 4WWHA 3FAKA 4M99A 4ISBA 3QUTA 5FDFA 4OGLA 2AK3A 3IKFA 3ZYCA 4ILEA 1PEDA 3CWQA 2A0LA 3LT2A 1UDWA 2W58A 2FETA 2E5WA 3T94A 1U1FA 3CZQA 1PNVA 5L7YA 1UXGA 3EZ2A 2B6HA 2JHCA 4IH4A 4E03A 2FPMA 4YI5A 5CTJA 4HN4B 2AFIA 2ZM6B 5IWAO 3H3XA 2C04A 1XV5A 2GBPA 3CBQA 4UD6A 1GRNA 4DA8A 2PUHA 1C9YA 3VRHA 2B9ZA 2NUAB 1XT6A 4GQIA 2D00A 1H2LA 4X63A 2E75B 1KO5A 5J9PC 2Z1TA 4TT3A 2KKWA 4ADSG 1TQ2A 5JJEB 4KR7A 3GFSA 1T8RA 3FD8A 1GQRA 3OJWA 1NJ2A 1R8SA 3JVEA 3K59A 3BQMB 3N53A 3WMXA 3CYQA 3M49A 2J7KA 5ELXA 1L3BA 1KNJA 1PP9H 3IPYA 3WB9A 4AK9A 3WRXA 4TWBA 5DASA 3A6FA 1M1UA 2FSHA 3SHVA 3SYPA 3L0DA 2BGTA 4UBLA 9MHTA 5L3EA 3GOQA 4MRPA 2V7TA 1CC1S 1N2GA 1SQGA 5EQDA 1ZXXA 3UAXA 4JUFA 1C0PA 5KWSA 2ZXEA 4XUCA 1ZOSA 1DTEA 2XQIA 3U40A 1TVMA 1MNAA 1IMJA 3A1CA 2X2PA 5FWAA 1G6UA 5HGXA 1F2DA 1J2TA 4CLRB 4ZI5A 1TMYA 2ZTVA 4BGDA 2CUTA 4V2IA 1MKYA 1LA2A 1YRLA 2O54A 3KKYA 1FU4A 3I9MA 3PFIA 2G88A 4HB3A 1H1DA 2NP6A 3WLEA 4G5FA 4KWEA 3HKCB 4JJGA 1GKKA 3JQ6A 1NTKH 3GFVA 1WCV1 4LJ6A 3D7KA 2ZIOA 3AXTA 2KQXA 3U11A 3E8HA 1TTPB 1SQQH 4Q3NA 4EEXA 4KBFA 2OGZA 1D4OA 3ORQA 4C4YA 2EFJA 2OO5A 5T4FA 2R3SA 4D8TA 3TLGB 3GLSA 4UBNA 1VIMA 5IC5A 2TMYA 1IOVA 2JAHA 5KHIA 4QPNA 1I10A 1RKUA 3DZ8A 5H4HA 2ZJ3A 1C41A 1EFLA 1FA9A 2QOEA 3HVHA 4BNKA 2PUDA 3RFVA 2IBZH 2YYZA 3TF5A 4GI3A 2CLSA 4UCTA 5JWRA 3GRFA 1Y3HA 2C2GA 2XY4A 1QIGA 4JYAB 3C7DB 3I4CA 3SR0A 3KPVA 3DWGA 2COEA 1E3SA 3FHLA 3I92A 5GINE 5EZSA 4C0HA 3M8KA 1KI7A 5JRJA 4LMPA 1U0JA 3LECA 2PQ6A 5BRAA 2WSSD 1U0NA 4HQLA 2UVPB 3CZCA 1NXWA 2OFOA 2P91A 3PXUA 4UTOA 1PZGA 2QZPA