4X22A

Crystal structure of leptospira interrogans triosephosphate isomerase (litim)
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
249
structure length
249
Chain Sequence
b'RKTIIAGNWKMNLSLKEAVFLAHSIREKIPSISKDKVSMVFPSTLHLENVSKILEGSSVIVGAQNCYHSGLAAFTGETSPDQLKEIGVKVVMVGHSERRQFLGESNFFCNDKIRFLLKNEFTVLYCVGETLSERESGKTLEVLSSQIREGLKGIDSVFFSNLILAYEPVWAIGTGKVATPSQAQEVHSFIRKEISGLFVGASSISESISILYGGSVKPDNIQDLLKEKDIDGGLVGGASQKISSFAGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Triosephosphate isomerase
molecule tags Isomerase
source organism Leptospira interrogans serovar icterohaemorrhagiae str. rga
publication title Connecting Active-Site Loop Conformations and Catalysis in Triosephosphate Isomerase: Insights from a Rare Variation at Residue 96 in the Plasmodial Enzyme
pubmed doi rcsb
total genus 91
structure length 249
sequence length 249
ec nomenclature ec 5.3.1.1: Triose-phosphate isomerase.
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00121 TIM Triosephosphate isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4x22A00
3R5EA 3W1XA 3MI3A 1XBXA 3TSBA 1P0KA 3TUUA 2H3BA 4UXDA 4NX5A 4AF0A 5G1YA 3BW3A 3LHZA 4IJBA 5D09A 1KM3A 3C2RA 4TIMA 5HULA 4BWLA 5IBXA 2Y7GA 4C1KA 1S5WA 3M7WA 1WOBA 1FXQA 4JTKA 3KFTA 2GUUA 1T96A 2QCCA 4QITA 5F4WA 1K8YA 2A7RA 3DHFA 3HMJG 4HHPA 4LVAA 5LHFA 4HT3A 5K4XA 4PODA 2NUXA 1HUVA 3TXZA 1ALDA 4N9BA 4LRSA 3KVJA 4K39A 2C14A 3GDRA 2V81A 3TMQA 3MMTA 1LP6A 2YXGA 4CNPA 1HFBA 3S1XA 3LCHA 3P67A 4A29A 4DEFA 3R8RA 3E12A 1M5WA 1W3NA 4X2RA 4GJ1A 3IVSA 3VI2A 2FLIA 2VFDA 5AFDA 3IIPA 4PC8A 3F1QA 4FNPA 2X1UA 1TREA 3O6YX 4NQ1A 1VLIA 4N9EA 4Y9AA 1NVMA 1EB3A 2WNNA 1G69A 3NVTA 2VOMA 3TE9A 3UXAA 1DV7A 5FF4A 3QMRA 3W1UA 2GOUA 2V5LA 8TIMA 5DELA 4LU0A 5CPOA 4UIOA 3W88A 5E93A 3L67A 5DXXA 3GKAA 1G67A 3DHDA 4ADSA 1IXQA 1TQJA 3W2KA 4DO5A 4O18A 5AHMA 5U4NA 3CU2A 1FCBA 3LDVA 3W1QA 3PF3A 5HQEA 1YPIA 4QM1A 3W7NA 2Z0IA 1ZHAA 1SFJA 4QJ1A 3HG2A 3B04A 3MI6A 1H61A 3A22A 4RZ5A 2ZZ1A 4CCDA 5AC6A 3PC0A 1O60A 3HGJA 3USBA 4N02A 3W7EA 3FEMA 1GVFA 5AB3A 1G4EA 2VFHA 3BG5A 3FLUA 3FS2A 3L5AA 1THFD 2CLHA 4MZ8A 3QF0A 4UFMA 5AYYA 1Q45A 1XUUA 1JUBA 3BVJA 1ZAHA 2YSWA 3W22A 3EKLA 1LYXA 3DKJA 2YW3A 1KFCA 5CPLA 5T26A 5AHLA 5GVJA 3TU9A 2X1TA 3FJLA 4MLRA 4FX8A 4O0ZA 1HO1A 1WDWA 3GDTA 4JIPA 5C55A 3QZEA 4LY8A 4NZJA 4FEZA 3PR2A 5CZ0A 1H60A 3IIZA 4O12A 3L65A 4GUHA 1WQ5A 1Z44A 4AB4A 4S2CA 1A50A 5D38A 1LOSA 4I7WA 2CLLA 2VEMA 4M6QA 3NA8A 5CZSA 1W31A 3NZ1A 4UFHA 2DZXA 3RFAA 1FWNA 3W9ZA 4S1FA 1VPXA 2JKAA 5LNUA 3MUXA 4JY8A 2J24A 3W86A 2WPBA 2RDWA 3UY7A 2FB2A 4B5NA 3CEUA 3NQFA 2X30A 3G1SA 2EGZA 4JY9A 3LBMA 4HN4A 1ADOA 3Q58A 3EX1A 4JX6A 4FO4A 2CLOA 1PHWA 2CW6A 5HWNA 3W1PA 1W5MA 3P8JA 1GVQA 4IX0A 3LXAA 3MP3A 3NQDA 5FEXA 3DI1A 4WOQA 4JDBA 1CX9A 1OHLA 4DF2A 3DFNA 3NQ2A 3LM7A 4LUIA 3GNNA 2JK2A 1TPEA 3IV3A 4O17A 1X8FA 3MYOA 1FDYA 1Z48A 3IVTA 1A5SA 4WD0A 2NX1A 3GAKA 3ZR4A 3MI2A 4UFKA 1F05A 3MW7A 2Q3RA 1KFKA 1TPUA 2DZVA 4EOUA 5BRBA 1F2JA 4MYAA 3TJLA 1FXPA 2WNQA 1IXNA 3NQ6A 1T0OA 5KTLA 1HL2A 5F4XA 3RK8A 4A21A 4UTKA 5LKYA 1DVJA 3HG5A 3CIXA 1PIIA 3KVLA 2A5HA 3IRDA 2DZPA 3BG9A 4RCXA 3W1TA 1WOAA 5D2YA 1OK4A 1PCKA 2LLEA 3CT7A 1TPWA 1FQ0A 5HWJA 1OX4B 4LT9A 4FF7A 2CU0A 4KKXA 1NEYA 4GUFA 4DQWA 5G1TA 3VFLA 1VYSX 4O0KA 3FKRA 3BGGA 3I6RA 3PUOA 1QOQA 3W7IA 3P60A 2B7PA 2QUVA 4GWEA 2ZRXA 2VXNA 3GAYA 2FFCA 5L6UA 2YW4A 3TKFA 3PY2A 4M5PA 4Y96A 4Z1DA 4RZ4A 1G4SA 1LRNA 4QNWA 3C2EA 4IMDA 1WXJA 5EMUA 2ZQ0A 3G1VA 3W07A 2WJZA 1RQBA 5A5WA 4Y8FA 4JYEA 1KTNA 3TMLA 4E2BA 3MYPA 4EF8A 3T4CA 2JKPA 2E09A 1Y0EA 3L68A 4Y6GA 4WX2A 4NJIA 2QAFA 3GZ3A 2TSYA 3TIMA 3VKJA 1K7FA 2ZRUA 1JCJA 4O28A 2HS8A 5TQLA 1FCQA 2DJLA 2A0NA 4BK9A 2WOQA 5TBOA 3RF9A 1IGSA 3IIXA 3T7VA 4JTLA 1Q3NA 3G0UA 3DH7A 1EPXA 2C13A 5K2ZA 2CZFA 3W6YA 3TC6A 4K8HA 1I2OA 2DZUA 3HPSA 3EX2A 2E6YA 4PL1A 3EB2A 3G1HA 3QFEA 1TPB1 5HJLA 2Q3OA 5KZDA 5F1VA 3NPWA 3STEA 3DBPA 4LV9A 3FOKA 4MZYA 3HO8A 5EPDA 2CLEA 4CNNA 5H2ZA 4KFOA 2ATSA 2ZZ2A 4CQAA 4FXSA 5F2LA 3IGXA 1F73A 4JYDA 1BWKA 4JTHA 1OVDA 4GUJA 4CCEA 3NL2A 3UZ5A 1W1ZA 5HUPA 4BI6A 1QPOA 3H53A 1YPFA 2DZTA 3BW4A 4BF9A 1TRDA 1SW7A 1X1ZA 3PVFA 1ZAJA 3VE9A 5L9FA 1SZNA 3PSWA 2Y7FA 3G1FA 5EBUA 3P5ZA 3W7GA 2VFGA 3VE7A 1ONRA 2ALDA 4FNQA 1WYIA 1A53A 1ICSA 1R2SA 3CM4A 3STCA 1B4EA 3T78A 4ZQMA 2E77A 1EWDA 4JTIA 3CWNA 3CLMA 1YYAA 2QKFA 4PFMA 3S0CA 2RDUA 1YXDA 4Q33A 5CZTA 1LZOA 4M7SA 4O1CA 4HKPA 2ATMA 4RZ6A 3BLIA 2EKCA 3EXSA 3NPUA 2CLKA 4IPIA 3DXIA 3O07A 4WUIA 2QCFA 2Y63A 4R33A 1OYBA 2OMAA 1OF6A 4IXXA 1B9BA 1ZJIA 1VHCA 2PC4A 3L0GA 5EKYA 4ZMGA 5KZEA 1BWLA 1GTHA 2E5BA 3CEPA 1QOPA 3B03A 2NWSA 3LV6A 5D37A 3I7QA 4JTEA 3N3MA 1QFEA 4UTWC 4LOCA 5DN1A 3SZ8A 2QCDA 3P80A 4K36A 3UPBA 1B57A 3TQVA 2OCZA 2I9EA 1LRTA 1OX5A 4O50A 5EY5A 5FF7A 3QPZA 2NV1A 2CZ5A 4JTUA 2AAMA 4N6FA 3RU6A 1GYNA 3O06A 1LRQA 3W85A 4DELA 3W2LA 4WOZA 1SO5A 3W84A 3HG4A 1TPC1 3N14A 1YADA 3O63A 3GXNA 2R91A 1EUNA 4ZVJA 3P8IA 3THQA 3ATZA 3N2XA 3WK3A 3ZWTA 5FEZA 3DKLA 3H54A 4HNVA 1LORA 5FF0A 1EWEA 4AWUA 4LNYA 2TYSA 4DF1A 3PB0A 2YYTA 5CZJA 5DLCA 3G0SA 5AC7A 2BLEA 2OT0A 4JTTA 3AJXA 5TIMA 3HB9A 2VENA 1CI1A 5G4EA 2WSRA 2UV8G 1W5PA 3IIOA 4WY0F 4EVZA 3A21A 1DORA 4D2JA 3ABQA 2GJNA 2E6AA 2CWNA 4IXHA 4ZQNA 3S42A 6ALDA 1TTJA 2ZZ4A 3W2JA 3JS3A 3STFA 3LB0A 1JVNA 3TQ0A 3W2UA 3EWWA 3MJYA 5C54A 1KLZA 3EWZA 3IIVA 2PRHA 4OT7A 2V30A 3LXCA 4N6EA 2F84A 3T40A 1LLZA 3ANYA 3LRLA 4NNCA 1D3HA 2YPIA 1TPVA 1JQVA 1VJIA 2E5CA 4N9DA 1OG0A 4NJGA 3S1VA 1JQXA 4QAIA 3S8HA 5CPNA 4EWND 5KZMA 1A5AA 4JD4A 5KMYA 1DJNA 1KV8A 2V2HA 1YDNA 2VFEA 1TO3A 1R30A 1VYPX 3KXQA 3P84A 4UCGA 3W71A 2GVLA 1SO6A 2PRMA 1C8VA 2OJPA 3GYEA 3OBKA 4DPQA 2NXIA 3V75A 2WSYA 3LERA 2QJGA 3NPXA 4EF9A 2QF7A 3GR8A 3W7LA 5AHNA 1ZFJA 5DCBA 3D0CA 4XTIA 1J4EA 1LROA 1H7WA 1JR1A 4XQ6A 3LV5A 2B7NA 1O94A 4LTSA 3TC7A 3I65A 2NX3A 1K3UA 4LC8A 3TCEA 1RVGA 2J6XA 2Z6JA 2DP3A 1ML1A 1H50A 2A4AA 3NL6A 4GRSA 1XCFA 3M44A 1H63A 3K30A 4TMBA 1GVSA 3MWAA 5DXYA 3KRZA 1KW1A 1AW5A 1SZGA 4K8EA 4JNMA 4E0CA 4MIMA 4I9AA 1LM1A 4MFDA 1FWRA 3W7MA 1W0MA 4AHPA 3KVKA 2AQWA 2ZCGA 1D3GA 2C19A 4QNEA 1MO0A 5G2HA 5F2GA 3VCRA 1OK6A 2BX7A 3S5OA 2DZSA 3QPYA 4MY8A 1MEWA 1XUZA 1UCWA 3GKFA 3TX9A 1K02A 2F7FA 5J5DA 3S5YA 4J9JA 5D32A 3HG3A 3KOFA 4Z1BA 4NNAA 1XDLA 2HMCA 4H4IA 3G18A 3WK1A 1MXSA 3W72A 4UFJA 3SI9A 3GIYA 3GDKA 3OHIA 4LVBA 2ISSA 4YLWA 3EKZA 4NVTA 2P10A 4POCA 3ZS4A 2NX9A 5DY2A 3EXTA 5BMXA 4O15A 2VFFA 4RXFA 1ICPA 2CLIA 3UNDA 4UC5A 5HMSA 2GVGA 2C18A 1DKWA 1YDOA 2G95A 2HTMA 1VCVA 5LGZA 1XI3A 3NQVA 3HGSA 1FUYA 1F6KA 3PB2A 4RJEA 3KX6A 1O95A 4K7VA 3S1WA 4WZHA 4LVDA 3DFQA 2W0UA 2V9DA 1QR7A 4FHAA 1Z41A 3TV8A 3C6CA 4Z08A 3S5NA 2A2IA 4O53A 4JYFA 2C3ZA 1JCLA 7TIMA 2QAPA 4M7TA 3B0VC 3LLDA 1H1YA 2BZNA 3EEGA 3NQ8A 2AGKA 1W5NA 4X22A 3G22A 3QMSA 5LNRA 3TK7A 1VC4A 1KFBA 1KFEA 3ABSA 5D2VA 4OQVA 5C5YA 5D02A 3NGJA 4FXRA 3B4UA 1M6JA 1W3TA 5E1QA 1PS9A 2QJHA 4U28A 4ZQOA 3O8AA 5AHEA 3NG3A 3LCWA 2FPVA 2VEIA 3I68A 4MUZA 4X9SA 3W7PA 5F1UA 2ZZ5A 3W83A 1EIXA 2G96A 4IOTA 4JR5A 4PEKA 3SGUA 1H7PA 3KRUA 1UUOA 3TNOA 5DBUA 2O7QA 1GYLA 3MHUA 2XFWA 1DQWA 3R89A 1F76A 3BO9A 1VS1A 3NM1A 2YCEA 2YZRA 5G2WA 2ZTKA 4HIBA 2PRLA 2Y88A 4NJJA 3PWAA 3ABRA 2VFIA 3EX3A 3L2IA 3QQ1A 5G4WA 5LNWA 3M43A 4TMCA 5FESA 3UY8A 4LVFA 2FJKA 3W7RA 1ZAIA 1UBSA 2CLFA 1GVOA 2I14A 3W1NA 3W73A 3PSVA 2QCDB 2QDHA 3UYCA 3YPIA 3QSRA 4AXKA 1RPXA 2Y7DA 4WJEA 5CPMA 3BPWA 3NQCA 2JKEA 3RLUA 1UUMA 3S6DA 1N8FA 4ONVA 1KFLA 3TSMA 5HR7A 4MFEA 3TROA 4DBDA 5CGQA 5CG7A 3NO5A 4NNBA 1I2NA 5EYWA 1ME9A 1ZY9A 1NFBA 1K8XA 3CHVA 1RR2A 1VQTA 4MYXA 1CW2A 3FA5A 3INPA 5D2WA 1XBVA 1RD5A 1SZFA 4HNUA 2B0MA 3LOTA 1QAPA 2QCEA 3W75A 1MSSA 4ALDA 3CC1A 2ZA2A 5F2IA 1G7VA 1LBLA 2A6LA 2XN2A 3FFSA 4Q32A 3BGJA 1D9EA 1TV7A 5AYXA 2E1DA 1RV8A 5SWUA 5K9XA 1TJPA 1VYRA 1WV2A 1LOLA 3TFXA 4ZQPA 3FJ6A 2B7OA 1PVNA 3DGRA 5E0KA 3GXTA 4JX4A 3M5YA 1JCYA 1KA9F 1N7KA 4M19A 4S2BA 3C8FA 1FX6A 4GUGA 4O57A 4ORIA 1OYCA 3WJYA 3WK0A 1TV5A 4ADTA 3HIJA 3LHYA 3UWZA 1X6UA 1R2TA 1FWWA 4PTNA 2JBMA 5D2TA 3GDLA 1FCUA 3NR0A 3C0JA 1VHNA 1ZALA 5HNRA 3QQ0A 5LSMA 1FDJA 2WV8A 5ABTA 2OX1A 3N9RA 1QPRA 4GC4A 3Q2DA 1XM3A 1AW1A 2DORA 1EEPA 1I4NA 4UFLA 3JRKA 1OFRA 2WO5A 1VZWA 4TO8A 3W1LA 3W7DA 1MEIA 4RKAA 4M6VA 4O52A 2ZRYA 4LW7A 1UASA 3SY5A 2X2GA 4JEQA 3WK2A 1H7OA 3MBDA 3ZFHA 3LCGA 3GB6A 1M7OA 4DPPA 1VCFA 5HUOA 5HWMA 1OJXA 4GXMA 4QISA 2Y85A 3LHWA 4K37A 3C2VA 5I3KA 2VELA 2DZWA 4NXSA 3S5ZA 3TW7A 3RMJA 3SFKA 3M9YA 1QO5A 1JCNA 3PBYA 3W2NA 5FF2A 2PE4A 5IM51 3NQ7A 2TRSA 3ATYA 3W76A 3EXRA 5I3FA 2Z1BA 1A5CA 4MY9A 4P2VA 3LI0A 4O4WA 4O11A 1GG0A 4OWGA 1IXPA 4RR4A 3F4WA 5BNKA 4UTIA 4K6AA 2BSLA 3DFSA 1TB3A 3W7OA 4WXZA 2YX0A 4YXGA 1LLWA 4JICA 4O16A 2VEKA 1IIHA 1SSDA 3NQEA 3QW3A 2WQPA 1T99A 1DBTA 3NYZA 1YTEA 1TPFA 4KFNA 1TTIA 4K38A 4ZQRA 3WJXA 4DO6A 3BG3A 1DHPA 3G3MA 3E02A 3FIGA 3GR7A 1AMKA 3FKKA 1W5OA 5AN7A 5C2XA 3GDMA 1HO4A 1SPQA 3B8DA 1DQXA 2Y6ZA 4JTJA 3G8EA 3C2OA 1DOSA 1GQNA 2H8XA 1EUAA 3A9IA 4UFIA 4OV4A 2J9XA 1JULA 4H6KA 2O7SA 4TR9A 4A2SA 4U4MA 2DU2A 4CCCA 3TH6A 3NM3A 3ELFA 3M0ZA 4DF0A 3UXDA 1H7RA 1TYGA 4JTFA 2C15A 1QCWA 3SW6A 1B4KA 4IMEA 5D33A 2A6NA 1H51A 1W8SA 3GVGA 4AWSA 4FX7A 4RX0A 2JGYA 3WJWA 2E6FA 4C1LA 3UWUA 5H91A 1Z42A 2ABBA 3O1NA 2BXVA 4JTGA 3A23A 1OX6A 2X16A 3NZRA 5D04C 3PS7A 4ORMA 2QEZA 3P81A 3N2MA 2ZYFA 5I3IA 2VKZG 4YMZA 4BWLC 4CQ8A 2X1RA 3BLEA 3I7RA 4AF0B 3E96A 2Y61A 4YL2A 4RXGA 5BMWA 4JDYA 1QPQA 1R46A 1OFQA 1WA3A 1FWTA 3CWOX 3PAJA 3BLFA 1O4UA 4AHQA 2V2CA 5FI8A 3L5LA 1J2WA 3DAQA 1SSGA 3MO7A 1ZCOA 2V5BA 1C29A 3L21A 2GQ9A 5FF3A 4ML9A 3N73A 3HGRA 4TU1A 5LNVA 1ZNNA 3EWBX 4AH7A 2C1HA 2QCMA 2RHGA 1FY6A 4NU7A 1NSJA 2GVJA 2RKXA 2H90A 4UNKA 1MEHA 1SU5A 4NUWA 1VGAA 2Y70A 1YLVA 1TPH1 4E2DA 5LNSA 3TFCA 3SECA 1P4CA 3M47A 4X3ZA 2QUTA 3PBWA 5CSRA 4RV8A 4UTWA 4L4LA 4LVGA 1LDCA 3SIZA 1WAUA 1Q6LA 2DJXA 3HPZA 4P61A 3IGUA 3IGSA 5AC8A 4IPJA 2RFGA 1SW3A 4R34A 4Z0SA 1QO2A 5G5IA 3BARA 2P1FA 1YXYA 2R8WA 2RDTA 4OBTA 5DBTA 4O13A 1O5KA 2XN0A 4OU1A 1PV8A 2WSQA 2QDGA 3EX4A 4HSOA 4O8RA 2YYUA 2R94A 3B06A 1VRDA 4YCPA 1L6YA 1RQHA 1VH7A 3KHJA 2Q8ZA 3EWYA 1ICQA 3ZWSA 3FYOA 3LTYA 1H62A 3NOEA 1QPNA 1JRBA 5F2MA 2JGQA 3T55A 1GVRA 5G2IA 3NL5A 1S5TA 3W70A 3OIXA 3DFPA 4Z1AA 3RLVA 2NWRA 3F03K 3NEVA 4FNRA 3QW4B 3TAKA 3HF3A 3MP4A 3VNDA 1S5VA 1OFBA 2FIQA 1TIMA 3NNTA 4Y90A 4IMGA 1W56A 2Y7EA 3B0UX 4W9TA 1PL9A 5DY3A 3C4UA 1G6CA 3PUEA 2J27A 1L9WA 3LTSA 3HJZA 4N4QA 2ISWA 4ICNA 3O05A 1QWGA 4LS1A 1GG1A 3U8GA 3C56A 4IWWA 4N2YA 5CKSA 2W79A 3G1XA 2ZBTA 3KRSA 1P1XA 4NJKA 3F4NA 2BWGA 2Q8LA 3A24A 3W7KA 3W74A 1TSIA 5AHFA 4I7UA 1GOXA 2VEPA 4MOZA 1OFPA 1PE1A 3O6DA 4M6PA 1LOQA 3Q94A 3M41A 3LCIA 2A21A 5LZLA 2D73A 1KM1A 2YR1A 3E9AA 5DCEA 3W3OA 2QUUA 3PM6A 1KTBA 1YTKA 1RZMA 2R14A 2YFNA 3NPVA 2G5WA 4PA8A 5EL1A 4IMFA 3M1ZA 3NQMA 1SR9A 3UZJA 5D03A 1M7PA 1IIGA 2WNZA 2ZZ7A 4HNTA 3HGOA 4UTHA 1KV5A 4UTTC 4LUJA 5CSSA 5IBXC 2NUYA 5MHBA 4UTLA 2J9ZA 3P5YA 1OF8A 3SJ3A 2X1SA 4N9CA 4O1DA 4I7VA 4R53A 3T44A 1ME7A 1GWJA 1K03A 1F7BA 4R7JA 4ZZ9A 1I45A 3V1PA 3MHGA 3DENA 3QEZA 3B05A 3CB8A 3DFTA 1C9DA 1H7NA 3NQAA 3KAOA 1OABA 1GEQA 5I3JA 1H7XA 3NXFA 3G24A 2CLMA 2FB3A 3A5VA 1GZGA 4OGZA 5AYZA 3G1AA 3UWYA 3DI0A 2QCLA 3L66A 1I2QA 4NT0A 3TSDA 4GUIA 3HBLA 2XN1A 4KFPA 2YDAA 3UWQA 1G4TA 4Q4KA 4A3UA 3TQKA 4XTDA 5I3HA 2NLIA 1EP2A 1KM0A 1ZENA 4FIRA 3SSJA 1OFAA 1A5BA 3UWVA 4IMCA 4GE8A 4NXKA 3L0KA 1F6PA 2CZDA 3LHTA 5HR6A 5LGXA 3W7CA 4UNLA 4RK8A 3PBUA 4CNOA 1AL7A 4XUGA 1G7UA 3N9SA 2TPSA 3BW2A 1BEUA 1OFEA 2QCHA 4PL2A 2Y89A 4AEOA 2E5DA 4Z1CA 3WJSA 2OT1A 3E0IA 4PCFA 2C16A 3U2OA 1VR6A 2ZRWA 3LRMA 1W37A 1IF2A 2G97A 3G1YA 2PURA 3OEXA 4JN6A 1BTMA 4KWVA 1GJPA 4XBKA 1X7FA 4GBUA 1OX4A 6TIMA 3W1MA 5EA9A 1F74A 1XKYA 4HNNA 3QM3A 4UTTA 3M5XA 5K3VA 4LWWA 4OV9A 5K4ZA 1BKSA 3S1UA 3O15A 3C61A 1R47A 2TMDA 4XKYB 3DU0A 4GNJA 3M5VA 4AHOA 2FPYA 4GFSA 2A85A 1Q6RA 1SUXA 3Q37A 1KM4A 3DFOA 2I1OA 5FEPA 3C52A 3N19B 4FNUA 1KM6A 4HPXA 5K9CA 1UB3A 4DXVA 1SFLA 2EHHA 1QDSA 3GXPA 3M6YA 5J5RA 1V7YA 1K7XA 4JGDA 1Q6OA 1O5XA 1TMHA 5KINA 3TA6A 2QJIA 3N34A 2V2DA 4L4MA 3W1RA 3C3NA 3TJXA 4WQ6A 1TV8A 4JX5A 3P74A 3ABOA 4MKNA 3C2FA 3M5ZA 4AAJA 2B7QA 2FTPA 4LV4A 4HSNA 5I3GA 3MP5A 2YGYA 3A5FA 3O16A 1NF7A 4DO4A 1EP1A 2W6RA 2E6DA 2V0TA 1TPDA 3CIWA 3NL3A 1I2PA 3IVUA 4FIQA 5AHIA 2B4GA 4BFAA 2Z6IA 4CQ9A 1V5XA 3OVQA 3QC3A 5LHEA 1XBYA 5A8GA 3TW6A 3LHUA 5U7SA 3TDFA 2J9YA 5F4SA 3GLCA 1SO3A 4A2RA 4DBEA 1K7EA 1W54A 1DJQA 2KZHA 4FNSA 4LS2A 4A22A 1L6SA 5C6MA 4JXCA 4LRTA 5BW6A 1W5QA 3G3DA 1ME8A 2HSAA 2V8ZA 1X1OA 4MJMA 4YWIA 1XDMA 1TTQA 1L2UA 1LBMA 3HOJA 1TCDA 4H3DA 1OYAA 4AVFA 2FDSA 4AWTA 4O1AA 3QYQA 1E51A 1AK5A 5D05A 4WY0B 2ZRVA 3LCFA 2NXGA 1MZHA 4O14A 3PG8A 4BI5A 4QIUA 1KBIA 1SZEA 1TRIA 4OHQA 3LRKA 1B3OA 3MHFA 3O6CA 3LTPA 2ABAA 1AG1O 1EP3A 2YFOA 2ZZ6A 3P62A 4O1BA 1AL8A 2ZA3A 4KWWA 3P7YA 3NQGA 4UTJA 2NXHA 4WY0A 1SW0A 2V82A 2NUWA 1QNVA 4BR1A 3EX6A 1PHQA 1AW2A 4FX6M 3RNDA 1XXXA 2A7PA 4XZ9A 1XFBA 1W3IA 2P0OA 3WJZA 1KM2A 5D30A 2NV2A 1JUKA 4OE7A 4LS0A 3OA3A 1LCOA 4UTUA 2GQ8A 2ZRZA 1YXCA 1H5YA 3CPRA 2ZDRA 3PBVA 2CFFA 3LI1A 4FB7A 4QQ3A 4UUIA 3UWWA 1RQEA 3HPXA 1VCGA 1XBZA 1N55A 5BOOA 3R2GA 1IXOA 1P5BA 4UTMA 3WFAA 4ADUA 3LBCA 5KITA 4XWUA 4CLMA 4N4PA 3LCLA 4UR8A 1OFDA 1SO4A 5D2XA 1KM5A 4RLIA 2QCNA 1WX0A 1DL3A 1XC4A 3HQ1A 3W1AA 4BI7A 4NJHA 3QH2A 4PH6A 1UJPA 3W7JA 3UPWA 3GK0A 3W23A 1LTDA 4O4VA 2H3DA 2NZLA 2GQAA 4UR7A 1YDVA 1KFJA 2GJLA 3UD6A 4AMAA 5HINA 4FNTA 1JCXA 3R12A 1XL9A 3JR2A 3S9YA 3W2MA 1SQ7A 2A1YA 2Y62A 2EF9A 1EA0A 1Q6QA 3QJAA 3U6WA 3NDOA 4EIVA 1GT8A 1L6WA 3R13A 4WXYA 4QSHA 2RH9A 4NX0A 1LBFA 3NAVA 3LLFA 4O10A 4O54A 3P82A 2ZA1A 1FDZA 1PCWA 1GPWA 4XKYA 3TXVA 1KLYA 3MBFA 3H55A 3QRHA 3OVRA 3GX9A 2A7NA 3LCXA 1YTDA 2QR6A 2ZTJA 4IQLA 4O19A 2EAWA 5AOUA 3STGA 1EX5A 1FCVA 1F5ZA 2C6QA 4MPQA 2WKJA 4ZQCA 1JCMP 3EWUA 4UMCA 2ISVA 3BK0A 3OVPA 3GNDA 2CZEA 3UQNA 1TQXA 3LXBA 4IGHA 2EPHA 1JUEA 3CTLA 1TJRA 1HTIA 2C0AA 3L9CA 1U5JA 4IX2A 2ZFAA 1J5TA 3G8RA 1U83A 3OG3A 4MVAA 2GPTA 1K8ZA 3G0XA 3E49A 3LX9A 2H6RA 1JJKA 1S3HA 3LHVA 4MLJA 1KBJA 3W7HA 4ZL1A 1I2RA 4JS3A 2HS6A 2FPTA 1G4PA 3B0PA 1FWSA 1WBHA 5KSWA 1GTEA 4XBSA 4MY1A 3TAOA 1FBAA 1H1ZA 5FEWA 1T8XA 3KVMA 1HG3A 5K7JA 3I7SA 2PCQA 3SGZA 3CQ0A 4UMBA 3LGEA 1WBJA 4IUOA 4UMAA 4G1KA 3W87A 2BTMA 4LC6A 2OZ0A 2QCGA 2ZZ3A 3QSTA 4NZFA 1R2RA 3DZ1A 4JTSA 3IEBA 3FYPA 1KTCA 3SR7A 1OFOA 3W7QA 2H8ZA 1TTPA 4MZ1A 3THAA 4YCOA 2Z2UA 3PUDA 2J88A 3G1DA 4MJZA 1JRCA 4K7YA 1NAL1 3EWXA 3PG9A 2E68A 4HPJA 3BV4A 1QMLA 2VC6A 5DCDA 1P0NA 3M16A 1I8JA 2FQIA 3P61A 4TX9A 3L5MA 5K9DA 4Z0JA 1NF0A 3QMTA 2IQTA 4JIQA 4E38A 1VLWA 3L0NA 3TR2A 3AO0A 3PULA
chains in the Genus database with same CATH superfamily
3DG7A 3MI3A 1IWBA 3TSBA 3S47A 1P0KA 3R7MA 3TUUA 3CV2A 1ZB5A 1DXFA 4NX5A 4OFCA 4NI3A 3LHZA 1KM3A 2QNEA 3R4IA 3EDKA 4OJYA 4QR6A 4C1KA 1R3TA 1PKNA 3CPUA 1UH2A 2IXUA 4BQ2A 2QCCA 1TZ7A 1IZCA 1K8YA 2I5QA 4LVAA 5LHFA 3L4XA 2NUXA 4B4FA 1HUVA 4REQA 5HA7A 3VNZA 3R58A 2C14A 2WMKA 2UZ9A 3WD3A 3TMQA 1IEXA 5DRIA 2QF8A 3LCHA 3LPPA 3E12A 2XGIA 4H6EA 2ACRA 2PDQA 2VFDA 3EMCA 3F1QA 1REQB 4FNPA 3LSBA 2X1UA 3PTKA 1TE1A 3W82A 4E8DA 5CC6A 1SFSA 1TREA 4Y9AA 3R6IA 2WNNA 4HMDA 1OC6A 1V93A 2GUYA 3UXAA 1ZUAX 3FDKA 3KCJA 5FF4A 3QMRA 3SQMA 3OGSA 2GOUA 4OOUA 4DNMA 1PB0A 4PB5A 4UIOA 3W88A 1VIZA 1RCXB 4L4OA 1QNPA 5DQPA 1V7AA 3QQWA 3UGRA 4O18A 3CU2A 1FHUA 1YPIA 1UWAA 1SFJA 1JI2A 3B04A 5MKGB 4LQ1A 3A22A 5JBFA 3MUIA 1FH9A 1CDGA 3MT1A 3USBA 4KCUA 2XGBA 4N02A 1TWIA 3WMLA 1K4HA 3RCYA 5AB3A 1G4EA 2ZE0A 9RUBA 2PPGA 2VFHA 2QLYA 1THFD 4G1NA 3GFXA 4NRRA 3L4WA 3VZXA 4MZ8A 3GH5A 4E4UA 1MQRA 1I9CB 2W5FA 2Q02A 1Q45A 4C6IA 3SSZA 4E6MA 3TW9A 3W22A 2Z1WA 5CEWA 1LYXA 4WSHA 2Z2AA 3DKJA 2YW3A 4Y9MA 5CPLA 5T26A 5AHLA 3FJLA 3GG1A 3RR1A 4O0ZA 1XCWA 3GDTA 3B9NA 1OT1A 4LY8A 4NZJA 4FEZA 3PR2A 5HPCA 5CZ0A 4DJEC 3IIZA 4GUHA 4ATWA 3TP4A 1A50A 4W7VA 1LOSA 2CLLA 4UFHA 1FWNA 2GLKA 4Q8UA 5LNUA 3KBSA 4ENLA 1FFQA 2FB2A 2HJPA 1FOBA 3RXZA 1BQGA 4JY9A 1J0HA 1PHWA 3WMBA 2CW6A 3PJXA 5HWNA 3W1PA 3WQFA 2WK2A 3P8JA 3W28A 1P6WA 1XLHA 2E0PA 1BPLB 3MP3A 5GQBA 3DI1A 1T40A 1W32A 1V3KA 1X8FA 1FDYA 1NDZA 3GAKA 2DSUA 3GTFA 3BAYA 1F05A 4B3ZA 2FKPA 2BASA 1KFKA 1TPUA 4CNTA 2DZVA 3AIEA 4QG9A 3MV11 1F2JA 4FR1A 2Q01A 3TJLA 5BRBA 4W5ZA 3EWCA 4QTGA 2WNQA 2PDWA 1QHPA 5F4XA 2WW5A 4A21A 4UTKA 3CIXA 4LX4A 2DZPA 2E9MA 4IH3A 2EQDA 3VX1A 3VMNA 1PCKA 1FQ0A 5HWJA 5ECVA 4GUFA 5CXPA 5AVNA 1B3YA 3RM4A 1Y5VA 4O0KA 2JIEA 4GPNA 3WF4A 4S3AA 1NP0A 2YIHA 5EFFA 3W7IA 1UMLA 1NARA 1W8GA 3LY0A 3M0KA 2VUNA 3NIYA 4M5PA 3W01A 3MUY1 3V35A 3WDRA 4QNWA 3SCQA 5EMUA 3WLSA 4H1ZA 2VTFA 4Y8FA 3WEZA 1EF3A 1KTNA 3QV7A 3MYPA 3T4CA 2JKPA 2BY3A 4ZEPA 5ABFA 2DT2A 3ZVHA 3QR0A 3FDGA 3GTIA 3VIMA 2ZRUA 3B40A 4O28A 1A47A 1FCQA 3GZAA 1HIZA 1TELA 3RF9A 1IGSA 3NEHA 4JTLA 6A3HA 4XAYA 1RSCA 1EPXA 4LUTA 4ZOCA 3V7PA 3RLGA 2VYOA 4B3LA 3EKGA 4AZIA 4EAYA 4O8AA 5HJLA 2QGYA 5KZDA 2YOCA 4UOZA 3DBPA 1TG7A 4MWAE 3AQUA 3HO8A 5EPDA 4CNNA 1B54A 4IPNB 4KFOA 4BZYA 2FGBA 1RHCA 1YRRA 5F2LA 1F73A 3V16A 1DWJM 2I56A 2WYSA 4NAEA 2CITA 4WCJA 2OQHA 3UZ5A 2WPGA 4J4KA 4BF9A 3BSGA 1TRDA 4I9MA 3NDYA 3A9BA 2GWGA 2DY3A 1QBBA 3MPGA 1XLMA 1ZAJA 5L9FA 3W26A 3CV7A 2D1ZA 1VFSA 3G1FA 3P5ZA 2V69A 2J7EA 1S1RA 1ONRA 2ALDA 2J7FA 5I2UA 1ZP3A 4DJEA 3AROA 4IP5A 2WNWA 3ZLGA 1KWKA 3STCA 3HURA 4G8TA 1B4EA 4FPSA 3T78A 1P1MA 1R85A 4QEHA 3CLMA 4NKCA 4CCZA 3UP8A 3S0CA 3PPHA 3M0VA 4P7RA 3GVRA 2E1WA 4V2XA 4RZ6A 2EKCA 3EXSA 3NPUA 1EGVA 3SFWA 3ZVHB 2C0HA 3DFHA 1B9BA 4LAKA 4DJDD 2X1IA 4AYSA 3L0GA 5EKYA 4ZMGA 1FHLA 5HMDA 2IPWA 1QOPA 3V36A 2NWSA 1ITUA 3LV6A 2WKGA 2XH7A 4WEVX 3SCSA 4XZLX 3H4XA 1RCQA 3SZ8A 2FMOA 3EPOA 4ZXLA 3L2LA 4JOMA 2OCZA 4O50A 1E1CA 2NV1A 2CZ5A 2GL5A 3TOPA 3C8NA 1UC4A 3RU6A 1DJIA 1XG4A 3O06A 3AXIA 1SO5A 1JZ8A 1TPC1 4NI8A 4DXXA 5IFTA 2D2OA 3BDKA 2QPUA 4FOJA 4HNVA 1RUSA 4DWSD 1S5MA 2ZKMX 3G0SA 4JFUA 3FVMA 2VENA 4QJ3B 4NRSA 2UV8G 5E0FA 4TOQA 4D2JA 2GJNA 5C8BB 3MB9A 3H2FA 3GG0A 2PDMA 1LUCB 3PPCA 3WBAA 4F3HA 2OX4A 2E8YA 3W2JA 2VR4A 4S38A 4MTVA 3VNJA 3MJYA 3BL3A 5C54A 3ZXWA 3H2CA 5DMLA 4B5SA 2W9MA 2V30A 4DJDA 4C65A 4QLKA 2CETA 4HZ8A 3VD5A 1VJIA 1OG0A 4GVIA 4NJGA 1OSEA 4QHRA 3S8HA 5CPNA 1NM9A 1FWIC 1A5AA 4DUWA 2V2HA 1TO3A 3GU2A 1GVYA 4B92A 3W71A 3HQPA 1OWQA 3VNIA 3OBKA 5EGRA 2WSYA 5CBJA 2QV4A 3UG8A 3NPXA 3ZT7A 1JZ6A 4YIWA 4KIRA 3WQOA 1JZ2A 3U7BA 4PB4A 2RUSA 1JR1A 4GYPC 1LQ2A 1O94A 5CLWA 2XIBA 3I65A 1AH4A 4ZE5A 3LA4A 5CSYA 1PIGA 4S3BA 4HA3A 2ZX5A 3K8KA 3VINA 4WGHA 1H50A 2A4AA 4GRSA 3UG5A 3VOGA 1OD8A 3M44A 3PTQA 2EKGA 3UU0A 1KW1A 5CPQA 1C91A 1VJSA 2DQXA 5G4HC 3W7MA 1US0A 4HNCA 4OOZA 1E9YB 4QNEA 3LZ3A 4EXQA 1OK6A 2BX7A 2XIQA 3L7RA 4FR6A 3R11A 1Z8AA 3UF9A 4FLRA 1UA7A 4Z2IA 3QPYA 4HGXA 1J0ZA 3I4EA 4HU4A 4Z1BA 4NNAA 4LANA 2ZIDA 3W72A 3I6EA 3GDKA 4L1XA 3JUGA 5D4YA 4NVTA 3NXLA 4JFWA 3GNXA 4UNIA 7REQB 1HKKA 4DJFC 2CLIA 3VDAA 3KCOA 4HHLA 4M3PA 2C18A 1XD1A 1XSIA 2G95A 2WBKA 3AMDA 3MCMA 3AMGA 1O5QA 1O5RA 1O95A 1S2TA 4LVDA 2W0UA 4FHAA 4US5D 4Z08A 3S5NA 4A8LA 4IQDA 2A2IA 4KT2A 4DLMA 4ZB5A 4I5RA 4C6OA 3RPTA 3AS2A 1R3YA 2DZAA 1Q13A 1ZLPA 3CQIA 2AGKA 1W5NA 5E9XA 1VC4A 3VOCA 3B8VA 1KFEA 1D7FA 3VD3A 3UA4A 4N0RA 1XYLA 1M6JA 1W3TA 5E1QA 4ZOAA 1WPCA 3CB3A 4OTKA 2Z28A 2DVTA 3ABZA 5IHSA 4MUZA 1XGEA 1ITXA 3VIIA 5D9NA 1EIXA 4IOTA 3CUFA 1TVNA 2EG6A 4DBUA 2G3MA 3MHUA 3CL8A 4DAIA 3BO9A 3NM1A 1CLXA 3VDCA 1MQPA 2ZTKA 4M29A 3ABRA 4C6JA 3KLLA 3Q45A 3QTGA 2PEVA 3CHDA 3PSVA 2NV9A 3UZZA 2VX4A 1KBBA 4AXKA 1RPXA 5MKGA 4WJEA 2PBOA 1BG9A 3BQ6A 1UUMA 1J5SA 1XYAA 4JEJA 3FX4A 2G3FA 3OOQA 3TROA 1WB0A 5A2AA 3ZJ6A 1HXJA 1IWPA 1JI1A 4QDWA 1I2NA 1ME9A 4JZ5A 3E2QA 1NFBA 3DERA 2XDFA 3FA5A 3INPA 1XBVA 4J3WA 4HNUA 3JZUA 3W75A 1MSSA 1IR2A 1NELA 2GSEA 5F2IA 3H6OA 3AAMA 2BVYA 3WQPA 4Q32A 3BGJA 1D9EA 3ZSSA 1QK2A 1D8CA 2GGEA 4UQAA 5SWUA 4M24A 3B0YA 3N4EA 1VYRA 1C8XA 3M07A 3H2OA 1PVNA 3DGRA 3S6TA 5B80A 4B16A 4HTYA 3A4AA 4LCSA 4S2BA 1J6PA 3WK0A 4L65A 3HIJA 3UWZA 1TWZA 1FWWA 3N17A 3GDLA 5HNRA 4GABA 4ROPA 3T2OA 1QPRA 2QPSA 1XM3A 2C71A 2ZUNA 3JRKA 4IJRA 1OFRA 1AQMA 3SGGA 4TO8A 4ZB2A 3MZNA 1OQFA 3W7DA 4QCFA 3WCZA 3WBXA 4M80A 4M6VA 3T0AA 4K1GA 2Z00A 2X40A 3SY5A 3WK2A 1VFMA 3LCGA 3GB6A 4PUEA 4GXMA 2KX9A 3LHWA 1A5MC 2VI0A 1KKOA 5HXMA 4NXSA 5EMLA 5M3WA 3TW7A 4Y9OA 1QO5A 4G56A 3AIBA 2A3CA 1GQJA 3GYCA 2G41A 3BAWA 2V3DA 1P6BA 3LI0A 4FI4A 1QHZA 2F6XA 1MQQA 4O11A 2OZTA 2GDVA 2VDIA 4ZO9A 4RR4A 3NURA 4WKAA 2RDXA 1EHNA 3CUZA 4UTIA 2YX0A 2XGZA 4XUYA 4O16A 3QW3A 1YTEA 2HCVA 2IKIA 3U7VA 4HOXA 3N6JA 3C5QA 2HQAA 3G3MA 1TMLA 3E02A 3FIGA 3EA2A 2DSVA 2PWEA 1U1HA 4IGMA 4ZSTA 1B3ZA 1SPQA 1LWIA 1DQXA 2GZXA 4JTJA 1GQNA 3FHAA 1PBGA 4EPDC 1JULA 4J3UA 1XINA 4H6KA 4TR9A 1DTNA 4M56A 4A2SA 2DU2A 3WD0A 3NM3A 4DF0A 3WYZA 1JFXA 4GXPA 4JTFA 1B4KA 3EZ4A 4D1JA 1H51A 3ARUA 4PSRA 4AWSA 4JL1A 2JGYA 1UD6A 1UWUA 5H91A 2ABBA 4PBEA 2BXVA 1KXVA 4HK5A 3MSRA 2Z1XA 2JIWA 1EJRC 1GOMA 2X16A 4ORMA 1RALA 2ZYFA 5M1TA 4HZ7A 5I3IA 4Q4QA 4CQ8A 3V0SA 1PUDA 4AF0B 3E96A 3KW3A 3RITA 4YL2A 4QGCA 4JDYA 1R46A 3S2JA 3VIJA 1OFQA 3CH9A 2QPXA 1WA3A 4I3GA 3GC5A 4I90A 3PAJA 5A6BA 3BLFA 4AHQA 1KCXA 2V2CA 5FI8A 1A0EA 1WP6A 3DAQA 4FXFA 1SSGA 7PTDA 2ZWZA 3T2QA 3WNMA 4GKLA 3L21A 4D6IA 3ZOAA 4YHEA 2ZUMA 3CS2A 1ZNNA 2R1PA 4Q8NA 4AH7A 1FY6A 1NSJA 2GVJA 3P2VA 2H90A 4YJ5A 2YXXA 1P43A 4NUWA 1VGAA 2VX7A 2Y70A 4KEMA 1KCLA 3QY7A 4EPEC 3SO7A 2E4TA 4X3ZA 3PBWA 2OYMA 4LJ3A 4DYEA 1SYTA 1LL4A 1IEVA 4JPGA 2Z25A 4L64A 1NWRA 1Q6LA 3QHNA 4P61A 3R10A 4AD4A 1K77A 3IGSA 2P76A 1GQIA 3E1F1 2WSKA 5H8MA 4Z0SA 3CXOA 2P1FA 2R8WA 5DBTA 2IXVA 2OGYA 4YN5A 1JXKA 2QDGA 3HTWA 3AYVA 3QHMA 1ICQA 2XPKA 1H62A 5FJPA 4S3KA 1JRBA 4EPKA 5CC5A 3EEZA 3K2GA 3T55A 1JGMA 3A6OA 4GYPA 3W70A 1YBQA 2ZWYA 3OIXA 3WSUA 1DJXA 4P7QA 4MADA 3TAKA 3HF3A 3MP4A 1KXHA 3PJUA 4KRZA 3NNTA 4IMGA 4LUYA 4W9TA 1PL9A 3PUEA 1A3WA 2J27A 2PZ0A 3TN4A 2OWWA 1FVPA 1PX3A 4N4QA 4LS1A 5H1WA 4HNOA 5LXEA 4IWWA 4N2YA 2W79A 4XD4A 4J2MA 2GGHA 1P1XA 4NJKA 2Q8LA 3A24A 4F9JA 3WDIA 1TSIA 4L5ZA 5CBBA 3OW1A 4I7UA 1BF6A 4Y7EA 3RX3A 5HBFA 4JHMA 5I5RA 1OFPA 2WVSA 3LCIA 2Y8KA 4H7CA 1KM1A 2YR1A 4Z2KA 2CBJA 2QUUA 3L4ZA 3W3OA 1YTKA 2YFNA 3S2NA 3NPVA 2ZX8A 2G5WA 5EL1A 1M9HA 3M1ZA 1SR9A 2A79A 3UR5A 3A3WA 1DIKA 4BS0A 1UZHA 2OLAA 5D9OA 3OJGA 1CLVA 4MF4A 3UR8A 6REQA 5I77A 4RUBA 4UTHA 1KV5A 5IBXC 1OCJA 1XQLA 5MHBA 4XB3A 4MAVA 2J9ZA 1G1YA 1Q5MA 3LNMA 1X97A 1E5NA 3MSGA 2A3EA 4N9CA 3UNTA 4I7VA 4R53A 1GWJA 4W86A 4R7JA 2Y1HA 2WJDA 3V1PA 1XW8A 4Q3MA 3WF1A 1C9DA 1H7NA 3WG6A 3NQAA 3UZYA 1OABA 5I3JA 4S3JA 3NFUA 4L1GA 2H9AB 4MMWA 1S2WA 4O1EA 4RZBA 1GZGA 3GIQA 3L66A 4NT0A 5EFDA 2RJGA 1XQKA 3WLJA 3GBEA 2O9PA 4H9TA 1G4TA 1UQYA 2Z1VA 4A3UA 3ARZA 4XTDA 1XYMA 5I3HA 3WEOA 3MUAA 1A5BA 1XIMA 3VUPA 4RW3A 3EOSA 5A3HA 2CZDA 3K4DA 5LGXA 4JKLA 3E74A 2WLYA 4NHVA 3VABA 2J78A 1XS2A 3V4BA 3RO8A 3LD5A 3BLPX 2QCHA 3OB8A 2E5DA 4Z1CA 2BS9A 4WDWA 3E0IA 4PCFA 4X61A 3LRMA 4NL1A 2PS2A 1UPPA 4KWVA 1GJPA 5KEZA 2PWDA 4GBUA 3QGVA 4AVOA 2OFJA 1YDYA 3VGGA 4DLFA 4C6CA 4RL3A 4W89A 1Q6CA 4PMVA 2I5IA 3QM3A 3M5XA 5K3VA 1G5AA 4LWWA 5I24A 1GW9A 3S1UA 4L4PA 3OZMA 2O4QA 4GFSA 5HQLA 1XRSA 1Q6RA 3R1ZA 2A3LA 1CXIA 1U22A 3UPMA 2YLLA 5K9CA 5HQMA 4TQTA 4GH1A 2ONEA 2EHHA 1QDSA 1UP0A 5J5RA 4KETA 2VEGA 1K7XA 4XD6A 3MKCA 2V2DA 4C6PA 4L4MA 2F2HA 4JX5A 1MRQA 2VX6A 4IGSA 4KPLA 4HYRA 3M5ZA 2FTPA 1AJZA 2WHJA 3GUWA 4PMNA 4EE9A 5BOEA 1XLDA 3MP5A 3GG7A 2J8GA 1OB0A 4MNJA 1SMDA 4DO4A 1EP1A 3EB3A 3KBMA 1TPDA 5A69A 1I2PA 4AZGA 2DQWA 5AHIA 1GJWA 2B4GA 4BFAA 3DYOA 4HOZA 3OVQA 3RN6A 1XBYA 3GM8A 1OC7A 5U7SA 3VNYA 2CXGA 3RR4A 3GLCA 3VKDA 1UD2A 3M4HA 5AZ1A 4DBEA 1K7EA 1E1EA 2BOFX 4LUSB 1R9XA 4H2CA 3TJIA 3VDBA 4FNSA 1L6SA 3ZM8A 1P48A 1LWHA 3ONCA 5BW6A 1W5QA 1ME8A 1AODA 7CGTA 4YWIA 3VD7A 1BRLA 1TTQA 1L2UA 4UTFA 4H3DA 1TCDA 1OYAA 2FDSA 4AWTA 4O1AA 1OZMA 3FY1A 3CBWA 3QYQA 1AK5A 2V5CA 4R27A 3IARA 2NXGA 1MZHA 4O14A 1H0GA 4BI5A 2MANA 4I8DA 4QIUA 1KBIA 4IQEA 1HKMA 3B8SA 1E6RA 1DP0A 3RG6A 3LPFA 1RK6A 3RU8X 2PWVA 2XVNA 2YFOA 3P62A 4XIAA 2PI6A 1AL8A 1R7AA 4F0SA 2BVWA 4UTJA 2NXHA 4XX6A 2R9RA 1TCMA 3I4KA 3WQ4A 4QS6A 5JVLA 4PUMA 3MKVA 2YKKA 2WVVB 3AU2A 1E43A 1DWIM 3TWBA 1FTXA 3QZAA 2ZRZA 1YXCA 4XO7A 1DWGM 2ZDRA 3B9AA 3FJ4A 1CB2A 1V3IA 4GD0A 1JDDA 4IG2B 4UUIA 3HPXA 1VCGA 1Q2RA 3BJTA 4GBDA 4H8NA 2BDQA 3DYPA 5BOOA 1IXOA 4KEUA 1P5BA 4EANA 4HSHA 5EMJA 4LYKA 2X05A 5D2XA 1KM5A 2QCNA 2DW7A 1DL3A 4U3AA 4BI7A 4XO6A 2GK1A 3QH2A 4PH6A 3I10A 4WR3A 2POTA 3G6LA 1KFJA 1BD0A 3CMJA 3R0KA 3B3DA 1NTHA 1SQ7A 1CEOA 2INFA 4HPGA 2EF9A 3AUOA 4PMYA 3IJLA 3GW3A 3S2LA 4ROQA 3POCA 1GEHA 4C1NB 1Z89A 2ZUWA 2ZXQA 4JTQA 4O10A 4O54A 3TTQA 1C3FA 2ZA1A 1NOUA 1FDZA 4WJ8A 3TXVA 1KLYA 1FWHC 3H55A 5REQA 1WZAA 3GX9A 2DVXA 2WQDA 3MU7A 4FOKA 4YNGA 1YTDA 4CD7A 4R88A 5HAOA 4GQQA 2FZBA 1H09A 4OUEA 3UZXA 1B5TA 3UQNA 3LXBA 3VOIA 3QPEA 3WQEA 1W9PA 3ZR6A 3PZVA 4IX2A 1J5TA 1OCQA 3OG3A 1U83A 1U30A 2GPTA 3N2CA 4RNHA 4QROA 3E49A 4Z42C 3ES8A 1JJKA 3PNUA 3MV01 4WIWA 3ITOA 3W7HA 4A3QA 3GTXA 3LG3A 2HS6A 1RPKA 3B0PA 9XIAA 4IP4A 1IV8A 3CTTA 1GTEA 2QDEA 4XBSA 2FGZA 4MY1A 5FEWA 1T8XA 3KVMA 4JIRA 3I7SA 3QBUA 1XV8A 2WC3A 4UMBA 3LGEA 4N7QA 4AC1X 1C90A 1WBJA 1AA1B 3W87A 3WFLA 4AY7A 3PWIA 4MAZA 4CEUC 3FK4A 4TTGA 3NGFA 4Q6JA 3HV8A 3SAZA 6ENLA 4P8UA 3QSTA 4NZFA 4JTSA 1KTCA 1Z69A 3UJ2A 4MZ1A 3THAA 3T8LA 1KKRA 1A5NC 3PUDA 4L6OA 4PEEA 1ZGDA 3HU7A 5CH9A 2X42A 3IPWA 1OCNA 4K7YA 3NZGA 2WBGA 3C86A 4HPJA 1Q6GA 1OBAA 2E9BA 5DCDA 1DPMA 3BXWA 1F9CA 1I1WA 2AAAA 1I8JA 4Q8MA 3Q65A 4LXFA 2FQIA 3P61A 2QUNA 2G8ZA 2WMHA 1XIGA 3FA4A 3QMTA 3PP7A 1TUFA 1VBUA 2DUAA 3L0NA 3TR2A 3R5EA 3AALA 1J93A 4AWEA 2EEXA 3BW3A 4GQ0A 1EJ7L 4AZ6A 4E2OA 4F0RA 2P53A 4HCDA 4AG0A 4YTRA 1S5WA 4ZBCA 1WOBA 3VNLA 2AL1A 2YDRA 1T96A 2PCEA 1R0MA 1OCBA 4MB5A 1V51A 4RW5A 3HMJG 4HHPA 2VD8A 1R3QA 4YS1A 3K5XA 4PSPA 1OM0A 1P7TB 4LRSA 1GYMA 1JNDA 3GDRA 4H7ZA 4TXEA 2BHZA 4CNPA 3GBDA 4A29A 4DEFA 2VUYA 1M5WA 4G7EA 3VI2A 5AFDA 1RA0A 4PC8A 2YBUA 1VRXA 4NQ1A 2J66A 4N9EA 1O66A 1NVMA 4HMEA 3A4WA 3NVTA 3S83A 2EXOA 3M46A 2V63A 3E2RA 4FXJA 2AOSA 5DELA 4LU0A 5A8MA 2PTYA 5CPOA 2DH2A 3L67A 4D8AA 5J8LA 1KRAC 3GKAA 4HB7A 1NWUA 2BHYA 3E0FA 4AXNA 1KC7A 3W2KA 3GTNA 4UWMA 1RD6A 3LDVA 1KGWA 4ZA0A 3W1QA 5HQEA 1KCKA 1W9XA 3W7NA 1ZHAA 5IXEA 1W1YA 3S9IA 3TYZA 4GH3A 3WQVA 5DT7A 4WDUA 2D2JA 3CMGA 4A3RA 5FKYA 3S6OA 3GVWA 1MMFA 2BFGA 3FLUA 3N4FA 4W7UA 2CLHA 3UZWA 5E9AA 4GIYA 3BANA 4IIBA 2QJMA 3BAXA 4C6NA 3ZQ9A 3QF0A 4UFMA 5FJIA 4W88A 3AZTA 4H19A 4GQGA 1I1XA 5DEZA 3VAVA 4PUWA 5H8UA 8XIAA 4M6UA 1MFVA 1TJ1A 3ID7A 4MLRA 1AD1A 2EO7A 1WDWA 4Q22A 4AFYA 4IL0A 1H5VA 3VFCA 1H60A 3OQ8A 4O12A 4PMUA 1SJCA 3L65A 1WQ5A 3VD4A 1LF1A 4AB4A 3FYYA 3W0KA 5D38A 1VEMA 1S2AA 3K8LA 4I7WA 5I02A 4B5TA 4AX7A 3NA8A 3T42A 2DZXA 3W9ZA 4HHMA 3MUXA 3OBEA 1OC5A 4JY8A 1IYXA 2J24A 1H11A 2WPBA 2RDWA 2O9RA 1UP2A 3ZMRA 3EOEA 4HA1A 5DMYA 3HN3A 4F0LA 2EGZA 2YCJA 3LBMA 1QWKA 4G7FA 3VC5A 4QBXA 2J8TA 1GZ1A 1UYQA 1T6MA 2XVGA 4JTCA 3IV8A 1RP8A 4E4PA 1PPIA 5LIXX 4IX0A 3K4AA 3G2GA 4CD8A 1LUCA 5A8NA 1DJHA 3DFNA 4LUIA 1OIFA 2G3JA 3WLKX 2JK2A 5JBEA 5CG0A 1W2VA 1TPEA 2G37A 5A8QA 4IFRA 5I03A 3IVTA 1A5SA 3EOUA 3BOLA 3TR9A 3B0XA 3VXGA 3ARXA 3MW7A 3A4JA 9XIMA 2EPLX 3UJSA 3KLKA 1QNRA 5AY7A 1IXNA 5A6SA 4NZ4A 2XFFA 5KTLA 1CXHA 1HL2A 3MJMA 5LKYA 3IRDA 4RCXA 1J0IA 2FH8A 1XYZA 2LLEA 2XH0A 4ZXOA 1OX4B 4LT9A 4PRWA 2CU0A 3UJEA 4KKXA 2L5HA 1FH8A 4DQWA 1HNYA 2D2GA 2VGIA 3VFLA 1VYSX 4MWAA 1US2A 1WCGA 1X7IA 1DJZA 4GJIA 2DV0A 2PD9A 4JAWA 2QUVA 4BEUA 2W63A 4QP0A 2VXNA 2FFCA 5L6UA 3RILA 2YW4A 1EXPA 2PP1A 3GHRA 2J6VA 3PY2A 4Y96A 4Z1DA 4RZ4A 3F4CA 4B5WA 3A4XA 3C2EA 1V6XA 4JQAA 2ZQ0A 3W07A 3VD9A 2W4XA 1HJWA 1V0MA 2E09A 3BCJA 5FOOA 3L68A 4Y6GA 4JQ1A 4NJIA 3GZ3A 1HW6A 2X41A 4E8CA 3KS6A 2TSYA 2JE8A 1K7FA 3VC6A 1JCJA 2HS8A 5TQLA 4KS0A 1DWFM 1I6NA 1I75A 4D6DA 2A0NA 2QJJA 5TBOA 3BAJA 1EQPA 3T7VA 4JTDA 3G0UA 3DH7A 3SUVA 1KXTA 3AIUA 3WUBA 3W81A 3ONBA 4K8HA 4NYUA 3HPSA 3GU1A 3EB2A 2GGJA 2HROA 4GQBA 2PTZA 3QFEA 1TPB1 2Q3OA 2GGIA 4LYRA 2P0IA 3NPWA 3STEA 4LV9A 3UR2A 1E0UA 1R3WA 3FA3A 5H2ZA 4PMXA 2ATSA 6CGTA 1J9YA 5EBAA 2ZZ2A 3MDUA 4FXSA 2ZUUA 3IGXA 3AJ7A 4LF1A 4JTHA 1OVDA 4OKDA 1W1ZA 4BI6A 4C6EA 5CCZA 2OTDA 1C9WA 4IIGA 1DIEA 3EMZA 1H49A 3H22A 2DSKA 1SZNA 4DBWA 4CVUA 3LU2A 3W7GA 2WLZA 5FSDC 2VFGA 4IZGA 3IRSA 3VO0A 3WNNA 4FNQA 1A53A 3UFYA 1R2SA 2XISA 4DM1A 1AQHA 4ZQMA 3GNRA 5T8GA 1SJAA 4JTIA 1LL6A 4FK9A 5BXPA 1E6NA 3OZYA 3MKKA 3HPFA 1DE6A 2GJRA 4PFMA 3O7UA 3T4WA 3QLDA 3AYRA 1MWOA 6REQB 3SUSA 3PZ9A 3VTRA 4O1CA 4HKPA 3BLIA 3I3EA 2VL4A 1CECA 4QAWA 1WKFA 2F9RA 1W9VA 1EJUC 1MW2A 1HJSA 5KZEA 1GTHA 1VPQA 2D24A 2E5BA 3CEPA 1CBGA 3H23A 1J10A 3ZT5A 1UH4A 3IJ7A 3MANA 1WDPA 3U3HA 3AU6A 9CGTA 5D37A 3I7QA 4JTEA 3N3MA 2IQDA 2HNHA 3GE7A 1XC6A 3P14A 4PYSA 4FP1A 1YMYA 4K36A 3UPBA 1B57A 3QPZA 1M04A 4D8ZA 1VIWA 4AZCA 5CAKA 5LA0A 2O92A 3LQLA 2OB3A 4KIEA 3W85A 1E6QM 3W2LA 3LM3A 1L2QA 2V5KA 2PWFA 3O63A 3WLMA 4B3KA 3P8IA 1P0EA 4AZ5A 4KEZA 5FEZA 3DKLA 4LCQA 3H54A 1QNQA 1KGXA 1EWEA 4AWUA 2KAUC 3TN3A 2GWNA 1PEZA 4DF1A 2YYTA 3WQGA 2OT0A 3AJXA 4OBSA 5LIUX 1CI1A 1W5PA 3IIOA 4EVZA 3OLIA 3UXLA 3A21A 1PSCA 3ABQA 2E6AA 1DEDA 3WBYA 2J4GA 4ATLA 4OBRA 4OECA 4KGJA 2D0HA 1XDJA 2YJQA 5JMUA 3K13A 4HP5A 1BVWA 3JS3A 4Z2GA 2D0FA 3W2UA 4KESA 1UR8A 3EWWA 1NOWA 1KLZA 3EWZA 3IIVA 2PRHA 1IEWA 2VT0A 1LLZA 4NNCA 1NIUA 1TPVA 4WLCA 1JQVA 3GFZA 3SUTA 1HGYA 3S1VA 4HU3A 4EWND 5KZMA 5KMYA 1ECEA 4WDXA 1R86A 2X7VA 3DHPA 1KV8A 1UR4A 5A95A 3QYSA 1NQKA 3UVIA 1NFGA 3OLGA 1IZJA 2BMBA 1VYPX 4GY1A 1EC7A 2GVLA 4W8LA 1F4AA 3GIPA 2GDQA 4F79A 1PKLA 2PA6A 3UW6A 4EF9A 3WLOA 2Z7GA 1QW8A 2QF7A 5HJYA 1CTNA 3U2EA 5TNVA 5AHNA 5BYWA 1ZFJA 3VM7A 4XIMA 5DCBA 5M03A 4XTIA 1H7WA 4LNCA 3LV5A 4BCEA 5HJXA 2NQJA 2GVYA 3GC2A 3V3WA 2YL5A 3VIPA 3NL6A 1XCFA 3CASA 1H63A 3IJQA 4GCAA 2PDGA 4TMBA 1XPYA 4KRUA 1GVSA 4JNMA 1OGSA 1U1UA 4I9AA 3C0SA 4A05A 1JYXA 2AQWA 2ZCGA 2C19A 2Y0FA 1L6FA 1JAEA 2DZSA 4HCHA 3CHFA 1K02A 1DJGA 4J9JA 4V33A 4L80A 3KTXA 4DYJA 4CU6A 4U31A 3PZOA 4H4IA 3G18A 1A80A 1FWFC 4QQUA 4FLQA 1MXSA 2OKTA 3SI9A 3OHIA 3EKZA 3ZS4A 2NX9A 2WXDM 4GYFA 5C2GA 3EXTA 4Q7NA 1GHRA 3GXDA 3SCRA 5BMXA 4RXFA 1ICPA 4YPJA 5HMSA 3ARRA 1EDQA 1VCVA 1XI3A 2FH6A 3W29A 4JCLA 1NP2A 4RJEA 4GKTA 4K7VA 4WZHA 3VK5A 2XH4A 3BUVA 2OZ3A 1J6OA 1QR7A 3C6CA 3ECQA 2C3ZA 1JCLA 4C90A 3P0XA 1KFWA 1H1YA 3EEGA 4X22A 5LNRA 5LIWX 1YPXA 3URAA 4QDPA 5D2VA 2IS7A 5D02A 2PDUA 3B4UA 4GYKA 5AHEA 4HN8A 2W62A 3NG3A 1HT6A 3LCWA 1EXBA 3I68A 1D8WA 4F2BA 3MO4A 5F1UA 3W83A 4ZCWA 3VKKA 2G96A 4JR5A 4PEKA 1VBGA 4J40A 3NDZA 3KRUA 1L8NA 1UUOA 3TNOA 5DBUA 2O7QA 1F4HA 2PGEA 1JYWA 1ISWA 1XLJA 3CQKA 1VS1A 2RJHA 2YCEA 5G2WA 3Q4DA 2Y88A 1V4YA 1A5UA 3QQ1A 5LNWA 5FESA 2QMJA 2VMFA 1OEPA 4XVEA 1XYFA 1FWJC 1YKWA 3W7RA 3M64A 1ZAIA 1UBSA 2CLFA 2I14A 3QTPA 4GIAA 5ABHA 4ICCX 1UROA 1J0KA 2FYMA 3UYCA 3VKBA 3I6TA 3QGKC 3QSRA 2BVDA 3M0LA 3BPWA 4ZO7A 2PBGA 1GHSA 2JKEA 4C6LA 1UWRA 1PWLA 3KBVA 3PPFA 3V5CA 5CGQA 2IW0A 1BVZA 4J2PA 1A0CA 3CUIA 5CBIA 1K8XA 3CHVA 1XH2A 1RR2A 4MYXA 1CW2A 1CGTA 2B0MA 3LOTA 1QAPA 2QCEA 3SRKA 2PMQA 3REQA 3CHCA 3QLLA 1G7VA 3M0HA 3VNMA 2A6LA 3Q67A 2O9OA 1FKXA 4JBRA 2Y8VA 3T05A 2BHUA 4Q4MA 5ABEA 2E1DA 1RV8A 2FZMA 2HVMA 3THCA 1GJUA 4WKFA 2DUZA 4RE4A 3FJ6A 3IJIA 3GXTA 4HD5A 4L9XA 4JX4A 3M5YA 3H2MA 1N7KA 1KA9F 4M19A 1A5LC 3U57A 1FX6A 1OYCA 3WJYA 3O0FA 1W1IE 1YE4A 4J27A 3TVAA 4GGBA 3LHYA 3GD6A 4FF5A 5D2TA 3C0JA 1FKWA 3QQ0A 2WJFA 3QZ6A 5ABTA 3M0XA 3BC9A 1B0IA 2XM1A 4GC4A 1AW1A 3SDOA 2DORA 1VZWA 5DFAA 4PBGA 1VKFA 3QVQA 3BE7A 4O52A 4WF7A 4GI9A 1GORA 5TD4A 1ODZA 5EMMA 5JIPA 5I07A 3DC8A 1VCFA 5HUOA 5HWMA 4M51A 4QISA 2DVUA 4K37A 3C2VA 5I3KA 2VELA 3F2DA 4UB9A 4ACYA 4BF5A 3OQEA 3S5ZA 4DYKA 4YU1A 3RMJA 1LLOA 3SFKA 1S39A 3PBYA 4HA4A 3W2NA 2TRSA 3ATYA 3W76A 3EXRA 4S3DA 1CXKA 4MY9A 3ISIX 4P2VA 4AMCA 3BCDA 3QR3A 2DIKA 1IXPA 3MSDA 3GS6A 4WKHA 3W7OA 2BSLA 4AIUA 3G1RA 1ZBCA 4FLOA 3N3TA 3ZR5A 1LLWA 2HVOA 3SEPA 4ERAA 5CC7A 5GJNA 3NQEA 3V18A 2WQPA 1T99A 3PZIA 2R82A 3CQJA 2INEA 4K38A 2GDUA 5IRPA 3BG3A 4F0KA 3GH4A 3GR7A 5JBDA 2IPGA 3OBAA 2XINA 2F6UA 5DF0A 3B8DA 3HMCA 4IHCA 4JQ2A 3G8EA 3PANA 4WSJA 5FJTA 4DZIA 4LBRA 5A6AA 3A9IA 4UFIA 5GNXA 1F3WA 1EGMA 3HA1A 3DFYA 4V15A 1OY0A 1XYBA 4RNFA 4HYVA 3ORWA 1Q85A 1HL9A 5E09A 4HMCA 2G50A 3SW6A 4R7OA 4REQB 1OZQA 3GVGA 3VVGA 4FX7A 4BY3A 4RX0A 4Z17A 2Z29A 2E6FA 1AVAA 1X6LA 3UWUA 3N29A 2WKLA 2DUXA 3SN0A 4AD0A 3PS7A 1X8CA 2PDXA 2QEZA 3P81A 4LSBA 1EFZA 3N2MA 2ZICA 3UCDA 2GQ3A 4DJFD 3ZYZA 2X1RA 3I7RA 1Q66A 4DM2A 3U4FA 2QULA 4UQBA 2IUZA 1J11A 2C1IA 4MPKA 6TAAA 2QJNA 4NP7A 1ZCOA 1VBJA 4D1IA 1ZJHA 2XWEA 2QS8A 2V5BA 4F66A 3IJ6A 3FSTA 1MUMA 5LNVA 2DSZA 4R9OA 1AH3A 2EJAA 3EWBX 2C1HA 2QCMA 2RHGA 4NU7A 2RKXA 1TV2A 1SU5A 3AS1A 1BXCA 4X0VA 1TPH1 4E2DA 1TV4A 5I79A 3R43A 3SECA 3TFCA 3POHA 2VDHA 4PRTA 2IMRA 3LLXA 4L4LA 3F7JA 1LWJA 5JH2A 5RUBA 2ZC8A 1LDCA 5KETA 2E28A 2DGAA 5FA5A 4IPJA 2RFGA 4LUSA 4S3FA 5TAOA 2FJUB 3EDFA 2V5DA 3EX4A 3B06A 4GZIA 2V68A 3F5JA 4YCPA 4M81A 2BXYA 1X39A 3UGVA 3ZWSA 4S3CA 2J7DA 2EG8A 3IK2A 4MGGA 3WL1A 2I16A 3MVTA 1U1JA 5F2MA 2JGQA 1S5TA 3GXFA 4EP8C 3JW7A 1UMYA 4Z1AA 3IJ9A 4LYQA 2NWRA 3RX2A 3NEVA 3LGGA 1X96A 1Q4WA 3QW4B 3AHYA 4H9UA 4FSAA 1CLKA 4MB3A 2FDMA 3RMEA 3JVAA 1IR1A 3FW6A 3B0UX 2V38A 4GA8A 1P7TA 1TX2A 3HJZA 2FHBA 1F3TA 3O05A 5CPSA 1GG1A 1XLAA 3U8GA 5CKSA 1K4GA 4NZ5A 3VGEA 4TTUA 4MG4A 5J04A 3F4NA 2Q71A 5AHFA 2J7GA 1BG4A 1GOXA 2VEPA 1UIPA 1PE1A 5E5CA 4GQRA 2A21A 3RM8A 3FGCA 2D73A 4DJED 4MWAB 1M3UA 2R14A 3NSNA 3WD4A 3VPLA 3DX5A 2INZA 3RGTA 2X0HA 1EC9A 3BMWA 5D03A 1M7PA 1HJVA 3T09A 3ZLHA 1BGAA 2ZZ7A 1AZ1A 1RH9A 4XZIA 1R9ZA 4UTLA 4DY1A 3WDHA 3SJ3A 2X1SA 2W66A 3MUZ1 4O1DA 4QG8A 3T44A 1BVNP 2EPOA 3B8IA 3EMQA 4YWSA 1ESWA 3DENA 3QEZA 3B05A 1EX1A 1F07A 1PKYA 3SCTA 1EYWA 1WKDA 4NILA 1BYCA 3A12A 2FB3A 3A5VA 2BV9A 4Q7IA 4UQ9A 2OLHA 3UWYA 1I2QA 1GQKA 2ISFA 2XN1A 4KFPA 3UVAA 1UD4A 4Q4KA 5FJJA 5JXQA 3SSJA 1OFAA 4IMCA 3L0KA 3BJSA 4AEEA 1OINA 3WH7A 5EMYA 4QLLA 3W7CA 4LGXA 5DANA 3U9IA 3WX7A 3CK5A 2PDHA 1BQCA 2C8NA 4X9YA 1G7UA 1IE7C 3ANUA 4QE4A 4A8IA 3N9SA 1OFEA 3QN3A 1IWAA 4IPPA 4ZGYA 4AEOA 3WJSA 3BMXA 4K1WA 2DIJA 1W37A 2G97A 5LYRA 1BTMA 4XBKA 1M1BA 5EA9A 1F74A 1XKYA 7XIMA 2XZ7A 4UTTA 2PDIA 1XIBA 4OV9A 3H2EA 1BKSA 3OA5A 2AGTA 4CQBA 1HP4A 1WKYA 3DU0A 3M5VA 4GNJA 2FPYA 2A85A 3TN5A 1SUXA 2TODA 3DFOA 4DUXA 1V8EA 5FEPA 4A8RA 3N19B 4DRSA 1UB3A 7REQA 4IMAA 3H8AA 3M6YA 3KTCA 2XWDA 1V7YA 4JGDA 1WUFA 3U2CA 4ML4A 3SRDA 3WLPA 2NW0A 3EA3A 3N34A 3W1RA 3AS3A 3TJXA 3ABOA 4MKNA 3AXKA 3C2FA 2B7QA 4HSNA 3CZJA 1XSKA 3OLEA 3PFRA 1ISXA 2W6RA 4KBXA 3V5OA 4GISA 1VAHA 3WLIA 2O55A 2AKZA 4H9ZA 4UQDA 3ZJ8A 4EX4A 4AZHA 2Z6IA 5LHEA 5A8GA 1UWTA 1RJQA 3ES7A 3LHUA 1MW1A 3TDFA 2DFAA 1DHKA 5CLTA 4A2RA 3HFYA 6PTDA 1JD9A 5DT5A 4V1YA 1YHTA 5BRQA 1F3EA 4F4RA 1DTUA 4C6FA 3A47A 3OVGA 2HSAA 3WH5A 1X1OA 1AFSA 3NZQA 3CZKA 1BYBA 4AVFA 3CUJA 3H4GA 4LB4A 1EH9A 2WANA 3VX0A 1CZ1A 5XINA 1MNSA 1XLLA 1HX0A 3LCFA 1KQZA 2RGMA 4PFHA 1HF6A 4PUNA 3PG8A 2NQ5A 3LMYA 3R94A 1TRIA 1JYVA 1V3HA 2YB1A 3O6CA 1W91A 4ACZA 1VBHA 3LTPA 1MZRA 1EP3A 3L23A 2OWXA 4Q7BA 2V6AA 1UR9A 5FAGA 3ZVIA 3MQTA 1CGUA 1UHVA 2XM2A 4C7GA 4A3HA 4F0HA 4IGNA 1EBHA 1QNVA 4BR1A 4F9DA 2OQLA 4FA3A 3TCSA 4HNLA 1ADDA 1PHQA 3M6DA 2A7PA 2CERA 4XKMA 4XZ9A 4GI8A 4DI9A 3WJZA 4DN1A 3KBNA 4DJFA 1JUKA 3EDJA 1U2YA 3EB4A 4OE7A 4UTUA 1YBQB 1H5YA 1DE5A 3BGAA 5EMKA 4QQ3A 1BHGA 4DJDC 1K70A 1RQEA 1XBZA 2WZEA 3R2GA 1ZZMA 4PUKA 4UTMA 3NSMA 4ADUA 3CZGA 4GFIA 3V5FA 1T41A 4N4PA 4UR8A 4TUFA 1OFDA 1SO4A 1V3MA 1TMQA 3P3BA 3MWCA 1WX0A 1XC4A 3HQ1A 1BXBA 3W1AA 4GZJA 4NJHA 3W7JA 3UPWA 3GK0A 1LTDA 4O4VA 4DWSA 1R3SA 2GQAA 3H4WA 1YDVA 5A2CA 4K8GA 4FNTA 3R12A 4ES4A 1EDTA 3JR2A 3W2MA 2VZVA 3QOKA 1B3VA 5A6MA 4LH8A 4EIVA 1ZU8A 1E71M 3EOLA 3LS9A 1E0TA 4YTSA 1W9DM 2R1LA 1G9HA 2WMJA 3SCWA 3G6MA 4E3TA 1Z6KA 2FVLA 1QI5A 1F8IA 2JQXA 1NWTA 1KXQA 3BTNA 4XKYA 3BAKA 1V08A 2Y8UA 3TLQA 3WF0A 1ECQA 3V0TA 5PTDA 5M5DA 4B5VA 2ZTJA 4IQLA 1OIMA 2EAWA 3WBEA 3STGA 1EX5A 4GY7A 1FCVA 2WM1A 4MPQA 2VQUA 1FFRA 5HNTA 2WKJA 3DCPA 1ZBWA 3OVPA 4PMQA 3GW0A 1K9EA 4HJWA 4IGHA 1RBOB 1JUEA 4JN7A 3W00A 1AH0A 1E9IA 1HTIA 2C0AA 3UXKA 1U5JA 2ZFAA 2XIOA 3G0XA 2NQHA 2DT1A 2H6RA 2WM0A 2NVCA 4AISA 2F2KA 4KH2A 4INFA 1EJWC 1OADA 1BAGA 5KSWA 4GIRA 4KF1A 1GPFA 3ME3A 1K1DA 1CWYA 1HKIA 4HHHA 3N18A 4UMAA 4G1KA 2BTMA 2OZ0A 3SCOA 4MJ4A 2ZZ3A 1S2VA 1R2RA 3B9OA 4H8HA 1IZKA 3G1DA 2C1GA 2ZADA 5AYIA 5G1MA 3RYSA 1FP9A 3EWXA 1RY0A 2E68A 3BV4A 1QMLA 1NH6A 3CMFA 4GMEA 4X2PA 1ITQA 3GDBA 5A6KA 2ZXAA 5K9DA 4Z0JA 4JHZA 3STPA 4PTDA 3RDKA 2G0WA 2PWGA 1VLWA 3QY6A 4BQ5A 3AO0A 1U5HA 4HPHA 3W1XA 2YBTA 1REQA 2UWFA 1RA5A 1Q6EA 4AF0A 5G1YA 2WC4A 1KCZA 3C2RA 5HULA 4HPNA 4QX4A 5IBXA 1AZ2A 3M7WA 5JQ9A 3KFTA 2BY1A 5BU6A 5F4WA 3TTSA 4DB7A 2A7RA 4G2DA 2VNCA 1NFPA 4PODA 1A3HA 3NZPA 1E6ZA 4N9BA 4XZNX 3RLHA 3KVJA 3OP2A 4DWDA 1K8CA 1QRQA 4JFVA 3DIPA 1HFBA 3AZRA 3P67A 1UUQA 4AD3A 1RVKA 1W3NA 4X2RA 3IVSA 1B3WA 2VO5A 2FLIA 3IIPA 2UY4A 3BSMA 5ENLA 3PZNA 3O6YX 3S2CA 1VLIA 1EB3A 1TJ0A 1G69A 3IJDA 2VOMA 3BOXA 3S4TA 1OD0A 5T9BG 1DV7A 4IICA 3W1UA 2V5LA 4XG1A 4DO7A 4D9PA 3N13A 1UD8A 3PK7A 1ONXA 3K46A 1TQJA 1UJQA 1FCBA 4PCSA 1X98A 3SCVA 1W1B1 3PF3A 2YL6A 1Q2SA 4QM1A 5A6BD 2P3EA 2AL2A 3HG2A 2P88A 4E3VA 3CAVA 3CT2A 2Y24A 4AU0A 4CCDA 3SCPA 2F61A 3PC0A 3ITTA 1R5YA 3AWNA 4NAFB 1GVFA 1SJBA 3ARTA 1J0YA 1E3ZA 3BG5A 1KBKA 8CGTA 3FS2A 4X63A 2J7BA 3U5UA 2PP3A 4IISA 1UA3A 1ZL1A 4MB1A 2VCCA 3TA9A 1NY1A 3ZT6A 1XUUA 3EOOA 1JUBA 5D8WA 4HBKA 1Y5XA 3XISA 1KFCA 1E0VA 5GVJA 4CEXC 4H8VA 4FX8A 2QZRA 1VJZA 2PDPA 4JIPA 4I6VA 3N9KA 3N2BA 1Z44A 4ZOEA 3T9PA 4C7DA 2VEMA 3C0QA 1A3XA 2QDDA 2XVKA 5CZSA 1W31A 1C7TA 2VVSA 4J28A 4JL2A 4XISA 3ITXA 4YVVA 1V79A 4PULA 2PP0A 1WDDA 1CT5A 1Q6FA 1VFLA 1B2YA 3HQNA 1V3JA 1TFVA 3W6MA 3E0VA 4B5NA 3CEUA 3REQB 3GVVA 1QXLA 2X30A 3NQFA 3G1SA 1TR9A 4HN4A 5HPOA 2HBVA 1D3CA 4FO4A 1QPKA 2DIEA 1SFTA 5C7VA 4MNLA 1GVQA 3VDHA 4RPPA 2FZDA 3GO2A 5FEXA 4WOQA 4JDBA 1OHLA 4DF2A 1C92A 4CN6A 2ZXDA 4C5YA 2BNJA 2ZUSA 2E9LA 3IV3A 2E67A 1N82A 3MYOA 2I9UA 3GH7A 2NX1A 4B2DD 3K1DA 3ZR4A 2VC7A 3MI2A 4UFKA 4TVCA 2Q3RA 4EOUA 4MYAA 1ENUA 1FXPA 3NQ6A 1T0OA 1M03A 3CHEA 4YVXA 1DVJA 2HDJA 3HG5A 2A5HA 3KVLA 2QT3A 3A64A 1EPVA 3W1TA 3S9ZA 3TTYA 5D2YA 3RX4A 1EA9C 3GY1A 4FLSA 5DRCA 4NASA 4B90A 1Y7VA 4FF7A 3TNBA 5G1TA 2P8BA 1YW1A 2PLKA 4L7ZA 3P60A 2JF6A 1K9TA 1Y8BA 1ZBKA 1ZQ5A 2OEKA 1L8PA 1JZ3A 3MUCA 3NYDA 1LRNA 1SVDA 3GTHA 2XIMA 3UESA 2ACSA 2WJZA 3HM7A 5A5WA 4JYEA 3TMLA 4E2BA 4EF8A 2WMGA 1EJVC 3KUMA 1J2BA 3VKJA 1E6PA 3QFWA 1DWHM 1PKMA 1ZJBA 2Z1KA 5CJMA 1UD5A 2WOQA 4J35A 5AKQA 3IIXA 2WZHA 2C13A 3VA8A 2CZFA 3W6YA 3TC6A 2PTXA 3GUGA 4Q8QA 2DZUA 3VIHA 2XIJA 2F8QA 3AYTA 4S3GA 3VILA 2E6YA 4F2UA 1UWIA 3G1HA 5FJOA 4GACA 3NVDA 4NF7A 3K4WA 3FOKA 4MZYA 5H6HA 2OWCA 3R25A 2HRWA 2IKJA 3W37A 1KWGA 3H7VA 4IG2A 4CQAA 4AC7C 2Z7KA 1BWKA 2WCSA 2WZMA 4GUJA 4WDTA 1YNQA 4GI6A 3VOHA 2OLSA 1QPOA 1US3A 2ZDSA 5I0DA 1YPFA 3VDGA 3BW4A 1XWYA 4GYJA 2AL2B 1XGDA 1X1ZA 1BYAA 3CAQA 3SJNA 1UBPC 4I5UA 3VE9A 3TEVA 3PSWA 1PDYA 2GOKA 2XZ9A 2OSXA 1GW1A 4G9PA 1WYIA 4KEVA 1ICSA 5TF0A 4JFSA 1Z3NA 4PUDA 2E77A 1CGWA 4AD5A 2OG9A 2QKFA 4GXWA 4XZMX 3VIKA 2RDUA 1YXDA 4M7SA 3WKZA 2ATMA 1JAKA 1WDSA 2QW5A 2ZE3A 2WJEA 1W6TA 4IPIA 4XZBA 3AFBA 4EXAA 1CCWB 3O07A 3AIVA 4WUIA 2Y63A 3QY8A 3CZLA 4ZO6A 2B31A 1CB7B 2OMAA 4IXXA 3JZEA 1ZJIA 2PLJA 4XK2A 2PC4A 5C70A 3AXHA 1BWLA 3L2MA 4K68A 2PWUA 4PE8A 4Y8EA 1EF2A 3L4UA 2OODA 3EPMA 5E70A 4UTWC 5DN1A 2QCDA 3P80A 2X8RA 1LRTA 1LJYA 3KEHA 1C93A 4JTUA 2AAMA 1W9BM 3TYUA 1CENA 4H9VA 4CKQA 4C6MA 4C7FA 1LRQA 3SBFA 3S3GA 3G77A 3UCCA 4MB4A 4IIHA 3W84A 3HG4A 2BB0A 1YADA 4BQ3A 2R91A 4KCVA 4PBFA 3ATZA 3ZWTA 3WK3A 3H21A 1LORA 1BKHA 4LNYA 1JDEA 2TYSA 2VZOA 1WDQA 3QKZA 1X1NA 1FRBA 3CL6A 3QXBA 4XAPA 5CZJA 1FHDA 5DLCA 3VOJA 5AC7A 2BLEA 5TIMA 1VPYA 5G4EA 4BJHA 4WY0F 4P5UA 3TWAA 4PCPA 1DORA 2Y5SA 3N1AA 1RBAA 2CWNA 4IXHA 4ZQNA 3S42A 1GOQA 3T07A 4OIFA 3LNPA 2D69A 3SN1A 1TTJA 2ZZ4A 3STFA 4FS9A 4DI8A 3LB0A 5GNZA 3CZEA 2GK1B 1E0WA 3OU8A 3RIKA 3LENA 2PB1A 5I06A 4AW7A 4HVXA 4QE1A 2F84A 3ANYA 5AC4A 8RUCA 3B9DA 1E4NA 2YPIA 3R79A 5MF5A 3XINA 2ANUA 3U2ZA 4XD3A 2E8ZA 3AICA 3VMOA 1YDNA 1HN1A 1R30A 4E5TA 3KXQA 2V67A 5BXRA 3P84A 1AJ2A 4UCGA 1QBAA 3URQA 1SO6A 2YXOA 2PRMA 3WLNA 3AHXA 2OJPA 1XLCA 4DPQA 3V75A 4V1XA 2QJGA 4ZTXA 1QI0A 3TJ4A 3PZQA 3PHAA 5LA1A 3GR8A 1YNYA 2NQLA 5FL0A 1J4EA 1D2KA 2UY3A 4H9YA 3NCOA 4MUPA 3HFTA 1EZ2A 1RVGA 2J6XA 2Z6JA 4U3CA 2XSBA 5HNUA 2SFPA 4HTBA 4GK8A 3D6NA 1V6VA 3O3RA 3K30A 4DHGA 3KRZA 1AW5A 1SZGA 4E0CA 1IEIA 4ILSA 1QT1A 1LM1A 4MFDA 4PTVA 1W0MA 3KVKA 1UR0A 3KOXA 1MO0A 3VCRA 3WH6A 3WY1A 3U0HA 4QJ5B 3S5OA 2BGSA 1E6SM 2DDXA 1MEWA 1XUZA 3TX9A 1DQUA 2F7FA 3QC0A 3S5YA 3IUDA 2PUZA 4U2ZA 5D32A 3HG3A 3ZIZA 1XDLA 1VFFA 1VFTA 2HMCA 4OUIA 3WK1A 1O1HA 4XAGA 4IM4A 3WMSA 3GIYA 1BXNA 2ISSA 2ON3A 4WGXA 4YLWA 2PDNA 5BRPA 4POCA 4J3SA 5DY2A 2VJXA 4BKNA 3PTDA 3UNDA 1DKWA 1JPIA 3KWSA 4GCXA 2WB5A 4CQDA 1FUYA 3PB2A 1XF0A 3KX6A 5HNNA 3S1WA 4AY8A 5I6SA 4AEFA 1UZ1A 2PDLA 3DFQA 4Q8TA 3AHVA 5I3DA 1ODUA 3FVDA 3AXXA 4O53A 4JYFA 3W25A 7TIMA 4AIOA 1YIXA 4M7TA 3LLDA 3IANA 3NQ8A 4GC3A 3G22A 2PDJA 2Q09A 3ARSA 1KFBA 2OEJA 5A6JA 4OQVA 5C5YA 4GI4A 2D3NA 3NGJA 4FXRA 4ZQOA 1PS9A 2QJHA 4U28A 1VBRA 5DX7A 1LL7A 2OSWA 5JUVA 1IT8A 2FPVA 3LZ5A 1E4MM 2VEIA 3GNPA 3W7PA 3ZLFA 2ZZ5A 1RJRA 2VC5A 4I5XA 4URIA 4J1OA 1E1FA 1W1PA 4NAEB 1AUSL 3CWHA 2XFWA 2YL8A 1FWDC 2CYGA 4JKMA 3GHTA 3B8TA 2W3ZA 2YZRA 2AMGA 1XLFA 2WVUA 2PRLA 3PWAA 1JYNA 4IIDA 2IPJA 3EX3A 3L2IA 5G4WA 3M43A 3UY8A 1WO2A 4C6KA 3XIMA 4H9XA 4Q4SA 3W1NA 2VWSA 4ICMA 2A3AA 1HL8A 2OYKA 3E2SA 4LBUA 3F2BA 2HK1A 2QDHA 4UOJA 4WRHA 4C6BA