4X23D

Crystal structure of cenp-c in complex with the nucleosome core particle
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
90
structure length
90
Chain Sequence
ESYAIYIYKVLKQVHPDTGISSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (147-MER)
publication title A conserved mechanism for centromeric nucleosome recognition by centromere protein CENP-C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 33
structure length 90
sequence length 90
chains with identical sequence H, N, R
ec nomenclature
pdb deposition date 2014-11-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 4x23D00
3LZ0C 4Z2MG 1JFIB 4ZUXA 1S32A 3AZID 3AZNB 4ZUXC 1S32C 5B40B 3KUYB 5B33B 2NZDA 4J8WA 3AZFB 4NE3A 3REHD 3W97D 5GXQA 4J8WC 3X1VD 4J8VB 5B1MC 3MGSC 3UT9D 2F8NG 3AZJD 4XZQB 3AZHA 3LZ0B 3TU4D 2IO5C 5B31G 3W97A 5KDMB 3X1VA 3VH6W 3W97C 3LZ1B 3WTPE 1P34D 3X1VC 4H9OA 3UTAD 3UT9A 3AN2A 1BH8A 5B1MB 3MGSB 3UT9C 1HQ3B 3MGRD 3TU4A 5B2JD 5B0YD 3TU4C 1TAFB 1A7WA 2YFWA 4QLCD 5AV9D 1Q9CA 3AZIB 2F8NA 3KWQD 5B0ZD 5G49A 5DNND 3AZMD 1P34C 3X1UD 3REKB 3REHB 3W97B 5AV5A 3UTAC 4G92C 3X1VB 5AY8B 4J8UD 3AZND 4X23D 4WU8D 5GT3D 4CSRB 5B33D 5AV8D 1ZLAD 1B67A 3MGRA 4YS3B 4WU9D 4H9RB 2CV5D 3MGRC 5B24D 3AZJB 5B2JC 4QLCA 3NQUA 3MGPB 1KX5D 3LJAB 2FJ7A 4QLCC 2HUEC 5B0ZA 3TU4B 1P3AD 3AZMA 2FJ7C 3X1UA 3KWQC 1H3OB 5B0ZC 5DNNC 3AZMC 3AV1D 5AV6D 1JFIA 3X1UC 3R45B 2BYKB 4J8UA 3AZNA 1P34B 4WU8A 2NQBD 5G49B 5B40A 3KUYA 5B33A 4KHAA 3VH5W 3UTAB 5AVBD 2PYOD 4J8UC 3AZNC 4G92B 4WU8C 3W99D 5JRGB 3W98D 3KUYC 2CV5A 5B33C 5B24A 4WU9C 2CV5C 5CPID 5B24C 1P3BD 4E44A 1KX5C 1P3AA 5B2JB 1KX3D 5B0YB 1P3AC 3AV1A 5AV6A 4QLCB 5AV9B 2AROB 2HUEB 1TZYD 4XZQA 3AV1C 4ZBJB 5AV6C 4R8PD 3KWQB 4AWLC 2CWEA 5B0ZB 3LZ0A 1P3ID 5DNNB 3AZMB 2PYOA 5AVBA 3X1UB 3MNND 4WV4B 3WA9D 2PYOC 5AVBC 1KX4D 3W99C 5DNMB 5KDMA 5GT0B 4J8UB 5CPIA 4X23B 4WU8B 5GT3B 3LZ1A 4EO5B 5AV8B 4KHAB 1ZLAB 4NFTA 5CPIC 4WU9B 3LZ1C 2CV5B 3REID 1P3OD 3REKD 1KX3A 1M1AD 5B24B 1P3BC 5B1MA 3MGSA 3B6GD 1KX3C 3LELB 5BNXB 1P3KB 1KX5B 3W96D 5AY8D 4R8PA 2BYMA 1HQ3A 1TZYC 1P3AB 4YS3D 5B32G 4R8PC 1R4VA 1HQ3C 3WA9A 3AV1B 5AV6B 4AWLB 1TAFA 3AV2B 1KX4A 1BFMA 3V9RB 3WA9C 1ULYA 3MGPD 3AZIA 2NQBB 1KX4C 3LJAD 2PYOB 3B0CT 5AVBB 3AZIC 3W99B 3W98B 3REIA 3REKA 4H9PA 3REHA 1M1AA 5JA4A 5F99D 3WTPD 5E5AB 1P3OC 3REIC 5B32D 3REKC 3B6GA 1U35B 3REHC 5CPIB 1M1AC 5AY8A 3VH6A 3B6GC 4CSRA 1P3BB 5CPKD 5AY8C 4YS3A 1EQZD 1KX3B 4H9RA 5JRGD 1KU5A 1F1EA 4YS3C 3AZJA 1TZYB 3MGPA 4R8PB 2BYMB 3AZJC 3LJAA 1P3IB 4CAYA 3MGPC 5AVCB 3LJAC 3MNNB 4G91C 4H9NA 4Z5TD 5BNVA 1H3OA 5BT1D 3WA9B 1P3FD 1KX4B 5B32A 2AROD 3R45A 4LD9D 5F99C 3WTPC 2BYKA 1P34A 5B32C 4E45A 3B0DB 5CPKA 4J8XD 3UTAA 1P3OB 3REIB 4H9PB 1EQZA 3VH6T 1M1AB 5JRGA 5JA4B 5CPKC 4H9QB 3B6GB 1EQZC 4Z66D 5JRGC 4HGAB 5CPJD 5DNMD 3AYWD 5GT0D 3W96B 3RELB 5B2ID 4JJND 3MGQD 5B2JA 5B0YA 4Z5TA 1P3FA 5CHLB 5B0YC 4Z5TC 2AROA 5BT1C 5AV9A 3LELD 1P3KD 2RVQD 1P3FC 4G91B 3KWQA 5AV9C 4CAYB 2AROC 1P3GD 1AOID 5DNNA 4H9SA 3C1BD 4H9NB 4ZBJC 5BNVB 3AZED 5F99B 4H9SC 3WTPB 4J8XC 3UTBD 5B32B 3AV2D 4Z66A 5DNMA 5GT0A 4X23A 5GT3A 4Z66C 5B2IA 4JJNA 5DNMC 5AV8A 2YFVB 5BO0A 5GT0C 3AYWC 5CPKB 1ZLAA 4X23C 1EQZB 3VH5A 5GT3C 5B2IC 4JJNC 4WU9A 4EO5C 5AV8C 3MGQA 1ZLAC 1P3LB 5E5AD 3MGQC 1U35D 3LELA 5BNXA 1P3KA 1KX5A 3LELC 1P3KC 1ID3B 5B1LB 1P3GA 2RVQC 3X1TD 4XUJD 4Z5TB 4DRAA 1P3PD 3AZEA 1P3GC 1P3FB 4WZSB 1N1JA 3C1BC 3UTBA 3AV2A 3AZEC 4LD9B 3V9RA 1M19B 3UTBC 3KSYA 3AV2C 2NQBA 4J8XB 1P3MD 1BH9B 5C3IC 5AVCD 2NQBC 4ZUXD 3W99A 5CP6B 3W98A 5GSUD 4Z66B 3VH5T 5E5AA 5CPJB 3W98C 3AYWB 1U35A 2NZDD 5B2IB 4JJNB 5E5AC 5BO0B 1U35C 1M18D 1P3BA 5GXQD 3MGQB 1P3PA 3MVDD 4YM6B 3REJD 4XUJC 1P3PC 1TZYA 3RELD 3C1CB 1P3GB 2HIOB 3O62D 1AOIB 1P3IA 3B6FD 3C1BB 1P3MA 3NQJB 5AVCA 3AZEB 3B0CW 3MNNA 1P3IC 1N1JB 3AZHD 1P3MC 5GSUA 3UTBB 5AVCC 3AFAD 3MNNC 3AZGD 3WKJD 4NE5A 5C3IB 5GSUC 4UUZB 4WNNB 1M18A 2NZDC 2JSSA 1P3OA 3MVDA 1M18C 3B0DC 3REJA 5GXQC 4H9QA 5FUGB 3MVDC 1WWSA 3REJC 3W96A 1F66B 3RELA 3AN2D 4HGAC 3O62A 3B6FA 3W96C 3X1TB 4XUJB 3RELC 1P3PB 4M6BA 3B6FC 3O62C 1P3LD 3AFAA 3AZGA 3WKJA 3AZHC 3AFAC 4Z2MH 3AZGC 3WKJC 1P3MB 5B1LD 1ID3D 4ZUXB 3AZLD 1S32B 5GSUB 3KXBD 5F99A 3WTPA 2F8ND 3A6ND 1M19D 2NZDB 4J8WB 4NE6A 1M18B 2YFVA 4KGCD 5GXQB 5AV5D 3B0BA 3MVDB 5CP6D 3AN2C 3REJB 5B31D 3X1SD 1P3LA 4KUDD 1P3LC 3B6FB 3O62B 2F8NH 3AZKD 5B1LA 1ID3A 3WAAD 3AZLA 4YM6D 3AZHB 5B1LC 1ID3C 3KXBA 3AFAB 3AZLC 3AZGB 2IO5B 2FJ7D 3WKJB 4LD9A 3A6NA 3KXBC 1M19A 3C1CD 2HIOD 5BS7A 4LD9C 3A6NC 4J8XA 1M19C 4KGCA 1BH9A 5BS7C 5CP6A 4KGCC 5AV5C 3X1SA 5B31A 4KUDA 5CP6C 4H9OB 5CPJA 5B40D 3KUYD 3AYWA 5B31C 3UT9B 3X1SC 4KUDC 3AN2B 1BH8B 3AZFD 5CPJC 3AZKA 3WAAA 4YM6A 3AZKC 4J8VD 4DRBA 3WAAC 4YM6C 1F66D 3C1CA 2HIOA 1AOIA 2LY8A 3C1BA 3AZLB 3C1CC 2YFWB 3NQJA 2F8NK 2HIOC 2L5AA 1AOIC 3KXBB 4XZQD 2F8NB 3A6NB 3LZ0D 4UUZA 4WNNA 3AZFA 5B40C 4KGCB 5AV5B 1S32D 3AZFC 5B31B 3X1SB 4J8VA 1HTAA 4KUDB 3LZ1D 5FUGA 3MGRB 4J8VC 4J8WD 1F66A 3AZKB 3X1TA 5B1MD 3MGSD 1F66C 3WAAB 4XUJA 3NQUB 1B6WA 3X1TC 1WWIA 2FJ7B 1HQ3D 4XZQC
chains in the Genus database with same CATH superfamily
3LZ0C 4Z2MG 1JFIB 4ZUXA 1S32A 3AZID 3AZNB 4ZUXC 1S32C 5B40B 3KUYB 5B33B 2NZDA 4J8WA 3AZFB 4NE3A 3REHD 3W97D 5GXQA 4J8WC 3X1VD 4J8VB 5B1MC 3MGSC 2W8SA 3UT9D 2F8NG 3AZJD 4XZQB 2BG1A 3AZHA 3LZ0B 3TU4D 2IO5C 5B31G 2Y2KA 3W97A 5KDMB 3X1VA 3VH6W 3W97C 3LZ1B 3WTPE 1P34D 3X1VC 4H9OA 3UTAD 3UT9A 3AN2A 1BH8A 5B1MB 3MGSB 3UT9C 2G5IC 1HQ3B 3MGRD 3TU4A 5B2JD 5B0YD 3TU4C 1TAFB 1A7WA 2YFWA 4QLCD 2JE5A 5AV9D 1Q9CA 3AZIB 2F8NA 3KWQD 5B0ZD 5G49A 5DNND 3AZMD 1P34C 3X1UD 3REKB 3REHB 3W97B 5AV5A 3UTAC 4G92C 3X1VB 5AY8B 4J8UD 3AZND 4X23D 4WU8D 5GT3D 4CSRB 5B33D 5AV8D 1ZLAD 1B67A 3MGRA 4YS3B 4WU9D 4H9RB 2CV5D 2G5HC 3MGRC 5B24D 2FFFB 3AZJB 5B2JC 4QLCA 3NQUA 3MGPB 1KX5D 3LJAB 2FJ7A 4QLCC 2HUEC 5B0ZA 3TU4B 1P3AD 2Y2NA 3AZMA 2FJ7C 3X1UA 3KWQC 1H3OB 2Y2JA 5B0ZC 5DNNC 3AZMC 3AV1D 5AV6D 1JFIA 3X1UC 3R45B 2BYKB 4J8UA 3AZNA 1P34B 1W2EA 4WU8A 2NQBD 5G49B 5B40A 3KUYA 5B33A 4KHAA 3VH5W 3UTAB 5AVBD 2PYOD 4J8UC 3AZNC 4G92B 4WU8C 3W99D 5JRGB 3W98D 3KUYC 2CV5A 5B33C 3EPKA 5B24A 4WU9C 2CV5C 5CPID 5B24C 3IP4C 2DF4C 1P3BD 4E44A 1KX5C 1P3AA 2Y2MA 5B2JB 1KX3D 5B0YB 2UWXA 2Y2OA 1P3AC 3AV1A 5AV6A 4QLCB 5AV9B 2AROB 2HUEB 1TZYD 4XZQA 3AV1C 4ZBJB 5AV6C 4R8PD 3KWQB 4AWLC 2CWEA 5B0ZB 3LZ0A 1P3ID 5DNNB 3AZMB 2PYOA 5AVBA 3X1UB 3MNND 4WV4B 3WA9D 2PYOC 5AVBC 1KX4D 3W99C 5DNMB 5KDMA 5GT0B 4J8UB 5CPIA 4X23B 4WU8B 5GT3B 3LZ1A 4EO5B 5AV8B 4KHAB 1ZLAB 2Y2PA 2ZM5A 4NFTA 5CPIC 4WU9B 4WJ3C 3LZ1C 2CV5B 3REID 1P3OD 3REKD 1KX3A 1M1AD 5B24B 1P3BC 5B1MA 3MGSA 3B6GD 1KX3C 3LELB 5BNXB 1P3KB 1KX5B 3W96D 5AY8D 4R8PA 2BYMA 1HQ3A 1TZYC 1P3AB 4YS3D 5B32G 4R8PC 1R4VA 1HQ3C 3WA9A 3AV1B 5AV6B 4AWLB 1TAFA 3AV2B 1KX4A 1BFMA 3V9RB 3WA9C 1ULYA 3MGPD 2ZY4A 3AZIA 2NQBB 1KX4C 3LJAD 2PYOB 3B0CT 5AVBB 3AZIC 3W99B 3W98B 3REIA 3REKA 4H9PA 3REHA 1M1AA 5JA4A 5F99D 3WTPD 5E5AB 1P3OC 3REIC 5B32D 3REKC 3B6GA 1U35B 3REHC 5CPIB 1M1AC 5AY8A 3A1IA 3VH6A 3B6GC 4CSRA 1P3BB 5CPKD 1PZRA 5AY8C 4YS3A 1EQZD 1KX3B 4H9RA 5JRGD 3A1KA 3FDDA 1KU5A 1F1EA 4YS3C 3AZJA 3KFUG 1TZYB 3MGPA 4R8PB 2BYMB 3AZJC 3LJAA 1P3IB 4CAYA 3MGPC 5AVCB 3LJAC 3MNNB 4G91C 4H9NA 4Z5TD 5BNVA 1H3OA 5BT1D 3WA9B 1P3FD 1KX4B 5B32A 2AROD 3R45A 4LD9D 5F99C 3WTPC 2BYKA 1P34A 5B32C 4E45A 3B0DB 5CPKA 4J8XD 3UTAA 1P3OB 3REIB 4H9PB 1EQZA 3VH6T 1M1AB 5JRGA 5JA4B 5CPKC 4H9QB 3B6GB 1EQZC 4Z66D 5JRGC 4HGAB 5CPJD 5DNMD 3AYWD 5GT0D 3W96B 3RELB 5B2ID 4JJND 2Y2IA 2RIQA 3MGQD 5B2JA 5B0YA 4Z5TA 3EPJA 3EPLA 1P3FA 5CHLB 3AL0C 2XD5A 5B0YC 4Z5TC 2AROA 5BT1C 5AV9A 3LELD 1P3KD 2RVQD 1P3FC 1Z2CB 4G91B 3KWQA 5AV9C 4CAYB 2AROC 1P3GD 1AOID 5DNNA 4H9SA 3C1BD 4H9NB 4ZBJC 5BNVB 3AZED 5F99B 4H9SC 3WTPB 4J8XC 3UTBD 5B32B 3AV2D 4Z66A 2Y2GA 5DNMA 5GT0A 4X23A 5GT3A 4Z66C 5B2IA 4JJNA 5DNMC 5AV8A 2YFVB 5BO0A 5GT0C 3AYWC 5CPKB 1ZLAA 4X23C 1EQZB 3VH5A 5GT3C 5B2IC 4JJNC 4WU9A 4EO5C 5AV8C 3MGQA 1ZLAC 1P3LB 5E5AD 3MGQC 1U35D 3LELA 5BNXA 1P3KA 1KX5A 3LELC 1P3KC 1ID3B 5B1LB 1P3GA 2RVQC 3X1TD 4XUJD 4Z5TB 4DRAA 1P3PD 3AZEA 1P3GC 1P3FB 4WZSB 1N1JA 3C1BC 3UTBA 3AV2A 3AZEC 4LD9B 3V9RA 1M19B 3UTBC 1T3UA 3KSYA 3AV2C 2NQBA 4J8XB 1P3MD 1BH9B 5C3IC 5AVCD 2NQBC 4ZUXD 3W99A 5CP6B 3W98A 3EG5B 5GSUD 4Z66B 3VH5T 5E5AA 5CPJB 3W98C 3AYWB 1U35A 2NZDD 5B2IB 4JJNB 5E5AC 2ZY2A 5BO0B 1U35C 1M18D 1P3BA 5GXQD 3MGQB 1P3PA 3MVDD 4YM6B 3REJD 2VQRA 3EPHA 4XUJC 1P3PC 1TZYA 3RELD 3C1CB 1P3GB 2HIOB 2ZY5A 3O62D 1P3IA 1AOIB 3B6FD 3C1BB 1P3MA 3NQJB 5AVCA 3AZEB 3B0CW 3MNNA 1P3IC 1N1JB 3AZHD 1P3MC 5GSUA 3UTBB 5AVCC 3AFAD 3MNNC 3AZGD 3WKJD 4NE5A 5C3IB 5GSUC 4UUZB 4WNNB 1M18A 4UPKA 2NZDC 2JSSA 1P3OA 3MVDA 1M18C 3B0DC 3REJA 5GXQC 4H9QA 5FUGB 3MVDC 1WWSA 3REJC 3W96A 1F66B 3RELA 3AN2D 4HGAC 3O62A 3B6FA 3W96C 3X1TB 4XUJB 3RELC 1P3PB 4M6BA 3B6FC 3O62C 1P3LD 2J8PA 3AFAA 3AZGA 3WKJA 3AZHC 3AFAC 4Z2MH 3AZGC 3WKJC 1P3MB 5B1LD 1ID3D 4ZUXB 3AZLD 1S32B 3H0MC 2F2AC 5GSUB 3KXBD 5F99A 3WTPA 2F8ND 2Y2LA 3A6ND 1M19D 2NZDB 4J8WB 4NE6A 1M18B 2YFVA 4KGCD 5GXQB 5AV5D 4DQYB 3B0BA 3MVDB 5CP6D 3AN2C 3REJB 5B31D 3X1SD 1P3LA 4KUDD 1P3LC 3B6FB 3O62B 2F8NH 3AZKD 5B1LA 1ID3A 3WAAD 3AZLA 4YM6D 3AZHB 5B1LC 1ID3C 3KXBA 3AFAB 3AZLC 3AZGB 2IO5B 2Y2HA 2FJ7D 3WKJB 4LD9A 3A6NA 3KXBC 1M19A 3C1CD 2HIOD 5BS7A 4LD9C 3A6NC 4J8XA 1M19C 2XD1A 4KGCA 1BH9A 5BS7C 5CP6A 4KGCC 2ZY3A 5AV5C 3X1SA 5B31A 4KUDA 5CP6C 4H9OB 5CPJA 5B40D 3KUYD 3AYWA 5B31C 3UT9B 3X1SC 4KUDC 3AN2B 1BH8B 3AZFD 5CPJC 3AZKA 3WAAA 4YM6A 3AZKC 4J8VD 4DRBA 3WAAC 4YM6C 1F66D 3C1CA 2HIOA 1AOIA 3H0LC 2LY8A 3C1BA 3AZLB 3C1CC 2YFWB 3NQJA 2F8NK 2HIOC 2L5AA 1AOIC 3KXBB 4XZQD 2F8NB 3H0RC 3A6NB 3LZ0D 2Y2QA 4UUZA 4WNNA 3AZFA 5B40C 4KGCB 5AV5B 1S32D 3AZFC 5B31B 3X1SB 4J8VA 1HTAA 4KUDB 2DQNC 3LZ1D 5FUGA 3MGRB 4J8VC 4J8WD 1F66A 3AZKB 3X1TA 3F6TA 2JCHA 5B1MD 3MGSD 4XUJA 1F66C 3WAAB 3NQUB 1B6WA 3X1TC 1WWIA 2FJ7B 1HQ3D 3P5JB 4XZQC
chains in the Genus database with same CATH topology
3LZ0C 4Z2MG 1JFIB 4ZUXA 1S32A 3AZID 3AZNB 4ZUXC 1S32C 5B40B 3KUYB 5B33B 2NZDA 4J8WA 3AZFB 4NE3A 3REHD 3W97D 5GXQA 4J8WC 3X1VD 4J8VB 5B1MC 3MGSC 2W8SA 3UT9D 2F8NG 3AZJD 4XZQB 2BG1A 3AZHA 3LZ0B 3TU4D 2IO5C 5B31G 2Y2KA 3W97A 5KDMB 3X1VA 3VH6W 3W97C 3LZ1B 3WTPE 1P34D 3X1VC 4H9OA 3UTAD 3UT9A 3AN2A 1BH8A 5B1MB 3MGSB 3UT9C 2G5IC 1HQ3B 3MGRD 3TU4A 5B2JD 5B0YD 3TU4C 1TAFB 1A7WA 2YFWA 4QLCD 2JE5A 5AV9D 1Q9CA 3AZIB 2F8NA 3KWQD 5B0ZD 5G49A 5DNND 3AZMD 1P34C 3X1UD 3REKB 3REHB 3W97B 5AV5A 3UTAC 4G92C 3X1VB 5AY8B 4J8UD 3AZND 4X23D 4WU8D 5GT3D 4CSRB 5B33D 5AV8D 1ZLAD 1B67A 3MGRA 4YS3B 4WU9D 4H9RB 2CV5D 2G5HC 3MGRC 5B24D 2FFFB 3AZJB 5B2JC 4QLCA 3NQUA 3MGPB 1KX5D 3LJAB 2FJ7A 4QLCC 2HUEC 5B0ZA 3TU4B 1P3AD 2Y2NA 3AZMA 2FJ7C 3X1UA 3KWQC 1H3OB 2Y2JA 5B0ZC 5DNNC 3AZMC 3AV1D 5AV6D 1JFIA 3X1UC 3R45B 2BYKB 4J8UA 3AZNA 1P34B 1W2EA 4WU8A 2NQBD 5G49B 5B40A 3KUYA 5B33A 4KHAA 3VH5W 3UTAB 5AVBD 2PYOD 4J8UC 3AZNC 4G92B 4WU8C 3W99D 5JRGB 3W98D 3KUYC 2CV5A 5B33C 3EPKA 5B24A 4WU9C 2CV5C 5CPID 5B24C 3IP4C 2DF4C 1P3BD 4E44A 1KX5C 1P3AA 2Y2MA 5B2JB 1KX3D 5B0YB 2UWXA 2Y2OA 1P3AC 3AV1A 5AV6A 4QLCB 5AV9B 2AROB 2HUEB 1TZYD 4XZQA 3AV1C 4ZBJB 5AV6C 4R8PD 3KWQB 4AWLC 2CWEA 5B0ZB 3LZ0A 1P3ID 5DNNB 3AZMB 2PYOA 5AVBA 3X1UB 3MNND 4WV4B 3WA9D 2PYOC 5AVBC 1KX4D 3W99C 5DNMB 5KDMA 5GT0B 4J8UB 5CPIA 4X23B 4WU8B 5GT3B 3LZ1A 4EO5B 5AV8B 4KHAB 1ZLAB 2Y2PA 2ZM5A 4NFTA 5CPIC 4WU9B 4WJ3C 3LZ1C 2CV5B 3REID 1P3OD 3REKD 1KX3A 1M1AD 5B24B 1P3BC 5B1MA 3MGSA 3B6GD 1KX3C 3LELB 5BNXB 1P3KB 1KX5B 3W96D 5AY8D 4R8PA 2BYMA 1HQ3A 1TZYC 1P3AB 4YS3D 5B32G 4R8PC 1R4VA 1HQ3C 3WA9A 3AV1B 5AV6B 4AWLB 1TAFA 3AV2B 1KX4A 1BFMA 3V9RB 3WA9C 1ULYA 3MGPD 2ZY4A 3AZIA 2NQBB 1KX4C 3LJAD 2PYOB 3B0CT 5AVBB 3AZIC 3W99B 3W98B 3REIA 3REKA 4H9PA 3REHA 1M1AA 5JA4A 5F99D 3WTPD 5E5AB 1P3OC 3REIC 5B32D 3REKC 3B6GA 1U35B 3REHC 5CPIB 1M1AC 5AY8A 3A1IA 3VH6A 3B6GC 4CSRA 1P3BB 5CPKD 1PZRA 5AY8C 4YS3A 1EQZD 1KX3B 4H9RA 5JRGD 3A1KA 3FDDA 1KU5A 1F1EA 4YS3C 3AZJA 3KFUG 1TZYB 3MGPA 4R8PB 2BYMB 3AZJC 3LJAA 1P3IB 4CAYA 3MGPC 5AVCB 3LJAC 3MNNB 4G91C 4H9NA 4Z5TD 5BNVA 1H3OA 5BT1D 3WA9B 1P3FD 1KX4B 5B32A 2AROD 3R45A 4LD9D 5F99C 3WTPC 2BYKA 1P34A 5B32C 4E45A 3B0DB 5CPKA 4J8XD 3UTAA 1P3OB 3REIB 4H9PB 1EQZA 3VH6T 1M1AB 5JRGA 5JA4B 5CPKC 4H9QB 3B6GB 1EQZC 4Z66D 5JRGC 4HGAB 5CPJD 5DNMD 3AYWD 5GT0D 3W96B 3RELB 5B2ID 4JJND 2Y2IA 2RIQA 3MGQD 5B2JA 5B0YA 4Z5TA 3EPJA 3EPLA 1P3FA 5CHLB 3AL0C 2XD5A 5B0YC 4Z5TC 2AROA 5BT1C 5AV9A 3LELD 1P3KD 2RVQD 1P3FC 1Z2CB 4G91B 3KWQA 5AV9C 4CAYB 2AROC 1P3GD 1AOID 5DNNA 4H9SA 3C1BD 4H9NB 4ZBJC 5BNVB 3AZED 5F99B 4H9SC 3WTPB 4J8XC 3UTBD 5B32B 3AV2D 4Z66A 2Y2GA 5DNMA 5GT0A 4X23A 5GT3A 4Z66C 5B2IA 4JJNA 5DNMC 5AV8A 2YFVB 5BO0A 5GT0C 3AYWC 5CPKB 1ZLAA 4X23C 1EQZB 3VH5A 5GT3C 5B2IC 4JJNC 4WU9A 4EO5C 5AV8C 3MGQA 1ZLAC 1P3LB 5E5AD 3MGQC 1U35D 3LELA 5BNXA 1P3KA 1KX5A 3LELC 1P3KC 1ID3B 5B1LB 1P3GA 2RVQC 3X1TD 4XUJD 4Z5TB 4DRAA 1P3PD 3AZEA 1P3GC 1P3FB 4WZSB 1N1JA 3C1BC 3UTBA 3AV2A 3AZEC 4LD9B 3V9RA 1M19B 3UTBC 1T3UA 3KSYA 3AV2C 2NQBA 4J8XB 1P3MD 1BH9B 5C3IC 5AVCD 2NQBC 4ZUXD 3W99A 5CP6B 3W98A 3EG5B 5GSUD 4Z66B 3VH5T 5E5AA 5CPJB 3W98C 3AYWB 1U35A 2NZDD 5B2IB 4JJNB 5E5AC 2ZY2A 5BO0B 1U35C 1M18D 1P3BA 5GXQD 3MGQB 1P3PA 3MVDD 4YM6B 3REJD 2VQRA 3EPHA 4XUJC 1P3PC 1TZYA 3RELD 3C1CB 1P3GB 2HIOB 2ZY5A 3O62D 1P3IA 1AOIB 3B6FD 3C1BB 1P3MA 3NQJB 5AVCA 3AZEB 3B0CW 3MNNA 1P3IC 1N1JB 3AZHD 1P3MC 5GSUA 3UTBB 5AVCC 3AFAD 3MNNC 3AZGD 3WKJD 4NE5A 5C3IB 5GSUC 4UUZB 4WNNB 1M18A 4UPKA 2NZDC 2JSSA 1P3OA 3MVDA 1M18C 3B0DC 3REJA 5GXQC 4H9QA 5FUGB 3MVDC 1WWSA 3REJC 3W96A 1F66B 3RELA 3AN2D 4HGAC 3O62A 3B6FA 3W96C 3X1TB 4XUJB 3RELC 1P3PB 4M6BA 3B6FC 3O62C 1P3LD 2J8PA 3AFAA 3AZGA 3WKJA 3AZHC 3AFAC 4Z2MH 3AZGC 3WKJC 1P3MB 5B1LD 1ID3D 4ZUXB 3AZLD 1S32B 3H0MC 2F2AC 5GSUB 3KXBD 5F99A 3WTPA 2F8ND 2Y2LA 3A6ND 1M19D 2NZDB 4J8WB 4NE6A 1M18B 2YFVA 4KGCD 5GXQB 5AV5D 4DQYB 3B0BA 3MVDB 5CP6D 3AN2C 3REJB 5B31D 3X1SD 1P3LA 4KUDD 1P3LC 3B6FB 3O62B 2F8NH 3AZKD 5B1LA 1ID3A 3WAAD 3AZLA 4YM6D 3AZHB 5B1LC 1ID3C 3KXBA 3AFAB 3AZLC 3AZGB 2IO5B 2Y2HA 2FJ7D 3WKJB 4LD9A 3A6NA 3KXBC 1M19A 3C1CD 2HIOD 5BS7A 4LD9C 3A6NC 4J8XA 1M19C 2XD1A 4KGCA 1BH9A 5BS7C 5CP6A 4KGCC 2ZY3A 5AV5C 3X1SA 5B31A 4KUDA 5CP6C 4H9OB 5CPJA 5B40D 3KUYD 3AYWA 5B31C 3UT9B 3X1SC 4KUDC 3AN2B 1BH8B 3AZFD 5CPJC 3AZKA 3WAAA 4YM6A 3AZKC 4J8VD 4DRBA 3WAAC 4YM6C 1F66D 3C1CA 2HIOA 1AOIA 3H0LC 2LY8A 3C1BA 3AZLB 3C1CC 2YFWB 3NQJA 2F8NK 2HIOC 2L5AA 1AOIC 3KXBB 4XZQD 2F8NB 3H0RC 3A6NB 3LZ0D 2Y2QA 4UUZA 4WNNA 3AZFA 5B40C 4KGCB 5AV5B 1S32D 3AZFC 5B31B 3X1SB 4J8VA 1HTAA 4KUDB 2DQNC 3LZ1D 5FUGA 3MGRB 4J8VC 4J8WD 1F66A 3AZKB 3X1TA 3F6TA 2JCHA 5B1MD 3MGSD 4XUJA 1F66C 3WAAB 3NQUB 1B6WA 3X1TC 1WWIA 2FJ7B 1HQ3D 3P5JB 4XZQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LZ0 C;  4Z2M G;  1JFI B;  4ZUX A;  1S32 A;  3AZI D;  3AZN B;  4ZUX C;  1S32 C;  5B40 B;  3KUY B;  5B33 B;  2NZD A;  4J8W A;  3AZF B;  4NE3 A;  3REH D;  3W97 D;  5GXQ A;  4J8W C;  3X1V D;  4J8V B;  5B1M C;  3MGS C;  3UT9 D;  2F8N G;  3AZJ D;  4XZQ B;  3AZH A;  3LZ0 B;  3TU4 D;  2IO5 C;  5B31 G;  3W97 A;  5KDM B;  3X1V A;  3VH6 W;  3W97 C;  3LZ1 B;  3WTP E;  1P34 D;  3X1V C;  4H9O A;  3UTA D;  3UT9 A;  3AN2 A;  1BH8 A;  5B1M B;  3MGS B;  3UT9 C;  1HQ3 B;  3MGR D;  3TU4 A;  5B2J D;  5B0Y D;  3TU4 C;  1TAF B;  1A7W A;  2YFW A;  4QLC D;  5AV9 D;  1Q9C A;  3AZI B;  2F8N A;  3KWQ D;  5B0Z D;  5G49 A;  5DNN D;  3AZM D;  1P34 C;  3X1U D;  3REK B;  3REH B;  3W97 B;  5AV5 A;  3UTA C;  4G92 C;  3X1V B;  5AY8 B;  4J8U D;  3AZN D;  4X23 D;  4WU8 D;  5GT3 D;  4CSR B;  5B33 D;  5AV8 D;  1ZLA D;  1B67 A;  3MGR A;  4YS3 B;  4WU9 D;  4H9R B;  2CV5 D;  3MGR C;  5B24 D;  3AZJ B;  5B2J C;  4QLC A;  3NQU A;  3MGP B;  1KX5 D;  3LJA B;  2FJ7 A;  4QLC C;  2HUE C;  5B0Z A;  3TU4 B;  1P3A D;  3AZM A;  2FJ7 C;  3X1U A;  3KWQ C;  1H3O B;  5B0Z C;  5DNN C;  3AZM C;  3AV1 D;  5AV6 D;  1JFI A;  3X1U C;  3R45 B;  2BYK B;  4J8U A;  3AZN A;  1P34 B;  4WU8 A;  2NQB D;  5G49 B;  5B40 A;  3KUY A;  5B33 A;  4KHA A;  3VH5 W;  3UTA B;  5AVB D;  2PYO D;  4J8U C;  3AZN C;  4G92 B;  4WU8 C;  3W99 D;  5JRG B;  3W98 D;  3KUY C;  2CV5 A;  5B33 C;  5B24 A;  4WU9 C;  2CV5 C;  5CPI D;  5B24 C;  1P3B D;  4E44 A;  1KX5 C;  1P3A A;  5B2J B;  1KX3 D;  5B0Y B;  1P3A C;  3AV1 A;  5AV6 A;  4QLC B;  5AV9 B;  2ARO B;  2HUE B;  1TZY D;  4XZQ A;  3AV1 C;  4ZBJ B;  5AV6 C;  4R8P D;  3KWQ B;  4AWL C;  2CWE A;  5B0Z B;  3LZ0 A;  1P3I D;  5DNN B;  3AZM B;  2PYO A;  5AVB A;  3X1U B;  3MNN D;  4WV4 B;  3WA9 D;  2PYO C;  5AVB C;  1KX4 D;  3W99 C;  5DNM B;  5KDM A;  5GT0 B;  4J8U B;  5CPI A;  4X23 B;  4WU8 B;  5GT3 B;  3LZ1 A;  4EO5 B;  5AV8 B;  4KHA B;  1ZLA B;  4NFT A;  5CPI C;  4WU9 B;  3LZ1 C;  2CV5 B;  3REI D;  1P3O D;  3REK D;  1KX3 A;  1M1A D;  5B24 B;  1P3B C;  5B1M A;  3MGS A;  3B6G D;  1KX3 C;  3LEL B;  5BNX B;  1P3K B;  1KX5 B;  3W96 D;  5AY8 D;  4R8P A;  2BYM A;  1HQ3 A;  1TZY C;  1P3A B;  4YS3 D;  5B32 G;  4R8P C;  1R4V A;  1HQ3 C;  3WA9 A;  3AV1 B;  5AV6 B;  4AWL B;  1TAF A;  3AV2 B;  1KX4 A;  1BFM A;  3V9R B;  3WA9 C;  1ULY A;  3MGP D;  3AZI A;  2NQB B;  1KX4 C;  3LJA D;  2PYO B;  3B0C T;  5AVB B;  3AZI C;  3W99 B;  3W98 B;  3REI A;  3REK A;  4H9P A;  3REH A;  1M1A A;  5JA4 A;  5F99 D;  3WTP D;  5E5A B;  1P3O C;  3REI C;  5B32 D;  3REK C;  3B6G A;  1U35 B;  3REH C;  5CPI B;  1M1A C;  5AY8 A;  3VH6 A;  3B6G C;  4CSR A;  1P3B B;  5CPK D;  5AY8 C;  4YS3 A;  1EQZ D;  1KX3 B;  4H9R A;  5JRG D;  1KU5 A;  1F1E A;  4YS3 C;  3AZJ A;  1TZY B;  3MGP A;  4R8P B;  2BYM B;  3AZJ C;  3LJA A;  1P3I B;  4CAY A;  3MGP C;  5AVC B;  3LJA C;  3MNN B;  4G91 C;  4H9N A;  4Z5T D;  5BNV A;  1H3O A;  5BT1 D;  3WA9 B;  1P3F D;  1KX4 B;  5B32 A;  2ARO D;  3R45 A;  4LD9 D;  5F99 C;  3WTP C;  2BYK A;  1P34 A;  5B32 C;  4E45 A;  3B0D B;  5CPK A;  4J8X D;  3UTA A;  1P3O B;  3REI B;  4H9P B;  1EQZ A;  3VH6 T;  1M1A B;  5JRG A;  5JA4 B;  5CPK C;  4H9Q B;  3B6G B;  1EQZ C;  4Z66 D;  5JRG C;  4HGA B;  5CPJ D;  5DNM D;  3AYW D;  5GT0 D;  3W96 B;  3REL B;  5B2I D;  4JJN D;  3MGQ D;  5B2J A;  5B0Y A;  4Z5T A;  1P3F A;  5CHL B;  5B0Y C;  4Z5T C;  2ARO A;  5BT1 C;  5AV9 A;  3LEL D;  1P3K D;  2RVQ D;  1P3F C;  4G91 B;  3KWQ A;  5AV9 C;  4CAY B;  2ARO C;  1P3G D;  1AOI D;  5DNN A;  4H9S A;  3C1B D;  4H9N B;  4ZBJ C;  5BNV B;  3AZE D;  5F99 B;  4H9S C;  3WTP B;  4J8X C;  3UTB D;  5B32 B;  3AV2 D;  4Z66 A;  5DNM A;  5GT0 A;  4X23 A;  5GT3 A;  4Z66 C;  5B2I A;  4JJN A;  5DNM C;  5AV8 A;  2YFV B;  5BO0 A;  5GT0 C;  3AYW C;  5CPK B;  1ZLA A;  4X23 C;  1EQZ B;  3VH5 A;  5GT3 C;  5B2I C;  4JJN C;  4WU9 A;  4EO5 C;  5AV8 C;  3MGQ A;  1ZLA C;  1P3L B;  5E5A D;  3MGQ C;  1U35 D;  3LEL A;  5BNX A;  1P3K A;  1KX5 A;  3LEL C;  1P3K C;  1ID3 B;  5B1L B;  1P3G A;  2RVQ C;  3X1T D;  4XUJ D;  4Z5T B;  4DRA A;  1P3P D;  3AZE A;  1P3G C;  1P3F B;  4WZS B;  1N1J A;  3C1B C;  3UTB A;  3AV2 A;  3AZE C;  4LD9 B;  3V9R A;  1M19 B;  3UTB C;  3KSY A;  3AV2 C;  2NQB A;  4J8X B;  1P3M D;  1BH9 B;  5C3I C;  5AVC D;  2NQB C;  4ZUX D;  3W99 A;  5CP6 B;  3W98 A;  5GSU D;  4Z66 B;  3VH5 T;  5E5A A;  5CPJ B;  3W98 C;  3AYW B;  1U35 A;  2NZD D;  5B2I B;  4JJN B;  5E5A C;  5BO0 B;  1U35 C;  1M18 D;  1P3B A;  5GXQ D;  3MGQ B;  1P3P A;  3MVD D;  4YM6 B;  3REJ D;  4XUJ C;  1P3P C;  1TZY A;  3REL D;  3C1C B;  1P3G B;  2HIO B;  3O62 D;  1AOI B;  1P3I A;  3B6F D;  3C1B B;  1P3M A;  3NQJ B;  5AVC A;  3AZE B;  3B0C W;  3MNN A;  1P3I C;  1N1J B;  3AZH D;  1P3M C;  5GSU A;  3UTB B;  5AVC C;  3AFA D;  3MNN C;  3AZG D;  3WKJ D;  4NE5 A;  5C3I B;  5GSU C;  4UUZ B;  4WNN B;  1M18 A;  2NZD C;  2JSS A;  1P3O A;  3MVD A;  1M18 C;  3B0D C;  3REJ A;  5GXQ C;  4H9Q A;  5FUG B;  3MVD C;  1WWS A;  3REJ C;  3W96 A;  1F66 B;  3REL A;  3AN2 D;  4HGA C;  3O62 A;  3B6F A;  3W96 C;  3X1T B;  4XUJ B;  3REL C;  1P3P B;  4M6B A;  3B6F C;  3O62 C;  1P3L D;  3AFA A;  3AZG A;  3WKJ A;  3AZH C;  3AFA C;  4Z2M H;  3AZG C;  3WKJ C;  1P3M B;  5B1L D;  1ID3 D;  4ZUX B;  3AZL D;  1S32 B;  5GSU B;  3KXB D;  5F99 A;  3WTP A;  2F8N D;  3A6N D;  1M19 D;  2NZD B;  4J8W B;  4NE6 A;  1M18 B;  2YFV A;  4KGC D;  5GXQ B;  5AV5 D;  3B0B A;  3MVD B;  5CP6 D;  3AN2 C;  3REJ B;  5B31 D;  3X1S D;  1P3L A;  4KUD D;  1P3L C;  3B6F B;  3O62 B;  2F8N H;  3AZK D;  5B1L A;  1ID3 A;  3WAA D;  3AZL A;  4YM6 D;  3AZH B;  5B1L C;  1ID3 C;  3KXB A;  3AFA B;  3AZL C;  3AZG B;  2IO5 B;  2FJ7 D;  3WKJ B;  4LD9 A;  3A6N A;  3KXB C;  1M19 A;  3C1C D;  2HIO D;  5BS7 A;  4LD9 C;  3A6N C;  4J8X A;  1M19 C;  4KGC A;  1BH9 A;  5BS7 C;  5CP6 A;  4KGC C;  5AV5 C;  3X1S A;  5B31 A;  4KUD A;  5CP6 C;  4H9O B;  5CPJ A;  5B40 D;  3KUY D;  3AYW A;  5B31 C;  3UT9 B;  3X1S C;  4KUD C;  3AN2 B;  1BH8 B;  3AZF D;  5CPJ C;  3AZK A;  3WAA A;  4YM6 A;  3AZK C;  4J8V D;  4DRB A;  3WAA C;  4YM6 C;  1F66 D;  3C1C A;  2HIO A;  1AOI A;  2LY8 A;  3C1B A;  3AZL B;  3C1C C;  2YFW B;  3NQJ A;  2F8N K;  2HIO C;  2L5A A;  1AOI C;  3KXB B;  4XZQ D;  2F8N B;  3A6N B;  3LZ0 D;  4UUZ A;  4WNN A;  3AZF A;  5B40 C;  4KGC B;  5AV5 B;  1S32 D;  3AZF C;  5B31 B;  3X1S B;  4J8V A;  1HTA A;  4KUD B;  3LZ1 D;  5FUG A;  3MGR B;  4J8V C;  4J8W D;  1F66 A;  3AZK B;  3X1T A;  5B1M D;  3MGS D;  1F66 C;  3WAA B;  4XUJ A;  3NQU B;  1B6W A;  3X1T C;  1WWI A;  2FJ7 B;  1HQ3 D;  4XZQ C; 
#chains in the Genus database with same CATH topology
 3LZ0 C;  4Z2M G;  1JFI B;  4ZUX A;  1S32 A;  3AZI D;  3AZN B;  4ZUX C;  1S32 C;  5B40 B;  3KUY B;  5B33 B;  2NZD A;  4J8W A;  3AZF B;  4NE3 A;  3REH D;  3W97 D;  5GXQ A;  4J8W C;  3X1V D;  4J8V B;  5B1M C;  3MGS C;  2W8S A;  3UT9 D;  2F8N G;  3AZJ D;  4XZQ B;  2BG1 A;  3AZH A;  3LZ0 B;  3TU4 D;  2IO5 C;  5B31 G;  2Y2K A;  3W97 A;  5KDM B;  3X1V A;  3VH6 W;  3W97 C;  3LZ1 B;  3WTP E;  1P34 D;  3X1V C;  4H9O A;  3UTA D;  3UT9 A;  3AN2 A;  1BH8 A;  5B1M B;  3MGS B;  3UT9 C;  2G5I C;  1HQ3 B;  3MGR D;  3TU4 A;  5B2J D;  5B0Y D;  3TU4 C;  1TAF B;  1A7W A;  2YFW A;  4QLC D;  2JE5 A;  5AV9 D;  1Q9C A;  3AZI B;  2F8N A;  3KWQ D;  5B0Z D;  5G49 A;  5DNN D;  3AZM D;  1P34 C;  3X1U D;  3REK B;  3REH B;  3W97 B;  5AV5 A;  3UTA C;  4G92 C;  3X1V B;  5AY8 B;  4J8U D;  3AZN D;  4X23 D;  4WU8 D;  5GT3 D;  4CSR B;  5B33 D;  5AV8 D;  1ZLA D;  1B67 A;  3MGR A;  4YS3 B;  4WU9 D;  4H9R B;  2CV5 D;  2G5H C;  3MGR C;  5B24 D;  2FFF B;  3AZJ B;  5B2J C;  4QLC A;  3NQU A;  3MGP B;  1KX5 D;  3LJA B;  2FJ7 A;  4QLC C;  2HUE C;  5B0Z A;  3TU4 B;  1P3A D;  2Y2N A;  3AZM A;  2FJ7 C;  3X1U A;  3KWQ C;  1H3O B;  2Y2J A;  5B0Z C;  5DNN C;  3AZM C;  3AV1 D;  5AV6 D;  1JFI A;  3X1U C;  3R45 B;  2BYK B;  4J8U A;  3AZN A;  1P34 B;  1W2E A;  4WU8 A;  2NQB D;  5G49 B;  5B40 A;  3KUY A;  5B33 A;  4KHA A;  3VH5 W;  3UTA B;  5AVB D;  2PYO D;  4J8U C;  3AZN C;  4G92 B;  4WU8 C;  3W99 D;  5JRG B;  3W98 D;  3KUY C;  2CV5 A;  5B33 C;  3EPK A;  5B24 A;  4WU9 C;  2CV5 C;  5CPI D;  5B24 C;  3IP4 C;  2DF4 C;  1P3B D;  4E44 A;  1KX5 C;  1P3A A;  2Y2M A;  5B2J B;  1KX3 D;  5B0Y B;  2UWX A;  2Y2O A;  1P3A C;  3AV1 A;  5AV6 A;  4QLC B;  5AV9 B;  2ARO B;  2HUE B;  1TZY D;  4XZQ A;  3AV1 C;  4ZBJ B;  5AV6 C;  4R8P D;  3KWQ B;  4AWL C;  2CWE A;  5B0Z B;  3LZ0 A;  1P3I D;  5DNN B;  3AZM B;  2PYO A;  5AVB A;  3X1U B;  3MNN D;  4WV4 B;  3WA9 D;  2PYO C;  5AVB C;  1KX4 D;  3W99 C;  5DNM B;  5KDM A;  5GT0 B;  4J8U B;  5CPI A;  4X23 B;  4WU8 B;  5GT3 B;  3LZ1 A;  4EO5 B;  5AV8 B;  4KHA B;  1ZLA B;  2Y2P A;  2ZM5 A;  4NFT A;  5CPI C;  4WU9 B;  4WJ3 C;  3LZ1 C;  2CV5 B;  3REI D;  1P3O D;  3REK D;  1KX3 A;  1M1A D;  5B24 B;  1P3B C;  5B1M A;  3MGS A;  3B6G D;  1KX3 C;  3LEL B;  5BNX B;  1P3K B;  1KX5 B;  3W96 D;  5AY8 D;  4R8P A;  2BYM A;  1HQ3 A;  1TZY C;  1P3A B;  4YS3 D;  5B32 G;  4R8P C;  1R4V A;  1HQ3 C;  3WA9 A;  3AV1 B;  5AV6 B;  4AWL B;  1TAF A;  3AV2 B;  1KX4 A;  1BFM A;  3V9R B;  3WA9 C;  1ULY A;  3MGP D;  2ZY4 A;  3AZI A;  2NQB B;  1KX4 C;  3LJA D;  2PYO B;  3B0C T;  5AVB B;  3AZI C;  3W99 B;  3W98 B;  3REI A;  3REK A;  4H9P A;  3REH A;  1M1A A;  5JA4 A;  5F99 D;  3WTP D;  5E5A B;  1P3O C;  3REI C;  5B32 D;  3REK C;  3B6G A;  1U35 B;  3REH C;  5CPI B;  1M1A C;  5AY8 A;  3A1I A;  3VH6 A;  3B6G C;  4CSR A;  1P3B B;  5CPK D;  1PZR A;  5AY8 C;  4YS3 A;  1EQZ D;  1KX3 B;  4H9R A;  5JRG D;  3A1K A;  3FDD A;  1KU5 A;  1F1E A;  4YS3 C;  3AZJ A;  3KFU G;  1TZY B;  3MGP A;  4R8P B;  2BYM B;  3AZJ C;  3LJA A;  1P3I B;  4CAY A;  3MGP C;  5AVC B;  3LJA C;  3MNN B;  4G91 C;  4H9N A;  4Z5T D;  5BNV A;  1H3O A;  5BT1 D;  3WA9 B;  1P3F D;  1KX4 B;  5B32 A;  2ARO D;  3R45 A;  4LD9 D;  5F99 C;  3WTP C;  2BYK A;  1P34 A;  5B32 C;  4E45 A;  3B0D B;  5CPK A;  4J8X D;  3UTA A;  1P3O B;  3REI B;  4H9P B;  1EQZ A;  3VH6 T;  1M1A B;  5JRG A;  5JA4 B;  5CPK C;  4H9Q B;  3B6G B;  1EQZ C;  4Z66 D;  5JRG C;  4HGA B;  5CPJ D;  5DNM D;  3AYW D;  5GT0 D;  3W96 B;  3REL B;  5B2I D;  4JJN D;  2Y2I A;  2RIQ A;  3MGQ D;  5B2J A;  5B0Y A;  4Z5T A;  3EPJ A;  3EPL A;  1P3F A;  5CHL B;  3AL0 C;  2XD5 A;  5B0Y C;  4Z5T C;  2ARO A;  5BT1 C;  5AV9 A;  3LEL D;  1P3K D;  2RVQ D;  1P3F C;  1Z2C B;  4G91 B;  3KWQ A;  5AV9 C;  4CAY B;  2ARO C;  1P3G D;  1AOI D;  5DNN A;  4H9S A;  3C1B D;  4H9N B;  4ZBJ C;  5BNV B;  3AZE D;  5F99 B;  4H9S C;  3WTP B;  4J8X C;  3UTB D;  5B32 B;  3AV2 D;  4Z66 A;  2Y2G A;  5DNM A;  5GT0 A;  4X23 A;  5GT3 A;  4Z66 C;  5B2I A;  4JJN A;  5DNM C;  5AV8 A;  2YFV B;  5BO0 A;  5GT0 C;  3AYW C;  5CPK B;  1ZLA A;  4X23 C;  1EQZ B;  3VH5 A;  5GT3 C;  5B2I C;  4JJN C;  4WU9 A;  4EO5 C;  5AV8 C;  3MGQ A;  1ZLA C;  1P3L B;  5E5A D;  3MGQ C;  1U35 D;  3LEL A;  5BNX A;  1P3K A;  1KX5 A;  3LEL C;  1P3K C;  1ID3 B;  5B1L B;  1P3G A;  2RVQ C;  3X1T D;  4XUJ D;  4Z5T B;  4DRA A;  1P3P D;  3AZE A;  1P3G C;  1P3F B;  4WZS B;  1N1J A;  3C1B C;  3UTB A;  3AV2 A;  3AZE C;  4LD9 B;  3V9R A;  1M19 B;  3UTB C;  1T3U A;  3KSY A;  3AV2 C;  2NQB A;  4J8X B;  1P3M D;  1BH9 B;  5C3I C;  5AVC D;  2NQB C;  4ZUX D;  3W99 A;  5CP6 B;  3W98 A;  3EG5 B;  5GSU D;  4Z66 B;  3VH5 T;  5E5A A;  5CPJ B;  3W98 C;  3AYW B;  1U35 A;  2NZD D;  5B2I B;  4JJN B;  5E5A C;  2ZY2 A;  5BO0 B;  1U35 C;  1M18 D;  1P3B A;  5GXQ D;  3MGQ B;  1P3P A;  3MVD D;  4YM6 B;  3REJ D;  2VQR A;  3EPH A;  4XUJ C;  1P3P C;  1TZY A;  3REL D;  3C1C B;  1P3G B;  2HIO B;  2ZY5 A;  3O62 D;  1P3I A;  1AOI B;  3B6F D;  3C1B B;  1P3M A;  3NQJ B;  5AVC A;  3AZE B;  3B0C W;  3MNN A;  1P3I C;  1N1J B;  3AZH D;  1P3M C;  5GSU A;  3UTB B;  5AVC C;  3AFA D;  3MNN C;  3AZG D;  3WKJ D;  4NE5 A;  5C3I B;  5GSU C;  4UUZ B;  4WNN B;  1M18 A;  4UPK A;  2NZD C;  2JSS A;  1P3O A;  3MVD A;  1M18 C;  3B0D C;  3REJ A;  5GXQ C;  4H9Q A;  5FUG B;  3MVD C;  1WWS A;  3REJ C;  3W96 A;  1F66 B;  3REL A;  3AN2 D;  4HGA C;  3O62 A;  3B6F A;  3W96 C;  3X1T B;  4XUJ B;  3REL C;  1P3P B;  4M6B A;  3B6F C;  3O62 C;  1P3L D;  2J8P A;  3AFA A;  3AZG A;  3WKJ A;  3AZH C;  3AFA C;  4Z2M H;  3AZG C;  3WKJ C;  1P3M B;  5B1L D;  1ID3 D;  4ZUX B;  3AZL D;  1S32 B;  3H0M C;  2F2A C;  5GSU B;  3KXB D;  5F99 A;  3WTP A;  2F8N D;  2Y2L A;  3A6N D;  1M19 D;  2NZD B;  4J8W B;  4NE6 A;  1M18 B;  2YFV A;  4KGC D;  5GXQ B;  5AV5 D;  4DQY B;  3B0B A;  3MVD B;  5CP6 D;  3AN2 C;  3REJ B;  5B31 D;  3X1S D;  1P3L A;  4KUD D;  1P3L C;  3B6F B;  3O62 B;  2F8N H;  3AZK D;  5B1L A;  1ID3 A;  3WAA D;  3AZL A;  4YM6 D;  3AZH B;  5B1L C;  1ID3 C;  3KXB A;  3AFA B;  3AZL C;  3AZG B;  2IO5 B;  2Y2H A;  2FJ7 D;  3WKJ B;  4LD9 A;  3A6N A;  3KXB C;  1M19 A;  3C1C D;  2HIO D;  5BS7 A;  4LD9 C;  3A6N C;  4J8X A;  1M19 C;  2XD1 A;  4KGC A;  1BH9 A;  5BS7 C;  5CP6 A;  4KGC C;  2ZY3 A;  5AV5 C;  3X1S A;  5B31 A;  4KUD A;  5CP6 C;  4H9O B;  5CPJ A;  5B40 D;  3KUY D;  3AYW A;  5B31 C;  3UT9 B;  3X1S C;  4KUD C;  3AN2 B;  1BH8 B;  3AZF D;  5CPJ C;  3AZK A;  3WAA A;  4YM6 A;  3AZK C;  4J8V D;  4DRB A;  3WAA C;  4YM6 C;  1F66 D;  3C1C A;  2HIO A;  1AOI A;  3H0L C;  2LY8 A;  3C1B A;  3AZL B;  3C1C C;  2YFW B;  3NQJ A;  2F8N K;  2HIO C;  2L5A A;  1AOI C;  3KXB B;  4XZQ D;  2F8N B;  3H0R C;  3A6N B;  3LZ0 D;  2Y2Q A;  4UUZ A;  4WNN A;  3AZF A;  5B40 C;  4KGC B;  5AV5 B;  1S32 D;  3AZF C;  5B31 B;  3X1S B;  4J8V A;  1HTA A;  4KUD B;  2DQN C;  3LZ1 D;  5FUG A;  3MGR B;  4J8V C;  4J8W D;  1F66 A;  3AZK B;  3X1T A;  3F6T A;  2JCH A;  5B1M D;  3MGS D;  4XUJ A;  1F66 C;  3WAA B;  3NQU B;  1B6W A;  3X1T C;  1WWI A;  2FJ7 B;  1HQ3 D;  3P5J B;  4XZQ C; 
#chains in the Genus database with same CATH homology
 3LZ0 C;  4Z2M G;  1JFI B;  4ZUX A;  1S32 A;  3AZI D;  3AZN B;  4ZUX C;  1S32 C;  5B40 B;  3KUY B;  5B33 B;  2NZD A;  4J8W A;  3AZF B;  4NE3 A;  3REH D;  3W97 D;  5GXQ A;  4J8W C;  3X1V D;  4J8V B;  5B1M C;  3MGS C;  2W8S A;  3UT9 D;  2F8N G;  3AZJ D;  4XZQ B;  2BG1 A;  3AZH A;  3LZ0 B;  3TU4 D;  2IO5 C;  5B31 G;  2Y2K A;  3W97 A;  5KDM B;  3X1V A;  3VH6 W;  3W97 C;  3LZ1 B;  3WTP E;  1P34 D;  3X1V C;  4H9O A;  3UTA D;  3UT9 A;  3AN2 A;  1BH8 A;  5B1M B;  3MGS B;  3UT9 C;  2G5I C;  1HQ3 B;  3MGR D;  3TU4 A;  5B2J D;  5B0Y D;  3TU4 C;  1TAF B;  1A7W A;  2YFW A;  4QLC D;  2JE5 A;  5AV9 D;  1Q9C A;  3AZI B;  2F8N A;  3KWQ D;  5B0Z D;  5G49 A;  5DNN D;  3AZM D;  1P34 C;  3X1U D;  3REK B;  3REH B;  3W97 B;  5AV5 A;  3UTA C;  4G92 C;  3X1V B;  5AY8 B;  4J8U D;  3AZN D;  4X23 D;  4WU8 D;  5GT3 D;  4CSR B;  5B33 D;  5AV8 D;  1ZLA D;  1B67 A;  3MGR A;  4YS3 B;  4WU9 D;  4H9R B;  2CV5 D;  2G5H C;  3MGR C;  5B24 D;  2FFF B;  3AZJ B;  5B2J C;  4QLC A;  3NQU A;  3MGP B;  1KX5 D;  3LJA B;  2FJ7 A;  4QLC C;  2HUE C;  5B0Z A;  3TU4 B;  1P3A D;  2Y2N A;  3AZM A;  2FJ7 C;  3X1U A;  3KWQ C;  1H3O B;  2Y2J A;  5B0Z C;  5DNN C;  3AZM C;  3AV1 D;  5AV6 D;  1JFI A;  3X1U C;  3R45 B;  2BYK B;  4J8U A;  3AZN A;  1P34 B;  1W2E A;  4WU8 A;  2NQB D;  5G49 B;  5B40 A;  3KUY A;  5B33 A;  4KHA A;  3VH5 W;  3UTA B;  5AVB D;  2PYO D;  4J8U C;  3AZN C;  4G92 B;  4WU8 C;  3W99 D;  5JRG B;  3W98 D;  3KUY C;  2CV5 A;  5B33 C;  3EPK A;  5B24 A;  4WU9 C;  2CV5 C;  5CPI D;  5B24 C;  3IP4 C;  2DF4 C;  1P3B D;  4E44 A;  1KX5 C;  1P3A A;  2Y2M A;  5B2J B;  1KX3 D;  5B0Y B;  2UWX A;  2Y2O A;  1P3A C;  3AV1 A;  5AV6 A;  4QLC B;  5AV9 B;  2ARO B;  2HUE B;  1TZY D;  4XZQ A;  3AV1 C;  4ZBJ B;  5AV6 C;  4R8P D;  3KWQ B;  4AWL C;  2CWE A;  5B0Z B;  3LZ0 A;  1P3I D;  5DNN B;  3AZM B;  2PYO A;  5AVB A;  3X1U B;  3MNN D;  4WV4 B;  3WA9 D;  2PYO C;  5AVB C;  1KX4 D;  3W99 C;  5DNM B;  5KDM A;  5GT0 B;  4J8U B;  5CPI A;  4X23 B;  4WU8 B;  5GT3 B;  3LZ1 A;  4EO5 B;  5AV8 B;  4KHA B;  1ZLA B;  2Y2P A;  2ZM5 A;  4NFT A;  5CPI C;  4WU9 B;  4WJ3 C;  3LZ1 C;  2CV5 B;  3REI D;  1P3O D;  3REK D;  1KX3 A;  1M1A D;  5B24 B;  1P3B C;  5B1M A;  3MGS A;  3B6G D;  1KX3 C;  3LEL B;  5BNX B;  1P3K B;  1KX5 B;  3W96 D;  5AY8 D;  4R8P A;  2BYM A;  1HQ3 A;  1TZY C;  1P3A B;  4YS3 D;  5B32 G;  4R8P C;  1R4V A;  1HQ3 C;  3WA9 A;  3AV1 B;  5AV6 B;  4AWL B;  1TAF A;  3AV2 B;  1KX4 A;  1BFM A;  3V9R B;  3WA9 C;  1ULY A;  3MGP D;  2ZY4 A;  3AZI A;  2NQB B;  1KX4 C;  3LJA D;  2PYO B;  3B0C T;  5AVB B;  3AZI C;  3W99 B;  3W98 B;  3REI A;  3REK A;  4H9P A;  3REH A;  1M1A A;  5JA4 A;  5F99 D;  3WTP D;  5E5A B;  1P3O C;  3REI C;  5B32 D;  3REK C;  3B6G A;  1U35 B;  3REH C;  5CPI B;  1M1A C;  5AY8 A;  3A1I A;  3VH6 A;  3B6G C;  4CSR A;  1P3B B;  5CPK D;  1PZR A;  5AY8 C;  4YS3 A;  1EQZ D;  1KX3 B;  4H9R A;  5JRG D;  3A1K A;  3FDD A;  1KU5 A;  1F1E A;  4YS3 C;  3AZJ A;  3KFU G;  1TZY B;  3MGP A;  4R8P B;  2BYM B;  3AZJ C;  3LJA A;  1P3I B;  4CAY A;  3MGP C;  5AVC B;  3LJA C;  3MNN B;  4G91 C;  4H9N A;  4Z5T D;  5BNV A;  1H3O A;  5BT1 D;  3WA9 B;  1P3F D;  1KX4 B;  5B32 A;  2ARO D;  3R45 A;  4LD9 D;  5F99 C;  3WTP C;  2BYK A;  1P34 A;  5B32 C;  4E45 A;  3B0D B;  5CPK A;  4J8X D;  3UTA A;  1P3O B;  3REI B;  4H9P B;  1EQZ A;  3VH6 T;  1M1A B;  5JRG A;  5JA4 B;  5CPK C;  4H9Q B;  3B6G B;  1EQZ C;  4Z66 D;  5JRG C;  4HGA B;  5CPJ D;  5DNM D;  3AYW D;  5GT0 D;  3W96 B;  3REL B;  5B2I D;  4JJN D;  2Y2I A;  2RIQ A;  3MGQ D;  5B2J A;  5B0Y A;  4Z5T A;  3EPJ A;  3EPL A;  1P3F A;  5CHL B;  3AL0 C;  2XD5 A;  5B0Y C;  4Z5T C;  2ARO A;  5BT1 C;  5AV9 A;  3LEL D;  1P3K D;  2RVQ D;  1P3F C;  1Z2C B;  4G91 B;  3KWQ A;  5AV9 C;  4CAY B;  2ARO C;  1P3G D;  1AOI D;  5DNN A;  4H9S A;  3C1B D;  4H9N B;  4ZBJ C;  5BNV B;  3AZE D;  5F99 B;  4H9S C;  3WTP B;  4J8X C;  3UTB D;  5B32 B;  3AV2 D;  4Z66 A;  2Y2G A;  5DNM A;  5GT0 A;  4X23 A;  5GT3 A;  4Z66 C;  5B2I A;  4JJN A;  5DNM C;  5AV8 A;  2YFV B;  5BO0 A;  5GT0 C;  3AYW C;  5CPK B;  1ZLA A;  4X23 C;  1EQZ B;  3VH5 A;  5GT3 C;  5B2I C;  4JJN C;  4WU9 A;  4EO5 C;  5AV8 C;  3MGQ A;  1ZLA C;  1P3L B;  5E5A D;  3MGQ C;  1U35 D;  3LEL A;  5BNX A;  1P3K A;  1KX5 A;  3LEL C;  1P3K C;  1ID3 B;  5B1L B;  1P3G A;  2RVQ C;  3X1T D;  4XUJ D;  4Z5T B;  4DRA A;  1P3P D;  3AZE A;  1P3G C;  1P3F B;  4WZS B;  1N1J A;  3C1B C;  3UTB A;  3AV2 A;  3AZE C;  4LD9 B;  3V9R A;  1M19 B;  3UTB C;  1T3U A;  3KSY A;  3AV2 C;  2NQB A;  4J8X B;  1P3M D;  1BH9 B;  5C3I C;  5AVC D;  2NQB C;  4ZUX D;  3W99 A;  5CP6 B;  3W98 A;  3EG5 B;  5GSU D;  4Z66 B;  3VH5 T;  5E5A A;  5CPJ B;  3W98 C;  3AYW B;  1U35 A;  2NZD D;  5B2I B;  4JJN B;  5E5A C;  2ZY2 A;  5BO0 B;  1U35 C;  1M18 D;  1P3B A;  5GXQ D;  3MGQ B;  1P3P A;  3MVD D;  4YM6 B;  3REJ D;  2VQR A;  3EPH A;  4XUJ C;  1P3P C;  1TZY A;  3REL D;  3C1C B;  1P3G B;  2HIO B;  2ZY5 A;  3O62 D;  1P3I A;  1AOI B;  3B6F D;  3C1B B;  1P3M A;  3NQJ B;  5AVC A;  3AZE B;  3B0C W;  3MNN A;  1P3I C;  1N1J B;  3AZH D;  1P3M C;  5GSU A;  3UTB B;  5AVC C;  3AFA D;  3MNN C;  3AZG D;  3WKJ D;  4NE5 A;  5C3I B;  5GSU C;  4UUZ B;  4WNN B;  1M18 A;  4UPK A;  2NZD C;  2JSS A;  1P3O A;  3MVD A;  1M18 C;  3B0D C;  3REJ A;  5GXQ C;  4H9Q A;  5FUG B;  3MVD C;  1WWS A;  3REJ C;  3W96 A;  1F66 B;  3REL A;  3AN2 D;  4HGA C;  3O62 A;  3B6F A;  3W96 C;  3X1T B;  4XUJ B;  3REL C;  1P3P B;  4M6B A;  3B6F C;  3O62 C;  1P3L D;  2J8P A;  3AFA A;  3AZG A;  3WKJ A;  3AZH C;  3AFA C;  4Z2M H;  3AZG C;  3WKJ C;  1P3M B;  5B1L D;  1ID3 D;  4ZUX B;  3AZL D;  1S32 B;  3H0M C;  2F2A C;  5GSU B;  3KXB D;  5F99 A;  3WTP A;  2F8N D;  2Y2L A;  3A6N D;  1M19 D;  2NZD B;  4J8W B;  4NE6 A;  1M18 B;  2YFV A;  4KGC D;  5GXQ B;  5AV5 D;  4DQY B;  3B0B A;  3MVD B;  5CP6 D;  3AN2 C;  3REJ B;  5B31 D;  3X1S D;  1P3L A;  4KUD D;  1P3L C;  3B6F B;  3O62 B;  2F8N H;  3AZK D;  5B1L A;  1ID3 A;  3WAA D;  3AZL A;  4YM6 D;  3AZH B;  5B1L C;  1ID3 C;  3KXB A;  3AFA B;  3AZL C;  3AZG B;  2IO5 B;  2Y2H A;  2FJ7 D;  3WKJ B;  4LD9 A;  3A6N A;  3KXB C;  1M19 A;  3C1C D;  2HIO D;  5BS7 A;  4LD9 C;  3A6N C;  4J8X A;  1M19 C;  2XD1 A;  4KGC A;  1BH9 A;  5BS7 C;  5CP6 A;  4KGC C;  2ZY3 A;  5AV5 C;  3X1S A;  5B31 A;  4KUD A;  5CP6 C;  4H9O B;  5CPJ A;  5B40 D;  3KUY D;  3AYW A;  5B31 C;  3UT9 B;  3X1S C;  4KUD C;  3AN2 B;  1BH8 B;  3AZF D;  5CPJ C;  3AZK A;  3WAA A;  4YM6 A;  3AZK C;  4J8V D;  4DRB A;  3WAA C;  4YM6 C;  1F66 D;  3C1C A;  2HIO A;  1AOI A;  3H0L C;  2LY8 A;  3C1B A;  3AZL B;  3C1C C;  2YFW B;  3NQJ A;  2F8N K;  2HIO C;  2L5A A;  1AOI C;  3KXB B;  4XZQ D;  2F8N B;  3H0R C;  3A6N B;  3LZ0 D;  2Y2Q A;  4UUZ A;  4WNN A;  3AZF A;  5B40 C;  4KGC B;  5AV5 B;  1S32 D;  3AZF C;  5B31 B;  3X1S B;  4J8V A;  1HTA A;  4KUD B;  2DQN C;  3LZ1 D;  5FUG A;  3MGR B;  4J8V C;  4J8W D;  1F66 A;  3AZK B;  3X1T A;  3F6T A;  2JCH A;  5B1M D;  3MGS D;  4XUJ A;  1F66 C;  3WAA B;  3NQU B;  1B6W A;  3X1T C;  1WWI A;  2FJ7 B;  1HQ3 D;  3P5J B;  4XZQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...