4X25A

Structural basis for mutation-induced destabilization of profilin 1 in als
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
134
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTFNVTVTKTDKTLVLLTGKEGVHGGLINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin-1
publication title Structural basis for mutation-induced destabilization of profilin 1 in ALS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 39
structure length 134
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4x25A00
1F2KA 2B95A 3MS6A 2V8FA 4D60A 2VK3A 1SKOA 1K0KA 3DAVA 3NECA 5EM0A 5EM1A 1G5UA 2PAVP 4FTXA 3CPTA 3T12B 3T1SA 2ZL1A 1SKOB 2HZ5A 1AWIA 3U4LP 3LGOA 3MSHA 5FDSA 3NULA 3KYEA 3LEQA 2JKFA 3T1XA 1PNEA 1YPRA 3T1RA 3L7HA 1VETA 1SZVA 1Z09A 3CPTB 1A0KA 1ACFA 5FEFA 4QWOA 3UB5P 3L9KA 1FIKA 1CQAA 2BTFP 2V8CA 1CJFA 2ACGA 4FUWA 3D9YA 3T1QB 1J3WA 1VEUA 1VETB 4ESPA 1HLUP 5EVEA 1PRQA 2JKGA 2ZL1B 2PRFA 4X1MA 1PFLA 1D1JA 4X1LA 4X25A 5FEGA 2E8JA 3CHWP 1CF0A 2PBDP 1VEUB 1Y4OA 5EV0A 1FILA
chains in the Genus database with same CATH superfamily
3WS0A 2Y2GA 4Q0IA 4OPQA 3MFDA 3FC7A 2HP9A 4RX2A 3GSGA 1H5XA 2JHEA 3CUEA 4JXWA 1EWZA 2C6WB 4BBUA 3Q81A 4LV0A 3C8CA 3IBJA 4DRTA 5JYOA 2J7VA 4HJ6A 1JWZA 3VFHA 1S0WA 5C5KA 3W4PA 1DJCA 2V9AA 2WKHA 3O87A 4MCWA 2NUTC 5M19A 5HDSA 3VP0A 4B88A 5FQ9A 5CRFA 3NULA 3QNCA 1E3UD 2VKSA 4DXCA 1D7EA 2QJ5A 1RGZA 3T4KA 3UPOA 1YT4A 2WAFA 2JBFA 4CPKA 2PU2A 1PI4A 2H5SA 1P97A 4MN6A 4MLLA 2A24B 3P98A 2XF3A 4XUZA 3QNBA 4NKPA 2B5RA 3RTYA 1T18A 1YMXA 5HL6A 2ZC5B 1ES2A 2Z6CA 4HQAA 1KVMA 1W8YA 1HLUP 4UA9A 4WEKA 4N1HA 2PRFA 3IWQA 2WUQA 1D1JA 1PWCA 5HARA 2IWCA 2W27A 1BSGA 3SS5A 1YLZA 3N8LA 2EXAA 1SHVA 3LR4A 5TJJA 1K4EA 1N9BA 2V20A 3NHQA 2EX6A 4KG2A 5I5LA 1K57C 1H8MA 3UNWA 4C75A 1N4OA 1S4SA 4WUJA 2A24A 5TGFA 3IWOA 1MKIA 3HLEA 4HBTA 4KENB 4O7DA 5HZHA 3MJQA 5J8XA 4X69A 5MC7A 4DMZA 3C30A 2D02A 4DXBA 3T12B 4NG2A 4QY5A 2EX8A 4I3IA 2EFXA 5FI6A 2JE5A 2KOIA 3FYZA 5I94A 2ZQ8A 3T4TA 3UE3A 3FWLA 3BYDA 4P6BA 1TEMA 2Q9NA 2CMNA 4BL2A 4OVDA 3L7HA 2QZ6A 3OPPA 3CWFA 3GTCA 5HWWA 2HDSA 3Q82A 1ESIA 3OPRA 5DF7A 1OTDA 3N4IA 3I7JA 3C38A 4OOMA 4ZAMA 5U47A 3EWKA 1ZHHB 3DTIA 1OMEA 3LIBA 3T1QB 1TS6A 2PDRA 4GKUA 2H28A 4EW7A 5EOEA 4OP8A 1I2WA 2V1AA 4HJ4A 1Z6FA 3PBQA 3G32A 2G7UA 3RFBA 3BQ8A 1S4RA 3OLOA 2QPNA 2P9VA 5EVID 1KGGA 5CHMA 3GVBA 2Y91A 3G6OA 2W1RA 1STZA 1XXMA 2OAP1 2LB5A 1V9YA 3A0VA 3HVFA 1LL5A 4DE0A 3O5YA 4ZDXA 3R7WB 1PW8A 3PHYA 4BBVA 4DE3A 5FI2A 4EBNA 1K0KA 5G18A 2W3EA 2VX8A 4BMWA 3MZFA 3NIAA 2EA9A 3C7VA 1O07A 4WBGA 5E2HA 5FSRA 5E2GA 5EVIB 3O88A 1IYPA 4KG5A 3T4SA 1IELA 1TS8A 4GNUA 2ZC3B 1YLYA 3CPTA 5FA7A 4E6WA 4OH0A 3TSGA 4H6JA 1SKOB 2P04A 4ME4A 1AWIA 3MMHA 2ZC7A 3NOPC 4KZ5A 4LRZE 4MN5A 3LEZA 4EERA 3V39A 1YM1A 3Q7VB 4MEZA 3OPLA 1K56D 2HDUA 5CGXA 4IHQA 4EUZA 3VSLA 4E3OA 2Y2OA 3HUMA 1ZG4A 3S4XA 4EETB 4KZ9A 5AQ7A 1T1BA 1FIKA 1CQAA 4GB7A 3ZG9B 3LY3A 4JXSA 2K7SA 4HESA 1S6RA 5EVIA 3S7PA 1PI5A 3H9WA 4GOGA 2BG1A 2VA0A 3QP4A 4X1MA 2Y59A 3D4FA 4R3AA 3A3IA 4BD0A 1JTGA 3CHWP 2O9CA 2KDKA 3Q7VA 1T1CA 1VEUB 1E25A 4E04A 3RXXA 3BW6A 3HUOA 4ZTKA 2XLNA 2JKRI 3F1NB 2WKEA 4PKYG 3H82B 4DE2A 3K3DA 3HLGA 2WAEA 1FCMA 4ZBEA 4R4RA 1E4DA 2X01A 3PAEA 4P6ZM 3V67A 4LFUA 2XFSA 3BEBA 2V1ZA 4UQIS 1IFQA 1GCEA 1K56A 1MY8A 1S1YA 4K08A 3GRJA 1K55C 4LGWA 4X55A 4F3LA 4FH4A 4M3KA 5CERA 4EQIA 1F5MA 2W3DA 3UMDA 2DCFA 3T1XA 2OWHA 4YNRA 2LB9A 4S2OA 2ZD8A 1SZVA 1VETA 3VFFA 2PYRA 4WYYA 4LLOB 4S2PA 3PBTA 3IF6B 3SS4A 1C3BA 4AFIA 1L0EA 2WYXA 4IVIA 3LIAA 3G2YA 5DTTA 2GNXA 3F1OB 3UDXA 1W5DA 2RCXA 1TDGA 1YSQA 4LRYC 5L2FA 3VOLA 3SH7A 2PD8A 2OLVA 4OONA 4JGPA 5AQBA 1YQSA 2W3HA 5GL9A 2R9WA 1BLHA 4OPYA 2PR6A 4GN2A 2WGWB 4E3NA 5HWVA 3BFCA 3FKWA 2R78A 3V50A 3OC2A 5HWTA 3VE3A 3OBFA 3IF6A 1IEMA 5IU1A 5J7EA 3E98A 4IBXA 5L09A 3ZYTA 4HP9A 1KOUA 1ES4A 3HLFA 5AVEA 5DKLA 2J3TC 3ZFZA 2XK1A 5HAQA 3DTMA 3IXGA 1G5UA 5FL3A 4MMNA 3ZVTA 1NRJA 1SKFA 2XH9A 5FASA 4MDZA 2O0YA 3UE6A 3WRZA 4EWFA 2PYPA 3P09A 3MKEA 1ES5A 4DE1A 4Y17A 3UPNA 4BENA 5IHVA 2WGWA 4LENA 4IBRA 3NC8A 5AQ9A 2FZ0A 4ID4A 5HAIA 1LI0A 1W7FA 4XT2A 1G6AA 4BLMA 3G4PA 2OOLA 3PAGA 2X02A 1XGIA 3E2KA 1ZG6A 3F1PB 4Y7PA 1UGUA 3D9YA 2Y2NA 1BTLA 3BWLA 3SH9A 1OTEA 2VV6A 3IS2B 2XROA 3WS1A 3ZHHA 2V0UA 4KZ8A 2J9PA 4A5RA 2Z2MB 4OQIA 3DWZA 2Z2LB 4GW9A 4PAUA 1RGYA 3DTKA 3TG9A 1OJGA 3T4JA 5HX9A 1ESUA 1F2KA 5D3OA 1K25A 5GLBA 3P7NA 3K2NA 2EWVA 1PW1A 4CLCE 1XP4A 1S67L 1P9RA 1M6KA 1YKDA 4EESA 4LV1A 4WF0A 2M7UA 3QP2A 4X68A 3ISGA 3CAXA 4ARZA 4NETA 3LUQA 4FSFA 2Q9MA 3U4LP 3HJIA 5FQMA 4ETXA 2GZAA 2AVXA 3QP6A 3MSHA 1BUEA 1K38A 4UQIM 3NOTC 3T1RA 1OTIA 1I5QA 3K3CA 2ZQCA 1Z09A 4Q0HA 1ACFA 3FPVA 4P85A 4BD1A 4LV3A 3FG8A 4N9KA 4ZJ3A 1Q2PA 5CHJA 3BECA 2VZWA 1AXBA 1IKGA 4K0XA 4ZJ1A 3FZCA 2ZBBA 1L0FA 4GD8A 1QMEA 4OPRA 1LSVA 1PWDA 2OAQ1 2VV7A 5DTSA 3P01A 2VEAA 2H0YA 4HJ3A 2D01A 3MZEA 3UB6A 4O0PA 3JYIA 4KZ4A 4PM9A 3MKFA 2L1MA 4LRXC 1CF0A 3MXSA 4LCLA 4S2KA 1FSYA 2ZMFA 1KDWA 2QWSA 1Y4OA 1MWTA 2FH5A 1LI9A 4OLDA 3HL9A 1VHMA 3BM6A 3S7QA 4R0QA 3N8SA 2B95A 3MS6A 5HFOA 1BLSA 3AGFA 3LFVA 3IXBA 4NXBA 3VV4A 1ERQA 1PZPA 1XJ6A 3WS5A 3AGEA 3HBRA 4EQ1A 3CI6A 2OV5A 2PHYA 4P0MA 2MJ6A 2OSUA 5GHXA 2WADA 4GDBA 3T50A 4IUKA 4P6ZS 2FFYA 3S7OA 3M6HA 4OP5A 4OQGA 4N9LA 3LYXA 5FAQA 1XA7A 1LSXA 2HJ9C 3FPWA 1P0ZA 3V3RA 3EGDC 4QY6A 1K54C 5HDDA 2O9AA 1G28A 2WKIA 5FI7A 4KUKA 3PBSA 4QWOA 1E3UA 1K57A 5EPHA 3RXWA 1OTAA 4WN5A 5A91A 1EW0A 1OT6A 1SDEA 2H0TA 5DVAA 1BZAA 2O9BA 1H0MA 3EEHA 3ITAA 1F9IA 3C4PA 3HJKA 1D06A 3EQUA 1XPBA 3SS3A 3PBRA 2XEPA 3H7WB 3MQQA 1W8QA 4G3KA 4YFMA 1BLPA 3SH8A 3WWXA 1XGJA 2GDNA 3Q07A 1DP6A 3B47A 1GHIA 4CJNA 5F6AA 4Y0TA 1JWVA 5GHYA 4HHDA 5HD5A 3G31A 5KSHA 1RCJA 1N9NA 1N9LA 3IH9A 3WRTA 4HH2A 3G2ZA 3LO7A 2QMIA 2Y2HA 3D72A 2XA7M 4D60A 5F1GA 5F83A 3V5MA 4CLCC 1WYCA 1DY6A 4LV2A 4R70A 1V9ZA 3UB7A 4ETZA 4EBPA 4Q0JA 5EM1A 1CEGA 1XKZA 4OKPA 2ZM0A 3VOZA 3UB8A 3ULFA 1KVLA 5DFXA 3TJZC 2W1TB 2E8IA 3M2JA 4RQ9A 1CI8A 3H7WA 3NI9A 4E3MA 2CC1A 2QYBA 5TBMB 2ZQ9A 3PYPA 3KYEA 1TVFA 1NYYA 5EVLA 1ALQA 4JGRA 3UE0A 3ZNYA 2XR0A 3W2ZA 4L9FA 3IX3A 5TR7A 1KE0A 2BTFP 4E3LA 5HSQA 2B18A 3MXRA 4S2NC 1MBLA 2EFUA 2JN7A 3VP3A 3D3OA 4JBFA 4R23A 3GV9A 5EUAA 1XFNA 4II7A 1U60A 4JXVA 3R7WA 1PFLA 1L0GA 2W3FA 2ZQAA 3C5AA 4PM7A 2ZM8A 5A8BA 3IQAA 4UA7A 4QHCA 4NXGA 1T19A 1BYWA 2KLIA 4R6LA 1WYBA 2VGKA 2YKHA 2KX6A 4PM5A 1SKOA 4IUHA 2PT7A 3MR0A 3IBRA 1L2SA 1NLZA 1LHYA 1IYSA 3SW1A 1JWPA 1MKMA 2ZMAA 2DMWA 1PZOA 3T4LA 3WS2A 3PTEA 5E43A 3QP1A 3LI8A 5DF8A 2Y2LA 3UDIA 1FCOA 2IWDA 1Q2QA 1G68A 3PBNA 1XJ3A 2P74A 3LEQA 4FCFA 4NK3A 3OPHA 5CGWA 1TDLA 3HLDA 3NDEA 1ZKJA 1OTBA 1VB6A 2HP5A 1NRFA 3HLBA 4IJGA 3UB5P 3Q7ZA 4S2MA 2I72A 3MBZA 4JF5A 1CJFA 1K6SA 4DDYA 3A3JA 2HP6A 1SDNA 4FUWA 1MWSA 3ZDJA 1P9WA 1GA9A 1EROA 4L9EA 1VEUA 1DP8A 3PBOA 2EX2A 4JF6A 3KSFA 4Y5FA 1PRQA 4YOFA 1KGEA 4JGOA 2ZL1B 4HH3A 1GHPA 5FQKA 3F1NA 3MFXA 4Y2FA 4S2LA 3T4OA 2J3TD 3H82A 1K55A 1XJ2A 3IF5A 4HP4A 2JKRM 4JKTA 4GS9B 3G35A 5DJTA 5CEDA 5A90A 4PHTA 4QB8A 3V3SA 1YLJA 5CEBA 1DP9A 2VK3A 3A0RA 3AGDA 1YLTA 1FQGA 4RA7A 4UHUA 4OQ0A 5HDCA 4PPRA 2GX5A 1OJ5A 3C4OA 4NXFA 3ZG8B 4DN0A 3NDGA 3WS4A 4E6XA 4N1XA 3HLWA 4YINA 1IYOA 5GLDA 5F1FA 2QJ7A 2M7VA 3G30A 2ZL1A 4WZ5C 2HJEA 3GECA 3VMAA 4DF6A 2DNSA 4Y0UA 1HTZA 3LCEA 2J8YA 4PMAA 1UWPX 2R9XA 3UDFA 2ZC4B 5HL1A 4I39A 3F1OA 5E2EA 1LL9A 3CITA 1NZOA 5G4ZA 4DJ2A 1J9MA 1H8ZA 2A3UA 4R38A 5FEFA 3ZG0A 4GDNA 4WM9A 2OLUA 3KSGA 3W4QA 2OWJA 3QP5A 4BL3A 3PR6A 2V1BA 4Y15A 1LL8A 2I9VA 2JCHA 3NCKA 4LCMA 5L8MA 2Y2KA 3TE8A 4KQDA 4G3WA 4GCZA 2HDRA 5E2FA 3VOYA 1UWNX 4X25A 2P08A 1FSWA 3MXQA 1HD8A 1WE4A 2PBDP 2BASA 5GLAA 3HLCA 2J80A 3UN7A 5AVFA 4JXGA 1XX2A 2K31A 4X56A 3NJAA 3IHBA 3O3VA 5DFYA 4PM8A 5G4YA 2K2NA 2XA7S 5FATA 5KZHA 3UPPA 5KMWA 4R3BA 2IA2A 3UB9A 2WKPA 3LI9A 1LT0A 4D2OA 4E3IA 5A92A 3GQZA 4U3TA 1T1AA 1GSXA 2Z6DA 3B3XA 4HY8A 4FD8A 4PM6A 3F1PA 4WZ4A 4HOIA 4OPZA 2BLSA 3UY6A 2XD5A 4KZBA 3S22A 3EGXC 5DTKA 3CG5A 1YLPA 5LBRA 4F94A 3IS2A 3LIFA 3IXHA 4HBUA 2WZZA 5J4EA 4BBTA 4P87A 4XXRA 4B4XA 2DRWA 4UAAA 3CUEC 5CECA 2ACGA 3BRMA 5IS1A 4HNBA 4Z1WA 3KYQA 4HI4A 1RP5A 3E4PA 1BT5A 4WMCD 3LIDA 3W4OA 5HPIA 1JTDA 2ZC6B 3N7WA 5EECA 4UEYA 4EEPA 5CGSA 5HAPA 2EXBA 1JNUA 4X1LA 2GJ3A 4GLQA 1FOFA 4JF4A 3LY4A 3W8KA 4RVAA 2Y2PA 1K6RA 1FR6A 3PXPA 3VP4A 2X71A 1CI9A 4WL9A 3FV7A 2V8FA 5AJGA 1BULA 1FCNA 2NUPC 3N6IA 4G3VA 3GDIA 1LLBA 1TF1A 4BJPA 2JKTI 4XUXA 5AQAA 4KUOA 3E4QA 1YLWA 4Y13A 5A93A 4GZBA 2WGVA 1KE4A 2PBYA 5CTMA 3R4KA 3A3FA 4EEUA 5HD3A 2ZOIA 3C7UA 5CTNA 3KO6A 3E4OA 4WELA 3IX4A 1W79A 3IH8A 2B02A 1CK3A 2UWXA 2EWWA 4I3JA 1MXOA 4S2IA 3OOVA 1NXYA 5CHUA 3UE1A 5L10A 1VM1A 5DJUA 4WMCA 1QMFA 5M1AA 5FAPA 2XDMA 2PD7A 1GHMA 1ES3A 1OT9A 1IYQA 3KX0X 1KE3A 2VV8A 2L4RA 3ZNTA 4ESPA 1YAXA 5EE8A 4CLCD 5DF9A 2JC7A 2JKTM 4RYEA 4OQHA 2O99A 3HUNA 4GJ4A 2HF6A 1H3QA 1X0OA 4EV4A 3NOUC 4H8RA 2E8JA 2WK0A 1ONGA 2ZQ7A 2W0NA 3UMEA 3ZG5A 2PR5A 1K54A 1TS0A 1FILA 3LR3A 3BQAA 2W3GA 4Q8IA 2ZM2A 1CEFA 4YWZA 4JLFA 3EOIA 2P9VB 2Y79A 1ONHA 4HIAA 3BFGA 3DAVA 1MWRA 4CLCB 3BFFA 1DJBA 4U0XA 3IXDA 4MN7A 4DDSA 3E0YA 5F68A 3OCNA 5J3WA 4BQMA 3IHAA 4MBKA 4EBLA 3DWKA 4K91A 4NXEA 4KQRA 4JGQA 2QHKA 4N92A 1OPXA 3KSIA 1Y54A 4X6TA 4OLGA 3S1YA 4B4ZA 1GA0A 3VSKA 1L3LA 3JVUA 3CPTB 3SOIA 1A0KA 2Y2IA 3VP2A 2WKRA 2ZJ9A 4H6JB 4R4SA 4NEED 4QJGA 3L9KA 1NYMA 3Q1FA 3BJNA 2WKQA 4L9GA 1PYYA 3VP1A 4CLCA 3ICYA 2HGVA 1G6OA 5EFWA 4RX3A 1DRMA 3KYZA 3O86A 4E3KA 5EVEA 2V0WA 4BWIA 5CX7A 5KIZA 4X53A 3ZQ5A 2VGLM 4QD4A 2YKFA 1W63Q 5FEGA 2XFTA 2XQZA 2HV1A 2WGIA 2QKPA 1ERMA 4DKIA 2XSSA 5EV0A 2W1TA 1MC0A 3ZVWA 5TBMA 3NECA 4U0TA 5EM0A 3A0SA 4S2NA 3BLSA 1K4FA 5EVIC 3MZDA 3DW0A 2XRNA 5L07A 2Y55A 3FKVA 3T1SA 2HZ5A 2HDQA 4B93A 2PU4A 3CZDA 3UO9A 1LSWA 3DTEA 3OCLA 3OZHA 1MZUA 2JKFA 3ZG7B 1YPRA 3NY4A 1TD5A 2FFFB 3HREA 4EXOA 3CMZA 2WZXA 5CXWA 3BY8A 3LIEA 4I3AA 4S2JA 4KG6A 1EI5A 1KDSA 2A49A 4I5SA 1SCWA 3T4QA 4DJ3A 3MQOA 4Z9QA 4MBHA 4F3LB 3BFDA 1IOUA 3MF0A 1H8YA 3B33A 1W63M 4KZ7A 4E3JA 4R1GA 2M1CA 2INWA 1J3WA 1L0DA 3MQ0A 1VETB 5IT5A 5FQJA 4EUVA 3DBAA 1NY0A 1ZC2A 4WEJA 3ITBA 1XFQA 1NWZA 2XGNA 4JPMA 3NBLA 3GMWA 2Y2MA 3QHYA 1XA1A 3JPUA 4K0WA 5HPFA 3VE4A 3EEAA 3BY9A 4C3QA 4L0LA 1DJAA 5KSCA 4KQOA 2IWBA 2EX9A 3BFEA 2ZOHA 5K5BA 3CJMA 3U2AA 1WA9A 2PAVP 4C6YA 4OOLA 4I38A 4O01A 5JYPA 1S66L 1S1ZA 3LICA 5FAOA 5BOHA 5FDHA 1NJ4A 2ZQDA 5FDSA 3ZCZA 1YMSA 3JVVA 3LR5A 1VQQA 4Y3IA 2P7JA 2G2UA 4KZ6A 5HW3A 4KZAA 4EU0A 2VGJA 4FH2A 3IF6C 1HVBA 1NLYA 1FR1A 1XJ4A 3RJUA 4PKYA 2V8CA 5F5YA 4WLAA 1I2SA 2VJWA 1YSPA 5FQIA 5F69A 3TRCA 1MWUA 4GS9A 4LPZA 3IT9A 2Y2JA 4MNRA 3TOIA 1M40A 4WZ5A 5DKKA 1MPLA 2RL3A 4XT2B 4MBFA 1ODVA 3BLMA 4GHIB 4B9OA 1GSWA 4KZ3A 2J9OA 5M18A 1TS7A 4FOFA 4GD6A 2XD1A 4CQHA 3GR2A 2ZMVA 1HZOA 4IVKA 3HCYA 3B42A 3N8RA 1KGFA 4O8GA 1GSVA 4Y0OA 4FTXA 1PWGA 2G2WA 2C5WB 2HPBA 3LR0A 1JVJA 3SZTA 3IX8A 4ZJ2A 3LGOA 1O7EA 3QP8A 4HEFA 5GHZA 1IKIA 2L0WA 4GHIA 1PNEA 3M2KA 3TW8A 4OOYA 1Y28A 3A3DA 1F98A 3CLOA 3C2WA 4ARZB 5FQQA 4QPRA 2V2FF 2Y2QA 4M4XA 2UV0E 1N9OA 1BLCA 3KSHA 1PIOA 1ZTUA 2Y8HA 3ZGAB 2J3WA 5GLCA 2H10A 2A2LA 3S7NA 2JKGA 5EOOA 3IWIA 3A3EA 3EQVA 4QU3A 2ZLYA 4ZRRA 4UA6A 3E2LA 2Q0OA 2VLGA 2Y4AA 4R3JA 4IEDA 4KQQA 3M6BA 2VGLS 3RH8B 3G34A 5F82A 1NZUA 5TFQA
chains in the Genus database with same CATH topology
1F2KA 2B95A 3MS6A 2V8FA 4D60A 2VK3A 1SKOA 1K0KA 3DAVA 3NECA 5EM0A 5EM1A 1G5UA 2PAVP 4FTXA 3CPTA 3T12B 3T1SA 2ZL1A 1SKOB 2HZ5A 1AWIA 3U4LP 3LGOA 3MSHA 5FDSA 3NULA 3KYEA 3LEQA 2JKFA 3T1XA 1PNEA 1YPRA 3T1RA 3L7HA 1VETA 1SZVA 1Z09A 3CPTB 1A0KA 1ACFA 5FEFA 4QWOA 3UB5P 3L9KA 1FIKA 1CQAA 2BTFP 2V8CA 1CJFA 2ACGA 4FUWA 3D9YA 3T1QB 1J3WA 1VEUA 1VETB 4ESPA 1HLUP 5EVEA 1PRQA 2JKGA 2ZL1B 2PRFA 4X1MA 1PFLA 1D1JA 4X1LA 4X25A 5FEGA 2E8JA 3CHWP 1CF0A 2PBDP 1VEUB 1Y4OA 5EV0A 1FILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2K A;  2B95 A;  3MS6 A;  2V8F A;  4D60 A;  2VK3 A;  1SKO A;  1K0K A;  3DAV A;  3NEC A;  5EM0 A;  5EM1 A;  1G5U A;  2PAV P;  4FTX A;  3CPT A;  3T12 B;  3T1S A;  2ZL1 A;  1SKO B;  2HZ5 A;  1AWI A;  3U4L P;  3LGO A;  3MSH A;  5FDS A;  3NUL A;  3KYE A;  3LEQ A;  2JKF A;  3T1X A;  1PNE A;  1YPR A;  3T1R A;  3L7H A;  1VET A;  1SZV A;  1Z09 A;  3CPT B;  1A0K A;  1ACF A;  5FEF A;  4QWO A;  3UB5 P;  3L9K A;  1FIK A;  1CQA A;  2BTF P;  2V8C A;  1CJF A;  2ACG A;  4FUW A;  3D9Y A;  3T1Q B;  1J3W A;  1VEU A;  1VET B;  4ESP A;  1HLU P;  5EVE A;  1PRQ A;  2JKG A;  2ZL1 B;  2PRF A;  4X1M A;  1PFL A;  1D1J A;  4X1L A;  4X25 A;  5FEG A;  2E8J A;  3CHW P;  1CF0 A;  2PBD P;  1VEU B;  1Y4O A;  5EV0 A;  1FIL A; 
#chains in the Genus database with same CATH topology
 3WS0 A;  2Y2G A;  4Q0I A;  4OPQ A;  3MFD A;  3FC7 A;  2HP9 A;  4RX2 A;  3GSG A;  1H5X A;  2JHE A;  3CUE A;  4JXW A;  1EWZ A;  2C6W B;  4BBU A;  3Q81 A;  4LV0 A;  3C8C A;  3IBJ A;  4DRT A;  5JYO A;  2J7V A;  4HJ6 A;  1JWZ A;  3VFH A;  1S0W A;  5C5K A;  3W4P A;  1DJC A;  2V9A A;  2WKH A;  3O87 A;  4MCW A;  2NUT C;  5M19 A;  5HDS A;  3VP0 A;  4B88 A;  5FQ9 A;  5CRF A;  3NUL A;  3QNC A;  1E3U D;  2VKS A;  4DXC A;  1D7E A;  2QJ5 A;  1RGZ A;  3T4K A;  3UPO A;  1YT4 A;  2WAF A;  2JBF A;  4CPK A;  2PU2 A;  1PI4 A;  2H5S A;  1P97 A;  4MN6 A;  4MLL A;  2A24 B;  3P98 A;  2XF3 A;  4XUZ A;  3QNB A;  4NKP A;  2B5R A;  3RTY A;  1T18 A;  1YMX A;  5HL6 A;  2ZC5 B;  1ES2 A;  2Z6C A;  4HQA A;  1KVM A;  1W8Y A;  1HLU P;  4UA9 A;  4WEK A;  4N1H A;  2PRF A;  3IWQ A;  2WUQ A;  1D1J A;  1PWC A;  5HAR A;  2IWC A;  2W27 A;  1BSG A;  3SS5 A;  1YLZ A;  3N8L A;  2EXA A;  1SHV A;  3LR4 A;  5TJJ A;  1K4E A;  1N9B A;  2V20 A;  3NHQ A;  2EX6 A;  4KG2 A;  5I5L A;  1K57 C;  1H8M A;  3UNW A;  4C75 A;  1N4O A;  1S4S A;  4WUJ A;  2A24 A;  5TGF A;  3IWO A;  1MKI A;  3HLE A;  4HBT A;  4KEN B;  4O7D A;  5HZH A;  3MJQ A;  5J8X A;  4X69 A;  5MC7 A;  4DMZ A;  3C30 A;  2D02 A;  4DXB A;  3T12 B;  4NG2 A;  4QY5 A;  2EX8 A;  4I3I A;  2EFX A;  5FI6 A;  2JE5 A;  2KOI A;  3FYZ A;  5I94 A;  2ZQ8 A;  3T4T A;  3UE3 A;  3FWL A;  3BYD A;  4P6B A;  1TEM A;  2Q9N A;  2CMN A;  4BL2 A;  4OVD A;  3L7H A;  2QZ6 A;  3OPP A;  3CWF A;  3GTC A;  5HWW A;  2HDS A;  3Q82 A;  1ESI A;  3OPR A;  5DF7 A;  1OTD A;  3N4I A;  3I7J A;  3C38 A;  4OOM A;  4ZAM A;  5U47 A;  3EWK A;  1ZHH B;  3DTI A;  1OME A;  3LIB A;  3T1Q B;  1TS6 A;  2PDR A;  4GKU A;  2H28 A;  4EW7 A;  5EOE A;  4OP8 A;  1I2W A;  2V1A A;  4HJ4 A;  1Z6F A;  3PBQ A;  3G32 A;  2G7U A;  3RFB A;  3BQ8 A;  1S4R A;  3OLO A;  2QPN A;  2P9V A;  5EVI D;  1KGG A;  5CHM A;  3GVB A;  2Y91 A;  3G6O A;  2W1R A;  1STZ A;  1XXM A;  2OAP 1;  2LB5 A;  1V9Y A;  3A0V A;  3HVF A;  1LL5 A;  4DE0 A;  3O5Y A;  4ZDX A;  3R7W B;  1PW8 A;  3PHY A;  4BBV A;  4DE3 A;  5FI2 A;  4EBN A;  1K0K A;  5G18 A;  2W3E A;  2VX8 A;  4BMW A;  3MZF A;  3NIA A;  2EA9 A;  3C7V A;  1O07 A;  4WBG A;  5E2H A;  5FSR A;  5E2G A;  5EVI B;  3O88 A;  1IYP A;  4KG5 A;  3T4S A;  1IEL A;  1TS8 A;  4GNU A;  2ZC3 B;  1YLY A;  3CPT A;  5FA7 A;  4E6W A;  4OH0 A;  3TSG A;  4H6J A;  1SKO B;  2P04 A;  4ME4 A;  1AWI A;  3MMH A;  2ZC7 A;  3NOP C;  4KZ5 A;  4LRZ E;  4MN5 A;  3LEZ A;  4EER A;  3V39 A;  1YM1 A;  3Q7V B;  4MEZ A;  3OPL A;  1K56 D;  2HDU A;  5CGX A;  4IHQ A;  4EUZ A;  3VSL A;  4E3O A;  2Y2O A;  3HUM A;  1ZG4 A;  3S4X A;  4EET B;  4KZ9 A;  5AQ7 A;  1T1B A;  1FIK A;  1CQA A;  4GB7 A;  3ZG9 B;  3LY3 A;  4JXS A;  2K7S A;  4HES A;  1S6R A;  5EVI A;  3S7P A;  1PI5 A;  3H9W A;  4GOG A;  2BG1 A;  2VA0 A;  3QP4 A;  4X1M A;  2Y59 A;  3D4F A;  4R3A A;  3A3I A;  4BD0 A;  1JTG A;  3CHW P;  2O9C A;  2KDK A;  3Q7V A;  1T1C A;  1VEU B;  1E25 A;  4E04 A;  3RXX A;  3BW6 A;  3HUO A;  4ZTK A;  2XLN A;  2JKR I;  3F1N B;  2WKE A;  4PKY G;  3H82 B;  4DE2 A;  3K3D A;  3HLG A;  2WAE A;  1FCM A;  4ZBE A;  4R4R A;  1E4D A;  2X01 A;  3PAE A;  4P6Z M;  3V67 A;  4LFU A;  2XFS A;  3BEB A;  2V1Z A;  4UQI S;  1IFQ A;  1GCE A;  1K56 A;  1MY8 A;  1S1Y A;  4K08 A;  3GRJ A;  1K55 C;  4LGW A;  4X55 A;  4F3L A;  4FH4 A;  4M3K A;  5CER A;  4EQI A;  1F5M A;  2W3D A;  3UMD A;  2DCF A;  3T1X A;  2OWH A;  4YNR A;  2LB9 A;  4S2O A;  2ZD8 A;  1SZV A;  1VET A;  3VFF A;  2PYR A;  4WYY A;  4LLO B;  4S2P A;  3PBT A;  3IF6 B;  3SS4 A;  1C3B A;  4AFI A;  1L0E A;  2WYX A;  4IVI A;  3LIA A;  3G2Y A;  5DTT A;  2GNX A;  3F1O B;  3UDX A;  1W5D A;  2RCX A;  1TDG A;  1YSQ A;  4LRY C;  5L2F A;  3VOL A;  3SH7 A;  2PD8 A;  2OLV A;  4OON A;  4JGP A;  5AQB A;  1YQS A;  2W3H A;  5GL9 A;  2R9W A;  1BLH A;  4OPY A;  2PR6 A;  4GN2 A;  2WGW B;  4E3N A;  5HWV A;  3BFC A;  3FKW A;  2R78 A;  3V50 A;  3OC2 A;  5HWT A;  3VE3 A;  3OBF A;  3IF6 A;  1IEM A;  5IU1 A;  5J7E A;  3E98 A;  4IBX A;  5L09 A;  3ZYT A;  4HP9 A;  1KOU A;  1ES4 A;  3HLF A;  5AVE A;  5DKL A;  2J3T C;  3ZFZ A;  2XK1 A;  5HAQ A;  3DTM A;  3IXG A;  1G5U A;  5FL3 A;  4MMN A;  3ZVT A;  1NRJ A;  1SKF A;  2XH9 A;  5FAS A;  4MDZ A;  2O0Y A;  3UE6 A;  3WRZ A;  4EWF A;  2PYP A;  3P09 A;  3MKE A;  1ES5 A;  4DE1 A;  4Y17 A;  3UPN A;  4BEN A;  5IHV A;  2WGW A;  4LEN A;  4IBR A;  3NC8 A;  5AQ9 A;  2FZ0 A;  4ID4 A;  5HAI A;  1LI0 A;  1W7F A;  4XT2 A;  1G6A A;  4BLM A;  3G4P A;  2OOL A;  3PAG A;  2X02 A;  1XGI A;  3E2K A;  1ZG6 A;  3F1P B;  4Y7P A;  1UGU A;  3D9Y A;  2Y2N A;  1BTL A;  3BWL A;  3SH9 A;  1OTE A;  2VV6 A;  3IS2 B;  2XRO A;  3WS1 A;  3ZHH A;  2V0U A;  4KZ8 A;  2J9P A;  4A5R A;  2Z2M B;  4OQI A;  3DWZ A;  2Z2L B;  4GW9 A;  4PAU A;  1RGY A;  3DTK A;  3TG9 A;  1OJG A;  3T4J A;  5HX9 A;  1ESU A;  1F2K A;  5D3O A;  1K25 A;  5GLB A;  3P7N A;  3K2N A;  2EWV A;  1PW1 A;  4CLC E;  1XP4 A;  1S67 L;  1P9R A;  1M6K A;  1YKD A;  4EES A;  4LV1 A;  4WF0 A;  2M7U A;  3QP2 A;  4X68 A;  3ISG A;  3CAX A;  4ARZ A;  4NET A;  3LUQ A;  4FSF A;  2Q9M A;  3U4L P;  3HJI A;  5FQM A;  4ETX A;  2GZA A;  2AVX A;  3QP6 A;  3MSH A;  1BUE A;  1K38 A;  4UQI M;  3NOT C;  3T1R A;  1OTI A;  1I5Q A;  3K3C A;  2ZQC A;  1Z09 A;  4Q0H A;  1ACF A;  3FPV A;  4P85 A;  4BD1 A;  4LV3 A;  3FG8 A;  4N9K A;  4ZJ3 A;  1Q2P A;  5CHJ A;  3BEC A;  2VZW A;  1AXB A;  1IKG A;  4K0X A;  4ZJ1 A;  3FZC A;  2ZBB A;  1L0F A;  4GD8 A;  1QME A;  4OPR A;  1LSV A;  1PWD A;  2OAQ 1;  2VV7 A;  5DTS A;  3P01 A;  2VEA A;  2H0Y A;  4HJ3 A;  2D01 A;  3MZE A;  3UB6 A;  4O0P A;  3JYI A;  4KZ4 A;  4PM9 A;  3MKF A;  2L1M A;  4LRX C;  1CF0 A;  3MXS A;  4LCL A;  4S2K A;  1FSY A;  2ZMF A;  1KDW A;  2QWS A;  1Y4O A;  1MWT A;  2FH5 A;  1LI9 A;  4OLD A;  3HL9 A;  1VHM A;  3BM6 A;  3S7Q A;  4R0Q A;  3N8S A;  2B95 A;  3MS6 A;  5HFO A;  1BLS A;  3AGF A;  3LFV A;  3IXB A;  4NXB A;  3VV4 A;  1ERQ A;  1PZP A;  1XJ6 A;  3WS5 A;  3AGE A;  3HBR A;  4EQ1 A;  3CI6 A;  2OV5 A;  2PHY A;  4P0M A;  2MJ6 A;  2OSU A;  5GHX A;  2WAD A;  4GDB A;  3T50 A;  4IUK A;  4P6Z S;  2FFY A;  3S7O A;  3M6H A;  4OP5 A;  4OQG A;  4N9L A;  3LYX A;  5FAQ A;  1XA7 A;  1LSX A;  2HJ9 C;  3FPW A;  1P0Z A;  3V3R A;  3EGD C;  4QY6 A;  1K54 C;  5HDD A;  2O9A A;  1G28 A;  2WKI A;  5FI7 A;  4KUK A;  3PBS A;  4QWO A;  1E3U A;  1K57 A;  5EPH A;  3RXW A;  1OTA A;  4WN5 A;  5A91 A;  1EW0 A;  1OT6 A;  1SDE A;  2H0T A;  5DVA A;  1BZA A;  2O9B A;  1H0M A;  3EEH A;  3ITA A;  1F9I A;  3C4P A;  3HJK A;  1D06 A;  3EQU A;  1XPB A;  3SS3 A;  3PBR A;  2XEP A;  3H7W B;  3MQQ A;  1W8Q A;  4G3K A;  4YFM A;  1BLP A;  3SH8 A;  3WWX A;  1XGJ A;  2GDN A;  3Q07 A;  1DP6 A;  3B47 A;  1GHI A;  4CJN A;  5F6A A;  4Y0T A;  1JWV A;  5GHY A;  4HHD A;  5HD5 A;  3G31 A;  5KSH A;  1RCJ A;  1N9N A;  1N9L A;  3IH9 A;  3WRT A;  4HH2 A;  3G2Z A;  3LO7 A;  2QMI A;  2Y2H A;  3D72 A;  2XA7 M;  4D60 A;  5F1G A;  5F83 A;  3V5M A;  4CLC C;  1WYC A;  1DY6 A;  4LV2 A;  4R70 A;  1V9Z A;  3UB7 A;  4ETZ A;  4EBP A;  4Q0J A;  5EM1 A;  1CEG A;  1XKZ A;  4OKP A;  2ZM0 A;  3VOZ A;  3UB8 A;  3ULF A;  1KVL A;  5DFX A;  3TJZ C;  2W1T B;  2E8I A;  3M2J A;  4RQ9 A;  1CI8 A;  3H7W A;  3NI9 A;  4E3M A;  2CC1 A;  2QYB A;  5TBM B;  2ZQ9 A;  3PYP A;  3KYE A;  1TVF A;  1NYY A;  5EVL A;  1ALQ A;  4JGR A;  3UE0 A;  3ZNY A;  2XR0 A;  3W2Z A;  4L9F A;  3IX3 A;  5TR7 A;  1KE0 A;  2BTF P;  4E3L A;  5HSQ A;  2B18 A;  3MXR A;  4S2N C;  1MBL A;  2EFU A;  2JN7 A;  3VP3 A;  3D3O A;  4JBF A;  4R23 A;  3GV9 A;  5EUA A;  1XFN A;  4II7 A;  1U60 A;  4JXV A;  3R7W A;  1PFL A;  1L0G A;  2W3F A;  2ZQA A;  3C5A A;  4PM7 A;  2ZM8 A;  5A8B A;  3IQA A;  4UA7 A;  4QHC A;  4NXG A;  1T19 A;  1BYW A;  2KLI A;  4R6L A;  1WYB A;  2VGK A;  2YKH A;  2KX6 A;  4PM5 A;  1SKO A;  4IUH A;  2PT7 A;  3MR0 A;  3IBR A;  1L2S A;  1NLZ A;  1LHY A;  1IYS A;  3SW1 A;  1JWP A;  1MKM A;  2ZMA A;  2DMW A;  1PZO A;  3T4L A;  3WS2 A;  3PTE A;  5E43 A;  3QP1 A;  3LI8 A;  5DF8 A;  2Y2L A;  3UDI A;  1FCO A;  2IWD A;  1Q2Q A;  1G68 A;  3PBN A;  1XJ3 A;  2P74 A;  3LEQ A;  4FCF A;  4NK3 A;  3OPH A;  5CGW A;  1TDL A;  3HLD A;  3NDE A;  1ZKJ A;  1OTB A;  1VB6 A;  2HP5 A;  1NRF A;  3HLB A;  4IJG A;  3UB5 P;  3Q7Z A;  4S2M A;  2I72 A;  3MBZ A;  4JF5 A;  1CJF A;  1K6S A;  4DDY A;  3A3J A;  2HP6 A;  1SDN A;  4FUW A;  1MWS A;  3ZDJ A;  1P9W A;  1GA9 A;  1ERO A;  4L9E A;  1VEU A;  1DP8 A;  3PBO A;  2EX2 A;  4JF6 A;  3KSF A;  4Y5F A;  1PRQ A;  4YOF A;  1KGE A;  4JGO A;  2ZL1 B;  4HH3 A;  1GHP A;  5FQK A;  3F1N A;  3MFX A;  4Y2F A;  4S2L A;  3T4O A;  2J3T D;  3H82 A;  1K55 A;  1XJ2 A;  3IF5 A;  4HP4 A;  2JKR M;  4JKT A;  4GS9 B;  3G35 A;  5DJT A;  5CED A;  5A90 A;  4PHT A;  4QB8 A;  3V3S A;  1YLJ A;  5CEB A;  1DP9 A;  2VK3 A;  3A0R A;  3AGD A;  1YLT A;  1FQG A;  4RA7 A;  4UHU A;  4OQ0 A;  5HDC A;  4PPR A;  2GX5 A;  1OJ5 A;  3C4O A;  4NXF A;  3ZG8 B;  4DN0 A;  3NDG A;  3WS4 A;  4E6X A;  4N1X A;  3HLW A;  4YIN A;  1IYO A;  5GLD A;  5F1F A;  2QJ7 A;  2M7V A;  3G30 A;  2ZL1 A;  4WZ5 C;  2HJE A;  3GEC A;  3VMA A;  4DF6 A;  2DNS A;  4Y0U A;  1HTZ A;  3LCE A;  2J8Y A;  4PMA A;  1UWP X;  2R9X A;  3UDF A;  2ZC4 B;  5HL1 A;  4I39 A;  3F1O A;  5E2E A;  1LL9 A;  3CIT A;  1NZO A;  5G4Z A;  4DJ2 A;  1J9M A;  1H8Z A;  2A3U A;  4R38 A;  5FEF A;  3ZG0 A;  4GDN A;  4WM9 A;  2OLU A;  3KSG A;  3W4Q A;  2OWJ A;  3QP5 A;  4BL3 A;  3PR6 A;  2V1B A;  4Y15 A;  1LL8 A;  2I9V A;  2JCH A;  3NCK A;  4LCM A;  5L8M A;  2Y2K A;  3TE8 A;  4KQD A;  4G3W A;  4GCZ A;  2HDR A;  5E2F A;  3VOY A;  1UWN X;  4X25 A;  2P08 A;  1FSW A;  3MXQ A;  1HD8 A;  1WE4 A;  2PBD P;  2BAS A;  5GLA A;  3HLC A;  2J80 A;  3UN7 A;  5AVF A;  4JXG A;  1XX2 A;  2K31 A;  4X56 A;  3NJA A;  3IHB A;  3O3V A;  5DFY A;  4PM8 A;  5G4Y A;  2K2N A;  2XA7 S;  5FAT A;  5KZH A;  3UPP A;  5KMW A;  4R3B A;  2IA2 A;  3UB9 A;  2WKP A;  3LI9 A;  1LT0 A;  4D2O A;  4E3I A;  5A92 A;  3GQZ A;  4U3T A;  1T1A A;  1GSX A;  2Z6D A;  3B3X A;  4HY8 A;  4FD8 A;  4PM6 A;  3F1P A;  4WZ4 A;  4HOI A;  4OPZ A;  2BLS A;  3UY6 A;  2XD5 A;  4KZB A;  3S22 A;  3EGX C;  5DTK A;  3CG5 A;  1YLP A;  5LBR A;  4F94 A;  3IS2 A;  3LIF A;  3IXH A;  4HBU A;  2WZZ A;  5J4E A;  4BBT A;  4P87 A;  4XXR A;  4B4X A;  2DRW A;  4UAA A;  3CUE C;  5CEC A;  2ACG A;  3BRM A;  5IS1 A;  4HNB A;  4Z1W A;  3KYQ A;  4HI4 A;  1RP5 A;  3E4P A;  1BT5 A;  4WMC D;  3LID A;  3W4O A;  5HPI A;  1JTD A;  2ZC6 B;  3N7W A;  5EEC A;  4UEY A;  4EEP A;  5CGS A;  5HAP A;  2EXB A;  1JNU A;  4X1L A;  2GJ3 A;  4GLQ A;  1FOF A;  4JF4 A;  3LY4 A;  3W8K A;  4RVA A;  2Y2P A;  1K6R A;  1FR6 A;  3PXP A;  3VP4 A;  2X71 A;  1CI9 A;  4WL9 A;  3FV7 A;  2V8F A;  5AJG A;  1BUL A;  1FCN A;  2NUP C;  3N6I A;  4G3V A;  3GDI A;  1LLB A;  1TF1 A;  4BJP A;  2JKT I;  4XUX A;  5AQA A;  4KUO A;  3E4Q A;  1YLW A;  4Y13 A;  5A93 A;  4GZB A;  2WGV A;  1KE4 A;  2PBY A;  5CTM A;  3R4K A;  3A3F A;  4EEU A;  5HD3 A;  2ZOI A;  3C7U A;  5CTN A;  3KO6 A;  3E4O A;  4WEL A;  3IX4 A;  1W79 A;  3IH8 A;  2B02 A;  1CK3 A;  2UWX A;  2EWW A;  4I3J A;  1MXO A;  4S2I A;  3OOV A;  1NXY A;  5CHU A;  3UE1 A;  5L10 A;  1VM1 A;  5DJU A;  4WMC A;  1QMF A;  5M1A A;  5FAP A;  2XDM A;  2PD7 A;  1GHM A;  1ES3 A;  1OT9 A;  1IYQ A;  3KX0 X;  1KE3 A;  2VV8 A;  2L4R A;  3ZNT A;  4ESP A;  1YAX A;  5EE8 A;  4CLC D;  5DF9 A;  2JC7 A;  2JKT M;  4RYE A;  4OQH A;  2O99 A;  3HUN A;  4GJ4 A;  2HF6 A;  1H3Q A;  1X0O A;  4EV4 A;  3NOU C;  4H8R A;  2E8J A;  2WK0 A;  1ONG A;  2ZQ7 A;  2W0N A;  3UME A;  3ZG5 A;  2PR5 A;  1K54 A;  1TS0 A;  1FIL A;  3LR3 A;  3BQA A;  2W3G A;  4Q8I A;  2ZM2 A;  1CEF A;  4YWZ A;  4JLF A;  3EOI A;  2P9V B;  2Y79 A;  1ONH A;  4HIA A;  3BFG A;  3DAV A;  1MWR A;  4CLC B;  3BFF A;  1DJB A;  4U0X A;  3IXD A;  4MN7 A;  4DDS A;  3E0Y A;  5F68 A;  3OCN A;  5J3W A;  4BQM A;  3IHA A;  4MBK A;  4EBL A;  3DWK A;  4K91 A;  4NXE A;  4KQR A;  4JGQ A;  2QHK A;  4N92 A;  1OPX A;  3KSI A;  1Y54 A;  4X6T A;  4OLG A;  3S1Y A;  4B4Z A;  1GA0 A;  3VSK A;  1L3L A;  3JVU A;  3CPT B;  3SOI A;  1A0K A;  2Y2I A;  3VP2 A;  2WKR A;  2ZJ9 A;  4H6J B;  4R4S A;  4NEE D;  4QJG A;  3L9K A;  1NYM A;  3Q1F A;  3BJN A;  2WKQ A;  4L9G A;  1PYY A;  3VP1 A;  4CLC A;  3ICY A;  2HGV A;  1G6O A;  5EFW A;  4RX3 A;  1DRM A;  3KYZ A;  3O86 A;  4E3K A;  5EVE A;  2V0W A;  4BWI A;  5CX7 A;  5KIZ A;  4X53 A;  3ZQ5 A;  2VGL M;  4QD4 A;  2YKF A;  1W63 Q;  5FEG A;  2XFT A;  2XQZ A;  2HV1 A;  2WGI A;  2QKP A;  1ERM A;  4DKI A;  2XSS A;  5EV0 A;  2W1T A;  1MC0 A;  3ZVW A;  5TBM A;  3NEC A;  4U0T A;  5EM0 A;  3A0S A;  4S2N A;  3BLS A;  1K4F A;  5EVI C;  3MZD A;  3DW0 A;  2XRN A;  5L07 A;  2Y55 A;  3FKV A;  3T1S A;  2HZ5 A;  2HDQ A;  4B93 A;  2PU4 A;  3CZD A;  3UO9 A;  1LSW A;  3DTE A;  3OCL A;  3OZH A;  1MZU A;  2JKF A;  3ZG7 B;  1YPR A;  3NY4 A;  1TD5 A;  2FFF B;  3HRE A;  4EXO A;  3CMZ A;  2WZX A;  5CXW A;  3BY8 A;  3LIE A;  4I3A A;  4S2J A;  4KG6 A;  1EI5 A;  1KDS A;  2A49 A;  4I5S A;  1SCW A;  3T4Q A;  4DJ3 A;  3MQO A;  4Z9Q A;  4MBH A;  4F3L B;  3BFD A;  1IOU A;  3MF0 A;  1H8Y A;  3B33 A;  1W63 M;  4KZ7 A;  4E3J A;  4R1G A;  2M1C A;  2INW A;  1J3W A;  1L0D A;  3MQ0 A;  1VET B;  5IT5 A;  5FQJ A;  4EUV A;  3DBA A;  1NY0 A;  1ZC2 A;  4WEJ A;  3ITB A;  1XFQ A;  1NWZ A;  2XGN A;  4JPM A;  3NBL A;  3GMW A;  2Y2M A;  3QHY A;  1XA1 A;  3JPU A;  4K0W A;  5HPF A;  3VE4 A;  3EEA A;  3BY9 A;  4C3Q A;  4L0L A;  1DJA A;  5KSC A;  4KQO A;  2IWB A;  2EX9 A;  3BFE A;  2ZOH A;  5K5B A;  3CJM A;  3U2A A;  1WA9 A;  2PAV P;  4C6Y A;  4OOL A;  4I38 A;  4O01 A;  5JYP A;  1S66 L;  1S1Z A;  3LIC A;  5FAO A;  5BOH A;  5FDH A;  1NJ4 A;  2ZQD A;  5FDS A;  3ZCZ A;  1YMS A;  3JVV A;  3LR5 A;  1VQQ A;  4Y3I A;  2P7J A;  2G2U A;  4KZ6 A;  5HW3 A;  4KZA A;  4EU0 A;  2VGJ A;  4FH2 A;  3IF6 C;  1HVB A;  1NLY A;  1FR1 A;  1XJ4 A;  3RJU A;  4PKY A;  2V8C A;  5F5Y A;  4WLA A;  1I2S A;  2VJW A;  1YSP A;  5FQI A;  5F69 A;  3TRC A;  1MWU A;  4GS9 A;  4LPZ A;  3IT9 A;  2Y2J A;  4MNR A;  3TOI A;  1M40 A;  4WZ5 A;  5DKK A;  1MPL A;  2RL3 A;  4XT2 B;  4MBF A;  1ODV A;  3BLM A;  4GHI B;  4B9O A;  1GSW A;  4KZ3 A;  2J9O A;  5M18 A;  1TS7 A;  4FOF A;  4GD6 A;  2XD1 A;  4CQH A;  3GR2 A;  2ZMV A;  1HZO A;  4IVK A;  3HCY A;  3B42 A;  3N8R A;  1KGF A;  4O8G A;  1GSV A;  4Y0O A;  4FTX A;  1PWG A;  2G2W A;  2C5W B;  2HPB A;  3LR0 A;  1JVJ A;  3SZT A;  3IX8 A;  4ZJ2 A;  3LGO A;  1O7E A;  3QP8 A;  4HEF A;  5GHZ A;  1IKI A;  2L0W A;  4GHI A;  1PNE A;  3M2K A;  3TW8 A;  4OOY A;  1Y28 A;  3A3D A;  1F98 A;  3CLO A;  3C2W A;  4ARZ B;  5FQQ A;  4QPR A;  2V2F F;  2Y2Q A;  4M4X A;  2UV0 E;  1N9O A;  1BLC A;  3KSH A;  1PIO A;  1ZTU A;  2Y8H A;  3ZGA B;  2J3W A;  5GLC A;  2H10 A;  2A2L A;  3S7N A;  2JKG A;  5EOO A;  3IWI A;  3A3E A;  3EQV A;  4QU3 A;  2ZLY A;  4ZRR A;  4UA6 A;  3E2L A;  2Q0O A;  2VLG A;  2Y4A A;  4R3J A;  4IED A;  4KQQ A;  3M6B A;  2VGL S;  3RH8 B;  3G34 A;  5F82 A;  1NZU A;  5TFQ A; 
#chains in the Genus database with same CATH homology
 1F2K A;  2B95 A;  3MS6 A;  2V8F A;  4D60 A;  2VK3 A;  1SKO A;  1K0K A;  3DAV A;  3NEC A;  5EM0 A;  5EM1 A;  1G5U A;  2PAV P;  4FTX A;  3CPT A;  3T12 B;  3T1S A;  2ZL1 A;  1SKO B;  2HZ5 A;  1AWI A;  3U4L P;  3LGO A;  3MSH A;  5FDS A;  3NUL A;  3KYE A;  3LEQ A;  2JKF A;  3T1X A;  1PNE A;  1YPR A;  3T1R A;  3L7H A;  1VET A;  1SZV A;  1Z09 A;  3CPT B;  1A0K A;  1ACF A;  5FEF A;  4QWO A;  3UB5 P;  3L9K A;  1FIK A;  1CQA A;  2BTF P;  2V8C A;  1CJF A;  2ACG A;  4FUW A;  3D9Y A;  3T1Q B;  1J3W A;  1VEU A;  1VET B;  4ESP A;  1HLU P;  5EVE A;  1PRQ A;  2JKG A;  2ZL1 B;  2PRF A;  4X1M A;  1PFL A;  1D1J A;  4X1L A;  4X25 A;  5FEG A;  2E8J A;  3CHW P;  1CF0 A;  2PBD P;  1VEU B;  1Y4O A;  5EV0 A;  1FIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...