4X25A

Structural basis for mutation-induced destabilization of profilin 1 in als
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
134
Chain Sequence
b'AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTFNVTVTKTDKTLVLLTGKEGVHGGLINKKCYEMASHLRRSQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin-1
molecule tags Protein binding
source organism Homo sapiens
publication title Structural basis for mutation-induced destabilization of profilin 1 in ALS.
pubmed doi rcsb
total genus 39
structure length 134
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4x25A00
5EV0A 2HZ5A 5EM1A 3NECA 3LEQA 1G5UA 1J3WA 1VETB 1YPRA 3L9KA 3LGOA 3NULA 4X25A 5EM0A 1ACFA 1CQAA 4X1MA 3T1SA 3DAVA 1CF0A 4ESPA 4X1LA 2JKFA 1CJFA 3L7HA 2PRFA 2VK3A 3KYEA 1F2KA 1VETA 2PBDP 4QWOA 1A0KA 2V8CA 3MS6A 2BTFP 2JKGA 1K0KA 1FIKA 3T1RA 1D1JA 1AWIA 4FUWA 4D60A 3CPTA 5FDSA 3CHWP 1Z09A 3UB5P 1Y4OA 1HLUP 1SKOA 2ZL1B 1PRQA 3U4LP 1VEUB 2ZL1A 3T1QB 5EVEA 2PAVP 4FTXA 1PFLA 2ACGA 3CPTB 1SZVA 5FEGA 3T1XA 3T12B 3MSHA 2B95A 1FILA 1SKOB 2V8FA 3D9YA 2E8JA 5FEFA 1VEUA 1PNEA
chains in the Genus database with same CATH superfamily
2DNSA 1YLPA 1ERMA 2JKTM 3V50A 2G7UA 5TBMB 2ZM8A 3VOZA 2J9PA 4OPRA 3S4XA 5KSHA 4RYEA 2DMWA 1S66L 4GCZA 4NG2A 2HV1A 2VGLS 5CTMA 3DW0A 4OQIA 2E8JA 2QPNA 3C2WA 3O87A 4KZ3A 3KSHA 1PWGA 3G35A 4EXOA 4OPYA 4CLCA 3HUMA 3HLGA 4KZ6A 1O7EA 2PDRA 3C8CA 4BL3A 1WYCA 3VOYA 2XF3A 2HP6A 4OQHA 2P04A 3IX3A 2O9AA 4PKYG 3G31A 4O7DA 3FKVA 5EV0A 5TBMA 3UY6A 1JTGA 1L0EA 3B47A 2PYPA 1YLTA 4DE1A 4P87A 5FA7A 1I2SA 1LSWA 2V8CA 4MBKA 5CTNA 4R38A 2WZXA 3VMAA 2XSSA 4ZDXA 3EEHA 3ISGA 1NY0A 1T1CA 3MFXA 2ZOHA 1STZA 4MEZA 1FILA 5JYOA 1FQGA 5TGFA 1YLWA 1H5XA 1AXBA 4JXGA 1GSVA 4XXRA 4Q8IA 3T4QA 5DTKA 4CQHA 2HGVA 5J7EA 3V3RA 1Z6FA 3A0RA 4Y13A 3UB8A 3OC2A 2GX5A 4LV0A 3JYIA 5M18A 2EWWA 4GLQA 3A3DA 4O8GA 1K25A 3BFCA 4R1GA 3AGFA 3O88A 3MQOA 3LGOA 1ACFA 4Z1WA 3SOIA 1CJFA 3NC8A 1FR6A 4KUKA 3HBRA 3RFBA 3G2YA 3VFFA 4N9KA 4RA7A 4S2JA 1SKOA 3G6OA 3UE0A 1MWUA 3HLWA 3C38A 3NDEA 3BYDA 4PAUA 5EOOA 2QJ5A 4PHTA 3EGDC 5L2FA 3N4IA 1H8YA 3ZDJA 3C7UA 4CLCD 3E4QA 1LSVA 1OMEA 1FCNA 2ZMAA 1DP8A 3QP5A 1MWRA 1L0GA 3RTYA 5CEBA 4S2NC 4C75A 1KGGA 1ODVA 1BTLA 4L9FA 4RQ9A 4G3VA 5AJGA 4OP5A 5DVAA 3MMHA 3K3DA 4C3QA 2C6WB 1PW8A 1Y4OA 3N8SA 1ESUA 1VM1A 1NLZA 2P9VB 3PYPA 3PBSA 2ZM0A 4K91A 1IYSA 2ZC3B 4ZRRA 3RJUA 2XGNA 2XFSA 4ARZB 4HH3A 1XA7A 3KSFA 1M6KA 1N4OA 3CHWP 1RP5A 3OCLA 3IF6C 4UEYA 1NXYA 4EERA 2WAEA 2E8IA 4HNBA 3OCNA 1ONGA 3RXWA 4Y0OA 1QMEA 4ETXA 1CQAA 3UNWA 2VK3A 2PBDP 1Y28A 3CLOA 1P9RA 3LIDA 5TJJA 3GRJA 4NXFA 2Y2NA 5F69A 2P9VA 3SS4A 2UWXA 4OPQA 2H5SA 1SKOB 2XROA 3PXPA 4ETZA 2QKPA 2VKSA 4GW9A 2HZ5A 3LR5A 2HJ9C 1GA0A 1K56A 1IEMA 2XH9A 4GDBA 5HZHA 5FASA 5IT5A 1IKGA 1VQQA 4P6BA 3FV7A 1K38A 3TE8A 1HZOA 2PAVP 5HDDA 1ES3A 1SZVA 3F1PA 1N9LA 1ES2A 1K57A 4KZ8A 5LBRA 1GSXA 4MCWA 2X01A 5HW3A 3PBRA 3LIFA 1Q2PA 2XFTA 2MJ6A 1HD8A 1OT9A 5FQQA 4YNRA 3R7WB 1YKDA 2KLIA 5FAQA 1BLPA 2W1TB 1KGFA 3PR6A 4MN7A 4LENA 4L0LA 4JGRA 4WZ4A 1DY6A 1ES5A 3W2ZA 2I72A 4ESPA 4QD4A 5HARA 4EUVA 3IX4A 3VP4A 4BBUA 4P6ZS 4HI4A 2QYBA 4GOGA 5IHVA 3BLSA 3PAGA 3E2LA 2INWA 3M2JA 2KDKA 3LCEA 3IX8A 1YAXA 2JE5A 1JTDA 1WE4A 3BY9A 3HLEA 5GLAA 1CF0A 3IS2B 5MC7A 4U0XA 2WAFA 3BY8A 3P09A 4UQIS 3CAXA 5HAIA 2FZ0A 1F9IA 2W1RA 1G68A 1W63M 4X55A 2HDRA 2H28A 2VV8A 3OPHA 4GN2A 3M6HA 3L9KA 4DF6A 1SDNA 4EETB 3BFFA 4XUXA 3VE3A 4UQIM 3E0YA 2J9OA 4M4XA 1S0WA 2VJWA 3Q82A 3W8KA 5CX7A 3TOIA 3P7NA 4DDYA 4KZBA 3HREA 4X53A 3ZQ5A 4DE2A 4OVDA 4OQ0A 3OZHA 1VEUA 2WYXA 5AQBA 1XFNA 1J3WA 1LSXA 3W4QA 2VGKA 1H8MA 4KZAA 1D1JA 3AGDA 4YINA 4R70A 2RL3A 2H10A 1N9BA 3F1OA 1ZG6A 3FZCA 5A93A 2JKRM 4G3KA 2M7UA 4DE3A 4Y5FA 2WGVA 1E3UA 3MXSA 1E3UD 1F2KA 3B33A 3SH7A 3BFGA 4HP4A 1EI5A 1SCWA 2Y8HA 1GHIA 1VEUB 1W8QA 2FFFB 2ZQ9A 1TDGA 3T4SA 4HJ4A 3T4JA 5HPIA 3T4KA 2ZM2A 3T1SA 3IWIA 3VSKA 2ZQ7A 4WELA 2W3EA 3H9WA 2B02A 4X68A 1W5DA 1I2WA 2Z6DA 4BBTA 1MBLA 2PYRA 5DJTA 4UA6A 3OLOA 4P6ZM 1MKIA 5FSRA 1OTAA 3V39A 2W0NA 5HAPA 1ZC2A 1IYPA 4NETA 2Y2HA 1K56D 1T19A 1EWZA 2O9CA 3H7WA 3C4OA 4MDZA 2PR6A 4EU0A 4FUWA 2WZZA 5JYPA 2EA9A 3G34A 1IYOA 4YWZA 3LFVA 1WA9A 2A3UA 4GZBA 4I5SA 4E3IA 1OTIA 4B4XA 4BQMA 2V0UA 3IWOA 3EQVA 3WRZA 3MFDA 4LRYC 4E3MA 2G2UA 4EW7A 1MC0A 1TS7A 2CMNA 5KZHA 3IXHA 5DTSA 1W79A 3B42A 3DTEA 1W7FA 5AQAA 3T12B 3GV9A 4OH0A 1FR1A 2Z2LB 1NYMA 1NWZA 4CPKA 3NULA 4I38A 3S1YA 1TEMA 3NI9A 2XK1A 3MKEA 5FL3A 3MZDA 3NOTC 5DF9A 5L10A 5FAOA 2EX6A 5J8XA 4IHQA 3Q1FA 1N9NA 2ZJ9A 4S2IA 1DJCA 5DF7A 1PI4A 5F68A 2O0YA 3MBZA 1FSWA 5FQ9A 4OLDA 4B9OA 4I39A 4CLCE 3P01A 4Q0JA 4OLGA 5FQMA 2EXBA 2Y2PA 2OOLA 3IF6A 4WYYA 2V2FF 3IF5A 3ZG5A 4U0TA 3E2KA 2NUTC 5CEDA 1OTEA 4LGWA 5F1GA 4R6LA 4B93A 1KGEA 2OLVA 2JHEA 1ESIA 1F5MA 1K6SA 1UWPX 3H82B 4F3LB 5KSCA 1CEFA 2O9BA 1RCJA 1J9MA 3GECA 5HFOA 2EX8A 2PRFA 4L9GA 3F1NB 2CC1A 2QWSA 3NOPC 1Q2QA 3HJKA 1BULA 1K55A 1RGYA 4EQ1A 2IWBA 4IVIA 3UDXA 5J3WA 1L0DA 4H6JA 1JVJA 1M40A 3NOUC 4H8RA 5FQIA 3LY4A 3JVVA 3U4LP 3S22A 2JCHA 1GCEA 4LFUA 5M1AA 2W3GA 1TS0A 4DXCA 3UO9A 2WGIA 3GMWA 4EV4A 5F1FA 3CWFA 5M19A 4RX2A 3T1RA 4E3KA 3W4PA 2VGLM 3CI6A 4HJ3A 4IUHA 4CLCC 3BM6A 3D72A 3VE4A 1BSGA 4R3AA 5EVEA 3ZHHA 4S2LA 4HIAA 1XJ4A 2OWHA 1MWTA 4EQIA 3IF6B 4X1LA 4K0XA 3DTMA 5GHYA 4WEJA 2Y2KA 2OV5A 3ZVWA 3FPWA 4NEED 1HLUP 4QPRA 4EBLA 1KVLA 3SH8A 2C5WB 1XXMA 3H82A 3KSGA 1XA1A 3DAVA 3BFEA 3T4TA 3A3EA 3FWLA 3CPTA 1H8ZA 4P0MA 3K2NA 1TS8A 4I3AA 2EFUA 5HWTA 3N7WA 2HF6A 2VX8A 1G6OA 2Y79A 5EM0A 3MJQA 4KG6A 4KQQA 2WUQA 2Y59A 3BFDA 4HBTA 3EGXC 3HUOA 4N1XA 1P9WA 3QP2A 3NY4A 4YFMA 3DWKA 2Y2QA 3VSLA 4QU3A 1G6AA 3V67A 3PBQA 4JGPA 5KMWA 4OQGA 4QB8A 1XGJA 5FI2A 1KE4A 3S7PA 4E3NA 1PRQA 2HDQA 4I3IA 4LV3A 3GDIA 3LR4A 4XT2B 5E43A 1ZKJA 3VP2A 1V9ZA 3T4LA 1P0ZA 1G28A 3T4OA 3ZG0A 4HBUA 2JKRI 4WBGA 3BW6A 1T1AA 1T1BA 1K54A 5DFXA 4DJ2A 3FKWA 5CHMA 3F1PB 2PD7A 2XLNA 3OPPA 4HQAA 5DKLA 5IS1A 4BD0A 3UMDA 3IS2A 4GDNA 3ICYA 2V1ZA 4DXBA 4E04A 2ZQAA 3KYEA 2JKTI 1A0KA 4KZ7A 5HD5A 2GDNA 1PW1A 4C6YA 2A24A 3T1QB 1KDWA 1D7EA 1XX2A 1NYYA 4UAAA 1X0OA 3MSHA 1MXOA 4NXGA 4YOFA 1ERQA 2WGWB 4N92A 3MZFA 3RXXA 5EVIC 5I5LA 5E2FA 3UE3A 4Y0TA 1KE0A 1TF1A 4MNRA 5A91A 4X69A 3NDGA 4EBPA 1XJ3A 4WZ5C 3D3OA 5E2EA 4NKPA 1N9OA 1YLJA 4PM6A 5A90A 4S2MA 5D3OA 2X02A 4OKPA 4S2PA 1NLYA 4HY8A 3IHAA 3LEQA 2XRNA 2XA7S 3TG9A 1BT5A 1S67L 3LY3A 1D06A 2P74A 4R23A 3UB7A 3UB9A 4E3OA 4KUOA 3PTEA 4R4SA 4EBNA 2PU4A 3LR0A 1BLHA 1H3QA 5AVEA 4WMCA 2VEAA 3HUNA 1VB6A 3UE1A 4EEUA 2UV0E 2LB5A 4Y3IA 4CLCB 3GQZA 4EEPA 3SH9A 3EOIA 4ME4A 2JC7A 1JWZA 4UA9A 2ZLYA 4WF0A 1DRMA 2YKFA 2HP5A 4OPZA 4ARZA 1S1YA 5EVIA 3K3CA 3ZNYA 2ZC4B 2Y4AA 5I94A 5EM1A 2ZMFA 2G2WA 1KVMA 3MR0A 3CUEC 3GVBA 1CK3A 3V5MA 1HTZA 4DN0A 2EX2A 4KG5A 3VP0A 3SS5A 3LIBA 3ULFA 1K54C 1W8YA 3WS5A 3C4PA 5AQ7A 3AGEA 3Q7ZA 5F82A 3N8RA 4B4ZA 4O01A 1E4DA 1L2SA 1GSWA 1BLCA 3E4PA 4GB7A 2VV7A 3BRMA 3T1XA 5HD3A 4HH2A 4OOMA 4KZ5A 2WK0A 4R4RA 3RH8B 2XDMA 2HP9A 4X1MA 2PD8A 5TR7A 3O86A 5CGXA 2H0TA 3E98A 4DDSA 5DF8A 3UPPA 2QZ6A 3GR2A 1LT0A 3SW1A 3OPLA 2PT7A 4MN5A 5BOHA 3KO6A 3PHYA 5CXWA 4PM9A 3KX0X 3JPUA 4FSFA 5HL1A 2Y2MA 3WS4A 3QNCA 1YSPA 4GD8A 4GS9A 1XP4A 4HESA 2J3WA 5KIZA 2V0WA 4U3TA 2GNXA 4LRZE 5EUAA 2VZWA 3IXDA 4LLOB 2R78A 3EEAA 4BLMA 1U60A 1L3LA 3NHQA 4B88A 1C3BA 2D02A 4EUZA 1AWIA 3LICA 1K4FA 1JNUA 2VA0A 5F5YA 3LEZA 2W3FA 3TRCA 5FEFA 5GL9A 3ZYTA 4GS9B 4A5RA 5CHUA 5G4YA 2JKFA 4JGOA 2NUPC 3MZEA 3WWXA 1XJ6A 4UA7A 5DFYA 3ZG8B 4D2OA 3UN7A 4FTXA 4BJPA 3ITBA 2DCFA 2BG1A 4N1HA 1XKZA 2Y2LA 3R4KA 3NECA 4IVKA 4X25A 1XPBA 3F1NA 1NZOA 3A0VA 4F94A 3HLDA 2OLUA 1EROA 3I7JA 1YSQA 3R7WA 5GLDA 1FIKA 3VV4A 1EW0A 1PWDA 4S2NA 1OTDA 5EOEA 2IWDA 3NJAA 4FH4A 3LUQA 4KQDA 2GZAA 2Y2OA 1K0KA 5C5KA 1K55C 3HLBA 3MQQA 4KQRA 4OONA 1PFLA 2FFYA 2ZBBA 3Q7VB 5CRFA 4ZJ1A 5FDHA 1PZPA 4BWIA 3PBNA 5FQJA 2HJEA 4QJGA 2WKPA 4JBFA 2JKGA 4PM7A 1YT4A 1OJ5A 4P85A 5FDSA 3ITAA 3DTIA 5TFQA 1QMFA 3CPTB 4IJGA 4FD8A 2H0YA 4LV1A 1TVFA 4FH2A 3C7VA 1JWPA 3MF0A 3D4FA 3IH9A 3ZFZA 5E2HA 5E2GA 4AFIA 5G18A 2LB9A 3BQAA 4Q0IA 3NBLA 4K08A 2XD1A 1YLYA 1SHVA 3FC7A 2OAP1 3N6IA 1NRFA 3V3SA 2ZC6B 3T50A 4QY5A 3DTKA 4JXWA 2J3TD 4HJ6A 1T18A 5CHJA 4Z9QA 4R3JA 4IBXA 1CI9A 4Y0UA 3WS1A 3QP1A 2VGJA 1V9YA 3LIEA 1TD5A 1OJGA 3ZG7B 2D01A 3A3FA 2QHKA 2O99A 3KSIA 5F6AA 2Y2JA 3LO7A 4XT2A 1ALQA 5HWVA 2ZOIA 3P98A 4RX3A 2Q9NA 3PBOA 4X6TA 1S1ZA 4S2OA 3M6BA 2JBFA 5EE8A 2JN7A 1SDEA 5DKKA 4MLLA 1S4RA 1YQSA 5HDCA 3BJNA 1TDLA 4HP9A 1ES4A 4NXBA 4DRTA 5AQ9A 2BASA 4KZ9A 3MS6A 4N9LA 2EX9A 2XEPA 4Q0HA 4UHUA 3QHYA 1E25A 3G4PA 1JWVA 1S4SA 3FPVA 2XA7M 2ZC5B 1LL9A 4L9EA 1UWNX 1PZOA 3S7NA 4Y17A 4HEFA 3QP4A 4LV2A 4GKUA 4ZJ2A 3GSGA 1IOUA 1DP9A 2FH5A 3BWLA 5HDSA 4LRXC 1OT6A 3W4OA 4GD6A 4JPMA 5FATA 4GNUA 5A8BA 4RVAA 2Y2IA 2OWJA 1RGZA 1BYWA 1LLBA 4ZJ3A 1L0FA 3ZVTA 2R9WA 3MXQA 4XUZA 4D60A 2W3DA 2PBYA 3MKFA 4WLAA 5FI7A 2QJ7A 2XD5A 4Y2FA 3Q81A 4I3JA 2I9VA 4ZTKA 5IU1A 1LI9A 1NJ4A 1FCOA 1IKIA 2Z2MB 3HCYA 5CGWA 5U47A 2AVXA 4HOIA 4OOLA 1K57C 3CZDA 4WUJA 1ZTUA 4KENB 4R3BA 4ZAMA 4E3JA 3IT9A 2A49A 3IXBA 5GLBA 1GHPA 3FG8A 3PAEA 4QHCA 1FSYA 3JVUA 2WKEA 5FEGA 3IH8A 1DJAA 4GHIB 4ID4A 3D9YA 5DJUA 3BEBA 5CERA 2OAQ1 1WYBA 1BLSA 1DJBA 4F3LA 5G4ZA 4E3LA 3B3XA 2L1MA 1PIOA 2OSUA 3U2AA 5HWWA 2J80A 4KG2A 2M7VA 2WKRA 2QMIA 2HDSA 4JGQA 2ZQCA 3KYQA 2IA2A 2WGWA 2ACGA 1PNEA 2VV6A 5L07A 1HVBA 2PR5A 3LR3A 3MQ0A 5EVLA 3HVFA 5L09A 3IHBA 3H7WB 5A92A 4WZ5A 1K6RA 1LL5A 5GLCA 4JF4A 2PHYA 3HLFA 3UB6A 4JKTA 3OPRA 3UMEA 4LCMA 5EECA 3QNBA 4MMNA 5FI6A 1S6RA 4OOYA 3O3VA 4BENA 2XR0A 1BZAA 3UDFA 3LI9A 3PBTA 1XGIA 1OPXA 4PMAA 1KOUA 3IWQA 1MZUA 4R0QA 1KE3A 2EFXA 2J7VA 5HPFA 3IBJA 4IBRA 4PM5A 2VLGA 3N8LA 3LIAA 2A2LA 1NZUA 3LI8A 1BUEA 2HDUA 3UB5P 4HHDA 3NCKA 4Y15A 5F83A 3VOLA 4DMZA 1H0MA 1XFQA 4GHIA 1PWCA 4NK3A 3ZGAB 2IWCA 4JXSA 5EVID 2EWVA 4BL2A 3A3JA 1XJ2A 5HSQA 3TW8A 1CI8A 4O0PA 4Y7PA 3C5AA 3S7OA 3F1OB 2R9XA 2L0WA 4PKYA 3E4OA 3QP8A 3VP1A 4E6WA 2W1TA 1YPRA 5HL6A 2Y2GA 2GJ3A 2J8YA 4WMCD 5CGSA 3KYZA 4QWOA 5HX9A 5HAQA 1LHYA 2V1BA 1ZG4A 5FAPA 1I5QA 4PPRA 1IFQA 3OBFA 3TJZC 4WM9A 2K31A 2ZC7A 4WN5A 1MKMA 2ZMVA 4KZ4A 1F98A 4MN6A 3EQUA 1OTBA 1W63Q 1VETA 2M1CA 4EESA 3CMZA 2BLSA 1CEGA 4PM8A 3UPOA 2WADA 3MXRA 2DRWA 3GTCA 1LI0A 4FOFA 1FOFA 3A3IA 2V8FA 1YM1A 2J3TC 2WKQA 5L8MA 3VP3A 2RCXA 4KQOA 3IQAA 5K5BA 1LL8A 3VFHA 2W27A 4LCLA 3S7QA 5DTTA 4H6JB 4II7A 3CUEA 4DE0A 2Z6CA 3O5YA 3WS0A 1GHMA 4DKIA 2V1AA 2L4RA 4WL9A 3TSGA 1K4EA 2KOIA 2X71A 2K2NA 1VETB 2V9AA 3CG5A 3Q7VA 2WKHA 3G32A 2BTFP 3G2ZA 5EFWA 1IYQA 3QP6A 4G3WA 5EPHA 3OOVA 4BD1A 5CECA 4K0WA 4LPZA 1MPLA 2P7JA 2HPBA 3G30A 3WS2A 1G5UA 1DP6A 2Q0OA 1YMXA 3HLCA 3CJMA 4FCFA 5GHXA 4GJ4A 3CITA 4BMWA 2ZQDA 4IEDA 5FQKA 3A0SA 2YKHA 2K7SA 1ZHHB 3BQ8A 3WRTA 2KX6A 1P97A 3NIAA 4M3KA 1IELA 3M2KA 2B18A 4NXEA 1ONHA 3IBRA 1PI5A 3UE6A 1UGUA 3HJIA 3ZNTA 3LYXA 2A24B 4MBFA 1MWSA 2EXAA 1FCMA 4OP8A 1YMSA 3ZCZA 3BECA 2ZD8A 4JLFA 2WKIA 5J4EA 2Q9MA 4E6XA 2V20A 1SKFA 4X56A 4MBHA 2W3HA 5GHZA 1MY8A 3FYZA 4WEKA 4JXVA 1VHMA 3C30A 3Q07A 2PU2A 1Y54A 4CJNA 2ZL1B 1PYYA 3UPNA 1GA9A 3L7HA 3SZTA 4EWFA 4JF5A 3SS3A 1Z09A 2B5RA 4BBVA 1O07A 3ZG9B 2Y91A 3DBAA 3HL9A 4S2KA 1KDSA 2XQZA 4DJ3A 2P08A 2ZQ8A 5AVFA 1TS6A 2Y55A 3BLMA 5EVIB 3IXGA 4QY6A 1YLZA 2ZL1A 3DWZA 4IUKA 1NRJA 4JF6A 2B95A 3EWKA 4ZBEA 3UDIA
chains in the Genus database with same CATH topology
5EV0A 2HZ5A 5EM1A 3NECA 3LEQA 1G5UA 1J3WA 1VETB 1YPRA 3L9KA 3LGOA 3NULA 4X25A 5EM0A 1ACFA 1CQAA 4X1MA 3T1SA 3DAVA 1CF0A 4ESPA 4X1LA 2JKFA 1CJFA 3L7HA 2PRFA 2VK3A 3KYEA 1F2KA 1VETA 2PBDP 4QWOA 1A0KA 2V8CA 3MS6A 2BTFP 2JKGA 1K0KA 1FIKA 3T1RA 1D1JA 1AWIA 4FUWA 4D60A 3CPTA 5FDSA 3CHWP 1Z09A 3UB5P 1Y4OA 1HLUP 1SKOA 2ZL1B 1PRQA 3U4LP 1VEUB 2ZL1A 3T1QB 5EVEA 2PAVP 4FTXA 1PFLA 2ACGA 3CPTB 1SZVA 5FEGA 3T1XA 3T12B 3MSHA 2B95A 1FILA 1SKOB 2V8FA 3D9YA 2E8JA 5FEFA 1VEUA 1PNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EV0 A;  2HZ5 A;  5EM1 A;  3NEC A;  3LEQ A;  1G5U A;  1J3W A;  1VET B;  1YPR A;  3L9K A;  3LGO A;  3NUL A;  4X25 A;  5EM0 A;  1ACF A;  1CQA A;  4X1M A;  3T1S A;  3DAV A;  1CF0 A;  4ESP A;  4X1L A;  2JKF A;  1CJF A;  3L7H A;  2PRF A;  2VK3 A;  3KYE A;  1F2K A;  1VET A;  2PBD P;  4QWO A;  1A0K A;  2V8C A;  3MS6 A;  2BTF P;  2JKG A;  1K0K A;  1FIK A;  3T1R A;  1D1J A;  1AWI A;  4FUW A;  4D60 A;  3CPT A;  5FDS A;  3CHW P;  1Z09 A;  3UB5 P;  1Y4O A;  1HLU P;  1SKO A;  2ZL1 B;  1PRQ A;  3U4L P;  1VEU B;  2ZL1 A;  3T1Q B;  5EVE A;  2PAV P;  4FTX A;  1PFL A;  2ACG A;  3CPT B;  1SZV A;  5FEG A;  3T1X A;  3T12 B;  3MSH A;  2B95 A;  1FIL A;  1SKO B;  2V8F A;  3D9Y A;  2E8J A;  5FEF A;  1VEU A;  1PNE A; 
#chains in the Genus database with same CATH topology
 2DNS A;  1YLP A;  1ERM A;  2JKT M;  3V50 A;  2G7U A;  5TBM B;  2ZM8 A;  3VOZ A;  2J9P A;  4OPR A;  3S4X A;  5KSH A;  4RYE A;  2DMW A;  1S66 L;  4GCZ A;  4NG2 A;  2HV1 A;  2VGL S;  5CTM A;  3DW0 A;  4OQI A;  2E8J A;  2QPN A;  3C2W A;  3O87 A;  4KZ3 A;  3KSH A;  1PWG A;  3G35 A;  4EXO A;  4OPY A;  4CLC A;  3HUM A;  3HLG A;  4KZ6 A;  1O7E A;  2PDR A;  3C8C A;  4BL3 A;  1WYC A;  3VOY A;  2XF3 A;  2HP6 A;  4OQH A;  2P04 A;  3IX3 A;  2O9A A;  4PKY G;  3G31 A;  4O7D A;  3FKV A;  5EV0 A;  5TBM A;  3UY6 A;  1JTG A;  1L0E A;  3B47 A;  2PYP A;  1YLT A;  4DE1 A;  4P87 A;  5FA7 A;  1I2S A;  1LSW A;  2V8C A;  4MBK A;  5CTN A;  4R38 A;  2WZX A;  3VMA A;  2XSS A;  4ZDX A;  3EEH A;  3ISG A;  1NY0 A;  1T1C A;  3MFX A;  2ZOH A;  1STZ A;  4MEZ A;  1FIL A;  5JYO A;  1FQG A;  5TGF A;  1YLW A;  1H5X A;  1AXB A;  4JXG A;  1GSV A;  4XXR A;  4Q8I A;  3T4Q A;  5DTK A;  4CQH A;  2HGV A;  5J7E A;  3V3R A;  1Z6F A;  3A0R A;  4Y13 A;  3UB8 A;  3OC2 A;  2GX5 A;  4LV0 A;  3JYI A;  5M18 A;  2EWW A;  4GLQ A;  3A3D A;  4O8G A;  1K25 A;  3BFC A;  4R1G A;  3AGF A;  3O88 A;  3MQO A;  3LGO A;  1ACF A;  4Z1W A;  3SOI A;  1CJF A;  3NC8 A;  1FR6 A;  4KUK A;  3HBR A;  3RFB A;  3G2Y A;  3VFF A;  4N9K A;  4RA7 A;  4S2J A;  1SKO A;  3G6O A;  3UE0 A;  1MWU A;  3HLW A;  3C38 A;  3NDE A;  3BYD A;  4PAU A;  5EOO A;  2QJ5 A;  4PHT A;  3EGD C;  5L2F A;  3N4I A;  1H8Y A;  3ZDJ A;  3C7U A;  4CLC D;  3E4Q A;  1LSV A;  1OME A;  1FCN A;  2ZMA A;  1DP8 A;  3QP5 A;  1MWR A;  1L0G A;  3RTY A;  5CEB A;  4S2N C;  4C75 A;  1KGG A;  1ODV A;  1BTL A;  4L9F A;  4RQ9 A;  4G3V A;  5AJG A;  4OP5 A;  5DVA A;  3MMH A;  3K3D A;  4C3Q A;  2C6W B;  1PW8 A;  1Y4O A;  3N8S A;  1ESU A;  1VM1 A;  1NLZ A;  2P9V B;  3PYP A;  3PBS A;  2ZM0 A;  4K91 A;  1IYS A;  2ZC3 B;  4ZRR A;  3RJU A;  2XGN A;  2XFS A;  4ARZ B;  4HH3 A;  1XA7 A;  3KSF A;  1M6K A;  1N4O A;  3CHW P;  1RP5 A;  3OCL A;  3IF6 C;  4UEY A;  1NXY A;  4EER A;  2WAE A;  2E8I A;  4HNB A;  3OCN A;  1ONG A;  3RXW A;  4Y0O A;  1QME A;  4ETX A;  1CQA A;  3UNW A;  2VK3 A;  2PBD P;  1Y28 A;  3CLO A;  1P9R A;  3LID A;  5TJJ A;  3GRJ A;  4NXF A;  2Y2N A;  5F69 A;  2P9V A;  3SS4 A;  2UWX A;  4OPQ A;  2H5S A;  1SKO B;  2XRO A;  3PXP A;  4ETZ A;  2QKP A;  2VKS A;  4GW9 A;  2HZ5 A;  3LR5 A;  2HJ9 C;  1GA0 A;  1K56 A;  1IEM A;  2XH9 A;  4GDB A;  5HZH A;  5FAS A;  5IT5 A;  1IKG A;  1VQQ A;  4P6B A;  3FV7 A;  1K38 A;  3TE8 A;  1HZO A;  2PAV P;  5HDD A;  1ES3 A;  1SZV A;  3F1P A;  1N9L A;  1ES2 A;  1K57 A;  4KZ8 A;  5LBR A;  1GSX A;  4MCW A;  2X01 A;  5HW3 A;  3PBR A;  3LIF A;  1Q2P A;  2XFT A;  2MJ6 A;  1HD8 A;  1OT9 A;  5FQQ A;  4YNR A;  3R7W B;  1YKD A;  2KLI A;  5FAQ A;  1BLP A;  2W1T B;  1KGF A;  3PR6 A;  4MN7 A;  4LEN A;  4L0L A;  4JGR A;  4WZ4 A;  1DY6 A;  1ES5 A;  3W2Z A;  2I72 A;  4ESP A;  4QD4 A;  5HAR A;  4EUV A;  3IX4 A;  3VP4 A;  4BBU A;  4P6Z S;  4HI4 A;  2QYB A;  4GOG A;  5IHV A;  3BLS A;  3PAG A;  3E2L A;  2INW A;  3M2J A;  2KDK A;  3LCE A;  3IX8 A;  1YAX A;  2JE5 A;  1JTD A;  1WE4 A;  3BY9 A;  3HLE A;  5GLA A;  1CF0 A;  3IS2 B;  5MC7 A;  4U0X A;  2WAF A;  3BY8 A;  3P09 A;  4UQI S;  3CAX A;  5HAI A;  2FZ0 A;  1F9I A;  2W1R A;  1G68 A;  1W63 M;  4X55 A;  2HDR A;  2H28 A;  2VV8 A;  3OPH A;  4GN2 A;  3M6H A;  3L9K A;  4DF6 A;  1SDN A;  4EET B;  3BFF A;  4XUX A;  3VE3 A;  4UQI M;  3E0Y A;  2J9O A;  4M4X A;  1S0W A;  2VJW A;  3Q82 A;  3W8K A;  5CX7 A;  3TOI A;  3P7N A;  4DDY A;  4KZB A;  3HRE A;  4X53 A;  3ZQ5 A;  4DE2 A;  4OVD A;  4OQ0 A;  3OZH A;  1VEU A;  2WYX A;  5AQB A;  1XFN A;  1J3W A;  1LSX A;  3W4Q A;  2VGK A;  1H8M A;  4KZA A;  1D1J A;  3AGD A;  4YIN A;  4R70 A;  2RL3 A;  2H10 A;  1N9B A;  3F1O A;  1ZG6 A;  3FZC A;  5A93 A;  2JKR M;  4G3K A;  2M7U A;  4DE3 A;  4Y5F A;  2WGV A;  1E3U A;  3MXS A;  1E3U D;  1F2K A;  3B33 A;  3SH7 A;  3BFG A;  4HP4 A;  1EI5 A;  1SCW A;  2Y8H A;  1GHI A;  1VEU B;  1W8Q A;  2FFF B;  2ZQ9 A;  1TDG A;  3T4S A;  4HJ4 A;  3T4J A;  5HPI A;  3T4K A;  2ZM2 A;  3T1S A;  3IWI A;  3VSK A;  2ZQ7 A;  4WEL A;  2W3E A;  3H9W A;  2B02 A;  4X68 A;  1W5D A;  1I2W A;  2Z6D A;  4BBT A;  1MBL A;  2PYR A;  5DJT A;  4UA6 A;  3OLO A;  4P6Z M;  1MKI A;  5FSR A;  1OTA A;  3V39 A;  2W0N A;  5HAP A;  1ZC2 A;  1IYP A;  4NET A;  2Y2H A;  1K56 D;  1T19 A;  1EWZ A;  2O9C A;  3H7W A;  3C4O A;  4MDZ A;  2PR6 A;  4EU0 A;  4FUW A;  2WZZ A;  5JYP A;  2EA9 A;  3G34 A;  1IYO A;  4YWZ A;  3LFV A;  1WA9 A;  2A3U A;  4GZB A;  4I5S A;  4E3I A;  1OTI A;  4B4X A;  4BQM A;  2V0U A;  3IWO A;  3EQV A;  3WRZ A;  3MFD A;  4LRY C;  4E3M A;  2G2U A;  4EW7 A;  1MC0 A;  1TS7 A;  2CMN A;  5KZH A;  3IXH A;  5DTS A;  1W79 A;  3B42 A;  3DTE A;  1W7F A;  5AQA A;  3T12 B;  3GV9 A;  4OH0 A;  1FR1 A;  2Z2L B;  1NYM A;  1NWZ A;  4CPK A;  3NUL A;  4I38 A;  3S1Y A;  1TEM A;  3NI9 A;  2XK1 A;  3MKE A;  5FL3 A;  3MZD A;  3NOT C;  5DF9 A;  5L10 A;  5FAO A;  2EX6 A;  5J8X A;  4IHQ A;  3Q1F A;  1N9N A;  2ZJ9 A;  4S2I A;  1DJC A;  5DF7 A;  1PI4 A;  5F68 A;  2O0Y A;  3MBZ A;  1FSW A;  5FQ9 A;  4OLD A;  4B9O A;  4I39 A;  4CLC E;  3P01 A;  4Q0J A;  4OLG A;  5FQM A;  2EXB A;  2Y2P A;  2OOL A;  3IF6 A;  4WYY A;  2V2F F;  3IF5 A;  3ZG5 A;  4U0T A;  3E2K A;  2NUT C;  5CED A;  1OTE A;  4LGW A;  5F1G A;  4R6L A;  4B93 A;  1KGE A;  2OLV A;  2JHE A;  1ESI A;  1F5M A;  1K6S A;  1UWP X;  3H82 B;  4F3L B;  5KSC A;  1CEF A;  2O9B A;  1RCJ A;  1J9M A;  3GEC A;  5HFO A;  2EX8 A;  2PRF A;  4L9G A;  3F1N B;  2CC1 A;  2QWS A;  3NOP C;  1Q2Q A;  3HJK A;  1BUL A;  1K55 A;  1RGY A;  4EQ1 A;  2IWB A;  4IVI A;  3UDX A;  5J3W A;  1L0D A;  4H6J A;  1JVJ A;  1M40 A;  3NOU C;  4H8R A;  5FQI A;  3LY4 A;  3JVV A;  3U4L P;  3S22 A;  2JCH A;  1GCE A;  4LFU A;  5M1A A;  2W3G A;  1TS0 A;  4DXC A;  3UO9 A;  2WGI A;  3GMW A;  4EV4 A;  5F1F A;  3CWF A;  5M19 A;  4RX2 A;  3T1R A;  4E3K A;  3W4P A;  2VGL M;  3CI6 A;  4HJ3 A;  4IUH A;  4CLC C;  3BM6 A;  3D72 A;  3VE4 A;  1BSG A;  4R3A A;  5EVE A;  3ZHH A;  4S2L A;  4HIA A;  1XJ4 A;  2OWH A;  1MWT A;  4EQI A;  3IF6 B;  4X1L A;  4K0X A;  3DTM A;  5GHY A;  4WEJ A;  2Y2K A;  2OV5 A;  3ZVW A;  3FPW A;  4NEE D;  1HLU P;  4QPR A;  4EBL A;  1KVL A;  3SH8 A;  2C5W B;  1XXM A;  3H82 A;  3KSG A;  1XA1 A;  3DAV A;  3BFE A;  3T4T A;  3A3E A;  3FWL A;  3CPT A;  1H8Z A;  4P0M A;  3K2N A;  1TS8 A;  4I3A A;  2EFU A;  5HWT A;  3N7W A;  2HF6 A;  2VX8 A;  1G6O A;  2Y79 A;  5EM0 A;  3MJQ A;  4KG6 A;  4KQQ A;  2WUQ A;  2Y59 A;  3BFD A;  4HBT A;  3EGX C;  3HUO A;  4N1X A;  1P9W A;  3QP2 A;  3NY4 A;  4YFM A;  3DWK A;  2Y2Q A;  3VSL A;  4QU3 A;  1G6A A;  3V67 A;  3PBQ A;  4JGP A;  5KMW A;  4OQG A;  4QB8 A;  1XGJ A;  5FI2 A;  1KE4 A;  3S7P A;  4E3N A;  1PRQ A;  2HDQ A;  4I3I A;  4LV3 A;  3GDI A;  3LR4 A;  4XT2 B;  5E43 A;  1ZKJ A;  3VP2 A;  1V9Z A;  3T4L A;  1P0Z A;  1G28 A;  3T4O A;  3ZG0 A;  4HBU A;  2JKR I;  4WBG A;  3BW6 A;  1T1A A;  1T1B A;  1K54 A;  5DFX A;  4DJ2 A;  3FKW A;  5CHM A;  3F1P B;  2PD7 A;  2XLN A;  3OPP A;  4HQA A;  5DKL A;  5IS1 A;  4BD0 A;  3UMD A;  3IS2 A;  4GDN A;  3ICY A;  2V1Z A;  4DXB A;  4E04 A;  2ZQA A;  3KYE A;  2JKT I;  1A0K A;  4KZ7 A;  5HD5 A;  2GDN A;  1PW1 A;  4C6Y A;  2A24 A;  3T1Q B;  1KDW A;  1D7E A;  1XX2 A;  1NYY A;  4UAA A;  1X0O A;  3MSH A;  1MXO A;  4NXG A;  4YOF A;  1ERQ A;  2WGW B;  4N92 A;  3MZF A;  3RXX A;  5EVI C;  5I5L A;  5E2F A;  3UE3 A;  4Y0T A;  1KE0 A;  1TF1 A;  4MNR A;  5A91 A;  4X69 A;  3NDG A;  4EBP A;  1XJ3 A;  4WZ5 C;  3D3O A;  5E2E A;  4NKP A;  1N9O A;  1YLJ A;  4PM6 A;  5A90 A;  4S2M A;  5D3O A;  2X02 A;  4OKP A;  4S2P A;  1NLY A;  4HY8 A;  3IHA A;  3LEQ A;  2XRN A;  2XA7 S;  3TG9 A;  1BT5 A;  1S67 L;  3LY3 A;  1D06 A;  2P74 A;  4R23 A;  3UB7 A;  3UB9 A;  4E3O A;  4KUO A;  3PTE A;  4R4S A;  4EBN A;  2PU4 A;  3LR0 A;  1BLH A;  1H3Q A;  5AVE A;  4WMC A;  2VEA A;  3HUN A;  1VB6 A;  3UE1 A;  4EEU A;  2UV0 E;  2LB5 A;  4Y3I A;  4CLC B;  3GQZ A;  4EEP A;  3SH9 A;  3EOI A;  4ME4 A;  2JC7 A;  1JWZ A;  4UA9 A;  2ZLY A;  4WF0 A;  1DRM A;  2YKF A;  2HP5 A;  4OPZ A;  4ARZ A;  1S1Y A;  5EVI A;  3K3C A;  3ZNY A;  2ZC4 B;  2Y4A A;  5I94 A;  5EM1 A;  2ZMF A;  2G2W A;  1KVM A;  3MR0 A;  3CUE C;  3GVB A;  1CK3 A;  3V5M A;  1HTZ A;  4DN0 A;  2EX2 A;  4KG5 A;  3VP0 A;  3SS5 A;  3LIB A;  3ULF A;  1K54 C;  1W8Y A;  3WS5 A;  3C4P A;  5AQ7 A;  3AGE A;  3Q7Z A;  5F82 A;  3N8R A;  4B4Z A;  4O01 A;  1E4D A;  1L2S A;  1GSW A;  1BLC A;  3E4P A;  4GB7 A;  2VV7 A;  3BRM A;  3T1X A;  5HD3 A;  4HH2 A;  4OOM A;  4KZ5 A;  2WK0 A;  4R4R A;  3RH8 B;  2XDM A;  2HP9 A;  4X1M A;  2PD8 A;  5TR7 A;  3O86 A;  5CGX A;  2H0T A;  3E98 A;  4DDS A;  5DF8 A;  3UPP A;  2QZ6 A;  3GR2 A;  1LT0 A;  3SW1 A;  3OPL A;  2PT7 A;  4MN5 A;  5BOH A;  3KO6 A;  3PHY A;  5CXW A;  4PM9 A;  3KX0 X;  3JPU A;  4FSF A;  5HL1 A;  2Y2M A;  3WS4 A;  3QNC A;  1YSP A;  4GD8 A;  4GS9 A;  1XP4 A;  4HES A;  2J3W A;  5KIZ A;  2V0W A;  4U3T A;  2GNX A;  4LRZ E;  5EUA A;  2VZW A;  3IXD A;  4LLO B;  2R78 A;  3EEA A;  4BLM A;  1U60 A;  1L3L A;  3NHQ A;  4B88 A;  1C3B A;  2D02 A;  4EUZ A;  1AWI A;  3LIC A;  1K4F A;  1JNU A;  2VA0 A;  5F5Y A;  3LEZ A;  2W3F A;  3TRC A;  5FEF A;  5GL9 A;  3ZYT A;  4GS9 B;  4A5R A;  5CHU A;  5G4Y A;  2JKF A;  4JGO A;  2NUP C;  3MZE A;  3WWX A;  1XJ6 A;  4UA7 A;  5DFY A;  3ZG8 B;  4D2O A;  3UN7 A;  4FTX A;  4BJP A;  3ITB A;  2DCF A;  2BG1 A;  4N1H A;  1XKZ A;  2Y2L A;  3R4K A;  3NEC A;  4IVK A;  4X25 A;  1XPB A;  3F1N A;  1NZO A;  3A0V A;  4F94 A;  3HLD A;  2OLU A;  1ERO A;  3I7J A;  1YSQ A;  3R7W A;  5GLD A;  1FIK A;  3VV4 A;  1EW0 A;  1PWD A;  4S2N A;  1OTD A;  5EOE A;  2IWD A;  3NJA A;  4FH4 A;  3LUQ A;  4KQD A;  2GZA A;  2Y2O A;  1K0K A;  5C5K A;  1K55 C;  3HLB A;  3MQQ A;  4KQR A;  4OON A;  1PFL A;  2FFY A;  2ZBB A;  3Q7V B;  5CRF A;  4ZJ1 A;  5FDH A;  1PZP A;  4BWI A;  3PBN A;  5FQJ A;  2HJE A;  4QJG A;  2WKP A;  4JBF A;  2JKG A;  4PM7 A;  1YT4 A;  1OJ5 A;  4P85 A;  5FDS A;  3ITA A;  3DTI A;  5TFQ A;  1QMF A;  3CPT B;  4IJG A;  4FD8 A;  2H0Y A;  4LV1 A;  1TVF A;  4FH2 A;  3C7V A;  1JWP A;  3MF0 A;  3D4F A;  3IH9 A;  3ZFZ A;  5E2H A;  5E2G A;  4AFI A;  5G18 A;  2LB9 A;  3BQA A;  4Q0I A;  3NBL A;  4K08 A;  2XD1 A;  1YLY A;  1SHV A;  3FC7 A;  2OAP 1;  3N6I A;  1NRF A;  3V3S A;  2ZC6 B;  3T50 A;  4QY5 A;  3DTK A;  4JXW A;  2J3T D;  4HJ6 A;  1T18 A;  5CHJ A;  4Z9Q A;  4R3J A;  4IBX A;  1CI9 A;  4Y0U A;  3WS1 A;  3QP1 A;  2VGJ A;  1V9Y A;  3LIE A;  1TD5 A;  1OJG A;  3ZG7 B;  2D01 A;  3A3F A;  2QHK A;  2O99 A;  3KSI A;  5F6A A;  2Y2J A;  3LO7 A;  4XT2 A;  1ALQ A;  5HWV A;  2ZOI A;  3P98 A;  4RX3 A;  2Q9N A;  3PBO A;  4X6T A;  1S1Z A;  4S2O A;  3M6B A;  2JBF A;  5EE8 A;  2JN7 A;  1SDE A;  5DKK A;  4MLL A;  1S4R A;  1YQS A;  5HDC A;  3BJN A;  1TDL A;  4HP9 A;  1ES4 A;  4NXB A;  4DRT A;  5AQ9 A;  2BAS A;  4KZ9 A;  3MS6 A;  4N9L A;  2EX9 A;  2XEP A;  4Q0H A;  4UHU A;  3QHY A;  1E25 A;  3G4P A;  1JWV A;  1S4S A;  3FPV A;  2XA7 M;  2ZC5 B;  1LL9 A;  4L9E A;  1UWN X;  1PZO A;  3S7N A;  4Y17 A;  4HEF A;  3QP4 A;  4LV2 A;  4GKU A;  4ZJ2 A;  3GSG A;  1IOU A;  1DP9 A;  2FH5 A;  3BWL A;  5HDS A;  4LRX C;  1OT6 A;  3W4O A;  4GD6 A;  4JPM A;  5FAT A;  4GNU A;  5A8B A;  4RVA A;  2Y2I A;  2OWJ A;  1RGZ A;  1BYW A;  1LLB A;  4ZJ3 A;  1L0F A;  3ZVT A;  2R9W A;  3MXQ A;  4XUZ A;  4D60 A;  2W3D A;  2PBY A;  3MKF A;  4WLA A;  5FI7 A;  2QJ7 A;  2XD5 A;  4Y2F A;  3Q81 A;  4I3J A;  2I9V A;  4ZTK A;  5IU1 A;  1LI9 A;  1NJ4 A;  1FCO A;  1IKI A;  2Z2M B;  3HCY A;  5CGW A;  5U47 A;  2AVX A;  4HOI A;  4OOL A;  1K57 C;  3CZD A;  4WUJ A;  1ZTU A;  4KEN B;  4R3B A;  4ZAM A;  4E3J A;  3IT9 A;  2A49 A;  3IXB A;  5GLB A;  1GHP A;  3FG8 A;  3PAE A;  4QHC A;  1FSY A;  3JVU A;  2WKE A;  5FEG A;  3IH8 A;  1DJA A;  4GHI B;  4ID4 A;  3D9Y A;  5DJU A;  3BEB A;  5CER A;  2OAQ 1;  1WYB A;  1BLS A;  1DJB A;  4F3L A;  5G4Z A;  4E3L A;  3B3X A;  2L1M A;  1PIO A;  2OSU A;  3U2A A;  5HWW A;  2J80 A;  4KG2 A;  2M7V A;  2WKR A;  2QMI A;  2HDS A;  4JGQ A;  2ZQC A;  3KYQ A;  2IA2 A;  2WGW A;  2ACG A;  1PNE A;  2VV6 A;  5L07 A;  1HVB A;  2PR5 A;  3LR3 A;  3MQ0 A;  5EVL A;  3HVF A;  5L09 A;  3IHB A;  3H7W B;  5A92 A;  4WZ5 A;  1K6R A;  1LL5 A;  5GLC A;  4JF4 A;  2PHY A;  3HLF A;  3UB6 A;  4JKT A;  3OPR A;  3UME A;  4LCM A;  5EEC A;  3QNB A;  4MMN A;  5FI6 A;  1S6R A;  4OOY A;  3O3V A;  4BEN A;  2XR0 A;  1BZA A;  3UDF A;  3LI9 A;  3PBT A;  1XGI A;  1OPX A;  4PMA A;  1KOU A;  3IWQ A;  1MZU A;  4R0Q A;  1KE3 A;  2EFX A;  2J7V A;  5HPF A;  3IBJ A;  4IBR A;  4PM5 A;  2VLG A;  3N8L A;  3LIA A;  2A2L A;  1NZU A;  3LI8 A;  1BUE A;  2HDU A;  3UB5 P;  4HHD A;  3NCK A;  4Y15 A;  5F83 A;  3VOL A;  4DMZ A;  1H0M A;  1XFQ A;  4GHI A;  1PWC A;  4NK3 A;  3ZGA B;  2IWC A;  4JXS A;  5EVI D;  2EWV A;  4BL2 A;  3A3J A;  1XJ2 A;  5HSQ A;  3TW8 A;  1CI8 A;  4O0P A;  4Y7P A;  3C5A A;  3S7O A;  3F1O B;  2R9X A;  2L0W A;  4PKY A;  3E4O A;  3QP8 A;  3VP1 A;  4E6W A;  2W1T A;  1YPR A;  5HL6 A;  2Y2G A;  2GJ3 A;  2J8Y A;  4WMC D;  5CGS A;  3KYZ A;  4QWO A;  5HX9 A;  5HAQ A;  1LHY A;  2V1B A;  1ZG4 A;  5FAP A;  1I5Q A;  4PPR A;  1IFQ A;  3OBF A;  3TJZ C;  4WM9 A;  2K31 A;  2ZC7 A;  4WN5 A;  1MKM A;  2ZMV A;  4KZ4 A;  1F98 A;  4MN6 A;  3EQU A;  1OTB A;  1W63 Q;  1VET A;  2M1C A;  4EES A;  3CMZ A;  2BLS A;  1CEG A;  4PM8 A;  3UPO A;  2WAD A;  3MXR A;  2DRW A;  3GTC A;  1LI0 A;  4FOF A;  1FOF A;  3A3I A;  2V8F A;  1YM1 A;  2J3T C;  2WKQ A;  5L8M A;  3VP3 A;  2RCX A;  4KQO A;  3IQA A;  5K5B A;  1LL8 A;  3VFH A;  2W27 A;  4LCL A;  3S7Q A;  5DTT A;  4H6J B;  4II7 A;  3CUE A;  4DE0 A;  2Z6C A;  3O5Y A;  3WS0 A;  1GHM A;  4DKI A;  2V1A A;  2L4R A;  4WL9 A;  3TSG A;  1K4E A;  2KOI A;  2X71 A;  2K2N A;  1VET B;  2V9A A;  3CG5 A;  3Q7V A;  2WKH A;  3G32 A;  2BTF P;  3G2Z A;  5EFW A;  1IYQ A;  3QP6 A;  4G3W A;  5EPH A;  3OOV A;  4BD1 A;  5CEC A;  4K0W A;  4LPZ A;  1MPL A;  2P7J A;  2HPB A;  3G30 A;  3WS2 A;  1G5U A;  1DP6 A;  2Q0O A;  1YMX A;  3HLC A;  3CJM A;  4FCF A;  5GHX A;  4GJ4 A;  3CIT A;  4BMW A;  2ZQD A;  4IED A;  5FQK A;  3A0S A;  2YKH A;  2K7S A;  1ZHH B;  3BQ8 A;  3WRT A;  2KX6 A;  1P97 A;  3NIA A;  4M3K A;  1IEL A;  3M2K A;  2B18 A;  4NXE A;  1ONH A;  3IBR A;  1PI5 A;  3UE6 A;  1UGU A;  3HJI A;  3ZNT A;  3LYX A;  2A24 B;  4MBF A;  1MWS A;  2EXA A;  1FCM A;  4OP8 A;  1YMS A;  3ZCZ A;  3BEC A;  2ZD8 A;  4JLF A;  2WKI A;  5J4E A;  2Q9M A;  4E6X A;  2V20 A;  1SKF A;  4X56 A;  4MBH A;  2W3H A;  5GHZ A;  1MY8 A;  3FYZ A;  4WEK A;  4JXV A;  1VHM A;  3C30 A;  3Q07 A;  2PU2 A;  1Y54 A;  4CJN A;  2ZL1 B;  1PYY A;  3UPN A;  1GA9 A;  3L7H A;  3SZT A;  4EWF A;  4JF5 A;  3SS3 A;  1Z09 A;  2B5R A;  4BBV A;  1O07 A;  3ZG9 B;  2Y91 A;  3DBA A;  3HL9 A;  4S2K A;  1KDS A;  2XQZ A;  4DJ3 A;  2P08 A;  2ZQ8 A;  5AVF A;  1TS6 A;  2Y55 A;  3BLM A;  5EVI B;  3IXG A;  4QY6 A;  1YLZ A;  2ZL1 A;  3DWZ A;  4IUK A;  1NRJ A;  4JF6 A;  2B95 A;  3EWK A;  4ZBE A;  3UDI A; 
#chains in the Genus database with same CATH homology
 5EV0 A;  2HZ5 A;  5EM1 A;  3NEC A;  3LEQ A;  1G5U A;  1J3W A;  1VET B;  1YPR A;  3L9K A;  3LGO A;  3NUL A;  4X25 A;  5EM0 A;  1ACF A;  1CQA A;  4X1M A;  3T1S A;  3DAV A;  1CF0 A;  4ESP A;  4X1L A;  2JKF A;  1CJF A;  3L7H A;  2PRF A;  2VK3 A;  3KYE A;  1F2K A;  1VET A;  2PBD P;  4QWO A;  1A0K A;  2V8C A;  3MS6 A;  2BTF P;  2JKG A;  1K0K A;  1FIK A;  3T1R A;  1D1J A;  1AWI A;  4FUW A;  4D60 A;  3CPT A;  5FDS A;  3CHW P;  1Z09 A;  3UB5 P;  1Y4O A;  1HLU P;  1SKO A;  2ZL1 B;  1PRQ A;  3U4L P;  1VEU B;  2ZL1 A;  3T1Q B;  5EVE A;  2PAV P;  4FTX A;  1PFL A;  2ACG A;  3CPT B;  1SZV A;  5FEG A;  3T1X A;  3T12 B;  3MSH A;  2B95 A;  1FIL A;  1SKO B;  2V8F A;  3D9Y A;  2E8J A;  5FEF A;  1VEU A;  1PNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...