4X25A

Structural basis for mutation-induced destabilization of profilin 1 in als
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
134
Chain Sequence
b'AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTFNVTVTKTDKTLVLLTGKEGVHGGLINKKCYEMASHLRRSQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Profilin-1
publication title Structural basis for mutation-induced destabilization of profilin 1 in ALS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 39
structure length 134
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4x25A00
3DAVA 4ESPA 3NECA 1Y4OA 1SKOB 3T1SA 3T1XA 3T12B 2V8CA 2JKFA 1CF0A 2E8JA 1AWIA 1FILA 5FDSA 1J3WA 3L9KA 1VEUA 3CPTB 1F2KA 1D1JA 4QWOA 2PBDP 2V8FA 4X1LA 1ACFA 3L7HA 1A0KA 1PRQA 3T1QB 2VK3A 5EM0A 2BTFP 1CQAA 5FEFA 4FUWA 3LEQA 3MSHA 5EM1A 1VETA 1K0KA 1PNEA 2ZL1A 3U4LP 1HLUP 2B95A 1Z09A 3D9YA 3LGOA 3KYEA 4X1MA 4D60A 1G5UA 1PFLA 2PAVP 1SKOA 1YPRA 2PRFA 3UB5P 3CPTA 3NULA 4X25A 1VEUB 2ACGA 1VETB 5EVEA 1SZVA 4FTXA 2ZL1B 2JKGA 5EV0A 5FEGA 3T1RA 3CHWP 1CJFA 2HZ5A 1FIKA 3MS6A
chains in the Genus database with same CATH superfamily
5JYOA 3BJNA 4I3IA 4R6LA 3VFHA 4CPKA 3LIAA 5FQ9A 3VE4A 1CI8A 4M4XA 3O88A 4R3JA 2WGIA 5TGFA 4OKPA 3N8LA 2OLUA 2H0TA 4FD8A 3DW0A 3CPTB 2I9VA 1BZAA 2EXAA 3LI8A 2FFYA 5F5YA 2VEAA 1NJ4A 1ACFA 4HNBA 4HI4A 5J4EA 3LIBA 1GA0A 2P74A 4ZTKA 4UEYA 4IEDA 3ITAA 1N9LA 5EM1A 2ZQ9A 1VETA 3HLEA 2XROA 1VHMA 5CHMA 5GLAA 1NLYA 2B5RA 5TBMA 4Y7PA 4PPRA 1E4DA 4OQIA 2W3EA 2WZZA 3Q81A 2Y2IA 1P97A 3EWKA 4KG2A 3SS5A 1X0OA 3OPHA 4EQ1A 1K6RA 3M2KA 3RH8B 3A0RA 1XFQA 2JKRM 3HUMA 4Y0UA 1MPLA 4HY8A 3DTKA 3BECA 4OPQA 5HL6A 2OWHA 3A3JA 3BY8A 3RTYA 1K55C 2JKGA 4DXCA 3NDEA 1YM1A 1O7EA 2P7JA 1H0MA 4FH2A 4NXBA 4IVKA 3HBRA 4ESPA 3GSGA 3SH8A 4E3NA 1OMEA 2J3TC 4LFUA 3MR0A 3G31A 2XEPA 3LI9A 1BLPA 3UE1A 5DJUA 1Q2QA 1J9MA 1I5QA 5E43A 1G28A 3UB7A 1AWIA 2ZC7A 2Y8HA 3MFXA 5CHUA 4XUZA 4KUOA 1F2KA 2UWXA 4QWOA 5F1GA 4OPYA 2PYPA 3EEAA 1V9YA 3HLWA 3IH9A 5AVFA 3IXDA 4ETZA 3QP2A 2JN7A 2ZMAA 5TJJA 2YKFA 1ESUA 4KUKA 3B42A 4AFIA 5HPIA 4GN2A 4CJNA 4BWIA 3IX4A 4R0QA 3QP8A 1JVJA 2O9BA 2HDUA 3NBLA 4IUHA 2V20A 3WS4A 4PM6A 1HLUP 3UDIA 1M6KA 5U47A 1Z09A 1W8YA 2KX6A 1XJ2A 4QJGA 3PBTA 3ITBA 1GHMA 2JCHA 3G35A 4IHQA 4X1MA 4X56A 2A24B 3RXXA 5CGXA 4B4XA 1K55A 1C3BA 5AVEA 2ACGA 5EVEA 1BLCA 1SZVA 4KG5A 4HJ4A 4IUKA 4WYYA 2P9VB 1TVFA 2HPBA 3A3DA 2J8YA 3VOLA 2Y79A 1MWUA 3CZDA 2A2LA 1D7EA 4EBNA 5L2FA 1SKOB 3IXBA 4MN6A 5F83A 2WKRA 1S0WA 3H82A 4KENB 1XJ3A 3CAXA 2ZMVA 3K2NA 5KIZA 4U3TA 5CECA 4Q8IA 2PBDP 3UB8A 5AQ9A 1DP6A 1LSXA 1S4RA 3VSLA 2G2WA 2WK0A 1A0KA 2Y59A 2VGLM 3TSGA 1ZG4A 2VK3A 1WYCA 1HZOA 2J9OA 4FUWA 3O87A 3PAEA 2HV1A 3IQAA 3SS3A 2XSSA 3A0SA 1GSVA 1P0ZA 2A3UA 2Y2QA 3GDIA 4RX3A 4ETXA 4L9FA 5FASA 5FL3A 3ZHHA 2DCFA 3T4QA 1KGFA 2ZQ8A 1T18A 4D60A 1G5UA 2J9PA 5CHJA 5J3WA 4H6JB 1WYBA 5EPHA 1PYYA 4CLCD 4JLFA 4WN5A 4R1GA 3OOVA 5FQQA 2KOIA 4EERA 3MZEA 3BRMA 4WL9A 4DDYA 3NULA 5DKLA 4H8RA 1YSPA 2XRNA 3DTEA 4BBUA 3IWOA 5M18A 2WGWB 4BD0A 2ZQAA 2WKQA 2K7SA 1PIOA 3ZG0A 4QHCA 4PM9A 3LR5A 3CUEC 5HSQA 4N9KA 1LHYA 3KX0X 3PBOA 3MKEA 2XFSA 4S2OA 3ZG8B 5EUAA 3V5MA 2UV0E 3HLFA 3GMWA 1EW0A 1DJCA 1E3UA 1SHVA 3HVFA 4X1LA 3F1OA 1MKIA 2PBYA 5A8BA 1JNUA 4WZ5A 3ZNTA 4WMCA 5EM0A 3LEZA 1YLTA 1ONHA 3G2ZA 1OTBA 5L8MA 4DJ2A 5DF7A 3CJMA 3IF6C 4EBPA 4S2NC 3ZNYA 1EWZA 1K38A 3HUNA 2OSUA 3KO6A 4WUJA 3BWLA 2B02A 3JVUA 3H7WA 4YWZA 2Y4AA 4CLCE 1DP8A 3UPNA 2BG1A 3MZFA 2HDQA 4C3QA 1MBLA 1PFLA 4EWFA 4E6WA 4LV1A 4CQHA 4HP9A 1OT6A 4OQGA 2O9CA 4RVAA 5HWTA 3V39A 3BFEA 3W4PA 4O7DA 1YLYA 4E3KA 3ZCZA 2Z2LB 4NXGA 1VQQA 3CHWP 4OLDA 3CUEA 2GJ3A 2HZ5A 3PR6A 4HH2A 4JBFA 2EX8A 4OP5A 3VP2A 2V1BA 3MXRA 4MBKA 3IX8A 2IWBA 3PHYA 1YMXA 1XGIA 4XXRA 1L0GA 4P85A 2GZAA 3E0YA 2KLIA 3K3DA 2LB5A 1W79A 4GDBA 1H8ZA 3IF6A 2O0YA 3ULFA 3AGFA 4S2NA 3MFDA 1YLJA 3FG8A 1T1BA 5KSCA 3S4XA 5FEFA 3O86A 1KDSA 1SDEA 1DY6A 4MBHA 3ZVWA 1YKDA 3JVVA 1F9IA 4HHDA 2L4RA 5HFOA 1GSWA 1CEGA 4I3AA 2QKPA 3CI6A 3MJQA 2XFTA 3NCKA 5HD5A 3BLMA 3ZVTA 1MZUA 3ZQ5A 2ZJ9A 4DE1A 4S2JA 2WAFA 4X53A 3RFBA 1ALQA 3LR3A 3VOZA 4E3MA 5F1FA 4GW9A 3IF5A 3G4PA 2Q0OA 1FCNA 2Y2HA 1OTDA 2BLSA 3S22A 1FSYA 4BENA 2EWVA 5F69A 4KZBA 3F1PA 1VETB 3O5YA 2W3HA 3BEBA 3TG9A 4C6YA 3PBQA 4LCLA 5EV0A 3F1NA 2C5WB 5TBMB 3T1RA 3FPVA 3P01A 5DKKA 4PM8A 4OOYA 2J7VA 3HJIA 1TS0A 4MDZA 2V9AA 4KZ7A 1H8YA 4R4SA 3T12B 2VKSA 3LFVA 2JE5A 4CLCC 2L1MA 4DXBA 1Q2PA 1MXOA 1FILA 2M7VA 4BD1A 3QNBA 2QJ7A 5FSRA 3EOIA 2DNSA 1YLZA 1OJ5A 4HJ6A 4I38A 3N6IA 4OLGA 3M6BA 2JKTM 3BW6A 3Q7VB 2NUTC 1HVBA 3L7HA 5FDHA 5GLCA 4YNRA 1PRQA 5J7EA 3DWZA 1IYSA 1BULA 3OPRA 3ZGAB 2NUPC 4OVDA 1W8QA 4WF0A 5GL9A 2ZC6B 3E2KA 4B93A 2ZL1A 5EE8A 4GKUA 4X55A 3RJUA 1F98A 1YLPA 1PI5A 5HD3A 1TS6A 4NXEA 4OPZA 1ZHHB 4G3VA 1XA7A 2OV5A 3EGDC 2Y2KA 1BUEA 1KOUA 3VMAA 2R9XA 4DMZA 1OTAA 5L07A 3S1YA 5DFXA 3PAGA 3S7QA 4A5RA 5EOOA 3BQ8A 3Q7ZA 4DRTA 3CWFA 1MWRA 3FV7A 1W63M 4QY5A 2Z6CA 3HUOA 4JF6A 5E2FA 3CITA 4DE3A 4S2IA 3DBAA 1P9WA 1XPBA 1DJBA 5IS1A 4E3OA 3LO7A 4CLCA 3K3CA 2PU2A 3VP4A 3E4PA 4RYEA 3WRZA 2E8JA 4LV3A 5EVIC 2H0YA 5MC7A 4NXFA 5CXWA 3BFFA 3LR4A 3WS0A 1TEMA 2W3FA 1GCEA 1IFQA 3E98A 3GV9A 5DTKA 1TDGA 1L3LA 3KSFA 1LSWA 1IKGA 3BYDA 4HP4A 4RX2A 3R7WA 2Z2MB 1O07A 3SH7A 1RGZA 5C5KA 4XT2A 2GDNA 4KZ4A 4BL3A 1K56D 3H82B 4EEUA 3UPPA 3LR0A 3IHBA 5DTTA 4X6TA 4FH4A 2W1TA 3HCYA 3UE6A 1ERQA 5FQKA 2XH9A 4GS9A 5A92A 3NDGA 3PBRA 3D4FA 4IVIA 3T4LA 3UO9A 3KSHA 2VV7A 2PYRA 4E3LA 4IBRA 2OLVA 3TE8A 3GECA 1PWDA 2G2UA 1FSWA 1YLWA 1I2SA 1AXBA 1VEUB 3ZFZA 2DRWA 3BFDA 4NEED 1CJFA 1HD8A 3UB6A 3IWQA 1NWZA 3BFCA 4PAUA 3OCNA 4LCMA 3KSIA 5EVIA 3NECA 5FAPA 1LSVA 2O9AA 4KZ6A 5FQMA 2FH5A 5HARA 4R4RA 4L9GA 5F82A 2A49A 5AQ7A 4OOLA 2C6WB 1YT4A 3HLGA 2OWJA 3C4OA 5A90A 2JKRI 2OAP1 5IHVA 4B88A 4X68A 4BMWA 3W2ZA 3T1QB 4N9LA 1KGEA 4GD6A 4N1XA 3B33A 4GNUA 4G3WA 4Y17A 5D3OA 4ID4A 5FI2A 3T4SA 2Z6DA 3V3RA 3MF0A 3SZTA 4XUXA 3FWLA 5F6AA 2PR6A 2PU4A 5L10A 2W27A 5FATA 1BYWA 4BLMA 2V0UA 2V0WA 3F1OB 3P98A 3IBRA 4OQ0A 4WZ5C 4PM5A 3G32A 4Q0IA 1SCWA 4I5SA 1ES4A 1PZOA 1QMFA 1S67L 3EQVA 4ZRRA 4KG6A 3C5AA 3C38A 2IWDA 3ZYTA 4GOGA 3H7WB 3PXPA 5I94A 4LRYC 5CTNA 3N4IA 4PKYA 1MC0A 1M40A 2Y2MA 4EU0A 3S7PA 2K2NA 3LY3A 4MLLA 3DAVA 2W1RA 3GRJA 4OOMA 1KVLA 1PI4A 4DKIA 4GDNA 4IJGA 4FOFA 4OH0A 5I5LA 2VJWA 1XP4A 3G2YA 4Y15A 2HF6A 1XKZA 5FQJA 1GHPA 4HBUA 1K6SA 2VZWA 4JKTA 5DFYA 3A3EA 2V1AA 5GHXA 2B18A 2JC7A 4LGWA 4DN0A 2PD7A 4WELA 1S4SA 2DMWA 1CI9A 3G34A 4F3LA 3PBSA 1XA1A 1ZC2A 3CLOA 5GHYA 4DDSA 1TDLA 3LICA 4P0MA 1FR1A 2Y91A 5M1AA 1T1AA 3T50A 4ZJ1A 4II7A 1CK3A 2GX5A 4ME4A 4EESA 2ZC4B 2EX6A 1EI5A 2H28A 1XJ4A 3BQAA 3KYZA 4Y5FA 4F94A 5A93A 1GA9A 5EFWA 3IF6B 1NXYA 2FZ0A 2PAVP 3OBFA 2VX8A 1BT5A 4RQ9A 4K91A 3UMEA 1FCOA 3C7UA 3GVBA 4N1HA 1PW1A 4QB8A 3VP1A 2XD1A 4K08A 3A3IA 1JWVA 2P04A 5HDDA 5FEGA 4NKPA 2VGKA 1TD5A 1NY0A 4GZBA 1V9ZA 4OP8A 2Y2JA 1GHIA 4Q0JA 2V1ZA 3IXHA 3W4QA 2QZ6A 4MN7A 2QWSA 2HGVA 1ZKJA 2EFUA 4UA6A 2I72A 3V67A 3EEHA 1J3WA 3MKFA 2ZD8A 1T1CA 3F1PB 2LB9A 2V8FA 3IBJA 4EUVA 4S2MA 3F1NB 3QP1A 3W4OA 4JF4A 1ES2A 4L9EA 5HL1A 4JXGA 3A3FA 3MSHA 1UGUA 3A0VA 4FCFA 3ZG7B 5CEBA 4OQHA 3WRTA 1JTDA 1BSGA 2L0WA 2IWCA 5G4YA 4WLAA 4JF5A 1DP9A 1PWGA 3BY9A 3UPOA 1PZPA 4R70A 3V50A 2RCXA 3IS2A 4Q0HA 1N9NA 3NI9A 2ZLYA 1YPRA 2ZOHA 3G6OA 1YAXA 1K56A 3NHQA 3VP3A 3FZCA 3AGDA 3W8KA 2ZL1B 3LY4A 2VGJA 1OTIA 3OPLA 4JGOA 5CGSA 4U0TA 3UDXA 2Y2PA 2WKEA 1TS7A 3UY6A 4WEKA 4PM7A 3VV4A 3NJAA 1TS8A 4X69A 5KZHA 4OPRA 4BBTA 1BTLA 3VSKA 4BJPA 5IT5A 5DF9A 2HP5A 3WS1A 2D01A 2Y2GA 4HJ3A 1H8MA 1H5XA 4GD8A 3HLDA 4P6BA 2HJ9C 5F68A 2VV8A 4WM9A 4HH3A 3D72A 1IKIA 2PR5A 2EX9A 1CQAA 3T4OA 3GR2A 2EA9A 4CLCB 4M3KA 4O01A 4EETB 2WKPA 4FSFA 3UN7A 3BLSA 5A91A 2BASA 1K0KA 3MBZA 1OT9A 4B4ZA 3TJZC 5HDSA 2K31A 4WZ4A 1STZA 5CEDA 2HDRA 4LV2A 4IBXA 2WGVA 4P6ZS 5FI6A 3C8CA 1EROA 3SW1A 1H3QA 1ODVA 4GHIA 3QNCA 5TFQA 2ZQCA 3OPPA 1E3UD 5FAQA 3FPWA 5CTMA 4MBFA 3I7JA 3QHYA 1RP5A 4I39A 4ARZA 4WMCD 3R7WB 4P87A 4XT2B 4R3AA 1LI0A 1S6RA 1IYOA 5JYPA 5BOHA 2E8IA 2GNXA 4UA9A 5AQBA 2W1TB 3O3VA 4JGRA 1L0DA 1RGYA 3C4PA 3HLCA 4GS9B 2VA0A 5K5BA 1LL8A 1IYQA 2Y2LA 3FYZA 3T4JA 1KVMA 4JXSA 1W5DA 4JGQA 2G7UA 3FC7A 5HPFA 3DTMA 1L2SA 3E4QA 3GQZA 1TF1A 1JTGA 5DJTA 2J3WA 1L0EA 1MWTA 1U60A 1SDNA 1HTZA 3ICYA 4BQMA 3EGXC 1Y28A 1KE4A 4HESA 3SOIA 5TR7A 3G30A 1T19A 4MMNA 5EVIB 1G68A 3C7VA 3MQ0A 2JHEA 3S7NA 1Z6FA 4S2PA 4KQOA 2FFFB 2ZM0A 3D3OA 5L09A 2VLGA 3PBNA 3SS4A 3PTEA 4QPRA 1G6OA 4JXVA 3Q7VA 4JGPA 5EVLA 3MQOA 3N8SA 1LT0A 4RA7A 3NOUC 3MMHA 2HDSA 2X71A 4UAAA 3E4OA 2JKTI 4UQIS 3T4KA 4Y0OA 2R9WA 3CPTA 4B9OA 3P09A 3SH9A 2ZM2A 1KDWA 3WS2A 3LIDA 2P08A 4EXOA 4PMAA 4LLOB 1Y54A 2Q9MA 2ZOIA 5FQIA 5AJGA 3OC2A 4OONA 1ERMA 1Y4OA 2M1CA 1S1YA 4Z1WA 4GB7A 1CF0A 5KMWA 1W63Q 4Y3IA 1FOFA 4HQAA 2VV6A 3EQUA 2W3GA 1YSQA 2H5SA 3UE3A 4ZAMA 4UA7A 3Q07A 5CX7A 4MCWA 5FI7A 4KZ8A 3IX3A 3C2WA 2XGNA 1K57C 4WBGA 2QPNA 3CG5A 3R4KA 4MNRA 1ES3A 1OTEA 1CEFA 3UE0A 3ZG5A 4EEPA 1BLSA 2WUQA 2HP9A 5G18A 2V2FF 3MQQA 4R23A 4E3IA 4DE0A 1XX2A 3KYEA 4BBVA 2XA7M 4E3JA 1XXMA 1S66L 1W7FA 5DF8A 4E6XA 2WKIA 4HIAA 5E2HA 3HL9A 3Q1FA 1ES5A 5HZHA 3KSGA 3OZHA 3T4TA 4KZ3A 3VFFA 4HOIA 3FKVA 4F3LB 1MKMA 3UB5P 3LIFA 5CERA 2Y55A 1ZTUA 5IU1A 5DTSA 2OAQ1 3UB9A 5GLDA 5HWVA 2WKHA 1K54C 1ESIA 3IHAA 1FR6A 4U0XA 4EV4A 3WS5A 3MS6A 3HLBA 1UWPX 4D2OA 3JYIA 4ZJ3A 3NC8A 5KSHA 1BLHA 5HDCA 5DVAA 4O8GA 2O99A 2XDMA 3WWXA 5HWWA 3S7OA 4MN5A 3IXGA 4DF6A 1VEUA 1E25A 4YFMA 2W0NA 1NLZA 1S1ZA 4KQQA 3TW8A 3KYQA 1K57A 5FAOA 3PYPA 1RCJA 3NOTC 2JBFA 1ZG6A 2A24A 2BTFP 2W3DA 2EXBA 1UWNX 4Y2FA 3C30A 2XK1A 5CRFA 4KZAA 2PT7A 3LIEA 1PW8A 2YKHA 4LPZA 1NZOA 4GLQA 1PNEA 2ZBBA 4PHTA 3U4LP 2XF3A 3UMDA 1KE3A 2ZM8A 3N7WA 2P9VA 4YOFA 4LRZE 5HAQA 1PWCA 1N9OA 4YINA 3MZDA 2PDRA 1SKOA 2R78A 1WA9A 3HJKA 1I2WA 3HREA 4NG2A 4P6ZM 2PRFA 2XLNA 1N4OA 2WADA 3TOIA 2EX2A 3MXSA 3NOPC 2WYXA 5LBRA 4O0PA 5HAIA 1K54A 3DWKA 2XD5A 1NRJA 4FTXA 4R38A 3IH8A 3P7NA 1FCMA 3UNWA 4DE2A 2ZC3B 5EOEA 5E2GA 1K25A 4WEJA 3E2LA 5HX9A 4Z9QA 1MWSA 2IA2A 3H9WA 3IS2B 2ZMFA 1QMEA 2EWWA 2WZXA 3T1XA 2Q9NA 2X01A 4HEFA 4EQIA 5EECA 5G4ZA 4ZBEA 2ZQ7A 1YQSA 5E2EA 4L0LA 2AVXA 1LL9A 2CMNA 4LRXC 3B47A 1YMSA 1D1JA 3U2AA 2XR0A 1XGJA 1NYMA 4KZ9A 4H6JA 5GLBA 2Y2NA 3QP5A 1SKFA 4QD4A 3B3XA 2ZC5B 3NY4A 3NIAA 3N8RA 3JPUA 3OCLA 4PKYG 5M19A 1ONGA 5EVID 4KQRA 4LV0A 4ZDXA 1OJGA 2WGWA 4EUZA 4QU3A 3LCEA 2ZQDA 4UHUA 4S2KA 3VP0A 2M7UA 3ZDJA 2WAEA 5J8XA 4GCZA 1IELA 1KGGA 2J3TD 1N9BA 3RXWA 3M2JA 1L0FA 3CMZA 2XA7S 2QYBA 2EFXA 2HP6A 3ISGA 1LI9A 1F5MA 3BFGA 4GJ4A 1NZUA 3ZG9B 1VB6A 4X25A 1LLBA 4UQIM 1XFNA 4EW7A 4K0WA 1JWPA 1NYYA 2Y2OA 4Y13A 4GHIB 4NK3A 1D06A 1OPXA 3DTIA 1IYPA 1WE4A 2XQZA 4BL2A 1NRFA 3TRCA 4G3KA 1IOUA 4LENA 3T1SA 4EBLA 2X02A 2V8CA 2JKFA 4ARZB 2PHYA 2VGLS 4R3BA 1XJ6A 5FDSA 3L9KA 1VM1A 1LL5A 2QJ5A 3Q82A 4KZ5A 3OLOA 1IEMA 4K0XA 4HBTA 1JWZA 2PD8A 2RL3A 4MEZA 2D02A 4Y0TA 1DRMA 2CC1A 5CGWA 4JPMA 2MJ6A 4KQDA 5FA7A 4S2LA 3LEQA 1K4FA 3QP6A 1DJAA 3QP4A 5GHZA 1G6AA 2B95A 2H10A 3D9YA 5AQAA 3LGOA 3BM6A 1P9RA 3IWIA 3GTCA 4C75A 4I3JA 2QMIA 1FQGA 5HW3A 4ZJ2A 2OOLA 3LYXA 1GSXA 4JXWA 3UDFA 3V3SA 4QY6A 4DJ3A 2J80A 2KDKA 3IT9A 2HJEA 1K4EA 4N92A 2INWA 1KE0A 3FKWA 3MXQA 2QHKA 4NETA 3LUQA 3VOYA 3VE3A 1MY8A 3AGEA 4E04A 1FIKA 3M6HA 5HAPA
chains in the Genus database with same CATH topology
3DAVA 4ESPA 3NECA 1Y4OA 1SKOB 3T1SA 3T1XA 3T12B 2V8CA 2JKFA 1CF0A 2E8JA 1AWIA 1FILA 5FDSA 1J3WA 3L9KA 1VEUA 3CPTB 1F2KA 1D1JA 4QWOA 2PBDP 2V8FA 4X1LA 1ACFA 3L7HA 1A0KA 1PRQA 3T1QB 2VK3A 5EM0A 2BTFP 1CQAA 5FEFA 4FUWA 3LEQA 3MSHA 5EM1A 1VETA 1K0KA 1PNEA 2ZL1A 3U4LP 1HLUP 2B95A 1Z09A 3D9YA 3LGOA 3KYEA 4X1MA 4D60A 1G5UA 1PFLA 2PAVP 1SKOA 1YPRA 2PRFA 3UB5P 3CPTA 3NULA 4X25A 1VEUB 2ACGA 1VETB 5EVEA 1SZVA 4FTXA 2ZL1B 2JKGA 5EV0A 5FEGA 3T1RA 3CHWP 1CJFA 2HZ5A 1FIKA 3MS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DAV A;  4ESP A;  3NEC A;  1Y4O A;  1SKO B;  3T1S A;  3T1X A;  3T12 B;  2V8C A;  2JKF A;  1CF0 A;  2E8J A;  1AWI A;  1FIL A;  5FDS A;  1J3W A;  3L9K A;  1VEU A;  3CPT B;  1F2K A;  1D1J A;  4QWO A;  2PBD P;  2V8F A;  4X1L A;  1ACF A;  3L7H A;  1A0K A;  1PRQ A;  3T1Q B;  2VK3 A;  5EM0 A;  2BTF P;  1CQA A;  5FEF A;  4FUW A;  3LEQ A;  3MSH A;  5EM1 A;  1VET A;  1K0K A;  1PNE A;  2ZL1 A;  3U4L P;  1HLU P;  2B95 A;  1Z09 A;  3D9Y A;  3LGO A;  3KYE A;  4X1M A;  4D60 A;  1G5U A;  1PFL A;  2PAV P;  1SKO A;  1YPR A;  2PRF A;  3UB5 P;  3CPT A;  3NUL A;  4X25 A;  1VEU B;  2ACG A;  1VET B;  5EVE A;  1SZV A;  4FTX A;  2ZL1 B;  2JKG A;  5EV0 A;  5FEG A;  3T1R A;  3CHW P;  1CJF A;  2HZ5 A;  1FIK A;  3MS6 A; 
#chains in the Genus database with same CATH topology
 5JYO A;  3BJN A;  4I3I A;  4R6L A;  3VFH A;  4CPK A;  3LIA A;  5FQ9 A;  3VE4 A;  1CI8 A;  4M4X A;  3O88 A;  4R3J A;  2WGI A;  5TGF A;  4OKP A;  3N8L A;  2OLU A;  2H0T A;  4FD8 A;  3DW0 A;  3CPT B;  2I9V A;  1BZA A;  2EXA A;  3LI8 A;  2FFY A;  5F5Y A;  2VEA A;  1NJ4 A;  1ACF A;  4HNB A;  4HI4 A;  5J4E A;  3LIB A;  1GA0 A;  2P74 A;  4ZTK A;  4UEY A;  4IED A;  3ITA A;  1N9L A;  5EM1 A;  2ZQ9 A;  1VET A;  3HLE A;  2XRO A;  1VHM A;  5CHM A;  5GLA A;  1NLY A;  2B5R A;  5TBM A;  4Y7P A;  4PPR A;  1E4D A;  4OQI A;  2W3E A;  2WZZ A;  3Q81 A;  2Y2I A;  1P97 A;  3EWK A;  4KG2 A;  3SS5 A;  1X0O A;  3OPH A;  4EQ1 A;  1K6R A;  3M2K A;  3RH8 B;  3A0R A;  1XFQ A;  2JKR M;  3HUM A;  4Y0U A;  1MPL A;  4HY8 A;  3DTK A;  3BEC A;  4OPQ A;  5HL6 A;  2OWH A;  3A3J A;  3BY8 A;  3RTY A;  1K55 C;  2JKG A;  4DXC A;  3NDE A;  1YM1 A;  1O7E A;  2P7J A;  1H0M A;  4FH2 A;  4NXB A;  4IVK A;  3HBR A;  4ESP A;  3GSG A;  3SH8 A;  4E3N A;  1OME A;  2J3T C;  4LFU A;  3MR0 A;  3G31 A;  2XEP A;  3LI9 A;  1BLP A;  3UE1 A;  5DJU A;  1Q2Q A;  1J9M A;  1I5Q A;  5E43 A;  1G28 A;  3UB7 A;  1AWI A;  2ZC7 A;  2Y8H A;  3MFX A;  5CHU A;  4XUZ A;  4KUO A;  1F2K A;  2UWX A;  4QWO A;  5F1G A;  4OPY A;  2PYP A;  3EEA A;  1V9Y A;  3HLW A;  3IH9 A;  5AVF A;  3IXD A;  4ETZ A;  3QP2 A;  2JN7 A;  2ZMA A;  5TJJ A;  2YKF A;  1ESU A;  4KUK A;  3B42 A;  4AFI A;  5HPI A;  4GN2 A;  4CJN A;  4BWI A;  3IX4 A;  4R0Q A;  3QP8 A;  1JVJ A;  2O9B A;  2HDU A;  3NBL A;  4IUH A;  2V20 A;  3WS4 A;  4PM6 A;  1HLU P;  3UDI A;  1M6K A;  5U47 A;  1Z09 A;  1W8Y A;  2KX6 A;  1XJ2 A;  4QJG A;  3PBT A;  3ITB A;  1GHM A;  2JCH A;  3G35 A;  4IHQ A;  4X1M A;  4X56 A;  2A24 B;  3RXX A;  5CGX A;  4B4X A;  1K55 A;  1C3B A;  5AVE A;  2ACG A;  5EVE A;  1BLC A;  1SZV A;  4KG5 A;  4HJ4 A;  4IUK A;  4WYY A;  2P9V B;  1TVF A;  2HPB A;  3A3D A;  2J8Y A;  3VOL A;  2Y79 A;  1MWU A;  3CZD A;  2A2L A;  1D7E A;  4EBN A;  5L2F A;  1SKO B;  3IXB A;  4MN6 A;  5F83 A;  2WKR A;  1S0W A;  3H82 A;  4KEN B;  1XJ3 A;  3CAX A;  2ZMV A;  3K2N A;  5KIZ A;  4U3T A;  5CEC A;  4Q8I A;  2PBD P;  3UB8 A;  5AQ9 A;  1DP6 A;  1LSX A;  1S4R A;  3VSL A;  2G2W A;  2WK0 A;  1A0K A;  2Y59 A;  2VGL M;  3TSG A;  1ZG4 A;  2VK3 A;  1WYC A;  1HZO A;  2J9O A;  4FUW A;  3O87 A;  3PAE A;  2HV1 A;  3IQA A;  3SS3 A;  2XSS A;  3A0S A;  1GSV A;  1P0Z A;  2A3U A;  2Y2Q A;  3GDI A;  4RX3 A;  4ETX A;  4L9F A;  5FAS A;  5FL3 A;  3ZHH A;  2DCF A;  3T4Q A;  1KGF A;  2ZQ8 A;  1T18 A;  4D60 A;  1G5U A;  2J9P A;  5CHJ A;  5J3W A;  4H6J B;  1WYB A;  5EPH A;  1PYY A;  4CLC D;  4JLF A;  4WN5 A;  4R1G A;  3OOV A;  5FQQ A;  2KOI A;  4EER A;  3MZE A;  3BRM A;  4WL9 A;  4DDY A;  3NUL A;  5DKL A;  4H8R A;  1YSP A;  2XRN A;  3DTE A;  4BBU A;  3IWO A;  5M18 A;  2WGW B;  4BD0 A;  2ZQA A;  2WKQ A;  2K7S A;  1PIO A;  3ZG0 A;  4QHC A;  4PM9 A;  3LR5 A;  3CUE C;  5HSQ A;  4N9K A;  1LHY A;  3KX0 X;  3PBO A;  3MKE A;  2XFS A;  4S2O A;  3ZG8 B;  5EUA A;  3V5M A;  2UV0 E;  3HLF A;  3GMW A;  1EW0 A;  1DJC A;  1E3U A;  1SHV A;  3HVF A;  4X1L A;  3F1O A;  1MKI A;  2PBY A;  5A8B A;  1JNU A;  4WZ5 A;  3ZNT A;  4WMC A;  5EM0 A;  3LEZ A;  1YLT A;  1ONH A;  3G2Z A;  1OTB A;  5L8M A;  4DJ2 A;  5DF7 A;  3CJM A;  3IF6 C;  4EBP A;  4S2N C;  3ZNY A;  1EWZ A;  1K38 A;  3HUN A;  2OSU A;  3KO6 A;  4WUJ A;  3BWL A;  2B02 A;  3JVU A;  3H7W A;  4YWZ A;  2Y4A A;  4CLC E;  1DP8 A;  3UPN A;  2BG1 A;  3MZF A;  2HDQ A;  4C3Q A;  1MBL A;  1PFL A;  4EWF A;  4E6W A;  4LV1 A;  4CQH A;  4HP9 A;  1OT6 A;  4OQG A;  2O9C A;  4RVA A;  5HWT A;  3V39 A;  3BFE A;  3W4P A;  4O7D A;  1YLY A;  4E3K A;  3ZCZ A;  2Z2L B;  4NXG A;  1VQQ A;  3CHW P;  4OLD A;  3CUE A;  2GJ3 A;  2HZ5 A;  3PR6 A;  4HH2 A;  4JBF A;  2EX8 A;  4OP5 A;  3VP2 A;  2V1B A;  3MXR A;  4MBK A;  3IX8 A;  2IWB A;  3PHY A;  1YMX A;  1XGI A;  4XXR A;  1L0G A;  4P85 A;  2GZA A;  3E0Y A;  2KLI A;  3K3D A;  2LB5 A;  1W79 A;  4GDB A;  1H8Z A;  3IF6 A;  2O0Y A;  3ULF A;  3AGF A;  4S2N A;  3MFD A;  1YLJ A;  3FG8 A;  1T1B A;  5KSC A;  3S4X A;  5FEF A;  3O86 A;  1KDS A;  1SDE A;  1DY6 A;  4MBH A;  3ZVW A;  1YKD A;  3JVV A;  1F9I A;  4HHD A;  2L4R A;  5HFO A;  1GSW A;  1CEG A;  4I3A A;  2QKP A;  3CI6 A;  3MJQ A;  2XFT A;  3NCK A;  5HD5 A;  3BLM A;  3ZVT A;  1MZU A;  3ZQ5 A;  2ZJ9 A;  4DE1 A;  4S2J A;  2WAF A;  4X53 A;  3RFB A;  1ALQ A;  3LR3 A;  3VOZ A;  4E3M A;  5F1F A;  4GW9 A;  3IF5 A;  3G4P A;  2Q0O A;  1FCN A;  2Y2H A;  1OTD A;  2BLS A;  3S22 A;  1FSY A;  4BEN A;  2EWV A;  5F69 A;  4KZB A;  3F1P A;  1VET B;  3O5Y A;  2W3H A;  3BEB A;  3TG9 A;  4C6Y A;  3PBQ A;  4LCL A;  5EV0 A;  3F1N A;  2C5W B;  5TBM B;  3T1R A;  3FPV A;  3P01 A;  5DKK A;  4PM8 A;  4OOY A;  2J7V A;  3HJI A;  1TS0 A;  4MDZ A;  2V9A A;  4KZ7 A;  1H8Y A;  4R4S A;  3T12 B;  2VKS A;  3LFV A;  2JE5 A;  4CLC C;  2L1M A;  4DXB A;  1Q2P A;  1MXO A;  1FIL A;  2M7V A;  4BD1 A;  3QNB A;  2QJ7 A;  5FSR A;  3EOI A;  2DNS A;  1YLZ A;  1OJ5 A;  4HJ6 A;  4I38 A;  3N6I A;  4OLG A;  3M6B A;  2JKT M;  3BW6 A;  3Q7V B;  2NUT C;  1HVB A;  3L7H A;  5FDH A;  5GLC A;  4YNR A;  1PRQ A;  5J7E A;  3DWZ A;  1IYS A;  1BUL A;  3OPR A;  3ZGA B;  2NUP C;  4OVD A;  1W8Q A;  4WF0 A;  5GL9 A;  2ZC6 B;  3E2K A;  4B93 A;  2ZL1 A;  5EE8 A;  4GKU A;  4X55 A;  3RJU A;  1F98 A;  1YLP A;  1PI5 A;  5HD3 A;  1TS6 A;  4NXE A;  4OPZ A;  1ZHH B;  4G3V A;  1XA7 A;  2OV5 A;  3EGD C;  2Y2K A;  1BUE A;  1KOU A;  3VMA A;  2R9X A;  4DMZ A;  1OTA A;  5L07 A;  3S1Y A;  5DFX A;  3PAG A;  3S7Q A;  4A5R A;  5EOO A;  3BQ8 A;  3Q7Z A;  4DRT A;  3CWF A;  1MWR A;  3FV7 A;  1W63 M;  4QY5 A;  2Z6C A;  3HUO A;  4JF6 A;  5E2F A;  3CIT A;  4DE3 A;  4S2I A;  3DBA A;  1P9W A;  1XPB A;  1DJB A;  5IS1 A;  4E3O A;  3LO7 A;  4CLC A;  3K3C A;  2PU2 A;  3VP4 A;  3E4P A;  4RYE A;  3WRZ A;  2E8J A;  4LV3 A;  5EVI C;  2H0Y A;  5MC7 A;  4NXF A;  5CXW A;  3BFF A;  3LR4 A;  3WS0 A;  1TEM A;  2W3F A;  1GCE A;  1IFQ A;  3E98 A;  3GV9 A;  5DTK A;  1TDG A;  1L3L A;  3KSF A;  1LSW A;  1IKG A;  3BYD A;  4HP4 A;  4RX2 A;  3R7W A;  2Z2M B;  1O07 A;  3SH7 A;  1RGZ A;  5C5K A;  4XT2 A;  2GDN A;  4KZ4 A;  4BL3 A;  1K56 D;  3H82 B;  4EEU A;  3UPP A;  3LR0 A;  3IHB A;  5DTT A;  4X6T A;  4FH4 A;  2W1T A;  3HCY A;  3UE6 A;  1ERQ A;  5FQK A;  2XH9 A;  4GS9 A;  5A92 A;  3NDG A;  3PBR A;  3D4F A;  4IVI A;  3T4L A;  3UO9 A;  3KSH A;  2VV7 A;  2PYR A;  4E3L A;  4IBR A;  2OLV A;  3TE8 A;  3GEC A;  1PWD A;  2G2U A;  1FSW A;  1YLW A;  1I2S A;  1AXB A;  1VEU B;  3ZFZ A;  2DRW A;  3BFD A;  4NEE D;  1CJF A;  1HD8 A;  3UB6 A;  3IWQ A;  1NWZ A;  3BFC A;  4PAU A;  3OCN A;  4LCM A;  3KSI A;  5EVI A;  3NEC A;  5FAP A;  1LSV A;  2O9A A;  4KZ6 A;  5FQM A;  2FH5 A;  5HAR A;  4R4R A;  4L9G A;  5F82 A;  2A49 A;  5AQ7 A;  4OOL A;  2C6W B;  1YT4 A;  3HLG A;  2OWJ A;  3C4O A;  5A90 A;  2JKR I;  2OAP 1;  5IHV A;  4B88 A;  4X68 A;  4BMW A;  3W2Z A;  3T1Q B;  4N9L A;  1KGE A;  4GD6 A;  4N1X A;  3B33 A;  4GNU A;  4G3W A;  4Y17 A;  5D3O A;  4ID4 A;  5FI2 A;  3T4S A;  2Z6D A;  3V3R A;  3MF0 A;  3SZT A;  4XUX A;  3FWL A;  5F6A A;  2PR6 A;  2PU4 A;  5L10 A;  2W27 A;  5FAT A;  1BYW A;  4BLM A;  2V0U A;  2V0W A;  3F1O B;  3P98 A;  3IBR A;  4OQ0 A;  4WZ5 C;  4PM5 A;  3G32 A;  4Q0I A;  1SCW A;  4I5S A;  1ES4 A;  1PZO A;  1QMF A;  1S67 L;  3EQV A;  4ZRR A;  4KG6 A;  3C5A A;  3C38 A;  2IWD A;  3ZYT A;  4GOG A;  3H7W B;  3PXP A;  5I94 A;  4LRY C;  5CTN A;  3N4I A;  4PKY A;  1MC0 A;  1M40 A;  2Y2M A;  4EU0 A;  3S7P A;  2K2N A;  3LY3 A;  4MLL A;  3DAV A;  2W1R A;  3GRJ A;  4OOM A;  1KVL A;  1PI4 A;  4DKI A;  4GDN A;  4IJG A;  4FOF A;  4OH0 A;  5I5L A;  2VJW A;  1XP4 A;  3G2Y A;  4Y15 A;  2HF6 A;  1XKZ A;  5FQJ A;  1GHP A;  4HBU A;  1K6S A;  2VZW A;  4JKT A;  5DFY A;  3A3E A;  2V1A A;  5GHX A;  2B18 A;  2JC7 A;  4LGW A;  4DN0 A;  2PD7 A;  4WEL A;  1S4S A;  2DMW A;  1CI9 A;  3G34 A;  4F3L A;  3PBS A;  1XA1 A;  1ZC2 A;  3CLO A;  5GHY A;  4DDS A;  1TDL A;  3LIC A;  4P0M A;  1FR1 A;  2Y91 A;  5M1A A;  1T1A A;  3T50 A;  4ZJ1 A;  4II7 A;  1CK3 A;  2GX5 A;  4ME4 A;  4EES A;  2ZC4 B;  2EX6 A;  1EI5 A;  2H28 A;  1XJ4 A;  3BQA A;  3KYZ A;  4Y5F A;  4F94 A;  5A93 A;  1GA9 A;  5EFW A;  3IF6 B;  1NXY A;  2FZ0 A;  2PAV P;  3OBF A;  2VX8 A;  1BT5 A;  4RQ9 A;  4K91 A;  3UME A;  1FCO A;  3C7U A;  3GVB A;  4N1H A;  1PW1 A;  4QB8 A;  3VP1 A;  2XD1 A;  4K08 A;  3A3I A;  1JWV A;  2P04 A;  5HDD A;  5FEG A;  4NKP A;  2VGK A;  1TD5 A;  1NY0 A;  4GZB A;  1V9Z A;  4OP8 A;  2Y2J A;  1GHI A;  4Q0J A;  2V1Z A;  3IXH A;  3W4Q A;  2QZ6 A;  4MN7 A;  2QWS A;  2HGV A;  1ZKJ A;  2EFU A;  4UA6 A;  2I72 A;  3V67 A;  3EEH A;  1J3W A;  3MKF A;  2ZD8 A;  1T1C A;  3F1P B;  2LB9 A;  2V8F A;  3IBJ A;  4EUV A;  4S2M A;  3F1N B;  3QP1 A;  3W4O A;  4JF4 A;  1ES2 A;  4L9E A;  5HL1 A;  4JXG A;  3A3F A;  3MSH A;  1UGU A;  3A0V A;  4FCF A;  3ZG7 B;  5CEB A;  4OQH A;  3WRT A;  1JTD A;  1BSG A;  2L0W A;  2IWC A;  5G4Y A;  4WLA A;  4JF5 A;  1DP9 A;  1PWG A;  3BY9 A;  3UPO A;  1PZP A;  4R70 A;  3V50 A;  2RCX A;  3IS2 A;  4Q0H A;  1N9N A;  3NI9 A;  2ZLY A;  1YPR A;  2ZOH A;  3G6O A;  1YAX A;  1K56 A;  3NHQ A;  3VP3 A;  3FZC A;  3AGD A;  3W8K A;  2ZL1 B;  3LY4 A;  2VGJ A;  1OTI A;  3OPL A;  4JGO A;  5CGS A;  4U0T A;  3UDX A;  2Y2P A;  2WKE A;  1TS7 A;  3UY6 A;  4WEK A;  4PM7 A;  3VV4 A;  3NJA A;  1TS8 A;  4X69 A;  5KZH A;  4OPR A;  4BBT A;  1BTL A;  3VSK A;  4BJP A;  5IT5 A;  5DF9 A;  2HP5 A;  3WS1 A;  2D01 A;  2Y2G A;  4HJ3 A;  1H8M A;  1H5X A;  4GD8 A;  3HLD A;  4P6B A;  2HJ9 C;  5F68 A;  2VV8 A;  4WM9 A;  4HH3 A;  3D72 A;  1IKI A;  2PR5 A;  2EX9 A;  1CQA A;  3T4O A;  3GR2 A;  2EA9 A;  4CLC B;  4M3K A;  4O01 A;  4EET B;  2WKP A;  4FSF A;  3UN7 A;  3BLS A;  5A91 A;  2BAS A;  1K0K A;  3MBZ A;  1OT9 A;  4B4Z A;  3TJZ C;  5HDS A;  2K31 A;  4WZ4 A;  1STZ A;  5CED A;  2HDR A;  4LV2 A;  4IBX A;  2WGV A;  4P6Z S;  5FI6 A;  3C8C A;  1ERO A;  3SW1 A;  1H3Q A;  1ODV A;  4GHI A;  3QNC A;  5TFQ A;  2ZQC A;  3OPP A;  1E3U D;  5FAQ A;  3FPW A;  5CTM A;  4MBF A;  3I7J A;  3QHY A;  1RP5 A;  4I39 A;  4ARZ A;  4WMC D;  3R7W B;  4P87 A;  4XT2 B;  4R3A A;  1LI0 A;  1S6R A;  1IYO A;  5JYP A;  5BOH A;  2E8I A;  2GNX A;  4UA9 A;  5AQB A;  2W1T B;  3O3V A;  4JGR A;  1L0D A;  1RGY A;  3C4P A;  3HLC A;  4GS9 B;  2VA0 A;  5K5B A;  1LL8 A;  1IYQ A;  2Y2L A;  3FYZ A;  3T4J A;  1KVM A;  4JXS A;  1W5D A;  4JGQ A;  2G7U A;  3FC7 A;  5HPF A;  3DTM A;  1L2S A;  3E4Q A;  3GQZ A;  1TF1 A;  1JTG A;  5DJT A;  2J3W A;  1L0E A;  1MWT A;  1U60 A;  1SDN A;  1HTZ A;  3ICY A;  4BQM A;  3EGX C;  1Y28 A;  1KE4 A;  4HES A;  3SOI A;  5TR7 A;  3G30 A;  1T19 A;  4MMN A;  5EVI B;  1G68 A;  3C7V A;  3MQ0 A;  2JHE A;  3S7N A;  1Z6F A;  4S2P A;  4KQO A;  2FFF B;  2ZM0 A;  3D3O A;  5L09 A;  2VLG A;  3PBN A;  3SS4 A;  3PTE A;  4QPR A;  1G6O A;  4JXV A;  3Q7V A;  4JGP A;  5EVL A;  3MQO A;  3N8S A;  1LT0 A;  4RA7 A;  3NOU C;  3MMH A;  2HDS A;  2X71 A;  4UAA A;  3E4O A;  2JKT I;  4UQI S;  3T4K A;  4Y0O A;  2R9W A;  3CPT A;  4B9O A;  3P09 A;  3SH9 A;  2ZM2 A;  1KDW A;  3WS2 A;  3LID A;  2P08 A;  4EXO A;  4PMA A;  4LLO B;  1Y54 A;  2Q9M A;  2ZOI A;  5FQI A;  5AJG A;  3OC2 A;  4OON A;  1ERM A;  1Y4O A;  2M1C A;  1S1Y A;  4Z1W A;  4GB7 A;  1CF0 A;  5KMW A;  1W63 Q;  4Y3I A;  1FOF A;  4HQA A;  2VV6 A;  3EQU A;  2W3G A;  1YSQ A;  2H5S A;  3UE3 A;  4ZAM A;  4UA7 A;  3Q07 A;  5CX7 A;  4MCW A;  5FI7 A;  4KZ8 A;  3IX3 A;  3C2W A;  2XGN A;  1K57 C;  4WBG A;  2QPN A;  3CG5 A;  3R4K A;  4MNR A;  1ES3 A;  1OTE A;  1CEF A;  3UE0 A;  3ZG5 A;  4EEP A;  1BLS A;  2WUQ A;  2HP9 A;  5G18 A;  2V2F F;  3MQQ A;  4R23 A;  4E3I A;  4DE0 A;  1XX2 A;  3KYE A;  4BBV A;  2XA7 M;  4E3J A;  1XXM A;  1S66 L;  1W7F A;  5DF8 A;  4E6X A;  2WKI A;  4HIA A;  5E2H A;  3HL9 A;  3Q1F A;  1ES5 A;  5HZH A;  3KSG A;  3OZH A;  3T4T A;  4KZ3 A;  3VFF A;  4HOI A;  3FKV A;  4F3L B;  1MKM A;  3UB5 P;  3LIF A;  5CER A;  2Y55 A;  1ZTU A;  5IU1 A;  5DTS A;  2OAQ 1;  3UB9 A;  5GLD A;  5HWV A;  2WKH A;  1K54 C;  1ESI A;  3IHA A;  1FR6 A;  4U0X A;  4EV4 A;  3WS5 A;  3MS6 A;  3HLB A;  1UWP X;  4D2O A;  3JYI A;  4ZJ3 A;  3NC8 A;  5KSH A;  1BLH A;  5HDC A;  5DVA A;  4O8G A;  2O99 A;  2XDM A;  3WWX A;  5HWW A;  3S7O A;  4MN5 A;  3IXG A;  4DF6 A;  1VEU A;  1E25 A;  4YFM A;  2W0N A;  1NLZ A;  1S1Z A;  4KQQ A;  3TW8 A;  3KYQ A;  1K57 A;  5FAO A;  3PYP A;  1RCJ A;  3NOT C;  2JBF A;  1ZG6 A;  2A24 A;  2BTF P;  2W3D A;  2EXB A;  1UWN X;  4Y2F A;  3C30 A;  2XK1 A;  5CRF A;  4KZA A;  2PT7 A;  3LIE A;  1PW8 A;  2YKH A;  4LPZ A;  1NZO A;  4GLQ A;  1PNE A;  2ZBB A;  4PHT A;  3U4L P;  2XF3 A;  3UMD A;  1KE3 A;  2ZM8 A;  3N7W A;  2P9V A;  4YOF A;  4LRZ E;  5HAQ A;  1PWC A;  1N9O A;  4YIN A;  3MZD A;  2PDR A;  1SKO A;  2R78 A;  1WA9 A;  3HJK A;  1I2W A;  3HRE A;  4NG2 A;  4P6Z M;  2PRF A;  2XLN A;  1N4O A;  2WAD A;  3TOI A;  2EX2 A;  3MXS A;  3NOP C;  2WYX A;  5LBR A;  4O0P A;  5HAI A;  1K54 A;  3DWK A;  2XD5 A;  1NRJ A;  4FTX A;  4R38 A;  3IH8 A;  3P7N A;  1FCM A;  3UNW A;  4DE2 A;  2ZC3 B;  5EOE A;  5E2G A;  1K25 A;  4WEJ A;  3E2L A;  5HX9 A;  4Z9Q A;  1MWS A;  2IA2 A;  3H9W A;  3IS2 B;  2ZMF A;  1QME A;  2EWW A;  2WZX A;  3T1X A;  2Q9N A;  2X01 A;  4HEF A;  4EQI A;  5EEC A;  5G4Z A;  4ZBE A;  2ZQ7 A;  1YQS A;  5E2E A;  4L0L A;  2AVX A;  1LL9 A;  2CMN A;  4LRX C;  3B47 A;  1YMS A;  1D1J A;  3U2A A;  2XR0 A;  1XGJ A;  1NYM A;  4KZ9 A;  4H6J A;  5GLB A;  2Y2N A;  3QP5 A;  1SKF A;  4QD4 A;  3B3X A;  2ZC5 B;  3NY4 A;  3NIA A;  3N8R A;  3JPU A;  3OCL A;  4PKY G;  5M19 A;  1ONG A;  5EVI D;  4KQR A;  4LV0 A;  4ZDX A;  1OJG A;  2WGW A;  4EUZ A;  4QU3 A;  3LCE A;  2ZQD A;  4UHU A;  4S2K A;  3VP0 A;  2M7U A;  3ZDJ A;  2WAE A;  5J8X A;  4GCZ A;  1IEL A;  1KGG A;  2J3T D;  1N9B A;  3RXW A;  3M2J A;  1L0F A;  3CMZ A;  2XA7 S;  2QYB A;  2EFX A;  2HP6 A;  3ISG A;  1LI9 A;  1F5M A;  3BFG A;  4GJ4 A;  1NZU A;  3ZG9 B;  1VB6 A;  4X25 A;  1LLB A;  4UQI M;  1XFN A;  4EW7 A;  4K0W A;  1JWP A;  1NYY A;  2Y2O A;  4Y13 A;  4GHI B;  4NK3 A;  1D06 A;  1OPX A;  3DTI A;  1IYP A;  1WE4 A;  2XQZ A;  4BL2 A;  1NRF A;  3TRC A;  4G3K A;  1IOU A;  4LEN A;  3T1S A;  4EBL A;  2X02 A;  2V8C A;  2JKF A;  4ARZ B;  2PHY A;  2VGL S;  4R3B A;  1XJ6 A;  5FDS A;  3L9K A;  1VM1 A;  1LL5 A;  2QJ5 A;  3Q82 A;  4KZ5 A;  3OLO A;  1IEM A;  4K0X A;  4HBT A;  1JWZ A;  2PD8 A;  2RL3 A;  4MEZ A;  2D02 A;  4Y0T A;  1DRM A;  2CC1 A;  5CGW A;  4JPM A;  2MJ6 A;  4KQD A;  5FA7 A;  4S2L A;  3LEQ A;  1K4F A;  3QP6 A;  1DJA A;  3QP4 A;  5GHZ A;  1G6A A;  2B95 A;  2H10 A;  3D9Y A;  5AQA A;  3LGO A;  3BM6 A;  1P9R A;  3IWI A;  3GTC A;  4C75 A;  4I3J A;  2QMI A;  1FQG A;  5HW3 A;  4ZJ2 A;  2OOL A;  3LYX A;  1GSX A;  4JXW A;  3UDF A;  3V3S A;  4QY6 A;  4DJ3 A;  2J80 A;  2KDK A;  3IT9 A;  2HJE A;  1K4E A;  4N92 A;  2INW A;  1KE0 A;  3FKW A;  3MXQ A;  2QHK A;  4NET A;  3LUQ A;  3VOY A;  3VE3 A;  1MY8 A;  3AGE A;  4E04 A;  1FIK A;  3M6H A;  5HAP A; 
#chains in the Genus database with same CATH homology
 3DAV A;  4ESP A;  3NEC A;  1Y4O A;  1SKO B;  3T1S A;  3T1X A;  3T12 B;  2V8C A;  2JKF A;  1CF0 A;  2E8J A;  1AWI A;  1FIL A;  5FDS A;  1J3W A;  3L9K A;  1VEU A;  3CPT B;  1F2K A;  1D1J A;  4QWO A;  2PBD P;  2V8F A;  4X1L A;  1ACF A;  3L7H A;  1A0K A;  1PRQ A;  3T1Q B;  2VK3 A;  5EM0 A;  2BTF P;  1CQA A;  5FEF A;  4FUW A;  3LEQ A;  3MSH A;  5EM1 A;  1VET A;  1K0K A;  1PNE A;  2ZL1 A;  3U4L P;  1HLU P;  2B95 A;  1Z09 A;  3D9Y A;  3LGO A;  3KYE A;  4X1M A;  4D60 A;  1G5U A;  1PFL A;  2PAV P;  1SKO A;  1YPR A;  2PRF A;  3UB5 P;  3CPT A;  3NUL A;  4X25 A;  1VEU B;  2ACG A;  1VET B;  5EVE A;  1SZV A;  4FTX A;  2ZL1 B;  2JKG A;  5EV0 A;  5FEG A;  3T1R A;  3CHW P;  1CJF A;  2HZ5 A;  1FIK A;  3MS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...