4X25A

Structural basis for mutation-induced destabilization of profilin 1 in als
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
139
structure length
134
Chain Sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTFNVTVTKTDKTLVLLTGKEGVHGGLINKKCYEMASHLRRSQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for mutation-induced destabilization of profilin 1 in ALS.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Profilin-1
total genus 39
structure length 134
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00235 Profilin Profilin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 4x25A00
5EM0A 1HLUP 1Z09A 2HZ5A 3MSHA 3T12B 4X1MA 4QWOA 3T1XA 2ZL1A 1YPRA 1SKOB 5FDSA 4FTXA 3U4LP 1CF0A 3DAVA 5EV0A 3CHWP 1J3WA 2JKGA 5EVEA 3NULA 5FEFA 4D60A 3L7HA 1F2KA 3CPTB 1PNEA 2PRFA 3D9YA 3T1SA 2V8CA 2PBDP 1SKOA 1AWIA 1ACFA 3T1RA 1FIKA 1PRQA 1FILA 1G5UA 2V8FA 2VK3A 3CPTA 1D1JA 1Y4OA 1CJFA 1VETB 3LEQA 3LGOA 3T1QB 1K0KA 1VEUB 2ACGA 2E8JA 3MS6A 2JKFA 3UB5P 5FEGA 1VETA 4X1LA 1SZVA 2ZL1B 3NECA 3L9KA 1A0KA 4X25A 2B95A 2BTFP 4ESPA 5EM1A 1PFLA 1VEUA 3KYEA 2PAVP 4FUWA 1CQAA
chains in the Genus database with same CATH superfamily
1K55C 1IOUA 1YSPA 4EESA 4JF5A 4EUVA 3E0YA 4UA6A 5EVLA 5FQQA 3MXRA 2ZBBA 3KX0X 4R38A 3RJUA 1IELA 4JGOA 4N9KA 3HUMA 1YPRA 5HDCA 3GTCA 3EOIA 1LHYA 3PYPA 4PMAA 2YKFA 4ME4A 4HQAA 2EFUA 2VGLS 3UE0A 3NOUC 4CLCE 4HBUA 4GCZA 3P98A 2J7VA 4OONA 4MMNA 2Y2JA 1IEMA 2UWXA 1JVJA 4Q8IA 4OPRA 3QP6A 4GDNA 3W8KA 1MY8A 4EQ1A 1IKIA 3MXQA 4PM6A 1ALQA 4QD4A 4E3MA 1PW1A 4X6TA 1GCEA 2K7SA 1RGZA 3LR4A 4KZ4A 3SH8A 1K55A 1YLTA 1KE0A 4DKIA 2OSUA 4NXGA 2JE5A 4EQIA 2D02A 4LV1A 1I2WA 3G2ZA 3LR3A 4LRYC 4KG2A 1SHVA 4R0QA 1FSYA 4DJ3A 1YAXA 4BQMA 4JXWA 3MQOA 1PI4A 3Q7VA 3KYZA 3PBOA 5KZHA 4II7A 3N8SA 2R9XA 5LBRA 4ESPA 4WLAA 3LY4A 5CEDA 2HDSA 1OTIA 1H3QA 4KQOA 5EVEA 3MMHA 4E6XA 5FSRA 1XGIA 2J80A 4HP9A 4JKTA 4LV2A 3T4JA 3KSFA 3PAEA 2HP9A 4JXVA 5U47A 1N4OA 4FSFA 4KZ3A 2ZL1A 1ONHA 3GRJA 2KLIA 4LLOB 1XGJA 4IVIA 3NBLA 4P6BA 3EEAA 4CLCB 3LIDA 3GECA 2J9PA 4H6JB 4ZJ3A 1KOUA 3IX3A 4S2MA 2GZAA 4K0WA 3PBNA 5CX7A 3UMDA 1YLZA 4WEJA 4M3KA 3MKFA 1QMEA 4MDZA 3DTKA 3LYXA 5A92A 3WRZA 1IYQA 5TBMA 3KYQA 4CLCC 1Q2QA 1K57A 2L4RA 4S2KA 1P9RA 3H9WA 1UGUA 4GW9A 2LB5A 4G3KA 3K3DA 3T4QA 5CGSA 2VA0A 5F82A 2B95A 1KVLA 3RFBA 2JKRM 5EM1A 3G35A 1Y28A 4BL3A 3HL9A 3A0VA 5FI7A 4UA9A 1MC0A 1ZG6A 4U0XA 1SDEA 2RCXA 2HF6A 2Z6DA 4MNRA 5L10A 4WYYA 3BM6A 4HESA 3P7NA 2UV0E 3T50A 3T1QB 2P7JA 1TS6A 3KSGA 4G3WA 2PU4A 4P0MA 4I3IA 3V39A 2EWWA 4E3IA 2V0WA 2X71A 2B5RA 2EFXA 3MFDA 3BRMA 1QMFA 4JGPA 1PI5A 2H5SA 2WYXA 4M4XA 5I94A 3LFVA 3C8CA 2V1BA 2IWCA 5GL9A 5F6AA 4OQHA 4Y15A 2WK0A 1W7FA 4CJNA 3PR6A 4ZRRA 4MN5A 2JHEA 1N9OA 2KOIA 3C2WA 4H6JA 1LSWA 1DY6A 1GSWA 3FV7A 4HOIA 3HLCA 4R4RA 2WKRA 3S7QA 2OAQ1 3CPTB 1ESUA 1JNUA 5GLCA 5J8XA 2HDUA 1T1CA 3IT9A 3IF6A 2Q9MA 3C38A 5L09A 1NWZA 3UB8A 5GLAA 4L9GA 3NECA 3ICYA 4BLMA 4BBUA 3B33A 1N9LA 3IWIA 2Y2LA 1HD8A 3OLOA 4R6LA 1MWSA 3IWQA 2EX2A 1BT5A 2VGKA 2OLUA 3UN7A 5KSCA 1VB6A 4X1MA 4HP4A 4R70A 2WZZA 2J9OA 5J7EA 3Q81A 1BSGA 3KSIA 1U60A 1ACFA 4CLCA 1Y4OA 2ZL1B 3RH8B 2FH5A 1OT9A 2XFSA 2XD1A 1L0GA 4EEUA 3JVUA 4PAUA 2O9AA 2VV8A 2WKEA 1KE3A 5M18A 3GDIA 1H8YA 5EVID 4LGWA 3O86A 1CEGA 2B02A 3IH9A 4ZTKA 4EEPA 3LI8A 2L0WA 3MZFA 1KGEA 1W8YA 2JKGA 5EUAA 4OQGA 5HX9A 3S7PA 4JXSA 2ZQDA 4MN6A 3ITAA 3BFCA 1XXMA 4EETB 1H8ZA 4A5RA 1DJCA 1SZVA 4I3JA 3ZG8B 1NZOA 3LY3A 2WKIA 3C7UA 3E4QA 5FQMA 3VP4A 2JC7A 1SKOB 5FDSA 4FTXA 3PBQA 3M2KA 2HJ9C 3GVBA 3SS5A 1FCMA 1NZUA 2ZMAA 4EBNA 2XH9A 2H0TA 3PBSA 4OKPA 4WF0A 2FFYA 4EU0A 2H28A 4C75A 4KUKA 5GLDA 2O9BA 4K91A 3VFHA 4QWOA 2WKPA 4IVKA 3A3JA 4GS9A 4S2OA 3NY4A 4R23A 5AQBA 1K25A 4KQRA 3VFFA 3HLBA 5FDHA 2M7UA 3TG9A 3I7JA 3NIAA 2ZQCA 1VETA 1EW0A 3IHAA 3LEZA 5DKKA 1XFNA 3SH9A 2HP5A 4YOFA 3QP4A 4OPZA 4E3KA 1NRJA 3HLGA 3CUEA 4WEKA 2PBDP 5CERA 3DWZA 1SKFA 2ZC5B 3ZHHA 1H8MA 4QHCA 3OPPA 4S2IA 2JKTM 2WGWA 3SS4A 5HD5A 2B18A 3T1XA 3F1NB 4JPMA 5DJUA 3OPLA 3NJAA 1K4FA 2WKQA 1ES4A 2V1ZA 4LV0A 3H7WA 4P87A 5EECA 4WM9A 5G4ZA 5A90A 4E3LA 3O3VA 1P9WA 1XJ2A 3UY6A 3BY9A 1S0WA 4Y7PA 2VGJA 5IU1A 2Y2QA 1T1AA 1S4SA 4XUXA 4YWZA 1J3WA 4YINA 5GLBA 3MF0A 2Q0OA 3QP1A 2VK3A 3H82A 5F69A 3OPRA 4RVAA 1V9ZA 1STZA 1T19A 3A0RA 3HLFA 1LL5A 4UHUA 3QP5A 3EQUA 3W4OA 5TR7A 4X53A 3T4SA 4WMCA 1WA9A 4YNRA 5F1GA 1FSWA 1LSVA 2A3UA 3CPTA 4B4ZA 4NXBA 1N9NA 4RQ9A 4X1LA 4OPYA 2HJEA 4HEFA 5GHXA 4S2JA 4ZDXA 5HPFA 5C5KA 3HVFA 5CGWA 4BD0A 1FIKA 4DE0A 4EERA 4DDYA 5DFYA 1LLBA 4LFUA 2PR6A 2H0YA 4Y2FA 4Y17A 3E2LA 3WS5A 4WZ4A 3U2AA 5E43A 1HZOA 1OPXA 3T4KA 2W3HA 4OOMA 5F5YA 2INWA 2ZC4B 5HWVA 3G31A 3QNCA 1YLWA 1K56D 4O0PA 2V8FA 4GJ4A 4R1GA 1K0KA 3LIAA 5CECA 2A2LA 2GJ3A 2Y91A 1J9MA 3DBAA 3FC7A 1E4DA 4GZBA 1DJBA 2HZ5A 2ZM8A 3P01A 4HY8A 1ES5A 3IXDA 3S4XA 1XJ6A 3DWKA 2OV5A 4UQIS 3UE6A 5HW3A 3IX4A 3BWLA 5A91A 3A3IA 1OTBA 4EWFA 5HZHA 5AQ7A 4Y0TA 2QYBA 4NKPA 4B9OA 3EEHA 4IUKA 5HD3A 2ZOHA 4ZAMA 1CI9A 4PM8A 3ZGAB 3IQAA 3M6BA 1PW8A 1ERQA 1BYWA 1L2SA 3ZG0A 3VOZA 4R4SA 3BQ8A 2EXBA 4I5SA 1XJ4A 4WMCD 2GNXA 3IBJA 5FQJA 2H10A 3ZNYA 1L0EA 3WWXA 3QHYA 3W4QA 1F98A 4EW7A 1FCOA 1X0OA 2W1TB 3LICA 1DRMA 4F3LA 2W27A 4LENA 2WGVA 5CRFA 2V8CA 2R78A 1JWVA 2XSSA 3LEQA 1IYSA 3CZDA 4IBRA 5EOEA 1W79A 1P97A 4E04A 2GDNA 3VOLA 3ZDJA 1IYPA 3ISGA 4BENA 2HPBA 3W4PA 3SW1A 2M7VA 3EWKA 3UPOA 5FAOA 3TW8A 3K3CA 2G2UA 3IXGA 3IX8A 5FEGA 4K0XA 2VGLM 1PYYA 2ZMVA 5E2FA 4O8GA 5KIZA 5EFWA 2Y2PA 1YT4A 4S2NC 5E2EA 4C3QA 3UB6A 1YMSA 3BLMA 3LIEA 2OWHA 5HDDA 5FAPA 1G5UA 2FZ0A 3ZG5A 4MLLA 2V20A 3EQVA 4X55A 2V0UA 3OC2A 3CJMA 4FH2A 5FA7A 1VEUA 2WKHA 4FUWA 1W8QA 2J3TC 3BEBA 4BMWA 2Y79A 4WN5A 1XX2A 2PT7A 3QNBA 3T4TA 3PBTA 5HFOA 3B42A 1EROA 1LL8A 2Y2MA 2X02A 1K54C 3MZDA 1VM1A 1XJ3A 4PM9A 5KSHA 1EWZA 1T1BA 4C6YA 4PM5A 1BULA 4E3JA 3NDGA 4D2OA 3FWLA 2OWJA 1TDLA 3ZVWA 1PNEA 4OP5A 1IYOA 3N4IA 3ZQ5A 3G34A 4OQIA 4KZ8A 3O87A 2E8JA 4FCFA 4E3NA 4MCWA 1KDSA 3MFXA 1ONGA 2O9CA 3BY8A 3T12B 1XA1A 3ULFA 1XA7A 1BLPA 4KZAA 3ZYTA 5FAQA 3CLOA 2NUPC 1S4RA 4S2NA 4HJ3A 1LT0A 4HH2A 5AVEA 4WZ5A 1GHMA 2WADA 1XKZA 1H5XA 3E98A 3IS2A 1PIOA 3R7WA 4FOFA 2PYPA 5M1AA 1YKDA 4UQIM 5A93A 2XK1A 1TDGA 2JN7A 4WZ5C 4EBPA 1OTEA 4Y13A 1NY0A 3IWOA 4B93A 1MKIA 1MWUA 2O0YA 3R4KA 3QP8A 5J3WA 1MWRA 1A0KA 5EVIB 4QU3A 3IXHA 3QP2A 5CHUA 3LCEA 1VQQA 4Y0UA 4HJ6A 1K6SA 4KZ5A 1ZKJA 3C4OA 4ARZB 4LCLA 1FILA 5K5BA 5J4EA 3SOIA 2ZM2A 3PAGA 2JKFA 5EVIC 1E3UD 4OVDA 4XXRA 2J3TD 3NCKA 4DDSA 4JBFA 5DTSA 3JPUA 3F1PA 5FEFA 2IWBA 3M2JA 2M1CA 5IT5A 3DTMA 3SS3A 3LIFA 4Y0OA 3AGEA 4Y5FA 2Y2KA 1YLYA 4BBVA 3BW6A 3TSGA 4GHIB 4I38A 5HL1A 5CHJA 1LSXA 1BLCA 2K2NA 4QY5A 3L7HA 3C5AA 5L07A 1NXYA 1AWIA 1MWTA 3RXXA 4JLFA 3W2ZA 4DRTA 4I39A 4GNUA 4KUOA 3N6IA 5EOOA 3GQZA 4CQHA 4G3VA 1KGFA 3F1PB 1YSQA 2E8IA 3G30A 1TS7A 2VEAA 3GMWA 2W3EA 5FL3A 1EI5A 4KENB 2ACGA 1ZTUA 4LPZA 2QJ7A 4OLGA 1AXBA 2XQZA 5AQ9A 4ARZA 3NDEA 5E2HA 2HGVA 2PU2A 4P6ZM 1BLSA 2HDRA 3G6OA 2DNSA 4KZ7A 1ERMA 3D4FA 4GB7A 3FKWA 4N9LA 1YM1A 3UB5P 1RP5A 1L0DA 3EGXC 2BTFP 3V5MA 2Y2NA 3DW0A 4DE3A 3CI6A 1N9BA 4N1XA 4IHQA 1K57C 4IEDA 5HWTA 4EV4A 2OAP1 4N1HA 2Y2OA 3LR0A 1GHPA 1G28A 2P9VB 2FFFB 2NUTC 3BFGA 3A3EA 2KDKA 3FKVA 1FR1A 3UB7A 2PAVP 1LL9A 5A8BA 3BFFA 2QMIA 4R3JA 2A24A 1ESIA 3G4PA 4XUZA 5FQKA 2EX8A 5BOHA 5CHMA 4RA7A 3KYEA 3A3FA 4LRXC 1NLZA 5TGFA 1E3UA 5HL6A 1CEFA 3E4PA 3AGFA 1WYCA 3BYDA 3C4PA 3PXPA 3LUQA 4IUHA 3T4LA 3GV9A 3HUNA 2WUQA 3VP3A 4BWIA 1PWDA 2W1RA 1KE4A 3IF5A 3MQQA 4Y3IA 2OLVA 4LV3A 3F1OB 5D3OA 1OJ5A 1FOFA 1CF0A 2L1MA 4R3AA 4JXGA 3NOPC 2XD5A 1DJAA 4IJGA 4CPKA 2WAFA 4WELA 5KMWA 5MC7A 1SCWA 5M19A 1UWPX 4HHDA 1H0MA 3O88A 1F9IA 1T18A 1G68A 1GHIA 2QPNA 1E25A 2EX9A 1Z09A 3Q1FA 1JWZA 4JF4A 3HLEA 4NETA 1F2KA 2BG1A 3OOVA 2Y2GA 2Y59A 3D9YA 2DRWA 1S67L 3HLWA 4KQQA 3ZG7B 4KG6A 1PRQA 3MKEA 3CG5A 1RGYA 4S2PA 4WBGA 1LI0A 3BECA 4NXFA 1DP8A 3NHQA 4MBKA 4DN0A 2A24B 3V3SA 3P09A 1JTDA 3SH7A 4HIAA 3VE4A 4GKUA 2IA2A 3HLDA 3UPPA 5DF8A 1GSVA 3NC8A 1G6AA 3LGOA 4PPRA 1VEUB 1O7EA 1O07A 4X69A 2XA7M 3CAXA 3S7OA 4RX2A 1ZG4A 1ZHHB 2Z2MB 3FPWA 2ZOIA 3NI9A 4MN7A 3WS2A 2ZJ9A 4MBHA 2GX5A 3MXSA 1DP9A 4R3BA 3PBRA 4KZBA 5HARA 2W1TA 1S66L 4GN2A 1SKOA 1UWNX 3AGDA 2ZQ7A 3PTEA 4BJPA 4QPRA 2XFTA 1ODVA 3VSLA 4YFMA 3HCYA 5DF9A 2XGNA 2Y8HA 2BLSA 3WRTA 2QHKA 3EGDC 4ETXA 5CEBA 4X68A 4DE2A 3D3OA 4PKYA 4OP8A 1V9YA 5IS1A 4B4XA 2ZQ9A 5DFXA 1Q2PA 4RYEA 2J8YA 2QZ6A 5CGXA 4UA7A 5FI2A 5DKLA 1S1YA 4D60A 2PRFA 5DTKA 1OTAA 3O5YA 4O7DA 2VLGA 2W3DA 2PYRA 2XA7S 4Z1WA 2VX8A 1W63Q 1WE4A 2J3WA 5HAQA 1ES3A 5EV0A 2VKSA 4PHTA 2YKHA 3VP1A 1IKGA 5IHVA 3LO7A 1L3LA 2HP6A 1KVMA 2Z2LB 3RXWA 3MR0A 4DXCA 2AVXA 5F1FA 2HDQA 5EPHA 5DJTA 4BBTA 3UE3A 3HJIA 2R9WA 4L9FA 1ES2A 3E4OA 4S2LA 4DMZA 3CUEC 2CC1A 2PDRA 1IFQA 1F5MA 3V3RA 2XF3A 4UAAA 3GSGA 1CI8A 1TEMA 1YMXA 3UPNA 2V1AA 2C5WB 4Q0JA 1NLYA 4GD8A 1OJGA 2PD8A 2JCHA 2O99A 3LR5A 1G6OA 5CTMA 2Y55A 3JVVA 3Q07A 5EVIA 4U3TA 5G18A 1D1JA 5I5LA 2HV1A 2DMWA 4GHIA 3VOYA 3UO9A 1S6RA 5AVFA 5F68A 1VHMA 1HLUP 4E6WA 3WS4A 3A3DA 4KZ9A 2IWDA 5FI6A 3C30A 3R7WB 3MQ0A 1PZPA 3IH8A 3DTEA 5DVAA 3S22A 4N92A 3FG8A 1LI9A 3OPHA 5EM0A 3MSHA 4BL2A 2Y2HA 3KO6A 1D06A 4EXOA 5GHYA 1MKMA 1CK3A 3UDIA 1DP6A 3M6HA 4GLQA 4NXEA 2VV6A 2DCFA 1CJFA 2WGWB 2XDMA 4MBFA 4NK3A 3CWFA 3FPVA 3OCNA 4U0TA 4HNBA 2P74A 3DAVA 4E3OA 2BASA 3RTYA 2X01A 5TBMB 3LI9A 1W5DA 5CXWA 2RL3A 4JF6A 1PZOA 4KG5A 3V50A 4B88A 4QJGA 1CQAA 2V2FF 4GD6A 5DF7A 2XEPA 3U4LP 4O01A 2I9VA 2JKRI 3WS0A 3T1SA 2WAEA 1K54A 1RCJA 4Z9QA 1K38A 1TF1A 3UB9A 2ZD8A 5HPIA 3NOTC 5L8MA 3G32A 4QY6A 4LCMA 5GHZA 1TS0A 4HI4A 4OQ0A 2C6WB 4HJ4A 3BLSA 5CTNA 4WUJA 3TOIA 3Q82A 4PKYG 1NYYA 4RX3A 3Q7VB 4OOYA 1XP4A 5G4YA 1MZUA 4UEYA 2ZMFA 3IS2B 2PHYA 5FASA 3ZNTA 2ZC3B 4P85A 2ZC6B 3IHBA 4DXBA 3B3XA 2W0NA 4JGQA 5FQIA 2QJ5A 3BFEA 3F1OA 3S7NA 2P04A 2D01A 3B47A 4OPQA 5EE8A 3S1YA 3OCLA 4I3AA 3CHWP 5TFQA 2QWSA 1Z6FA 2JBFA 4H8RA 1GA9A 3D72A 1JWPA 4Q0IA 4ZBEA 2CMNA 4DJ2A 4ETZA 2ZLYA 4GDBA 1M40A 2Y2IA 4HH3A 1C3BA 2PD7A 4OLDA 3ZG9B 3BJNA 3TRCA 1PWGA 4WL9A 4OOLA 5HAIA 5TJJA 3TJZC 2K31A 2WZXA 4ID4A 1NRFA 5HAPA 4GS9B 3GR2A 1PFLA 1SDNA 5F83A 1OT6A 1PWCA 5L2FA 2EXAA 2XRNA 2Q9NA 4AFIA 2P9VA 3NULA 5HDSA 2P08A 2W3GA 3UNWA 4KZ6A 3OBFA 3MS6A 3IF6B 1MXOA 5FQ9A 3UMEA 1BUEA 2V9AA 4XT2B 3FZCA 3T1RA 4F94A 3N8RA 4OH0A 5HSQA 4ZJ2A 3UDFA 1OMEA 4NG2A 1NJ4A 4K08A 1TVFA 3DTIA 1Y54A 2VZWA 4NEED 3VV4A 1ZC2A 3V67A 1TS8A 1GA0A 3IBRA 3Q7ZA 1FQGA 1WYBA 1I5QA 5DTTA 1M6KA 3KSHA 2VJWA 3VMAA 1D7EA 3VP0A 4DE1A 2EA9A 3IF6C 3ITBA 3TE8A 3LIBA 2MJ6A 3K2NA 1P0ZA 1W63M 3N7WA 4F3LB 2G7UA 4FH4A 4X25A 2XR0A 1KGGA 3T4OA 3ZVTA 1I2SA 4HBTA 1K4EA 4L9EA 1YLPA 2XLNA 1HVBA 4FD8A 2A49A 1KDWA 5JYPA 2EX6A 3MZEA 4LRZE 1NYMA 4GOGA 2G2WA 1HTZA 2PBYA 3VP2A 1K6RA 4X56A 3MJQA 3CITA 3E2KA 2ZQAA 3HJKA 4EBLA 3ZFZA 1L0FA 4L0LA 3HUOA 3N8LA 1MBLA 1XPBA 2EWVA 2JKTI 2Y4AA 3F1NA 3A0SA 2LB9A 3UE1A 2ZM0A 2Z6CA 1OTDA 4BD1A 3IXBA 5E2GA 3WS1A 3L9KA 2ZQ8A 3HREA 1XFQA 2KX6A 4MEZA 4DF6A 1BLHA 4EUZA 2W3FA 4QB8A 2I72A 1BTLA 3SZTA 4IBXA 2QKPA 4PM7A 3H82B 2VV7A 3VE3A 3C7VA 4KQDA 1YLJA 1VETB 4Q0HA 3BQAA 1JTGA 2OOLA 1FR6A 3HBRA 1BZAA 1K56A 5AJGA 3G2YA 5FATA 3BFDA 4P6ZS 1TD5A 2PR5A 4CLCD 1YQSA 4JGRA 3ZCZA 5JYOA 5AQAA 3FYZA 1FCNA 1MPLA 3H7WB 2XROA 1GSXA 1S1ZA 3OZHA 3JYIA 4XT2A 5HWWA 3CMZA 3PHYA 3VSKA 2WGIA 3UDXA 4ZJ1A 2ZC7A 3MBZA
chains in the Genus database with same CATH topology
5EM0A 1HLUP 1Z09A 2HZ5A 3MSHA 3T12B 4X1MA 4QWOA 3T1XA 2ZL1A 1YPRA 1SKOB 5FDSA 4FTXA 3U4LP 1CF0A 3DAVA 5EV0A 3CHWP 1J3WA 2JKGA 5EVEA 3NULA 5FEFA 4D60A 3L7HA 1F2KA 3CPTB 1PNEA 2PRFA 3D9YA 3T1SA 2V8CA 2PBDP 1SKOA 1AWIA 1ACFA 3T1RA 1FIKA 1PRQA 1FILA 1G5UA 2V8FA 2VK3A 3CPTA 1D1JA 1Y4OA 1CJFA 1VETB 3LEQA 3LGOA 3T1QB 1K0KA 1VEUB 2ACGA 2E8JA 3MS6A 2JKFA 3UB5P 5FEGA 1VETA 4X1LA 1SZVA 2ZL1B 3NECA 3L9KA 1A0KA 4X25A 2B95A 2BTFP 4ESPA 5EM1A 1PFLA 1VEUA 3KYEA 2PAVP 4FUWA 1CQAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EM0 A;  1HLU P;  1Z09 A;  2HZ5 A;  3MSH A;  3T12 B;  4X1M A;  4QWO A;  3T1X A;  2ZL1 A;  1YPR A;  1SKO B;  5FDS A;  4FTX A;  3U4L P;  1CF0 A;  3DAV A;  5EV0 A;  3CHW P;  1J3W A;  2JKG A;  5EVE A;  3NUL A;  5FEF A;  4D60 A;  3L7H A;  1F2K A;  3CPT B;  1PNE A;  2PRF A;  3D9Y A;  3T1S A;  2V8C A;  2PBD P;  1SKO A;  1AWI A;  1ACF A;  3T1R A;  1FIK A;  1PRQ A;  1FIL A;  1G5U A;  2V8F A;  2VK3 A;  3CPT A;  1D1J A;  1Y4O A;  1CJF A;  1VET B;  3LEQ A;  3LGO A;  3T1Q B;  1K0K A;  1VEU B;  2ACG A;  2E8J A;  3MS6 A;  2JKF A;  3UB5 P;  5FEG A;  1VET A;  4X1L A;  1SZV A;  2ZL1 B;  3NEC A;  3L9K A;  1A0K A;  4X25 A;  2B95 A;  2BTF P;  4ESP A;  5EM1 A;  1PFL A;  1VEU A;  3KYE A;  2PAV P;  4FUW A;  1CQA A; 
#chains in the Genus database with same CATH topology
 1K55 C;  1IOU A;  1YSP A;  4EES A;  4JF5 A;  4EUV A;  3E0Y A;  4UA6 A;  5EVL A;  5FQQ A;  3MXR A;  2ZBB A;  3KX0 X;  4R38 A;  3RJU A;  1IEL A;  4JGO A;  4N9K A;  3HUM A;  1YPR A;  5HDC A;  3GTC A;  3EOI A;  1LHY A;  3PYP A;  4PMA A;  2YKF A;  4ME4 A;  4HQA A;  2EFU A;  2VGL S;  3UE0 A;  3NOU C;  4CLC E;  4HBU A;  4GCZ A;  3P98 A;  2J7V A;  4OON A;  4MMN A;  2Y2J A;  1IEM A;  2UWX A;  1JVJ A;  4Q8I A;  4OPR A;  3QP6 A;  4GDN A;  3W8K A;  1MY8 A;  4EQ1 A;  1IKI A;  3MXQ A;  4PM6 A;  1ALQ A;  4QD4 A;  4E3M A;  1PW1 A;  4X6T A;  1GCE A;  2K7S A;  1RGZ A;  3LR4 A;  4KZ4 A;  3SH8 A;  1K55 A;  1YLT A;  1KE0 A;  4DKI A;  2OSU A;  4NXG A;  2JE5 A;  4EQI A;  2D02 A;  4LV1 A;  1I2W A;  3G2Z A;  3LR3 A;  4LRY C;  4KG2 A;  1SHV A;  4R0Q A;  1FSY A;  4DJ3 A;  1YAX A;  4BQM A;  4JXW A;  3MQO A;  1PI4 A;  3Q7V A;  3KYZ A;  3PBO A;  5KZH A;  4II7 A;  3N8S A;  2R9X A;  5LBR A;  4ESP A;  4WLA A;  3LY4 A;  5CED A;  2HDS A;  1OTI A;  1H3Q A;  4KQO A;  5EVE A;  3MMH A;  4E6X A;  5FSR A;  1XGI A;  2J80 A;  4HP9 A;  4JKT A;  4LV2 A;  3T4J A;  3KSF A;  3PAE A;  2HP9 A;  4JXV A;  5U47 A;  1N4O A;  4FSF A;  4KZ3 A;  2ZL1 A;  1ONH A;  3GRJ A;  2KLI A;  4LLO B;  1XGJ A;  4IVI A;  3NBL A;  4P6B A;  3EEA A;  4CLC B;  3LID A;  3GEC A;  2J9P A;  4H6J B;  4ZJ3 A;  1KOU A;  3IX3 A;  4S2M A;  2GZA A;  4K0W A;  3PBN A;  5CX7 A;  3UMD A;  1YLZ A;  4WEJ A;  4M3K A;  3MKF A;  1QME A;  4MDZ A;  3DTK A;  3LYX A;  5A92 A;  3WRZ A;  1IYQ A;  5TBM A;  3KYQ A;  4CLC C;  1Q2Q A;  1K57 A;  2L4R A;  4S2K A;  1P9R A;  3H9W A;  1UGU A;  4GW9 A;  2LB5 A;  4G3K A;  3K3D A;  3T4Q A;  5CGS A;  2VA0 A;  5F82 A;  2B95 A;  1KVL A;  3RFB A;  2JKR M;  5EM1 A;  3G35 A;  1Y28 A;  4BL3 A;  3HL9 A;  3A0V A;  5FI7 A;  4UA9 A;  1MC0 A;  1ZG6 A;  4U0X A;  1SDE A;  2RCX A;  2HF6 A;  2Z6D A;  4MNR A;  5L10 A;  4WYY A;  3BM6 A;  4HES A;  3P7N A;  2UV0 E;  3T50 A;  3T1Q B;  2P7J A;  1TS6 A;  3KSG A;  4G3W A;  2PU4 A;  4P0M A;  4I3I A;  3V39 A;  2EWW A;  4E3I A;  2V0W A;  2X71 A;  2B5R A;  2EFX A;  3MFD A;  3BRM A;  1QMF A;  4JGP A;  1PI5 A;  2H5S A;  2WYX A;  4M4X A;  5I94 A;  3LFV A;  3C8C A;  2V1B A;  2IWC A;  5GL9 A;  5F6A A;  4OQH A;  4Y15 A;  2WK0 A;  1W7F A;  4CJN A;  3PR6 A;  4ZRR A;  4MN5 A;  2JHE A;  1N9O A;  2KOI A;  3C2W A;  4H6J A;  1LSW A;  1DY6 A;  1GSW A;  3FV7 A;  4HOI A;  3HLC A;  4R4R A;  2WKR A;  3S7Q A;  2OAQ 1;  3CPT B;  1ESU A;  1JNU A;  5GLC A;  5J8X A;  2HDU A;  1T1C A;  3IT9 A;  3IF6 A;  2Q9M A;  3C38 A;  5L09 A;  1NWZ A;  3UB8 A;  5GLA A;  4L9G A;  3NEC A;  3ICY A;  4BLM A;  4BBU A;  3B33 A;  1N9L A;  3IWI A;  2Y2L A;  1HD8 A;  3OLO A;  4R6L A;  1MWS A;  3IWQ A;  2EX2 A;  1BT5 A;  2VGK A;  2OLU A;  3UN7 A;  5KSC A;  1VB6 A;  4X1M A;  4HP4 A;  4R70 A;  2WZZ A;  2J9O A;  5J7E A;  3Q81 A;  1BSG A;  3KSI A;  1U60 A;  1ACF A;  4CLC A;  1Y4O A;  2ZL1 B;  3RH8 B;  2FH5 A;  1OT9 A;  2XFS A;  2XD1 A;  1L0G A;  4EEU A;  3JVU A;  4PAU A;  2O9A A;  2VV8 A;  2WKE A;  1KE3 A;  5M18 A;  3GDI A;  1H8Y A;  5EVI D;  4LGW A;  3O86 A;  1CEG A;  2B02 A;  3IH9 A;  4ZTK A;  4EEP A;  3LI8 A;  2L0W A;  3MZF A;  1KGE A;  1W8Y A;  2JKG A;  5EUA A;  4OQG A;  5HX9 A;  3S7P A;  4JXS A;  2ZQD A;  4MN6 A;  3ITA A;  3BFC A;  1XXM A;  4EET B;  1H8Z A;  4A5R A;  1DJC A;  1SZV A;  4I3J A;  3ZG8 B;  1NZO A;  3LY3 A;  2WKI A;  3C7U A;  3E4Q A;  5FQM A;  3VP4 A;  2JC7 A;  1SKO B;  5FDS A;  4FTX A;  3PBQ A;  3M2K A;  2HJ9 C;  3GVB A;  3SS5 A;  1FCM A;  1NZU A;  2ZMA A;  4EBN A;  2XH9 A;  2H0T A;  3PBS A;  4OKP A;  4WF0 A;  2FFY A;  4EU0 A;  2H28 A;  4C75 A;  4KUK A;  5GLD A;  2O9B A;  4K91 A;  3VFH A;  4QWO A;  2WKP A;  4IVK A;  3A3J A;  4GS9 A;  4S2O A;  3NY4 A;  4R23 A;  5AQB A;  1K25 A;  4KQR A;  3VFF A;  3HLB A;  5FDH A;  2M7U A;  3TG9 A;  3I7J A;  3NIA A;  2ZQC A;  1VET A;  1EW0 A;  3IHA A;  3LEZ A;  5DKK A;  1XFN A;  3SH9 A;  2HP5 A;  4YOF A;  3QP4 A;  4OPZ A;  4E3K A;  1NRJ A;  3HLG A;  3CUE A;  4WEK A;  2PBD P;  5CER A;  3DWZ A;  1SKF A;  2ZC5 B;  3ZHH A;  1H8M A;  4QHC A;  3OPP A;  4S2I A;  2JKT M;  2WGW A;  3SS4 A;  5HD5 A;  2B18 A;  3T1X A;  3F1N B;  4JPM A;  5DJU A;  3OPL A;  3NJA A;  1K4F A;  2WKQ A;  1ES4 A;  2V1Z A;  4LV0 A;  3H7W A;  4P87 A;  5EEC A;  4WM9 A;  5G4Z A;  5A90 A;  4E3L A;  3O3V A;  1P9W A;  1XJ2 A;  3UY6 A;  3BY9 A;  1S0W A;  4Y7P A;  2VGJ A;  5IU1 A;  2Y2Q A;  1T1A A;  1S4S A;  4XUX A;  4YWZ A;  1J3W A;  4YIN A;  5GLB A;  3MF0 A;  2Q0O A;  3QP1 A;  2VK3 A;  3H82 A;  5F69 A;  3OPR A;  4RVA A;  1V9Z A;  1STZ A;  1T19 A;  3A0R A;  3HLF A;  1LL5 A;  4UHU A;  3QP5 A;  3EQU A;  3W4O A;  5TR7 A;  4X53 A;  3T4S A;  4WMC A;  1WA9 A;  4YNR A;  5F1G A;  1FSW A;  1LSV A;  2A3U A;  3CPT A;  4B4Z A;  4NXB A;  1N9N A;  4RQ9 A;  4X1L A;  4OPY A;  2HJE A;  4HEF A;  5GHX A;  4S2J A;  4ZDX A;  5HPF A;  5C5K A;  3HVF A;  5CGW A;  4BD0 A;  1FIK A;  4DE0 A;  4EER A;  4DDY A;  5DFY A;  1LLB A;  4LFU A;  2PR6 A;  2H0Y A;  4Y2F A;  4Y17 A;  3E2L A;  3WS5 A;  4WZ4 A;  3U2A A;  5E43 A;  1HZO A;  1OPX A;  3T4K A;  2W3H A;  4OOM A;  5F5Y A;  2INW A;  2ZC4 B;  5HWV A;  3G31 A;  3QNC A;  1YLW A;  1K56 D;  4O0P A;  2V8F A;  4GJ4 A;  4R1G A;  1K0K A;  3LIA A;  5CEC A;  2A2L A;  2GJ3 A;  2Y91 A;  1J9M A;  3DBA A;  3FC7 A;  1E4D A;  4GZB A;  1DJB A;  2HZ5 A;  2ZM8 A;  3P01 A;  4HY8 A;  1ES5 A;  3IXD A;  3S4X A;  1XJ6 A;  3DWK A;  2OV5 A;  4UQI S;  3UE6 A;  5HW3 A;  3IX4 A;  3BWL A;  5A91 A;  3A3I A;  1OTB A;  4EWF A;  5HZH A;  5AQ7 A;  4Y0T A;  2QYB A;  4NKP A;  4B9O A;  3EEH A;  4IUK A;  5HD3 A;  2ZOH A;  4ZAM A;  1CI9 A;  4PM8 A;  3ZGA B;  3IQA A;  3M6B A;  1PW8 A;  1ERQ A;  1BYW A;  1L2S A;  3ZG0 A;  3VOZ A;  4R4S A;  3BQ8 A;  2EXB A;  4I5S A;  1XJ4 A;  4WMC D;  2GNX A;  3IBJ A;  5FQJ A;  2H10 A;  3ZNY A;  1L0E A;  3WWX A;  3QHY A;  3W4Q A;  1F98 A;  4EW7 A;  1FCO A;  1X0O A;  2W1T B;  3LIC A;  1DRM A;  4F3L A;  2W27 A;  4LEN A;  2WGV A;  5CRF A;  2V8C A;  2R78 A;  1JWV A;  2XSS A;  3LEQ A;  1IYS A;  3CZD A;  4IBR A;  5EOE A;  1W79 A;  1P97 A;  4E04 A;  2GDN A;  3VOL A;  3ZDJ A;  1IYP A;  3ISG A;  4BEN A;  2HPB A;  3W4P A;  3SW1 A;  2M7V A;  3EWK A;  3UPO A;  5FAO A;  3TW8 A;  3K3C A;  2G2U A;  3IXG A;  3IX8 A;  5FEG A;  4K0X A;  2VGL M;  1PYY A;  2ZMV A;  5E2F A;  4O8G A;  5KIZ A;  5EFW A;  2Y2P A;  1YT4 A;  4S2N C;  5E2E A;  4C3Q A;  3UB6 A;  1YMS A;  3BLM A;  3LIE A;  2OWH A;  5HDD A;  5FAP A;  1G5U A;  2FZ0 A;  3ZG5 A;  4MLL A;  2V20 A;  3EQV A;  4X55 A;  2V0U A;  3OC2 A;  3CJM A;  4FH2 A;  5FA7 A;  1VEU A;  2WKH A;  4FUW A;  1W8Q A;  2J3T C;  3BEB A;  4BMW A;  2Y79 A;  4WN5 A;  1XX2 A;  2PT7 A;  3QNB A;  3T4T A;  3PBT A;  5HFO A;  3B42 A;  1ERO A;  1LL8 A;  2Y2M A;  2X02 A;  1K54 C;  3MZD A;  1VM1 A;  1XJ3 A;  4PM9 A;  5KSH A;  1EWZ A;  1T1B A;  4C6Y A;  4PM5 A;  1BUL A;  4E3J A;  3NDG A;  4D2O A;  3FWL A;  2OWJ A;  1TDL A;  3ZVW A;  1PNE A;  4OP5 A;  1IYO A;  3N4I A;  3ZQ5 A;  3G34 A;  4OQI A;  4KZ8 A;  3O87 A;  2E8J A;  4FCF A;  4E3N A;  4MCW A;  1KDS A;  3MFX A;  1ONG A;  2O9C A;  3BY8 A;  3T12 B;  1XA1 A;  3ULF A;  1XA7 A;  1BLP A;  4KZA A;  3ZYT A;  5FAQ A;  3CLO A;  2NUP C;  1S4R A;  4S2N A;  4HJ3 A;  1LT0 A;  4HH2 A;  5AVE A;  4WZ5 A;  1GHM A;  2WAD A;  1XKZ A;  1H5X A;  3E98 A;  3IS2 A;  1PIO A;  3R7W A;  4FOF A;  2PYP A;  5M1A A;  1YKD A;  4UQI M;  5A93 A;  2XK1 A;  1TDG A;  2JN7 A;  4WZ5 C;  4EBP A;  1OTE A;  4Y13 A;  1NY0 A;  3IWO A;  4B93 A;  1MKI A;  1MWU A;  2O0Y A;  3R4K A;  3QP8 A;  5J3W A;  1MWR A;  1A0K A;  5EVI B;  4QU3 A;  3IXH A;  3QP2 A;  5CHU A;  3LCE A;  1VQQ A;  4Y0U A;  4HJ6 A;  1K6S A;  4KZ5 A;  1ZKJ A;  3C4O A;  4ARZ B;  4LCL A;  1FIL A;  5K5B A;  5J4E A;  3SOI A;  2ZM2 A;  3PAG A;  2JKF A;  5EVI C;  1E3U D;  4OVD A;  4XXR A;  2J3T D;  3NCK A;  4DDS A;  4JBF A;  5DTS A;  3JPU A;  3F1P A;  5FEF A;  2IWB A;  3M2J A;  2M1C A;  5IT5 A;  3DTM A;  3SS3 A;  3LIF A;  4Y0O A;  3AGE A;  4Y5F A;  2Y2K A;  1YLY A;  4BBV A;  3BW6 A;  3TSG A;  4GHI B;  4I38 A;  5HL1 A;  5CHJ A;  1LSX A;  1BLC A;  2K2N A;  4QY5 A;  3L7H A;  3C5A A;  5L07 A;  1NXY A;  1AWI A;  1MWT A;  3RXX A;  4JLF A;  3W2Z A;  4DRT A;  4I39 A;  4GNU A;  4KUO A;  3N6I A;  5EOO A;  3GQZ A;  4CQH A;  4G3V A;  1KGF A;  3F1P B;  1YSQ A;  2E8I A;  3G30 A;  1TS7 A;  2VEA A;  3GMW A;  2W3E A;  5FL3 A;  1EI5 A;  4KEN B;  2ACG A;  1ZTU A;  4LPZ A;  2QJ7 A;  4OLG A;  1AXB A;  2XQZ A;  5AQ9 A;  4ARZ A;  3NDE A;  5E2H A;  2HGV A;  2PU2 A;  4P6Z M;  1BLS A;  2HDR A;  3G6O A;  2DNS A;  4KZ7 A;  1ERM A;  3D4F A;  4GB7 A;  3FKW A;  4N9L A;  1YM1 A;  3UB5 P;  1RP5 A;  1L0D A;  3EGX C;  2BTF P;  3V5M A;  2Y2N A;  3DW0 A;  4DE3 A;  3CI6 A;  1N9B A;  4N1X A;  4IHQ A;  1K57 C;  4IED A;  5HWT A;  4EV4 A;  2OAP 1;  4N1H A;  2Y2O A;  3LR0 A;  1GHP A;  1G28 A;  2P9V B;  2FFF B;  2NUT C;  3BFG A;  3A3E A;  2KDK A;  3FKV A;  1FR1 A;  3UB7 A;  2PAV P;  1LL9 A;  5A8B A;  3BFF A;  2QMI A;  4R3J A;  2A24 A;  1ESI A;  3G4P A;  4XUZ A;  5FQK A;  2EX8 A;  5BOH A;  5CHM A;  4RA7 A;  3KYE A;  3A3F A;  4LRX C;  1NLZ A;  5TGF A;  1E3U A;  5HL6 A;  1CEF A;  3E4P A;  3AGF A;  1WYC A;  3BYD A;  3C4P A;  3PXP A;  3LUQ A;  4IUH A;  3T4L A;  3GV9 A;  3HUN A;  2WUQ A;  3VP3 A;  4BWI A;  1PWD A;  2W1R A;  1KE4 A;  3IF5 A;  3MQQ A;  4Y3I A;  2OLV A;  4LV3 A;  3F1O B;  5D3O A;  1OJ5 A;  1FOF A;  1CF0 A;  2L1M A;  4R3A A;  4JXG A;  3NOP C;  2XD5 A;  1DJA A;  4IJG A;  4CPK A;  2WAF A;  4WEL A;  5KMW A;  5MC7 A;  1SCW A;  5M19 A;  1UWP X;  4HHD A;  1H0M A;  3O88 A;  1F9I A;  1T18 A;  1G68 A;  1GHI A;  2QPN A;  1E25 A;  2EX9 A;  1Z09 A;  3Q1F A;  1JWZ A;  4JF4 A;  3HLE A;  4NET A;  1F2K A;  2BG1 A;  3OOV A;  2Y2G A;  2Y59 A;  3D9Y A;  2DRW A;  1S67 L;  3HLW A;  4KQQ A;  3ZG7 B;  4KG6 A;  1PRQ A;  3MKE A;  3CG5 A;  1RGY A;  4S2P A;  4WBG A;  1LI0 A;  3BEC A;  4NXF A;  1DP8 A;  3NHQ A;  4MBK A;  4DN0 A;  2A24 B;  3V3S A;  3P09 A;  1JTD A;  3SH7 A;  4HIA A;  3VE4 A;  4GKU A;  2IA2 A;  3HLD A;  3UPP A;  5DF8 A;  1GSV A;  3NC8 A;  1G6A A;  3LGO A;  4PPR A;  1VEU B;  1O7E A;  1O07 A;  4X69 A;  2XA7 M;  3CAX A;  3S7O A;  4RX2 A;  1ZG4 A;  1ZHH B;  2Z2M B;  3FPW A;  2ZOI A;  3NI9 A;  4MN7 A;  3WS2 A;  2ZJ9 A;  4MBH A;  2GX5 A;  3MXS A;  1DP9 A;  4R3B A;  3PBR A;  4KZB A;  5HAR A;  2W1T A;  1S66 L;  4GN2 A;  1SKO A;  1UWN X;  3AGD A;  2ZQ7 A;  3PTE A;  4BJP A;  4QPR A;  2XFT A;  1ODV A;  3VSL A;  4YFM A;  3HCY A;  5DF9 A;  2XGN A;  2Y8H A;  2BLS A;  3WRT A;  2QHK A;  3EGD C;  4ETX A;  5CEB A;  4X68 A;  4DE2 A;  3D3O A;  4PKY A;  4OP8 A;  1V9Y A;  5IS1 A;  4B4X A;  2ZQ9 A;  5DFX A;  1Q2P A;  4RYE A;  2J8Y A;  2QZ6 A;  5CGX A;  4UA7 A;  5FI2 A;  5DKL A;  1S1Y A;  4D60 A;  2PRF A;  5DTK A;  1OTA A;  3O5Y A;  4O7D A;  2VLG A;  2W3D A;  2PYR A;  2XA7 S;  4Z1W A;  2VX8 A;  1W63 Q;  1WE4 A;  2J3W A;  5HAQ A;  1ES3 A;  5EV0 A;  2VKS A;  4PHT A;  2YKH A;  3VP1 A;  1IKG A;  5IHV A;  3LO7 A;  1L3L A;  2HP6 A;  1KVM A;  2Z2L B;  3RXW A;  3MR0 A;  4DXC A;  2AVX A;  5F1F A;  2HDQ A;  5EPH A;  5DJT A;  4BBT A;  3UE3 A;  3HJI A;  2R9W A;  4L9F A;  1ES2 A;  3E4O A;  4S2L A;  4DMZ A;  3CUE C;  2CC1 A;  2PDR A;  1IFQ A;  1F5M A;  3V3R A;  2XF3 A;  4UAA A;  3GSG A;  1CI8 A;  1TEM A;  1YMX A;  3UPN A;  2V1A A;  2C5W B;  4Q0J A;  1NLY A;  4GD8 A;  1OJG A;  2PD8 A;  2JCH A;  2O99 A;  3LR5 A;  1G6O A;  5CTM A;  2Y55 A;  3JVV A;  3Q07 A;  5EVI A;  4U3T A;  5G18 A;  1D1J A;  5I5L A;  2HV1 A;  2DMW A;  4GHI A;  3VOY A;  3UO9 A;  1S6R A;  5AVF A;  5F68 A;  1VHM A;  1HLU P;  4E6W A;  3WS4 A;  3A3D A;  4KZ9 A;  2IWD A;  5FI6 A;  3C30 A;  3R7W B;  3MQ0 A;  1PZP A;  3IH8 A;  3DTE A;  5DVA A;  3S22 A;  4N92 A;  3FG8 A;  1LI9 A;  3OPH A;  5EM0 A;  3MSH A;  4BL2 A;  2Y2H A;  3KO6 A;  1D06 A;  4EXO A;  5GHY A;  1MKM A;  1CK3 A;  3UDI A;  1DP6 A;  3M6H A;  4GLQ A;  4NXE A;  2VV6 A;  2DCF A;  1CJF A;  2WGW B;  2XDM A;  4MBF A;  4NK3 A;  3CWF A;  3FPV A;  3OCN A;  4U0T A;  4HNB A;  2P74 A;  3DAV A;  4E3O A;  2BAS A;  3RTY A;  2X01 A;  5TBM B;  3LI9 A;  1W5D A;  5CXW A;  2RL3 A;  4JF6 A;  1PZO A;  4KG5 A;  3V50 A;  4B88 A;  4QJG A;  1CQA A;  2V2F F;  4GD6 A;  5DF7 A;  2XEP A;  3U4L P;  4O01 A;  2I9V A;  2JKR I;  3WS0 A;  3T1S A;  2WAE A;  1K54 A;  1RCJ A;  4Z9Q A;  1K38 A;  1TF1 A;  3UB9 A;  2ZD8 A;  5HPI A;  3NOT C;  5L8M A;  3G32 A;  4QY6 A;  4LCM A;  5GHZ A;  1TS0 A;  4HI4 A;  4OQ0 A;  2C6W B;  4HJ4 A;  3BLS A;  5CTN A;  4WUJ A;  3TOI A;  3Q82 A;  4PKY G;  1NYY A;  4RX3 A;  3Q7V B;  4OOY A;  1XP4 A;  5G4Y A;  1MZU A;  4UEY A;  2ZMF A;  3IS2 B;  2PHY A;  5FAS A;  3ZNT A;  2ZC3 B;  4P85 A;  2ZC6 B;  3IHB A;  4DXB A;  3B3X A;  2W0N A;  4JGQ A;  5FQI A;  2QJ5 A;  3BFE A;  3F1O A;  3S7N A;  2P04 A;  2D01 A;  3B47 A;  4OPQ A;  5EE8 A;  3S1Y A;  3OCL A;  4I3A A;  3CHW P;  5TFQ A;  2QWS A;  1Z6F A;  2JBF A;  4H8R A;  1GA9 A;  3D72 A;  1JWP A;  4Q0I A;  4ZBE A;  2CMN A;  4DJ2 A;  4ETZ A;  2ZLY A;  4GDB A;  1M40 A;  2Y2I A;  4HH3 A;  1C3B A;  2PD7 A;  4OLD A;  3ZG9 B;  3BJN A;  3TRC A;  1PWG A;  4WL9 A;  4OOL A;  5HAI A;  5TJJ A;  3TJZ C;  2K31 A;  2WZX A;  4ID4 A;  1NRF A;  5HAP A;  4GS9 B;  3GR2 A;  1PFL A;  1SDN A;  5F83 A;  1OT6 A;  1PWC A;  5L2F A;  2EXA A;  2XRN A;  2Q9N A;  4AFI A;  2P9V A;  3NUL A;  5HDS A;  2P08 A;  2W3G A;  3UNW A;  4KZ6 A;  3OBF A;  3MS6 A;  3IF6 B;  1MXO A;  5FQ9 A;  3UME A;  1BUE A;  2V9A A;  4XT2 B;  3FZC A;  3T1R A;  4F94 A;  3N8R A;  4OH0 A;  5HSQ A;  4ZJ2 A;  3UDF A;  1OME A;  4NG2 A;  1NJ4 A;  4K08 A;  1TVF A;  3DTI A;  1Y54 A;  2VZW A;  4NEE D;  3VV4 A;  1ZC2 A;  3V67 A;  1TS8 A;  1GA0 A;  3IBR A;  3Q7Z A;  1FQG A;  1WYB A;  1I5Q A;  5DTT A;  1M6K A;  3KSH A;  2VJW A;  3VMA A;  1D7E A;  3VP0 A;  4DE1 A;  2EA9 A;  3IF6 C;  3ITB A;  3TE8 A;  3LIB A;  2MJ6 A;  3K2N A;  1P0Z A;  1W63 M;  3N7W A;  4F3L B;  2G7U A;  4FH4 A;  4X25 A;  2XR0 A;  1KGG A;  3T4O A;  3ZVT A;  1I2S A;  4HBT A;  1K4E A;  4L9E A;  1YLP A;  2XLN A;  1HVB A;  4FD8 A;  2A49 A;  1KDW A;  5JYP A;  2EX6 A;  3MZE A;  4LRZ E;  1NYM A;  4GOG A;  2G2W A;  1HTZ A;  2PBY A;  3VP2 A;  1K6R A;  4X56 A;  3MJQ A;  3CIT A;  3E2K A;  2ZQA A;  3HJK A;  4EBL A;  3ZFZ A;  1L0F A;  4L0L A;  3HUO A;  3N8L A;  1MBL A;  1XPB A;  2EWV A;  2JKT I;  2Y4A A;  3F1N A;  3A0S A;  2LB9 A;  3UE1 A;  2ZM0 A;  2Z6C A;  1OTD A;  4BD1 A;  3IXB A;  5E2G A;  3WS1 A;  3L9K A;  2ZQ8 A;  3HRE A;  1XFQ A;  2KX6 A;  4MEZ A;  4DF6 A;  1BLH A;  4EUZ A;  2W3F A;  4QB8 A;  2I72 A;  1BTL A;  3SZT A;  4IBX A;  2QKP A;  4PM7 A;  3H82 B;  2VV7 A;  3VE3 A;  3C7V A;  4KQD A;  1YLJ A;  1VET B;  4Q0H A;  3BQA A;  1JTG A;  2OOL A;  1FR6 A;  3HBR A;  1BZA A;  1K56 A;  5AJG A;  3G2Y A;  5FAT A;  3BFD A;  4P6Z S;  1TD5 A;  2PR5 A;  4CLC D;  1YQS A;  4JGR A;  3ZCZ A;  5JYO A;  5AQA A;  3FYZ A;  1FCN A;  1MPL A;  3H7W B;  2XRO A;  1GSX A;  1S1Z A;  3OZH A;  3JYI A;  4XT2 A;  5HWW A;  3CMZ A;  3PHY A;  3VSK A;  2WGI A;  3UDX A;  4ZJ1 A;  2ZC7 A;  3MBZ A; 
#chains in the Genus database with same CATH homology
 5EM0 A;  1HLU P;  1Z09 A;  2HZ5 A;  3MSH A;  3T12 B;  4X1M A;  4QWO A;  3T1X A;  2ZL1 A;  1YPR A;  1SKO B;  5FDS A;  4FTX A;  3U4L P;  1CF0 A;  3DAV A;  5EV0 A;  3CHW P;  1J3W A;  2JKG A;  5EVE A;  3NUL A;  5FEF A;  4D60 A;  3L7H A;  1F2K A;  3CPT B;  1PNE A;  2PRF A;  3D9Y A;  3T1S A;  2V8C A;  2PBD P;  1SKO A;  1AWI A;  1ACF A;  3T1R A;  1FIK A;  1PRQ A;  1FIL A;  1G5U A;  2V8F A;  2VK3 A;  3CPT A;  1D1J A;  1Y4O A;  1CJF A;  1VET B;  3LEQ A;  3LGO A;  3T1Q B;  1K0K A;  1VEU B;  2ACG A;  2E8J A;  3MS6 A;  2JKF A;  3UB5 P;  5FEG A;  1VET A;  4X1L A;  1SZV A;  2ZL1 B;  3NEC A;  3L9K A;  1A0K A;  4X25 A;  2B95 A;  2BTF P;  4ESP A;  5EM1 A;  1PFL A;  1VEU A;  3KYE A;  2PAV P;  4FUW A;  1CQA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...