4X2VA

Crystal structure of the murine norovirus ns6 protease (inactive c139a mutant) with a c-terminal extension to include residue p1 prime of ns7
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
174
structure length
174
Chain Sequence
APVSIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLTGSNAKAQDLGTIPGDAGCPYVYKKGNTWVVIGVHVAATRSGNTVIAATHGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS6 Protease
publication title Structure determination of Murine Norovirus NS6 proteases with C-terminal extensions designed to probe protease-substrate interactions.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Hydrolase
total genus 30
structure length 174
sequence length 174
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2vA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2vA01
2O8TA 1SGCA 2PHBA 1JWTA 2ZGJA 2ZU4A 4NSYA 2J34A 4FXGH 2BLOA 4GHQA 4Z0KA 4DW2U 1GI7B 2BQWB 2XYAA 1ZSKA 3D62A 4NA7A 1X7AC 2NU1E 1SMFE 4ABDA 1VZQH 3MO6A 5EQRA 2GCTB 4MDSA 3VB5A 3A7ZA 1Y3VA 3BTTE 3I78A 1DPOA 9ESTA 2SNWA 1V2KT 1W2KH 4OS6A 1WQVH 2A2QH 1TNIA 1TNHA 3EA8A 1CT0E 4LZ4B 1DANH 1O2WA 1C4V2 4F4OC 5BPEA 3K6ZA 5E0GA 4AG1A 1TNKA 2FOFA 1A0HB 4WY3A 4UFGH 1SHHB 3V3MA 1NTPA 1GJDB 1YPMH 5L6NH 2A5IA 3PMAB 3M5NA 1JRSA 2Z6BD 1JIMA 1F92A 3RXFA 4X2XA 1BBRE 1C1TA 2BDIA 1ELDE 2Y5HA 2AGIX 4I31A 4BTTB 1CGHA 2BX3A 3U1JB 1DWDH 5CHAB 3G01A 4ABAA 4B75A 2ZFFH 1ZMNA 1DLEA 4UEHH 1AE5A 1XX9A 1GVZA 2EA3A 4DVAU 1TRNA 5L2ZH 3HGNA 5EPNA 3D49H 1ZTKA 2PSYA 1CQQA 5JDUB 3QGJA 2A4RA 2PUXB 1OYTH 2G5NA 3SN8A 1NM6A 1CVWH 3TH4H 2VH0A 1QB9A 4AFUA 4O3TA 1C2EA 3MWIU 1LQDB 2R0KA 1TGTA 1O5CB 1W8BH 2YNBA 3DT0H 4ISLA 7GCHF 1O3JA 1LPKB 3HKJB 4Z6AH 5HGGA 4U01A 1A5HA 3SJ8A 1BMAA 3SUGA 4BTIB 1K21H 1Z1IA 4O3UA 3ZV8A 4WF8A 3MU4A 1WOFA 1ZR0A 1MKXK 3B9FH 1IAUA 1V6DA 1KLJH 1G3EA 3SNAA 3EA9A 1AE8H 1UVUH 4MPXA 1C2FA 1GBLA 1VGCB 3ATMA 1GI6A 4KKDA 2ZDNA 5L2YH 1T8NA 1NFYA 2ZPRA 3EQ0H 1G32B 1E38B 3BTWE 5CE1A 4TY6A 2BQ6B 3ZZ5A 1G2LA 2F91A 3QWCH 2BD2A 1VCQA 5C5OA 4ZXXH 2ZQ2A 1TGCA 1TA2A 3TLOA 4OGYA 1B5GH 1CHOG 4E7NA 3BTEE 2ZCHP 4X6PA 4I33A 2ULLA 4ASHA 2BD8A 1S6FA 1A3BH 5DG6A 2ZQ1A 4X2WA 1O2XA 1S82A 2XWBI 6LPRA 2H5CA 1P12E 2V6NA 1GDNA 1IQIA 3GDVA 1SGRE 3M5OA 1VR1H 1MH0A 1O2OA 1KTTB 3CS0A 3FFGA 1TOCB 2A5KA 4FUCA 2FOHA 1G36A 1ZRBA 3FP6E 1AVGH 1Y3XA 3GOVB 1EZSC 4B76A 1BUIA 2WUCA 1Z8IB 3RXLA 2BXUH 4K5ZA 1KXDA 1YPEH 3B8JA 1XKBC 1WYKA 1ZMLA 2BDAA 5GJ4B 1GDUA 1Z71A 2ZTXA 3ZVAA 1FIZA 1QB6A 1BTHH 3M35A 3PLBA 1K1IA 2AMDA 4K3JA 3LPRA 1OWIA 3SGQE 3BSQA 1HAYB 1F0RA 4K8BA 2HNTE 4CHAC 3SI4H 3RC6A 1TPAE 1T4VH 3K2UA 1V2TT 3MHWU 1BRCE 1NRRH 1V2VT 2BM2A 2VIOA 4FVBA 2VB0A 5DP4A 3HGPA 1KLIH 3AW0A 1O3GA 2XCNA 3GY3A 1NT1A 2FWWA 2G52A 8GCHF 4TWWA 1SGFA 3GY4A 3ZZDA 2PKSB 1C1SA 2P8OC 2SFAA 4UDWH 3QO6A 4ABIA 5TJXA 1LDTT 1CBWB 4IC6A 4BNRA 1B0EA 1SFIA 2DUCA 3PYHA 1C5XB 5EGMA 1L4DA 4YOGA 2ODPA 1SOZA 1LVYA 1JXPA 1B0FA 5AF9H 1C5SA 1J15A 1YF4A 2GMTB 1DY9A 4ZKNU 4CHAB 2WINI 4ZKOU 1THPB 2ZDLA 1NRPH 1BRUP 5DP3A 3TJOA 3KQBA 1GBMA 5AHGH 2AMQA 1OYQA 1MKXH 1NFUA 3DA9B 1O3NA 1WSSH 4ZHLU 1VITG 1TRYA 3S0NA 3MNBA 3TK9A 3DD2H 2Y7ZA 1O2IA 3P92A 4WH8A 5GPIB 3UNQA 2GP9B 1C1OA 2XW9A 3E91A 3SJKA 3M5MA 3GCTG 2P8OB 1LCYA 2ODYB 2KAIA 4IW4E 3SNCA 1W7GH 5T6FA 2G4UA 3RMNH 1UTLM 1O30A 1BA8B 3SU5A 2ANMH 3ITIA 1RRKA 3MNXA 3RLYH 2BD4A 1A7SA 1S81A 1J17T 2GT8A 3SZNA 3F9HA 1TLDA 3UFAA 4ISIH 4MLFB 4B1TA 1UCYE 1V2QT 1EAWA 2Z9LA 3U9AH 1ELCA 1EPTA 1KXFA 1OP0A 1MBQA 1T8OA 2XTTB 2FTLE 3O8BA 1K28D 4ZKSU 1ANEA 2ZFSA 3ZZ6A 1LVOA 4ESTE 2WUBA 3E0PB 1IQLA 1HGTH 1KXCA 1G2MA 1O3IA 1HAVB 1QB1A 3ZYEA 1VITF 1GMCF 5EXLA 4DIIH 4FUHA 3A83A 2EI8A 3TVJB 2Z9IA 1O3MA 1VJ9U 2ZNKH 3RXRA 3E1XB 3V7TA 1FN6A 2NWNA 4OS1A 4AGKA 1T32A 1THSH 3VXFH 1PPHE 2ZZUH 4X1PU 2OINA 3LONA 1QBNA 1ETTH 1TX6A 1O5EH 1GBIA 1MD7A 2VIPA 1UTOA 1O2ZA 1GVLA 2B9LA 1A61H 1MQ6A 1TWXB 2XWAA 4X2YA 1D3TB 3TH2H 1O38A 3M3VA 2ESTE 2BD9A 1LPZB 1TQ7B 2TRMA 4ZHAA 1BCUH 3U69H 3ZYDA 2VNTA 3AVZA 2GDDA 3HK3B 4WH6A 4OS4A 1GWAA 1AHTH 1IHSH 2P59A 1NN6A 2BLQA 5SGAE 1P2IA 1HAVA 2HOBA 3TGIE 2ASUB 2FPZA 2ZIQH 4X8VH 5EW1H 3ATKA 3M3SA 3RM2H 1TX8A 3C27B 1MTSA 1A0JA 2AEIH 7KMEH 2J9NA 1O2UA 1Y3YA 4RN6A 6CHAC 3MTYA 1UO6A 4K1SA 1NY22 1HXEH 1NFWA 3T25A 1DITH 4CRGA 1ZJKA 2BYAX 1BTXA 1YPKH 5A8XA 4BXWA 1DLKB 2QYIA 4ABFA 4D9RA 4A92A 4Y10E 1GHBF 1C1UH 1ELGA 3LGUA 3SU4A 1EJMA 1H8DH 1C2GA 2PGQB 2UWPA 2H1UA 1TBRH 4NFFA 2AH4X 1C5VA 1TAWA 3MH6A 2XC4A 1OS8A 1S83A 2UWLA 2ZFTA 4FU8A 3SHAH 2XXLA 1EP5A 2ODQA 5LGOA 3H5CB 1ELAA 1GI5A 3MU0A 3ZZCA 1Y3UA 2A1DB 2NU0E 2JH0D 3MU8A 4Y7AA 1DY8A 1KXBA 3OSYA 1HJAC 1O39A 5EU8A 3A88A 4ABEA 4SGAE 2W5EA 2UUYA 1IQJA 1DWEH 4R8TB 1NZQH 4TPYA 3QTVH 1XXFA 3BTDE 4D8NA 1P9SA 2CF8H 2W7SA 2G5VA 3VB7A 1ZJDA 2UUFB 4WVPE 2QF0A 3SU6A 2SGAA 2Z7FE 1ZHPA 2HLCA 3PTNA 1HAPH 4NWKA 1MCTA 2FS9A 2ZGXH 3SGBE 2FDAA 2B7DH 3LGYA 5GDSH 3T29A 1ARBA 2QXJA 2PW8H 4H6TA 1HRTH 3ZZ9A 2BX4A 3P8GA 3SU0A 3FAOA 3UR9A 2F9VA 2BY7X 4BANB 1SLUB 2IJOB 3MH4A 5FBIA 1O3PB 2ZWLH 4CRCA 1O3AA 1BQYA 2QGRA 1CHGA 3SORA 1JIRA 1MU6B 4GCHF 5E8EH 3KCGH 2STBE 3AAUA 1C4U2 1GBDA 1UTNA 2VGCB 2ZHFH 1ZPCA 2ZCKP 3ESTA 3FP7E 1YPLH 3HK6B 1E37B 5GCHG 3T27A 1CSOE 4ISHH 2AYWA 3F6UH 1BTPA 3TITA 3A8DA 5AFZH 1NPMA 1L0ZA 2QCYA 2ZFQH 1FMGA 2XBWA 2QAAA 1XUGA 1N6YA 4ZROA 1VCPA 1ZZZA 1XMNB 2IOTA 1MU8B 5C67A 1O2SA 2GDEH 1ANBA 4X8TH 3TJNA 1NS3A 1HAGE 4GAWA 1FV9A 4WJG2 1FJSA 3QZQA 4J1YA 4DGJA 2GZ7A 4YT6H 1XVMA 1P2NA 1A5GH 2ZU3A 1AB9B 2ILNA 1O3CA 4I8LA 2FLBH 1O36A 1SR5C 1AKSB 1QR3E 3GCHC 1NU7B 2QXIA 4OS5A 2ZGCA 4WWYA 2JETC 2STAE 1AWFH 1P05A 3QGNB 3PV4A 2FLRH 9LPRA 1MTNB 1P01A 5GCHF 2Y5GA 1AU8A 3UUZA 2Y82A 5DP8A 1PQ7A 4CBOA 3ZZ4A 1YCPM 1W3CA 2BY5X 4K1TA 1Q2WA 2ALPA 1GDQA 2Q6DA 5A0CA 5G4BA 3HKIB 1J16A 1O5DH 3A8BA 4I8JA 4DT7B 2GCTC 2M5TA 1O3OA 1PFXC 3URDA 3AW1A 3UIRA 3RP2A 2I6SA 1GI2A 3UQVA 1GHYH 4YTAA 3SV8A 2PSXA 1AWHB 1OX1A 4INHA 2FO9A 2FS8A 1HAIH 5FBEA 4I8GA 1HFDA 4X8UH 1ZSLA 1SGEE 5FPSA 1QTFA 4A6LA 3U98H 3PM3A 4UE7H 4CBNA 3RMOH 1WQSA 1DFPA 2FXRA 1VITH 3SO3A 2FOAA 1Q31A 1LHFH 4CRBA 1FIWA 2ZDMA 4UFDH 1GJ5H 3M36A 2ZPQA 1TMBH 4NGAH 1MKWK 3LGTA 4GUXA 2AIPA 1MAYA 1Z7KA 1T8MA 2ALVA 3ENSB 1BMLA 3C1KA 5CHAC 4ABGA 5EW2H 1UVSH 1SGYE 1DICA 2OLGA 4KTCA 4QT8C 1DOJA 3E6PH 5HMAA 4MTBA 3LH1A 4KGAA 4INLA 2HWLB 3RXJA 2SGEE 4LOYH 1RIWC 4NZLA 1RGQA 2ZGHA 3PROA 2QC2A 2ZFRH 3VXEH 4ZXYH 1EUFA 3KL6A 1AGJA 3TJUA 3GCNA 1YLCA 7GCHG 3S9BA 3K9XB 4VGCB 1RXPA 3V13A 5JBAS 1GHXH 2FOMB 1SFQB 2C3SA 4AYVB 1TMTH 1UVPA 1W10U 3H7TA 4X8SH 3L33A 3LKWA 3TU7H 1DE7H 2LNCA 4X6MA 2BHGA 1TA6A 3P95A 2O8UA 1AIXH 1TONA 2BQ7B 2O8LA 2VIQA 5C5NA 4OS2A 4AGJA 4Y7BA 1QA0A 1FAXA 5ESBA 1FZZA 1XM1A 1A0LA 3A84A 1NO9H 1VGCC 1TOMH 2AGGX 2SGDE 2VJ1A 3SNDA 1SOTA 1V2PT 2XC0A 3A85A 1RIWB 1WU1A 2VWOA 3MOCA 4A7IB 1CA0B 1C2MA 5LPFA 4XBCA 2F3CE 2ZA5A 1ESAA 1A3EH 3TNSA 5DPAA 2AGEX 4ZHMU 2OTVA 1FN8A 3PWBA 2A4GA 3P17H 4PROA 5AVDA 1EATA 2DE8A 2VINA 1AUTC 4GVUA 4MNWA 4B2CA 3RXUA 1IHTH 2RA3A 1RD3B 3QDZB 3LC5A 2OC7A 1LQEA 3BTFE 1C5NH 1EB2A 2AS9A 1UTQA 2QIQA 1O31A 1V2UT 3U8RH 1S85A 3NZIA 3ZVFA 4HZHA 3JZ2B 1EOJA 1GBTA 1IQEA 2J4IA 3OY6U 1O5FH 4MNYA 3A8CA 1C9TA 1Y3WA 2WYGA 1KIGH 1UVTH 2ZU5A 4Y8ZA 1K22H 1O35A 5DO4H 4NWLA 2BLVA 4BAKB 2TGDA 3MYWA 4X1NU 1O3BA 1EQ9A 1SGNE 1TQ0B 2RCEA 3RXCA 3RXKA 2ZDKA 4YOJA 1GMHG 2D1JA 1TBZH 1ZTLA 3A80A 3F9GA 3Q3KA 1JBUH 3PMBB 3U8TH 1FNIA 3BG8A 3UY9A 1EAUA 1MZDA 3PLPA 2FI3E 3M3TA 4CR5A 1QBOA 5FCKA 1ELEE 3WY8A 3A86A 1QCPA 1GL0E 5T3HA 1LHDH 1PJPA 4AB8A 2B5TB 2Z9KA 4AOQA 3P6ZB 3L3TA 2V35A 3RXEA 1MKWH 1BHXB 1THRH 3KGPA 2BVSH 1EAIA 2UUKB 1J9CH 8GCHG 2HVXA 5A0AE 1GBCA 3S7HB 2XRCA 3RXVA 4Y0ZE 1SHYA 1KXAA 1GI4A 2BDCA 5A0BA 2PKSC 3QZRA 1HIAB 5I25A 1ZSJA 1UJ1A 1FXYA 4XBDA 1O3LA 2W3KA 1G9IE 2XBYA 3STIA 5JBCS 1CBWC 1FONA 1GMHF 1Z8JB 4X2VA 1HPGA 3BTME 4JCNA 1CA8B 1LO6A 1D6WA 2TPIZ 3LGIA 1EZUC 3RU4T 1E36B 1EPTC 2FM2A 2G8TA 5BRRE 2FX4A 4GSOA 2GMTC 2VIVA 1EJNA 1K1OA 2ZECA 1L2EA 1P04A 3QN7A 4HFPB 4ISNA 5EXMA 2GD4B 1O2JA 3GY8A 3Q76A 1BOQA 1W14U 7LPRA 3BN9A 3VB3A 1BJUA 1KY9A 2BZ6H 4JZFH 4IN2A 1O34A 1HJ9A 2VWMA 4SGBE 2Y6TA 2KAIB 1GBEA 1CT2E 1YPJH 2VIWA 5ABWA 2WPHS 4NSVA 2FODA 1V2OT 5LPEA 1HIAA 4TY7A 1FAKH 4NFEA 3SJOA 4GLYA 4IC5A 1G30B 5EOKA 5FCRA 3ZV9A 1XUHA 1YCPK 1AY6H 3FANA 2BOHB 3QLPH 2R2WU 3RXQA 5FPYA 1V2LT 2Z9GA 1ZHMA 1SQTA 2TIOA 3OY5U 4ZKRU 1XUJA 1EPTB 1RFNA 1QRXA 3BTKE 2R3YA 1WUNH 4IGDA 1GJ4H 1O2VA 1K9OE 2Q1JA 3M37A 1GI8B 1C4Y2 2CJIA 1UK3A 1O33A 2O8MA 4B2AA 3SW2B 1ACBE 3GY7A 2Z3EA 4B74A 2C8WB 2I6QA 1EP6A 4NIVA 3T5FH 3BTQE 2CMYA 1YPGH 1C1WH 1GMCG 1S0QA 1XUFA 1E0FD 1ETSH 3E3TA 3SUFA 1CO7E 2H2ZA 1QQ4A 2GTBA 1EX3A 3SQHE 2SNVA 4Q80A 2NU4E 4ABBA 3RXHA 1IQFA 5C1YA 1P2JA 4LK4A 1W12U 4GPGA 4DY7B 1HXFH 5J4QA 1SGFG 1DDJA 3A89A 2FOGA 3O8DA 3UR6A 2GV7A 1RS0A 1P03A 4IMZA 1OP8A 2BY9X 3LGVA 1INCA 1FLEE 1ANCA 2V3OH 2XBVA 3HATH 3TIUA 3S69A 1SLWB 4X1RU 1GHWH 1P3EA 1GI3A 4NIWA 3BIVH 1EKBB 4I8KA 3KHVA 4D9QA 4JYVH 2J94A 1SGIB 1MCVA 1SSXA 1TBQH 1K2I1 2H9HA 4YT7H 1BTZA 5C3NA 1N8OC 1TNLA 5JPMH 1GJ6A 1OWDA 3SV6A 1C5YB 2WPJS 5DKMA 3I29A 3GY2A 1SI5H 5EODA 1GBFA 1BTYA 3P8FA 1BHXF 2HPQH 4Y8YA 4AN7A 3H7OA 1EJAA 4F49A 3RMLH 3AAVA 1QL8A 4CRAA 1YGCH 1GHAF 1L4ZA 1C5ZB 2B0FA 1SPJA 1GHBG 4HTCH 4U2WA 1O5AB 3A87A 3GCOA 1NRNH 2C90B 4O03A 1DWBH 4K69A 1GJBB 1CGJE 1V2MT 4YZUA 4YOIA 1GBAA 1O3FA 1GPZA 4JYUH 2Z94A 1NRQH 2WPKS 3ZVBA 2ZDVH 3R3GB 3SU1A 1M9UA 1LHCH 1HAHH 5ESTE 5J4SA 4BXSA 3R0FA 1BT7A 1FUJA 1VJAU 1N8OB 2WPMS 4D7GA 1ZLRA 2AFQB 1ZPBA 4K60A 1GJCB 4BTUB 3GICB 2J2UA 3MO3A 1LHGH 2BTCE 3SHCH 3F9EA 3EYDA 3UTUH 3SJ9A 2CF9H 1H8IH 2VH6A 1TNJA 2Y81A 1YCPH 4NCYA 2A4QA 2ZTZA 3M61U 2P3FH 1F0UA 1Z6EA 5TCCA 1OXGA 3STJA 1Y59T 1XXDA 3DFJA 3ODFA 6ESTA 2QXGA 3KN2A 2GV6A 1XKAC 2BVRH 2PKAA 1MD8A 1LTOA 1AVXA 2UUJB 4Y11E 1IQHA 1PPGE 2ZFPH 2QF3A 3TNTA 4I32A 3A82A 5JBTA 1AI8H 1A46H 3RXDA 1Z8RA 1AMHA 1KSNA 1HV7A 3TJVA 3RMMH 2PWXA 1C2HA 1DSUA 4BAHB 1AFQB 2EI6A 4K1EA 2W3IA 1K1MA 2CN0H 1T7CA 4GCHG 1ELBA 1P06A 3M7TA 2FI4E 2GZ9A 2VVCA 3GDSA 1P8VC 1D4PB 1W7XH 1FY8E 1QJ1B 1CT4E 4WXIA 1G3BA 1W0ZU 2VWNA 2VGCC 1D9IA 4LXBH 4Y6DA 3KIDU 1XUKA 3VPKA 1UTPA 2JKHA 3BEFB 4AFQA 3B23B 3IG6B 3V0XA 2ZI2H 1SVPA 4A5TS 1QGFA 3ELAH 2TGPZ 1G3CA 2ZHDA 1IQMA 3RXGA 4MNXA 5LH8A 3EDXB 4H42U 2C93B 1TALA 3QX5H 1A5IA 2R2MB 1UK4A 2TBSA 1C1RA 1JOUB 4WXVA 2H9TH 1W11U 3SBKA 4CRFA 3RC5A 1BRAA 2FOCA 1MTVA 4INKA 1DXPA 2H5DA 4NG9H 4KELA 4MPWA 4CREA 3QK1A 1AB9C 2QA9E 3E8LA 3PB1E 4NIXA 1O2NA 2JH5D 3UOPA 1TGBA 1QJ6B 5GXPA 1LVMA 4FUEA 1CE5A 2FYQA 1LPGB 1P57B 4Y76A 2OC0A 2BOKA 1HJ8A 5C2ZA 1MTNC 1C5RA 1BZXE 2SGPE 1IOEA 1C1MA 1ZGIA 8ESTE 1UK2A 5K0HA 2D2DA 3RC4A 1L1JA 2A2XH 5E2OA 4XSKU 3CS7A 1QQUA 4Q7ZA 3RM0H 1YC0A 1GCDA 1QJ7B 1O2TA 1W13U 2VIDA 4YLUA 1V2WT 1GVKB 1J8AA 1O3EA 1UTMA 2Z3DA 3SQEE 4MG3A 1PPZA 3Q3XA 1D3PB 1GGDC 3FP8E 1O2HA 4FUJA 2ZC9H 6GCHG 3I77A 2F9OA 1H1BA 4K2YA 1V2JT 1MTWA 1FY5A 2PFEA 4MNVA 4B2BA 2ZEBA 1QNJA 1BTUA 3NPSA 2W7UA 1SQOA 3A7YA 1P2QA 3GYLB 1SGTA 1WTGH 1A4WH 4TPIZ 3UQOA 1H4WA 1WCZA 2ZF0H 4FUGA 2GCHF 4X6OA 4XFQA 3SV7A 3L6PA 2OXSA 2A0QB 2G4TA 2ZHEH 1KXEA 3VGCB 3P8OA 1GMDF 2A32A 1DSTA 3PWCA 4BOHA 2AERH 3T62A 2F9BH 1B7XB 4Q7YA 4FUIA 3Q77A 1O3DA 1PQ5A 5F8XA 3P8NA 3UWIA 3ZVDA 4JMYA 1GGDB 2OCVB 3NCLA 2GT7A 4ZUHA 1O3HA 3ZZAA 4A1XA 2H6MA 3IWMA 4FU9A 1MAXA 2Q6FA 6GCHF 3KQDA 1SC8U 3EGKH 1GI9B 1O32A 2SGFE 1TIOA 4VGCC 1SBWA 1MUEB 3KF2A 1OSSA 1BDAA 5E0JA 2W26A 4M7GA 1PPEE 3PMJA 1BBRK 5E0HA 4JK6A 4ISOA 2BLWA 1TPOA 2RDLA 1Y5AT 1C5MD 4ABHA 1TGNA 3U8OH 3N7OA 2FMJA 3UOUA 2ZTYA 2P16A 4LZ1H 3OX7U 3E0NB 5ETXA 3MO9A 2HNTF 2UWOA 1GHVH 1QA7A 3PLKA 2JH6D 4DURA 1TRMA 1SGDE 1TMUH 4MPVA 2IPHA 1Y8TA 1TE0A 1SLXB 4XDEA 2ANYA 1NESE 1CA0C 2RG3A 3F68H 1NROH 1AUJA 1MMJN 3RXBA 1PPFE 3RUOA 2YOLA 1MBMA 2G81E 1HCGA 4IN1A 3LJJA 1DWCH 4R0IA 1O2MA 2HRVA 1ELVA 5AFYH 2Q6GA 3LH3A 5FX5A 4JZEH 1GBHA 2J92A 4X1SU 2GVFA 3ZZBA 2RA0A 2D26C 1KLTA 3U1IB 1GBKA 3MI4A 4AG2A 2OC1A 1WTHD 1F5RA 4JZDH 2BMGB 1V2RT 3ZVEA 2QXHA 3FVFB 1FQ3A 2QY0B 1NRSH 3DUXH 3MU5A 4E06H 1HNEE 2TGAA 3PTBA 2ZCLP 4FUDA 1ESBA 1FY3A 3LU9B 4DG4A 2A31A 1C2DA 2Y7XA 5HXFA 1KDQB 2EI7A 1HYLA 3NWUA 3O8CA 1O2RA 2ZKSA 4X1QU 1GI1A 2C4FH 1ZYOA 2A5AA 4WMEA 1E35B 3GISB 1OPHB 2QV1A 3NUMA 1SG8B 1FI8A 3ATLA 4AFSA 3ATWA 4AORA 1GG6C 3ZVCA 5L30H 1A2CH 2P94A 4UD9H 1K1PA 1J14A 4DOQA 3ZZ8A 1QRZA 1W0YH 4MPUA 5PTPA 2WYJA 1QURH 1HAXB 1PYTC 5A2MH 1S0RA 3CENA 4AYYB 1CGIE 3Q3YA 1OWJA 2P95A 4ABJA 5F6MA 2VVVA 4FUFA 2FTMA 1DT2A 1BMMH 5DP6A 1YPHC 4O9VA 5HYOA 3GDUA 1EXFA 3LGWA 4MQAA 5A8YA 3LIWA 1YYY1 3UNSA 4WMDA 3E16B 1KDQA 1MTUA 2FP7B 1YBWA 1GBJA 1P3CA 2OQUA 3EA7A 5EXNA 5FAHA 1V3XA 4BAOB 2ANKH 3BG4C 3E90B 5F8TA 2QN5T 3LOXA 1GG6B 1BBRH 5T6DA 4AZ2B 4JK5A 1OKXA 5C1XA 4Y8XA 2OC8A 1S6HA 2G55A 3LT3A 2FOEA 4I8HA 1RTFB 2FYRA 1UTKA 2ZU2A 2FEQH 3FZDA 1ZGVA 3MNCA 1GJ8B 2G51A 4KTSA 3M7UA 4THNH 2R0LA 4CH8B 1S5SA 1SB1H 1GJ7B 1XUIA 3UPEA 1DXWA 1H9HE 1K1JA 1SL3A 1P2MA 3GY6A 3ZZ7A 1TB6H 5CMXH 1O5GH 2GKVE 2NU2E 1C5QA 5FPTA 1MZAA 3NXPA 2ZPSA 4DJZB 2H9EH 1Y5UT 5F03A 3MH7A 1LMWB 3RDZA 3BG4B 4A1VA 3S9CA 2Y80A 4OGXA 5E2PA 1UMAH 5DP7A 1H9LB 3D23A 1YKTA 1TABE 1NFXA 2BD5A 1C1VH 4WMFA 2FI5E 1RTKA 4FVDA 4UONA 2BDHA 1EZQA 5A09A 3MU1A 3LC3A 1C5PA 1ARCA 2WPLS 3M7QA 3TPIZ 3W94A 3P70B 3URCA 1C2JA 1CHOF 1UHBB 1N6XA 3A7VA 1ETRH 2OD3B 2WPIS 4B71A 1ZRKA 2BDGA 2J38A 2PUQH 2F9PA 4XBBA 4BAMB 4IS5A 4XOJA 1BITA 1BMNH 1D6RA 1C5LH 1DUEA 4GHTA 4UFFH 4YO9A 1HUTH 1DS2E 1G3DA 1UCYK 1AFEH 2ZP0H 1HDTH 2HGTH 5EG4A 1C2KA 5IDKA 2SGQE 5JYIA 2XCFA 2FIRH 2BD7A 2J95A 3FZZA 5H4IB 1LVBA 3SUEA 2A7JA 1TYNA 2OBQA 1RTLA 1NC6A 1TPPA 3TGKE 1PQAA 5DP5A 4E7RG 2BXTH 3SU2A 2BVXH 3O8RA 3MMGA 3RXIA 2CGAA 4TYDA 1GL1A 5A8ZA 2BZAA 1CU1A 4FU7A 1GHAG 1UHBA 3VEQB 5FHTA 4AFZA 7ESTE 1T8LA 4NA8A 5FXLA 4YLQH 1BRBE 1HAZB 2Y5FA 5JBBS 2K1QA 1PPBH 1TGSZ 1H9IE 1C1PA 1N1LA 1C1NA 3A7TA 4A1TA 2F9UA 2BY8X 1YLDA 2PLXA 4MVNA 1UTJA 3UNRA 1KTSB 3SJIA 4CRDA 1ID5H 1L1GA 3KEEA 5LPRA 1F2SE 1JRTA 3ZVGA 1TNGA 1T4UH 4X0WU 1EOLA 1OWKA 1WAYB 4Q7XA 1O2PA 2TGTA 3KQEA 2XC5A 4J2YB 1QBVH 3IITA 1IQGA 4O97A 1AZZA 2ZGBH 3PO1C 2PTCE 4CR9A 1O2YA 1QIXB 1AD8H 1LHEH 4Y0YE 3MH5A 4DCDA 4RKJB 4U30A 1DUAA 3QUMP 2PGBB 5EQSA 3RXAA 1TFXA 2PKAB 3GCTF 1IQKA 3VB6A 3TK6A 3K6YA 2EC9H 3RXSA 2ZG0H 2ZU1A 1QHRB 5IYTA 3SU3A 4B73A 3BEUA 4HI3A 5TCAA 2HALA 4JYTA 3BTGE 3ODDA 1DX5M 4U32A 1O2KA 2HPPH 1ZMJA 2R9PA 2FESH 1Y5BT 2VVUA 4RKOB 1O2QA 1Z1JA 2ANWA 3LJOA 1AFQC 3SOSA 1QL9A 3DHKH 2G00A 2VWLA 1OP2A 3PO1B 2BDBA 1P10A 1O2GH 3LDXH 3A7WA 3SGAE 1ZPZA 4XE4A 1P11E 1NU9A 1UCYH 2OP9A 3GY5A 2AIQA 2OQ5A 2HNTC 3RLWH 5DJ7A 5EQQA 1OOKB 2WV4A 4H4FA 1P2OA 1DVAH 1HAOH 4CH2B 2P93A 1AVWA 1HBTH 4AX9H 5DP9A 1O37A 2Z9JA 2PTNA 1AO5A 3RXMA 1YM0A 4JZ1A 5B6OA 2FOBA 3UREA 3DFLA 1F7ZA 1FPCH 2PR3A 2CV3A 2A7HA 1PYTD 1O3KA 2C8ZB 3RXPA 4JZIA 3V12A 1FPHH 1HB0B 3NKKA 8KME2 1K1NA 4BAQB 1EZXC 3HPTB 1A1RA 3ZZ3A 3MNSA 5GWZA 1OWEA 1WBGB 4KTUA 3RU4D 3RXTA 4D76A 1SLVB 8LPRA 1O2LA 3F9FA 5I46H 3KQCA 1F5LA 4H6SB 5K7RA 2C8XB 3MFJA 4NZQA 4ZMAH 2FZZA 2LPRA 1ABIH 1C5OH 3BF6H 2Z3CA 5DK1A 2ZO3H 2GGVB 1D3QB 2THFB 2DE9A 2A45B 2R3UA 2B8OH 2C8YB 1V2ST 2P3TB 2ZHQH 3D65E 6CHAB 3Q00A 3NK8A 1C5TA 3AASA 2IN2A 1L1NA 4NA9H 1PQ8A 2BD3A 2FX6A 4TWYA 4IBLH 3KNXA 3VFEA 1ZTJA 4ZH8A 3S9AA 2CXVA 4NIYA 1BB0B 1O0DH 2GZ8A 4KP0A 1VCWA 1ESTA 3RXOA 2GX4A 1T31A 2OUAA 1D3DB 3SNEA 3GYMA 2A7CA 3ATIA 4UFEH 1QY6A 1SGPE 1Z6JH 4FUBA 5HM9A 1GCTC 4Q2KA 5JB9S 1DM4B 1E34B 1BIOA 3BTHE 1P0SH 2D8WA 1FY1A 5GIBA 1TPSA 4HGCA 3SV2H 3T28A 3VB4A 2GCHG 4ZAEA 3TH3H 1EASA 1HJAB 2BDYA 4IMQA 2XNIA 1ANDA 1XVOA 3CP7A 1GMDG 1S84A 1ZOMA 3SUDA 1C5UA 3UWJH 3SI3H 5DGJA 3VGCC 1QFKH 4OS7A 2P3UB 3A81A 2NU3E 1O5BB 1ORFA 4Y71A 2V0BA 2BB4A 1G37A 1C9PA 5HM2A 1PPCE 3M5LA 1HLTH 4X6NA 1YP9A 1GJAB 4E05H 1KYNA 2VU8E 5EPYA 1QL7A 1UVOA 3BEIB 1C2LA 4YM9A 1AZ8A 1JMOH 1GCTB 2CHAC 1BTWA 5F8ZA 3W95A 1LKAA 1C5WB 2EEKA 2V3HH 2AMPA 1F0SA 1ELFA 1GHZA 1GJ9B 3PMHB 1FY4A 2A4OA 3A8AA 2ZDAH 3OYPA 4Y79A 1C2IA 2ZHWH 1TX7A 1ABJH 1P2KA 1OWHA 1C1QA 1U6QA 2F83A 1F5KU 2OBOA 3RU4E 4K8YA 4RSPA 1YPHE 1LKBA 1BJVA 1WV7H 1SQAA 5JB8S 1AQ7A 5C20A 1RJXB 3F1SB 3QTOH 3JZ1B 4I7YH 1GI0A 1SGQE 3T26A 4D7FA 1F0TA 1P02A 2PV9B 3A7XA 3OTJE 1GBBA 4AB9A 5FX6A 3SV9A 2CHAB 3OU0A 2XBXA 3S7KB 1Q3XA 1AN1E 1EB1H 3EE0B 1ELTA 1IQNA 2O8WA 5T6GA 3BIUH 3TK5A 2O9QA 3EAJA 1EAXA 4DIHH 2YNAA 1Z8GA 3T2NA 1V2NT 3K65B 3SNBA 2BY6X 1MQ5A 1FDPA 1P09A 3GCHB 3TGJE 1ZHRA 1AKSA 1QRWA 3BV9B 2JETB 2F9NA 2WV5A 5C1UA 1P9UA 1K1LA 4YESB
chains in the Genus database with same CATH superfamily
2O8TA 1SGCA 2PHBA 1JWTA 2ZGJA 2ZU4A 4NSYA 2J34A 4FXGH 2BLOA 4GHQA 4Z0KA 4DW2U 1GI7B 2BQWB 2XYAA 1ZSKA 1YY3A 3D62A 4NA7A 1X7AC 2J98A 2NU1E 1SMFE 4ABDA 1VZQH 3MO6A 5EQRA 2GCTB 4MDSA 3VB5A 3A7ZA 1Y3VA 3BTTE 3I78A 1DPOA 9ESTA 2SNWA 1V2KT 1W2KH 4OS6A 1WQVH 2A2QH 1TNIA 1TNHA 3EA8A 1CT0E 2K0QA 1DANH 4LZ4B 1O2WA 1C4V2 4F4OC 5BPEA 3K6ZA 5E0GA 4AG1A 1TNKA 2FOFA 1A0HB 4WY3A 4UFGH 1SHHB 3V3MA 1NTPA 1GJDB 1YPMH 5L6NH 2A5IA 5CDFE 3PMAB 3M5NA 1JRSA 2Z6BD 1JIMA 1F92A 3RXFA 4X2XA 1BBRE 1C1TA 2BDIA 1ELDE 2Y5HA 2AGIX 4I31A 4BTTB 1CGHA 3FN8A 2BX3A 3U1JB 1DWDH 5CHAB 3G01A 4ABAA 4B75A 2ZFFH 1ZMNA 1DLEA 4UEHH 1AE5A 1XX9A 1GVZA 2EA3A 3NRLA 4DVAU 1TRNA 5L2ZH 3HGNA 5EPNA 3D49H 1WDIA 1ZTKA 2PSYA 1CQQA 5JDUB 3QGJA 2A4RA 2PUXB 1OYTH 2G5NA 4DT4A 3SN8A 1NM6A 1CVWH 3F0PA 3TH4H 2VH0A 1QB9A 4AFUA 4O3TA 1C2EA 3MWIU 1LQDB 2R0KA 1TGTA 1O5CB 1W8BH 2YNBA 3DT0H 4ISLA 7GCHF 1O3JA 1LPKB 3HKJB 4Z6AH 5HGGA 4U01A 1A5HA 3SJ8A 1BMAA 2J97A 3SUGA 1K21H 1Z1IA 4O3UA 3ZV8A 4BTIB 3UAIC 4WF8A 3MU4A 1WOFA 1ZR0A 1MKXK 3B9FH 1IAUA 1V6DA 1KLJH 1G3EA 3SNAA 3EA9A 1AE8H 1UVUH 4MPXA 1C2FA 1GBLA 1VGCB 5KGOA 3ATMA 1GI6A 4KKDA 2ZDNA 5L2YH 1T8NA 5EJZA 1NFYA 2ZPRA 3EQ0H 3VG8A 1G32B 1E38B 3BTWE 5CE1A 4TY6A 1YLNA 2BQ6B 3ZZ5A 1G2LA 2F91A 3QWCH 2BD2A 1VCQA 5C5OA 4ZXXH 2JIZD 2ZQ2A 1TGCA 1TA2A 3TLOA 2KCYA 4OGYA 1B5GH 1CHOG 4E7NA 3BTEE 2ZCHP 3OE7D 4X6PA 4I33A 2ULLA 4ASHA 2BD8A 1S6FA 1A3BH 5DG6A 2ZQ1A 4X2WA 1O2XA 1S82A 2XWBI 6LPRA 2H5CA 1P12E 2V6NA 2RFKC 5IK2D 1GDNA 1IQIA 3GDVA 1SGRE 2PP6A 3M5OA 1VR1H 1MH0A 1O2OA 1KTTB 3CS0A 3FFGA 1TOCB 2A5KA 4FUCA 2FOHA 1G36A 1ZRBA 3FP6E 1AVGH 1Y3XA 3GOVB 1EZSC 4B76A 1BUIA 2WUCA 1Z8IB 3RXLA 2BXUH 4K5ZA 1KXDA 5HIYA 1YPEH 3KYFA 3B8JA 1XKBC 3WWFA 1WYKA 1ZMLA 2BDAA 5GJ4B 1GDUA 1Z71A 2ZTXA 3ZVAA 1FIZA 1QB6A 1BTHH 3M35A 3PLBA 1K1IA 2AMDA 4K3JA 3LPRA 1OWIA 3SGQE 3BSQA 1HAYB 1F0RA 4K8BA 2HNTE 4CHAC 3SI4H 3RC6A 1TPAE 1T4VH 5T1VA 3K2UA 1V2TT 3MHWU 1BRCE 1NRRH 1V2VT 2BM2A 2VIOA 4FVBA 2CK3D 2VB0A 5DP4A 3HGPA 1KLIH 3AW0A 1O3GA 2XCNA 3GY3A 1NT1A 1K0HA 2FWWA 2G52A 8GCHF 4TWWA 1SGFA 3GY4A 3ZZDA 2PKSB 1C1SA 2P8OC 2SFAA 4UDWH 3QO6A 4ABIA 5TJXA 1LDTT 1CBWB 4IC6A 4BNRA 1B0EA 1SFIA 2DUCA 3PYHA 1C5XB 5EGMA 1L4DA 4YOGA 2ODPA 1SOZA 1LVYA 1JXPA 1B0FA 5AF9H 1C5SA 1J15A 1YF4A 2GMTB 1DY9A 4ZKNU 4CHAB 2WINI 4ZKOU 1THPB 2ZDLA 1NRPH 1BRUP 5DP3A 3TJOA 3KQBA 1GBMA 5AHGH 2AMQA 1OYQA 1MKXH 1NFUA 3DA9B 1O3NA 1WSSH 4ZHLU 1VITG 1TRYA 3S0NA 3MNBA 1SQRA 3TK9A 3DD2H 2Y7ZA 1O2IA 3P92A 4WH8A 5GPIB 3UNQA 2GP9B 1C1OA 2XW9A 3E91A 2J5UA 3SJKA 3M5MA 3GCTG 2P8OB 1LCYA 2ODYB 2KAIA 4IW4E 3SNCA 2YMSC 1W7GH 5T6FA 2G4UA 3RMNH 1UTLM 1O30A 1BA8B 3SU5A 2ANMH 3ITIA 1RRKA 3MNXA 3RLYH 2BD4A 1A7SA 1S81A 1J17T 2JJ1D 2GT8A 4YXWD 3SZNA 3F9HA 1TLDA 3UFAA 4ISIH 4MLFB 4B1TA 1UCYE 1V2QT 1EAWA 2Z9LA 3U9AH 1ELCA 1EPTA 1KXFA 1OP0A 1MBQA 1T8OA 2XTTB 2FTLE 3F3BA 3O8BA 1K28D 4ZKSU 1ANEA 2ZFSA 3ZZ6A 1LVOA 4ESTE 2WUBA 3E0PB 1IQLA 1HGTH 1KXCA 1G2MA 2WPDD 1O3IA 1HAVB 1QB1A 3ZYEA 1VITF 1GMCF 5EXLA 4DIIH 4FUHA 3A83A 2EI8A 3TVJB 2YMSB 2Z9IA 1O3MA 1VJ9U 2ZNKH 4Q63A 3RXRA 3E1XB 3V7TA 1FN6A 2NWNA 4OS1A 4AGKA 1T32A 1THSH 3VXFH 1PPHE 2ZZUH 4X1PU 2OINA 3LONA 1QBNA 1ETTH 1TX6A 1O5EH 1GBIA 1MD7A 2VIPA 1UTOA 1O2ZA 1GVLA 2B9LA 1A61H 1MQ6A 1TWXB 2XWAA 4X2YA 1D3TB 3TH2H 1O38A 3M3VA 2ESTE 2BD9A 1LPZB 1TQ7B 2TRMA 4ZHAA 1BCUH 3U69H 3ZYDA 2VNTA 3AVZA 2GDDA 3HK3B 4WH6A 4OS4A 1GWAA 1AHTH 1IHSH 2P59A 1NN6A 2BLQA 3F2HA 5SGAE 1P2IA 3DSOA 5EJ1A 1HAVA 2HOBA 3TGIE 2ASUB 2FPZA 2ZIQH 5DSFA 4X8VH 5EW1H 3ATKA 3M3SA 3RM2H 1TX8A 3C27B 1MTSA 1A0JA 2AEIH 7KMEH 2J9NA 1O2UA 1YWUA 1Y3YA 4RN6A 6CHAC 3MTYA 1UO6A 4K1SA 1NY22 1HXEH 1NFWA 3T25A 1DITH 4CRGA 1ZJKA 2BYAX 1BTXA 1YPKH 5A8XA 4BXWA 1DLKB 2QYIA 4ABFA 4D9RA 4A92A 4Y10E 1GHBF 1C1UH 1ELGA 3LGUA 3SU4A 1EJMA 1H8DH 1C2GA 2PGQB 2UWPA 2H1UA 1TBRH 4NFFA 2KM0A 2AH4X 1C5VA 1TAWA 3MH6A 2XC4A 1OS8A 1S83A 2UWLA 2ZFTA 4FU8A 3SHAH 2XXLA 1EP5A 2ODQA 5LGOA 3H5CB 1ELAA 1GI5A 3MU0A 3ZZCA 1Y3UA 2A1DB 2NU0E 2JH0D 3MU8A 4Y7AA 1DY8A 1KXBA 3OSYA 1HJAC 1O39A 5EU8A 3A88A 4ABEA 4SGAE 2W5EA 2UUYA 1IQJA 1DWEH 4R8TB 1NZQH 4TPYA 3QTVH 1XXFA 2GJGA 3BTDE 4D8NA 1P9SA 2CF8H 2W7SA 2G5VA 3VB7A 1ZJDA 2UUFB 2W6ID 4WVPE 2QF0A 3SU6A 3N7DA 2SGAA 2Z7FE 1ZHPA 2HLCA 3PTNA 1HAPH 4NWKA 1MCTA 2FS9A 2ZGXH 3SGBE 2FDAA 2B7DH 3LGYA 5GDSH 3T29A 1ARBA 2QXJA 2PW8H 4H6TA 1HRTH 3ZZ9A 2BX4A 3P8GA 3SU0A 3FAOA 3UR9A 2F9VA 2BY7X 4BANB 1SLUB 2IJOB 3MH4A 5FBIA 1O3PB 2ZWLH 3DSPA 4CRCA 1O3AA 1BQYA 2QGRA 1CHGA 3SORA 1JIRA 1MU6B 4GCHF 5E8EH 3KCGH 2KFWA 2STBE 3AAUA 1C4U2 1GBDA 1UTNA 2VGCB 2ZHFH 1ZPCA 2ZCKP 3ESTA 3FP7E 1YPLH 3HK6B 1E37B 5GCHG 3T27A 1CSOE 4ISHH 2AYWA 3F6UH 1BTPA 3TITA 3A8DA 5C0TA 5AFZH 3PV2A 1NPMA 1L0ZA 2QCYA 2ZFQH 1FMGA 2XBWA 2QAAA 1XUGA 1N6YA 4ZROA 1VCPA 1ZZZA 1XMNB 2IOTA 3F0OA 1MU8B 5C67A 1O2SA 2GDEH 1ANBA 4X8TH 3TJNA 1NS3A 1HAGE 4GAWA 4ACBA 1FV9A 4WJG2 1FJSA 3QZQA 4J1YA 4DGJA 2GZ7A 4YT6H 1XVMA 1P2NA 1A5GH 2ZU3A 1AB9B 2ILNA 1O3CA 4I8LA 2FLBH 1O36A 1SR5C 1AKSB 1QR3E 3GCHC 1NU7B 2QXIA 4OS5A 2ZGCA 4WWYA 2JETC 2STAE 1AWFH 1P05A 3EE7A 3QGNB 3PV4A 2FLRH 9LPRA 1MTNB 1P01A 5GCHF 2Y5GA 1AU8A 3UUZA 2Y82A 5DP8A 1PQ7A 4CBOA 3ZZ4A 1YCPM 1W3CA 2BY5X 4K1TA 1Q2WA 2ALPA 1GDQA 2J98B 2Q6DA 5A0CA 5G4BA 3HKIB 1J16A 1O5DH 2L74A 2AHME 3A8BA 2W6JD 4B6EA 4I8JA 4DT7B 2GCTC 2M5TA 1O3OA 1PFXC 3URDA 5HKKD 3AW1A 3UIRA 3RP2A 2I6SA 1GI2A 3UQVA 2EY4C 1GHYH 2YMSD 4YTAA 3SV8A 2PSXA 1AWHB 1OX1A 4INHA 2FO9A 2FS8A 1HAIH 5FBEA 4I8GA 1HFDA 4X8UH 1ZSLA 3WWBA 1COWD 1SGEE 5FPSA 1QTFA 4A6LA 3U98H 3PM3A 4UE7H 4CBNA 3RMOH 1WQSA 1DFPA 2FXRA 1VITH 3SO3A 2FOAA 1Q31A 1LHFH 4CRBA 1FIWA 2ZDMA 3OAAD 4UFDH 1GJ5H 3M36A 2ZPQA 1TMBH 4NGAH 1MKWK 3LGTA 4GUXA 2AIPA 1MAYA 1Z7KA 1T8MA 2ALVA 3ENSB 1BMLA 3C1KA 5CHAC 4ABGA 5EW2H 1UVSH 1SGYE 1DICA 2OLGA 4KTCA 4QT8C 1DOJA 3E6PH 5HMAA 4MTBA 3LH1A 4KGAA 4INLA 2HWLB 3RXJA 2SGEE 4TSFD 4LOYH 1RIWC 4NZLA 1RGQA 2ZGHA 3PROA 2QC2A 2ZFRH 3VXEH 4ZXYH 1EUFA 3KYGA 3KL6A 1AGJA 3TJUA 3GCNA 1YLCA 7GCHG 3S9BA 3K9XB 4VGCB 1RXPA 3V13A 5JBAS 1GHXH 2FOMB 1SFQB 2C3SA 4AYVB 1TMTH 1UVPA 1W10U 3H7TA 4X8SH 3L33A 3LKWA 3OEED 4Z1MD 3TU7H 1DE7H 2LNCA 4X6MA 2BHGA 1TA6A 3P95A 2O8UA 1AIXH 1TONA 2BQ7B 2O8LA 2VIQA 5C5NA 4OS2A 4AGJA 4Y7BA 1QA0A 1FAXA 5ESBA 1FZZA 1XM1A 4XD7D 1A0LA 3A84A 1NO9H 1VGCC 1TOMH 2AGGX 2SGDE 2VJ1A 4FETA 3SNDA 1SOTA 1V2PT 2XC0A 5KEDA 1E1QD 3A85A 1RIWB 1WU1A 2VWOA 3MOCA 4A7IB 1CA0B 1C2MA 5LPFA 4XBCA 2F3CE 2ZA5A 1ESAA 1A3EH 3KQ5A 3TNSA 5DPAA 2AGEX 4ZHMU 2KX4A 2OTVA 1FN8A 3PWBA 2A4GA 3P17H 4PROA 5AVDA 1EATA 2DE8A 2VINA 1AUTC 4GVUA 4MNWA 4B2CA 3RXUA 1IHTH 2RA3A 1RD3B 3QDZB 3LC5A 4RT0A 2OC7A 1LQEA 3BTFE 1C5NH 1EB2A 2AS9A 1UTQA 2QIQA 1O31A 1V2UT 3U8RH 1S85A 3NZIA 3ZVFA 4HZHA 3JZ2B 1EOJA 1GBTA 2KR7A 1IQEA 2J4IA 3OY6U 1O5FH 2HLDD 4MNYA 3A8CA 1C9TA 1Y3WA 2WYGA 1KIGH 1UVTH 2ZU5A 4Y8ZA 1K22H 1O35A 5DO4H 2L6OA 4NWLA 2BLVA 4P00A 2TGDA 3MYWA 4BAKB 4X1NU 1O3BA 1EQ9A 1SGNE 1TQ0B 2RCEA 3RXCA 3RXKA 2ZDKA 4YOJA 1GMHG 2D1JA 1TBZH 1ZTLA 3A80A 3F9GA 3Q3KA 1JBUH 3PMBB 3U8TH 1FNIA 3BG8A 3UY9A 1EAUA 1MZDA 3PLPA 2FI3E 3M3TA 4CR5A 1QBOA 5FCKA 1ELEE 3WY8A 3A86A 1QCPA 1GL0E 5T3HA 1LHDH 1PJPA 4AB8A 2B5TB 2Z9KA 4AOQA 3P6ZB 3L3TA 2V35A 3RXEA 1MKWH 1BHXB 1THRH 3KGPA 2BVSH 1EAIA 2UUKB 1J9CH 8GCHG 5C94A 2HVXA 5A0AE 1GBCA 3S7HB 2XRCA 3RXVA 4Y0ZE 1SHYA 1KXAA 1GI4A 2BDCA 5A0BA 2PKSC 3QZRA 1HIAB 5I25A 3F2GA 1ZSJA 1UJ1A 1FXYA 4XBDA 1O3LA 2W3KA 1G9IE 2XBYA 3STIA 5JBCS 1CBWC 1FONA 1GMHF 1Z8JB 4X2VA 1HPGA 3BTME 4JCNA 1CA8B 1LO6A 1D6WA 2TPIZ 3DSGA 3LGIA 1EZUC 3RU4T 1E36B 1EPTC 2FM2A 2G8TA 5BRRE 2FX4A 4GSOA 5DN6D 2GMTC 2RDEA 2VIVA 1EJNA 1K1OA 2ZECA 1L2EA 1P04A 3QN7A 4HFPB 4ISNA 5EXMA 2GD4B 1O2JA 3GY8A 3Q76A 1BOQA 1W14U 7LPRA 2QF4A 1E1RD 3BN9A 3VB3A 1BJUA 1KY9A 2BZ6H 4JZFH 4IN2A 1O34A 1HJ9A 2VWMA 4SGBE 2Y6TA 2KAIB 1GBEA 1CT2E 1YPJH 5FL7D 2VIWA 5ABWA 2WPHS 4NSVA 2FODA 1V2OT 5LPEA 1HIAA 4TY7A 1FAKH 4NFEA 3SJOA 4GLYA 4IC5A 1G30B 5EOKA 5FCRA 3ZV9A 1XUHA 1YCPK 1AY6H 3FANA 2BOHB 3QLPH 2R2WU 3RXQA 5FPYA 1V2LT 2Z9GA 1ZHMA 1SQTA 2TIOA 3OY5U 4ZKRU 1XUJA 1EPTB 1RFNA 1QRXA 3BTKE 2XOKD 2R3YA 1WUNH 2LP6A 4IGDA 1GJ4H 1O2VA 1K9OE 2Q1JA 3M37A 1GI8B 1C4Y2 2CJIA 1UK3A 1O33A 1VKYA 2O8MA 4B2AA 3SW2B 1ACBE 3GY7A 2Z3EA 4B74A 2C8WB 2I6QA 1EP6A 4NIVA 3T5FH 3BTQE 2CMYA 1YPGH 1C1WH 1GMCG 1S0QA 1XUFA 1E0FD 1ETSH 3E3TA 3SUFA 1CO7E 2H2ZA 1QQ4A 2GTBA 1EX3A 3SQHE 2SNVA 4Q80A 2NU4E 4ABBA 3RXHA 1IQFA 5C1YA 1P2JA 4LK4A 1W12U 4GPGA 4DY7B 1HXFH 5J4QA 1SGFG 1DDJA 3A89A 2FOGA 3O8DA 3UR6A 2GV7A 1RS0A 1P03A 4IMZA 1OP8A 2BY9X 3LGVA 1INCA 1FLEE 1ANCA 2V3OH 2XBVA 3HATH 3TIUA 3S69A 1SLWB 4X1RU 1GHWH 1P3EA 1GI3A 4NIWA 3BIVH 1EKBB 4I8KA 3KHVA 4D9QA 4JYVH 2J94A 1SGIB 1MCVA 1SSXA 1TBQH 1K2I1 2H9HA 4YT7H 1BTZA 5C3NA 1N8OC 1TNLA 5JPMH 1GJ6A 1OWDA 3SV6A 1C5YB 2WPJS 5DKMA 3I29A 3GY2A 1SI5H 5EODA 1GBFA 1BTYA 3P8FA 1BHXF 5EIYA 2HPQH 4Y8YA 4AN7A 3H7OA 1EJAA 4F49A 5B6LA 3RMLH 3AAVA 1QL8A 4CRAA 1YGCH 1GHAF 1L4ZA 1C5ZB 2B0FA 1SPJA 1GHBG 4HTCH 4U2WA 1O5AB 3A87A 3GCOA 4B6FA 1NRNH 2C90B 4O03A 1DWBH 4K69A 1GJBB 1CGJE 1V2MT 4YZUA 5EJLA 4YOIA 1GBAA 1O3FA 1GPZA 4JYUH 2OK5A 2Z94A 1NRQH 1WXRA 3PRBA 2WPKS 1MABB 3ZVBA 2ZDVH 3R3GB 3SU1A 1M9UA 1LHCH 1HAHH 5ESTE 5J4SA 4BXSA 3R0FA 1BT7A 1FUJA 1VJAU 1N8OB 2WPMS 4D7GA 1ZLRA 2AFQB 1ZPBA 4K60A 1GJCB 4BTUB 3GICB 3OEHD 2J2UA 3MO3A 1LHGH 2BTCE 3SHCH 3F9EA 3EYDA 3UTUH 3SJ9A 2CF9H 1H8IH 2VH6A 1TNJA 2Y81A 1YCPH 4NCYA 2A4QA 2ZTZA 3M61U 2P3FH 1F0UA 1Z6EA 5TCCA 1OXGA 3F2FA 3STJA 1Y59T 1XXDA 3DFJA 3ODFA 6ESTA 2QXGA 3KN2A 2GV6A 1XKAC 2BVRH 2WV9A 2PKAA 1MD8A 1LTOA 1AVXA 2UUJB 4Y11E 1IQHA 1PPGE 2ZFPH 2QF3A 3TNTA 4I32A 3A82A 5JBTA 1AI8H 1A46H 3RXDA 1Z8RA 1AMHA 1KSNA 1HV7A 3TJVA 1UW7A 3RMMH 2PWXA 4F48B 1C2HA 1DSUA 4BAHB 1AFQB 2EI6A 4K1EA 2W3IA 1K1MA 2CN0H 1T7CA 4GCHG 1ELBA 1P06A 3M7TA 2FI4E 2GZ9A 2VVCA 3GDSA 1P8VC 1D4PB 1W7XH 1FY8E 1QJ1B 1CT4E 4WXIA 1G3BA 1W0ZU 2VWNA 2VGCC 1D9IA 4LXBH 4Y6DA 3KIDU 1XUKA 3VPKA 1UTPA 2JKHA 3BEFB 4AFQA 3B23B 3IG6B 3V0XA 2ZI2H 1SVPA 4A5TS 1QGFA 3ELAH 2TGPZ 1G3CA 2ZHDA 1IQMA 3RXGA 2QE7D 2QF5A 4MNXA 5LH8A 3EDXB 4H42U 2C93B 1TALA 3QX5H 1A5IA 2R2MB 1UK4A 2TBSA 1C1RA 1JOUB 4WXVA 4RT1A 2H9TH 1W11U 3SBKA 4CRFA 1S6LA 3RC5A 1BRAA 2FOCA 1MTVA 4INKA 1DXPA 2H5DA 4NG9H 4KELA 4MPWA 4CREA 3QK1A 1AB9C 2QA9E 3E8LA 3PB1E 4NIXA 3ZIAD 1O2NA 2JH5D 3UOPA 1TGBA 1QJ6B 5GXPA 1LVMA 4FUEA 1CE5A 2FYQA 1LPGB 1P57B 4Y76A 4ZCNA 2OC0A 2BOKA 1HJ8A 5C2ZA 1MTNC 1C5RA 1BZXE 2SGPE 1IOEA 1C1MA 1ZGIA 8ESTE 1UK2A 3MQKC 5K0HA 2D2DA 3RC4A 1L1JA 2A2XH 2EQNA 3W1EA 5E2OA 4XSKU 3CS7A 1QQUA 4Q7ZA 3RM0H 1YC0A 1GCDA 1QJ7B 1O2TA 1W13U 2VIDA 4YLUA 1V2WT 1GVKB 1J8AA 1O3EA 1UTMA 2Z3DA 3SQEE 4MG3A 1PPZA 3Q3XA 3U28C 1D3PB 1GGDC 1E79D 3FP8E 1O2HA 4FUJA 2ZC9H 6GCHG 3I77A 2F9OA 1H1BA 4K2YA 1W0KD 1V2JT 2KCPA 1MTWA 1FY5A 3N7EA 2PFEA 4MNVA 2WSSD 4B2BA 2ZEBA 1QNJA 1BTUA 3NPSA 2W7UA 1SQOA 3GS9A 3A7YA 2IPQX 1P2QA 3GYLB 1SGTA 3UB0A 2JJ2D 1WTGH 1A4WH 4TPIZ 3UQOA 4Q4LA 1H4WA 1WCZA 2ZF0H 4FUGA 2GCHF 4X6OA 4XFQA 3SV7A 3L6PA 2OXSA 2A0QB 2G4TA 2ZHEH 1KXEA 3VGCB 3P8OA 1GMDF 2A32A 1DSTA 3PWCA 4BOHA 2AERH 3T62A 2F9BH 1B7XB 4Q7YA 4FUIA 3Q77A 5C0UA 1O3DA 1PQ5A 5F8XA 3P8NA 3UWIA 3ZVDA 4JMYA 1GGDB 2OCVB 3NCLA 2GT7A 4ZUHA 1O3HA 3ZZAA 4FOUC 4A1XA 2H6MA 4P02A 3IWMA 4FU9A 1MAXA 2Q6FA 6GCHF 3KQDA 1BMFD 1SC8U 3EGKH 1GI9B 1O32A 2SGFE 1TIOA 4VGCC 1SBWA 1MUEB 3KF2A 1OSSA 1BDAA 5E0JA 2W26A 4M7GA 1PPEE 3PMJA 1BBRK 5E0HA 4JK6A 4ISOA 2BLWA 1TPOA 2RDLA 1Y5AT 1C5MD 4ABHA 1TGNA 3U8OH 3N7OA 2FMJA 3UOUA 2ZTYA 2P16A 4LZ1H 3OX7U 3E0NB 5ETXA 3MO9A 2HNTF 2UWOA 1GHVH 1QA7A 3PLKA 5KECA 2JH6D 4DURA 1TRMA 1SGDE 2M2AA 1TMUH 4MPVA 2IPHA 1Y8TA 1TE0A 1SLXB 4XDEA 2ANYA 1NESE 1CA0C 2RG3A 3OTPA 3F68H 4ASUD 1NROH 1AUJA 1MMJN 3RXBA 1PPFE 3RUOA 2YOLA 1MBMA 2G81E 1HCGA 1EFRD 4IN1A 3LJJA 1DWCH 4R0IA 1O2MA 2HRVA 4RI0A 1ELVA 5AFYH 2Q6GA 3LH3A 4TT3D 5FX5A 4JZEH 1GBHA 2J92A 4X1SU 2GVFA 3ZZBA 2RA0A 2D26C 1KLTA 3U1IB 1GBKA 3MI4A 4AG2A 2V3MA 3H09A 2OC1A 1WTHD 1F5RA 4JZDH 2BMGB 1V2RT 3ZVEA 2QXHA 3FVFB 1NBMD 1FQ3A 2QY0B 1NRSH 3DUXH 3MU5A 4E06H 1HNEE 2TGAA 3PTBA 2ZCLP 4FUDA 1ESBA 1FY3A 3LU9B 4DG4A 2A31A 1C2DA 2Y7XA 5HXFA 1KDQB 2EI7A 1HYLA 3NWUA 3O8CA 4F55A 1O2RA 2ZKSA 4X1QU 1GI1A 2C4FH 1ZYOA 2A5AA 4WMEA 1E35B 1KMHB 3GISB 1OPHB 2QV1A 3NUMA 1SG8B 1FI8A 3ATLA 2VBCA 3ATWA 5CHBA 4AFSA 4AORA 1GG6C 3ZVCA 5L30H 1A2CH 2P94A 4UD9H 1K1PA 1J14A 4DOQA 3ZZ8A 1QRZA 1W0YH 4MPUA 5PTPA 2WYJA 1QURH 1HAXB 1PYTC 5A2MH 1S0RA 3CENA 2IJD1 4AYYB 1CGIE 3Q3YA 1OWJA 2P95A 4ABJA 5F6MA 2VVVA 4FUFA 2FTMA 1DT2A 1BMMH 5DP6A 1YPHC 4O9VA 5HYOA 3GDUA 1EXFA 3LGWA 4MQAA 5A8YA 3LIWA 1YYY1 3UNSA 4WMDA 3E16B 1KDQA 1MTUA 2FP7B 1FX0B 1YBWA 1GBJA 4XRNA 1P3CA 2OQUA 3EA7A 5EXNA 5FAHA 1V3XA 4BAOB 2ANKH 3BG4C 3E90B 5F8TA 2QN5T 3LOXA 1GG6B 3SYJA 1BBRH 5T6DA 4AZ2B 4JK5A 1OKXA 5C1XA 4Y8XA 2OC8A 1S6HA 2G55A 3LT3A 2FOEA 4I8HA 1RTFB 2FYRA 1UTKA 5C17A 2ZU2A 2FEQH 3FZDA 1ZGVA 3MNCA 1GJ8B 2F4LA 2G51A 4KTSA 3M7UA 4THNH 2R0LA 4CH8B 1S5SA 1SB1H 1GJ7B 1XUIA 3UPEA 1DXWA 1H9HE 1K1JA 1SL3A 1P2MA 3GY6A 3ZZ7A 1TB6H 5CMXH 1O5GH 2GKVE 2NU2E 1C5QA 5FPTA 1MZAA 3NXPA 2ZPSA 4DJZB 2H9EH 1Y5UT 5F03A 3MH7A 1LMWB 3FKSD 2KZ4A 3RDZA 3BG4B 4A1VA 3S9CA 1NBME 2Y80A 4OGXA 5E2PA 1UMAH 5DP7A 1H9LB 3D23A 1YKTA 1TABE 1NFXA 2BD5A 1C1VH 4WMFA 3PV5A 2FI5E 1RTKA 4FVDA 4UONA 2BDHA 1EZQA 5A09A 3MU1A 3LC3A 1C5PA 1ARCA 2WPLS 3M7QA 3TPIZ 3W94A 3P70B 3URCA 1C2JA 1CHOF 1UHBB 1N6XA 3A7VA 1ETRH 2OD3B 2WPIS 4B71A 1ZRKA 2BDGA 2J38A 2PUQH 2F9PA 1SKYE 4XBBA 4BAMB 3PRDA 4IS5A 4XOJA 1BITA 1BMNH 1D6RA 1C5LH 1DUEA 4GHTA 4UFFH 4YO9A 1HUTH 1DS2E 3SZEA 1G3DA 1UCYK 1AFEH 2ZP0H 1HDTH 3FOAA 2HGTH 5EG4A 1C2KA 5IDKA 2F43B 2SGQE 5JYIA 2XCFA 2FIRH 2BD7A 2J95A 3FZZA 5H4IB 1LVBA 2KCOA 3SUEA 2A7JA 1TYNA 2OBQA 1RTLA 1NC6A 1TPPA 3TGKE 1PQAA 5DP5A 4M9FA 4E7RG 2BXTH 3SU2A 2BVXH 3O8RA 3MMGA 3RXIA 2CGAA 4TYDA 1GL1A 5A8ZA 2BZAA 1CU1A 4FU7A 1GHAG 1UHBA 3VEQB 5FHTA 4AFZA 7ESTE 1T8LA 4NA8A 5FXLA 4YLQH 1BRBE 1HAZB 2Y5FA 5JBBS 2K1QA 1PPBH 1TGSZ 1H9IE 1C1PA 1N1LA 1C1NA 3A7TA 3AK5A 3FO8D 4A1TA 2F9UA 2BY8X 1YLDA 5F53A 2PLXA 4MVNA 1UTJA 3UNRA 1KTSB 3SJIA 4CRDA 1ID5H 1L1GA 3KEEA 5LPRA 1F2SE 1JRTA 3ZVGA 4I86A 1TNGA 1T4UH 4X0WU 1EOLA 1OWKA 1WAYB 5GNDA 4Q7XA 1O2PA 2TGTA 3KQEA 2XC5A 4J2YB 1QBVH 3IITA 1IQGA 4O97A 1AZZA 2ZGBH 3PO1C 2PTCE 4CR9A 1O2YA 1H8ED 1AD8H 1LHEH 1QIXB 4Y0YE 3MH5A 4DCDA 2K8IA 4RKJB 4U30A 1DUAA 3QUMP 2PGBB 5EQSA 3RXAA 1TFXA 2PKAB 3GCTF 1IQKA 3VB6A 3TK6A 3K6YA 2EC9H 3RXSA 2ZG0H 2ZU1A 1QHRB 5IYTA 3SU3A 4B73A 4AC9A 3BEUA 4HI3A 5TCAA 2HALA 4JYTA 3BTGE 3ODDA 1DX5M 4U32A 1O2KA 2HPPH 1ZMJA 2R9PA 2FESH 1Y5BT 2VVUA 2JDID 4RKOB 1O2QA 1Z1JA 1H8HD 2ANWA 3LJOA 1AFQC 3SOSA 1QL9A 3DHKH 2G00A 2VWLA 1OP2A 3PO1B 2BDBA 1P10A 1O2GH 3LDXH 3A7WA 3SGAE 1ZPZA 4XE4A 1P11E 1NU9A 1UCYH 2OP9A 4OM9A 3GY5A 2AIQA 2OQ5A 2HNTC 3RLWH 5DJ7A 5EQQA 1OOKB 2WV4A 4H4FA 1P2OA 1DVAH 1HAOH 4CH2B 2P93A 1AVWA 1HBTH 4AX9H 5DP9A 1O37A 2Z9JA 2PTNA 1AO5A 3RXMA 1YM0A 4JZ1A 5B6OA 2FOBA 3UREA 3DFLA 1F7ZA 1FPCH 2PR3A 2CV3A 2A7HA 1PYTD 1O3KA 2C8ZB 3RXPA 4JZIA 3V12A 1FPHH 1HB0B 3NKKA 8KME2 1K1NA 4BAQB 1EZXC 3HPTB 1A1RA 3ZZ3A 3MNSA 5GWZA 2XNDD 1OWEA 1WBGB 4KTUA 3RU4D 3RXTA 4D76A 1SLVB 8LPRA 1O2LA 3F9FA 5I46H 3KQCA 2KCAA 1F5LA 4H6SB 5K7RA 2C8XB 3MFJA 4NZQA 4ZMAH 2FZZA 2LPRA 1ABIH 1C5OH 3BF6H 2Z3CA 5DK1A 2ZO3H 2GGVB 1D3QB 2THFB 2DE9A 2A45B 2R3UA 2B8OH 4ACAA 2C8YB 1V2ST 2P3TB 2ZHQH 3D65E 6CHAB 3Q00A 3NK8A 1C5TA 2V7QD 3AASA 2IN2A 1L1NA 4NA9H 1PQ8A 2BD3A 2FX6A 4TWYA 4IBLH 3KNXA 3VFEA 1ZTJA 4ZH8A 3S9AA 2CXVA 4NIYA 1BB0B 1O0DH 2GZ8A 4KP0A 1VCWA 1ESTA 3RXOA 2GX4A 1T31A 2OUAA 1D3DB 3SNEA 3GYMA 2A7CA 3ATIA 4UFEH 1QY6A 1SGPE 1Z6JH 4FUBA 5HM9A 1GCTC 4Q2KA 5JB9S 1DM4B 1E34B 1BIOA 3BTHE 1P0SH 2D8WA 1FY1A 5GIBA 1TPSA 4HGCA 3SV2H 2HVYB 3T28A 3VB4A 2GCHG 4ZAEA 3TH3H 1EASA 1HJAB 2BDYA 4IMQA 2XNIA 1ANDA 1XVOA 3CP7A 1GMDG 1S84A 1ZOMA 3SUDA 1C5UA 3UWJH 3SI3H 5DGJA 3VGCC 1QFKH 4OS7A 2P3UB 3A81A 2WZQA 2NU3E 1O5BB 3DCLA 3WW7A 1ORFA 2LELA 2WHXA 4Y71A 2V0BA 2BB4A 1G37A 1C9PA 5HM2A 1W0JD 1PPCE 3M5LA 1HLTH 4X6NA 1YP9A 1GJAB 4E05H 1KYNA 2VU8E 5EPYA 1QL7A 1UVOA 3BEIB 1C2LA 4YM9A 1AZ8A 1JMOH 1GCTB 1OHHD 1BTWA 2CHAC 5F8ZA 3W95A 1LKAA 1C5WB 2EEKA 2V3HH 2AMPA 1F0SA 1ELFA 1GHZA 1GJ9B 3OFND 5HIZA 3PMHB 1FY4A 2A4OA 3A8AA 2ZDAH 3OYPA 4Y79A 1C2IA 2ZHWH 1TX7A 1ABJH 1P2KA 1OWHA 1C1QA 1U6QA 2F83A 1F5KU 2OBOA 3RU4E 4K8YA 4RSPA 1YPHE 1LKBA 1BJVA 1WV7H 1SQAA 5JB8S 1AQ7A 5C20A 1RJXB 3F1SB 3QTOH 3JZ1B 4I7YH 1GI0A 1SGQE 3T26A 4D7FA 1F0TA 1P02A 2PV9B 3A7XA 3OTJE 1GBBA 4AB9A 5FX6A 3SV9A 2CHAB 3OU0A 2XBXA 3S7KB 1Q3XA 1AN1E 1EB1H 3EE0B 1ELTA 1IQNA 2O8WA 5T6GA 3BIUH 3TK5A 2O9QA 1QZ8A 3EAJA 1EAXA 4DIHH 2YNAA 1Z8GA 3T2NA 1V2NT 3K65B 3SNBA 2BY6X 1MQ5A 1FDPA 1P09A 3N99A 3GCHB 3TGJE 1ZHRA 1AKSA 4HG6A 1QRWA 3CNRA 3BV9B 2JETB 2F9NA 2WV5A 5C1UA 1P9UA 1K1LA 4YESB
chains in the Genus database with same CATH topology
2O8TA 1SGCA 2PHBA 1JWTA 2ZGJA 2ZU4A 4NSYA 2J34A 4FXGH 2BLOA 4GHQA 4Z0KA 4DW2U 1GI7B 2BQWB 2XYAA 1ZSKA 3D62A 4NA7A 1X7AC 2NU1E 1SMFE 4ABDA 1VZQH 3MO6A 5EQRA 2GCTB 4MDSA 3VB5A 3A7ZA 1Y3VA 3BTTE 3I78A 1DPOA 9ESTA 2SNWA 1V2KT 1W2KH 4OS6A 1WQVH 2A2QH 1TNIA 1TNHA 3EA8A 1CT0E 4LZ4B 1DANH 1O2WA 1C4V2 4F4OC 5BPEA 3K6ZA 5E0GA 4AG1A 1TNKA 2FOFA 1A0HB 4WY3A 4UFGH 1SHHB 3V3MA 1NTPA 1GJDB 1YPMH 5L6NH 2A5IA 3PMAB 3M5NA 1JRSA 2Z6BD 1JIMA 1F92A 3RXFA 4X2XA 1BBRE 1C1TA 2BDIA 1ELDE 2Y5HA 2AGIX 4I31A 4BTTB 1CGHA 2BX3A 3U1JB 1DWDH 5CHAB 3G01A 4ABAA 4B75A 2ZFFH 1ZMNA 1DLEA 4UEHH 1AE5A 1XX9A 1GVZA 2EA3A 4DVAU 1TRNA 5L2ZH 3HGNA 5EPNA 3D49H 1ZTKA 2PSYA 1CQQA 5JDUB 3QGJA 2A4RA 2PUXB 1OYTH 2G5NA 3SN8A 1NM6A 1CVWH 3TH4H 2VH0A 1QB9A 4AFUA 4O3TA 1C2EA 3MWIU 1LQDB 2R0KA 1TGTA 1O5CB 1W8BH 2YNBA 3DT0H 4ISLA 7GCHF 1O3JA 1LPKB 3HKJB 4Z6AH 5HGGA 4U01A 1A5HA 3SJ8A 1BMAA 3SUGA 4BTIB 1K21H 1Z1IA 4O3UA 3ZV8A 4WF8A 3MU4A 1WOFA 1ZR0A 1MKXK 3B9FH 1IAUA 1V6DA 1KLJH 1G3EA 3SNAA 3EA9A 1AE8H 1UVUH 4MPXA 1C2FA 1GBLA 1VGCB 3ATMA 1GI6A 4KKDA 2ZDNA 5L2YH 1T8NA 1NFYA 2ZPRA 3EQ0H 1G32B 1E38B 3BTWE 5CE1A 4TY6A 2BQ6B 3ZZ5A 1G2LA 2F91A 3QWCH 2BD2A 1VCQA 5C5OA 4ZXXH 2ZQ2A 1TGCA 1TA2A 3TLOA 4OGYA 1B5GH 1CHOG 4E7NA 3BTEE 2ZCHP 4X6PA 4I33A 2ULLA 4ASHA 2BD8A 1S6FA 1A3BH 5DG6A 2ZQ1A 4X2WA 1O2XA 1S82A 2XWBI 6LPRA 2H5CA 1P12E 2V6NA 1GDNA 1IQIA 3GDVA 1SGRE 3M5OA 1VR1H 1MH0A 1O2OA 1KTTB 3CS0A 3FFGA 1TOCB 2A5KA 4FUCA 2FOHA 1G36A 1ZRBA 3FP6E 1AVGH 1Y3XA 3GOVB 1EZSC 4B76A 1BUIA 2WUCA 1Z8IB 3RXLA 2BXUH 4K5ZA 1KXDA 1YPEH 3B8JA 1XKBC 1WYKA 1ZMLA 2BDAA 5GJ4B 1GDUA 1Z71A 2ZTXA 3ZVAA 1FIZA 1QB6A 1BTHH 3M35A 3PLBA 1K1IA 2AMDA 4K3JA 3LPRA 1OWIA 3SGQE 3BSQA 1HAYB 1F0RA 4K8BA 2HNTE 4CHAC 3SI4H 3RC6A 1TPAE 1T4VH 3K2UA 1V2TT 3MHWU 1BRCE 1NRRH 1V2VT 2BM2A 2VIOA 4FVBA 2VB0A 5DP4A 3HGPA 1KLIH 3AW0A 1O3GA 2XCNA 3GY3A 1NT1A 2FWWA 2G52A 8GCHF 4TWWA 1SGFA 3GY4A 3ZZDA 2PKSB 1C1SA 2P8OC 2SFAA 4UDWH 3QO6A 4ABIA 5TJXA 1LDTT 1CBWB 4IC6A 4BNRA 1B0EA 1SFIA 2DUCA 3PYHA 1C5XB 5EGMA 1L4DA 4YOGA 2ODPA 1SOZA 1LVYA 1JXPA 1B0FA 5AF9H 1C5SA 1J15A 1YF4A 2GMTB 1DY9A 4ZKNU 4CHAB 2WINI 4ZKOU 1THPB 2ZDLA 1NRPH 1BRUP 5DP3A 3TJOA 3KQBA 1GBMA 5AHGH 2AMQA 1OYQA 1MKXH 1NFUA 3DA9B 1O3NA 1WSSH 4ZHLU 1VITG 1TRYA 3S0NA 3MNBA 3TK9A 3DD2H 2Y7ZA 1O2IA 3P92A 4WH8A 5GPIB 3UNQA 2GP9B 1C1OA 2XW9A 3E91A 3SJKA 3M5MA 3GCTG 2P8OB 1LCYA 2ODYB 2KAIA 4IW4E 3SNCA 1W7GH 5T6FA 2G4UA 3RMNH 1UTLM 1O30A 1BA8B 3SU5A 2ANMH 3ITIA 1RRKA 3MNXA 3RLYH 2BD4A 1A7SA 1S81A 1J17T 2GT8A 3SZNA 3F9HA 1TLDA 3UFAA 4ISIH 4MLFB 4B1TA 1UCYE 1V2QT 1EAWA 2Z9LA 3U9AH 1ELCA 1EPTA 1KXFA 1OP0A 1MBQA 1T8OA 2XTTB 2FTLE 3O8BA 1K28D 4ZKSU 1ANEA 2ZFSA 3ZZ6A 1LVOA 4ESTE 2WUBA 3E0PB 1IQLA 1HGTH 1KXCA 1G2MA 1O3IA 1HAVB 1QB1A 3ZYEA 1VITF 1GMCF 5EXLA 4DIIH 4FUHA 3A83A 2EI8A 3TVJB 2Z9IA 1O3MA 1VJ9U 2ZNKH 3RXRA 3E1XB 3V7TA 1FN6A 2NWNA 4OS1A 4AGKA 1T32A 1THSH 3VXFH 1PPHE 2ZZUH 4X1PU 2OINA 3LONA 1QBNA 1ETTH 1TX6A 1O5EH 1GBIA 1MD7A 2VIPA 1UTOA 1O2ZA 1GVLA 2B9LA 1A61H 1MQ6A 1TWXB 2XWAA 4X2YA 1D3TB 3TH2H 1O38A 3M3VA 2ESTE 2BD9A 1LPZB 1TQ7B 2TRMA 4ZHAA 1BCUH 3U69H 3ZYDA 2VNTA 3AVZA 2GDDA 3HK3B 4WH6A 4OS4A 1GWAA 1AHTH 1IHSH 2P59A 1NN6A 2BLQA 5SGAE 1P2IA 1HAVA 2HOBA 3TGIE 2ASUB 2FPZA 2ZIQH 4X8VH 5EW1H 3ATKA 3M3SA 3RM2H 1TX8A 3C27B 1MTSA 1A0JA 2AEIH 7KMEH 2J9NA 1O2UA 1Y3YA 4RN6A 6CHAC 3MTYA 1UO6A 4K1SA 1NY22 1HXEH 1NFWA 3T25A 1DITH 4CRGA 1ZJKA 2BYAX 1BTXA 1YPKH 5A8XA 4BXWA 1DLKB 2QYIA 4ABFA 4D9RA 4A92A 4Y10E 1GHBF 1C1UH 1ELGA 3LGUA 3SU4A 1EJMA 1H8DH 1C2GA 2PGQB 2UWPA 2H1UA 1TBRH 4NFFA 2AH4X 1C5VA 1TAWA 3MH6A 2XC4A 1OS8A 1S83A 2UWLA 2ZFTA 4FU8A 3SHAH 2XXLA 1EP5A 2ODQA 5LGOA 3H5CB 1ELAA 1GI5A 3MU0A 3ZZCA 1Y3UA 2A1DB 2NU0E 2JH0D 3MU8A 4Y7AA 1DY8A 1KXBA 3OSYA 1HJAC 1O39A 5EU8A 3A88A 4ABEA 4SGAE 2W5EA 2UUYA 1IQJA 1DWEH 4R8TB 1NZQH 4TPYA 3QTVH 1XXFA 3BTDE 4D8NA 1P9SA 2CF8H 2W7SA 2G5VA 3VB7A 1ZJDA 2UUFB 4WVPE 2QF0A 3SU6A 2SGAA 2Z7FE 1ZHPA 2HLCA 3PTNA 1HAPH 4NWKA 1MCTA 2FS9A 2ZGXH 3SGBE 2FDAA 2B7DH 3LGYA 5GDSH 3T29A 1ARBA 2QXJA 2PW8H 4H6TA 1HRTH 3ZZ9A 2BX4A 3P8GA 3SU0A 3FAOA 3UR9A 2F9VA 2BY7X 4BANB 1SLUB 2IJOB 3MH4A 5FBIA 1O3PB 2ZWLH 4CRCA 1O3AA 1BQYA 2QGRA 1CHGA 3SORA 1JIRA 1MU6B 4GCHF 5E8EH 3KCGH 2STBE 3AAUA 1C4U2 1GBDA 1UTNA 2VGCB 2ZHFH 1ZPCA 2ZCKP 3ESTA 3FP7E 1YPLH 3HK6B 1E37B 5GCHG 3T27A 1CSOE 4ISHH 2AYWA 3F6UH 1BTPA 3TITA 3A8DA 5AFZH 1NPMA 1L0ZA 2QCYA 2ZFQH 1FMGA 2XBWA 2QAAA 1XUGA 1N6YA 4ZROA 1VCPA 1ZZZA 1XMNB 2IOTA 1MU8B 5C67A 1O2SA 2GDEH 1ANBA 4X8TH 3TJNA 1NS3A 1HAGE 4GAWA 1FV9A 4WJG2 1FJSA 3QZQA 4J1YA 4DGJA 2GZ7A 4YT6H 1XVMA 1P2NA 1A5GH 2ZU3A 1AB9B 2ILNA 1O3CA 4I8LA 2FLBH 1O36A 1SR5C 1AKSB 1QR3E 3GCHC 1NU7B 2QXIA 4OS5A 2ZGCA 4WWYA 2JETC 2STAE 1AWFH 1P05A 3QGNB 3PV4A 2FLRH 9LPRA 1MTNB 1P01A 5GCHF 2Y5GA 1AU8A 3UUZA 2Y82A 5DP8A 1PQ7A 4CBOA 3ZZ4A 1YCPM 1W3CA 2BY5X 4K1TA 1Q2WA 2ALPA 1GDQA 2Q6DA 5A0CA 5G4BA 3HKIB 1J16A 1O5DH 3A8BA 4I8JA 4DT7B 2GCTC 2M5TA 1O3OA 1PFXC 3URDA 3AW1A 3UIRA 3RP2A 2I6SA 1GI2A 3UQVA 1GHYH 4YTAA 3SV8A 2PSXA 1AWHB 1OX1A 4INHA 2FO9A 2FS8A 1HAIH 5FBEA 4I8GA 1HFDA 4X8UH 1ZSLA 1SGEE 5FPSA 1QTFA 4A6LA 3U98H 3PM3A 4UE7H 4CBNA 3RMOH 1WQSA 1DFPA 2FXRA 1VITH 3SO3A 2FOAA 1Q31A 1LHFH 4CRBA 1FIWA 2ZDMA 4UFDH 1GJ5H 3M36A 2ZPQA 1TMBH 4NGAH 1MKWK 3LGTA 4GUXA 2AIPA 1MAYA 1Z7KA 1T8MA 2ALVA 3ENSB 1BMLA 3C1KA 5CHAC 4ABGA 5EW2H 1UVSH 1SGYE 1DICA 2OLGA 4KTCA 4QT8C 1DOJA 3E6PH 5HMAA 4MTBA 3LH1A 4KGAA 4INLA 2HWLB 3RXJA 2SGEE 4LOYH 1RIWC 4NZLA 1RGQA 2ZGHA 3PROA 2QC2A 2ZFRH 3VXEH 4ZXYH 1EUFA 3KL6A 1AGJA 3TJUA 3GCNA 1YLCA 7GCHG 3S9BA 3K9XB 4VGCB 1RXPA 3V13A 5JBAS 1GHXH 2FOMB 1SFQB 2C3SA 4AYVB 1TMTH 1UVPA 1W10U 3H7TA 4X8SH 3L33A 3LKWA 3TU7H 1DE7H 2LNCA 4X6MA 2BHGA 1TA6A 3P95A 2O8UA 1AIXH 1TONA 2BQ7B 2O8LA 2VIQA 5C5NA 4OS2A 4AGJA 4Y7BA 1QA0A 1FAXA 5ESBA 1FZZA 1XM1A 1A0LA 3A84A 1NO9H 1VGCC 1TOMH 2AGGX 2SGDE 2VJ1A 3SNDA 1SOTA 1V2PT 2XC0A 3A85A 1RIWB 1WU1A 2VWOA 3MOCA 4A7IB 1CA0B 1C2MA 5LPFA 4XBCA 2F3CE 2ZA5A 1ESAA 1A3EH 3TNSA 5DPAA 2AGEX 4ZHMU 2OTVA 1FN8A 3PWBA 2A4GA 3P17H 4PROA 5AVDA 1EATA 2DE8A 2VINA 1AUTC 4GVUA 4MNWA 4B2CA 3RXUA 1IHTH 2RA3A 1RD3B 3QDZB 3LC5A 2OC7A 1LQEA 3BTFE 1C5NH 1EB2A 2AS9A 1UTQA 2QIQA 1O31A 1V2UT 3U8RH 1S85A 3NZIA 3ZVFA 4HZHA 3JZ2B 1EOJA 1GBTA 1IQEA 2J4IA 3OY6U 1O5FH 4MNYA 3A8CA 1C9TA 1Y3WA 2WYGA 1KIGH 1UVTH 2ZU5A 4Y8ZA 1K22H 1O35A 5DO4H 4NWLA 2BLVA 4BAKB 2TGDA 3MYWA 4X1NU 1O3BA 1EQ9A 1SGNE 1TQ0B 2RCEA 3RXCA 3RXKA 2ZDKA 4YOJA 1GMHG 2D1JA 1TBZH 1ZTLA 3A80A 3F9GA 3Q3KA 1JBUH 3PMBB 3U8TH 1FNIA 3BG8A 3UY9A 1EAUA 1MZDA 3PLPA 2FI3E 3M3TA 4CR5A 1QBOA 5FCKA 1ELEE 3WY8A 3A86A 1QCPA 1GL0E 5T3HA 1LHDH 1PJPA 4AB8A 2B5TB 2Z9KA 4AOQA 3P6ZB 3L3TA 2V35A 3RXEA 1MKWH 1BHXB 1THRH 3KGPA 2BVSH 1EAIA 2UUKB 1J9CH 8GCHG 2HVXA 5A0AE 1GBCA 3S7HB 2XRCA 3RXVA 4Y0ZE 1SHYA 1KXAA 1GI4A 2BDCA 5A0BA 2PKSC 3QZRA 1HIAB 5I25A 1ZSJA 1UJ1A 1FXYA 4XBDA 1O3LA 2W3KA 1G9IE 2XBYA 3STIA 5JBCS 1CBWC 1FONA 1GMHF 1Z8JB 4X2VA 1HPGA 3BTME 4JCNA 1CA8B 1LO6A 1D6WA 2TPIZ 3LGIA 1EZUC 3RU4T 1E36B 1EPTC 2FM2A 2G8TA 5BRRE 2FX4A 4GSOA 2GMTC 2VIVA 1EJNA 1K1OA 2ZECA 1L2EA 1P04A 3QN7A 4HFPB 4ISNA 5EXMA 2GD4B 1O2JA 3GY8A 3Q76A 1BOQA 1W14U 7LPRA 3BN9A 3VB3A 1BJUA 1KY9A 2BZ6H 4JZFH 4IN2A 1O34A 1HJ9A 2VWMA 4SGBE 2Y6TA 2KAIB 1GBEA 1CT2E 1YPJH 2VIWA 5ABWA 2WPHS 4NSVA 2FODA 1V2OT 5LPEA 1HIAA 4TY7A 1FAKH 4NFEA 3SJOA 4GLYA 4IC5A 1G30B 5EOKA 5FCRA 3ZV9A 1XUHA 1YCPK 1AY6H 3FANA 2BOHB 3QLPH 2R2WU 3RXQA 5FPYA 1V2LT 2Z9GA 1ZHMA 1SQTA 2TIOA 3OY5U 4ZKRU 1XUJA 1EPTB 1RFNA 1QRXA 3BTKE 2R3YA 1WUNH 4IGDA 1GJ4H 1O2VA 1K9OE 2Q1JA 3M37A 1GI8B 1C4Y2 2CJIA 1UK3A 1O33A 2O8MA 4B2AA 3SW2B 1ACBE 3GY7A 2Z3EA 4B74A 2C8WB 2I6QA 1EP6A 4NIVA 3T5FH 3BTQE 2CMYA 1YPGH 1C1WH 1GMCG 1S0QA 1XUFA 1E0FD 1ETSH 3E3TA 3SUFA 1CO7E 2H2ZA 1QQ4A 2GTBA 1EX3A 3SQHE 2SNVA 4Q80A 2NU4E 4ABBA 3RXHA 1IQFA 5C1YA 1P2JA 4LK4A 1W12U 4GPGA 4DY7B 1HXFH 5J4QA 1SGFG 1DDJA 3A89A 2FOGA 3O8DA 3UR6A 2GV7A 1RS0A 1P03A 4IMZA 1OP8A 2BY9X 3LGVA 1INCA 1FLEE 1ANCA 2V3OH