4X2WA

Crystal structure of the murine norovirus ns6 protease (inactive c139a mutant) with a c-terminal extension to include residues p1 prime - p2 prime of ns7
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
179
structure length
173
Chain Sequence
VSIWSRVVQFGTGWGFWVSGHVFITAKHVAPPKGTEIFGRKPGDFTVTSSGDFLKYYFTSAVRPDIPAMVLENGCQEGVVASVLVKRASGEMLALAVRMGSQAAIKIGSAVVHGQTGMLLTQDLGTIPGDAGCPYVYKKGNTWVVIGVHVAATRSGNTVIAATHGEPTLEALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of Murine Norovirus NS6 proteases with C-terminal extensions designed to probe protease-substrate interactions.
pubmed doi rcsb
source organism Murine norovirus 1
molecule tags Hydrolase
molecule keywords NS6 Protease
total genus 29
structure length 173
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2wA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4x2wA01
2GMTB 1V2NT 3QN7A 1JIMA 1ZHMA 5GWZA 1XXFA 1EJNA 4Q2KA 1YPJH 1YPKH 3LU9B 2YNBA 3MU0A 4H6TA 3LONA 3QLPH 4MNXA 1U6QA 3RC4A 4BAOB 1NN6A 2ZPRA 4FXGH 1NTPA 1VITH 1TQ0B 2W3IA 3HKIB 2ZHDA 3GYMA 2STBE 4K3JA 3BTHE 1UMAH 2ZI2H 2TIOA 3GDSA 5GCHF 2B0FA 2ZQ2A 2F9BH 2ZPQA 2XW9A 1SGIB 2UWOA 2RA0A 1C5SA 3BTWE 4CHAC 4TYDA 3BTKE 4YT6H 5LPEA 1L4DA 1MAXA 1O2LA 1TBQH 2F9NA 3SHCH 2OBQA 5FBIA 1O31A 4MPUA 3I77A 2CGAA 2J38A 4OS5A 1IQKA 1V6DA 1V2QT 2VIOA 3OY6U 2BD2A 5CMXH 3CS7A 1TX6A 2ZGHA 5E0HA 5C2ZA 4Y79A 1PYTD 3SW2B 4NA8A 1SHHB 1QGFA 1W12U 1DOJA 3RMNH 4A1XA 1XUGA 5DG6A 3ZVEA 2GDDA 1ELBA 2TGTA 1C4V2 1LKAA 4U01A 2J94A 1ZRBA 4K8YA 1O2HA 4Y11E 4CRAA 3MHWU 4ABDA 2BX3A 1LO6A 2OUAA 5K7RA 2BZ6H 1C1TA 4MPWA 9ESTA 3UQOA 2Y82A 3P6ZB 3SUDA 2JKHA 3SNAA 2XNIA 1YLCA 4FUFA 2P3FH 1QY6A 1BTWA 3PO1B 2ZEBA 3KF2A 3GY2A 1V2TT 1BQYA 1DITH 1GGDC 1V2OT 2BD9A 1NRQH 1QL7A 4B2BA 4D76A 2XBYA 3A80A 4X1QU 1G9IE 4UFFH 4IBLH 2ZDKA 1TYNA 2P3TB 2PSYA 2VIPA 1ZTJA 2OQUA 1CBWC 1C2JA 1G3CA 3PMBB 2XWAA 1TNHA 1BTYA 4KTCA 3KQDA 3TNSA 3QX5H 1V2LT 3U8TH 4YOIA 4CR9A 1FN6A 4B2CA 1NPMA 1SLVB 3NUMA 1P2NA 2PKSC 1UVTH 1GBEA 3M7TA 1NFXA 5L30H 1A0LA 4K1EA 3SJ8A 4ASHA 3KHVA 2AGEX 6GCHF 4UFEH 1NT1A 1YP9A 2ZHEH 4AGKA 1GHBG 2BXUH 1ZRKA 3SHAH 1VCPA 3AW0A 4YLQH 4CRDA 1O32A 3DT0H 1FQ3A 1Z7KA 4Y0ZE 1BT7A 4I8JA 1HAHH 2BD4A 1A3BH 3RM2H 1ZSKA 1LCYA 5AFZH 2FOGA 5C1XA 5E0GA 5JBBS 2C8YB 4AYVB 1KDQA 1SGRE 1VZQH 3BTFE 3UWIA 1P9UA 4O03A 5FCKA 3RXLA 3UNRA 1O3DA 3L33A 2VJ1A 2G4TA 3HK6B 4JK6A 1OYTH 2GD4B 1NU7B 3VB6A 3S69A 2VNTA 3OX7U 1ZJDA 1K22H 2P3UB 1LHFH 1G30B 1GJ6A 1PQ5A 5I25A 1Q31A 3FAOA 1CGHA 4NWLA 4ZMAH 1LHCH 4B1TA 3SJ9A 3SGBE 3ITIA 2XTTB 1BMAA 4JYVH 2A31A 5A0AE 1N1LA 2XXLA 1RTKA 4JMYA 4O3TA 3IG6B 3M5OA 4D7FA 4H6SB 1YCPK 4DJZB 2ZO3H 5IYTA 1AB9B 4B2AA 1BBRE 3AAVA 2GT7A 1WV7H 1DSTA 3SU0A 2FOAA 1CBWB 2XWBI 1ZTKA 1GVLA 3GY5A 3S7HB 1C5XB 1XKAC 1P02A 3TH2H 4ABFA 3P92A 1G3EA 1GJBB 2A4QA 5EODA 3ZZ9A 2A0QB 1GHXH 1C1NA 1TBZH 3M3TA 3VXEH 1GDQA 2Z9JA 3EGKH 1QRZA 4YESB 5C5NA 1C1QA 1GI5A 3I78A 2XCFA 1ZJKA 2PHBA 1EKBB 2F91A 1ZYOA 1O3MA 3BTGE 5T6GA 1A0JA 1C2MA 2AGIX 1TNIA 1EB2A 1GJ5H 1A5IA 4O3UA 5TCAA 3G01A 1Z71A 1O33A 3MH5A 5HGGA 1SVPA 1W3CA 1E38B 1HV7A 2BD8A 3L3TA 4IMQA 3U9AH 1O2GH 1PFXC 2C93B 4X8TH 3S7KB 1ZOMA 5A8YA 1DVAH 1MKXH 3KL6A 4AFUA 4K1TA 1GBJA 3SGAE 5EQSA 1TRMA 3F1SB 1GVZA 1WYKA 2J95A 2GCTC 1C9TA 3KCGH 2VGCC 2D1JA 4ABAA 8ESTE 1O2OA 1TX7A 3KQEA 5AF9H 1EAXA 2Q6FA 3GCOA 4AB9A 3EAJA 2OP9A 1NFYA 3URCA 5FXLA 1BRCE 5J4QA 3FVFB 5EW2H 1ETRH 1FPCH 2A4OA 2HALA 2ZDVH 3LH3A 3GOVB 3UOPA 1BTUA 2FODA 3UY9A 1YPHE 1GDNA 3LPRA 1QIXB 1J9CH 3BTQE 1NRNH 1MZDA 1TA6A 1QBOA 4OS7A 2BDIA 3ZZDA 1Q3XA 2EEKA 1D3PB 4FU7A 1ELFA 1SGQE 1IHTH 4ZH8A 1DSUA 1GI2A 5LGOA 4YM9A 1EAWA 3QK1A 2ZA5A 2ZHFH 4Y71A 2A7JA 1ZSJA 3NWUA 5FX6A 3DFLA 1Z8RA 4GPGA 1BMMH 5E8EH 1OWHA 1X7AC 4J2YB 3TK9A 4MVNA 2HVXA 1YYY1 1Z6EA 1O3CA 3MO6A 1NESE 3EA8A 1W13U 3A83A 5DP9A 1O3IA 2FI5E 1H8DH 1LVMA 1PJPA 2AIQA 1DXWA 4AB8A 1AFEH 4DIHH 1LVOA 1Y5AT 1C2KA 3D62A 3MNXA 2AGGX 4DGJA 3BTTE 3QDZB 3A84A 1P05A 1INCA 4YOGA 2ZP0H 5EW1H 1K1IA 1OPHB 2VWMA 1SLUB 1TRYA 1O5CB 4RKJB 1FY3A 4OS4A 3SQHE 4Y8XA 3H7OA 2HPQH 3PV4A 2EI6A 1HRTH 4IGDA 1RXPA 3TH4H 1O2JA 1CE5A 3ZVGA 2BDYA 5GIBA 3A86A 2OBOA 1GJ9B 2Z9KA 1NS3A 4R0IA 1AN1E 1O2TA 2ZTXA 1THSH 2H5DA 3SBKA 1SGNE 1EAUA 3GCHB 4IC6A 4XDEA 3V13A 2ZFRH 4THNH 1L4ZA 4RN6A 3E0PB 3UUZA 2NU0E 2FOEA 3RC5A 4Y8YA 3OSYA 5DK1A 3TNTA 4NZQA 1IQHA 3BG4B 3EQ0H 1NC6A 1DE7H 4AN7A 1WOFA 2EI8A 3A8DA 3RMMH 1AKSB 1AVXA 4INHA 2BM2A 3HKJB 2NWNA 3LGIA 3U98H 4CRFA 2ZFPH 1GI1A 5ABWA 3A8CA 5F03A 2OTVA 4ZKNU 2G00A 4NA7A 2OD3B 3KNXA 1H4WA 1WUNH 3GY6A 3KGPA 1CT2E 2DUCA 1SGDE 3QTOH 3SQEE 1VCQA 4ZKOU 4VGCC 2AFQB 3TU7H 1B7XB 3MWIU 1XXDA 2FEQH 6CHAB 4O9VA 2RCEA 4NZLA 4WXVA 2BY5X 1A0HB 1V2PT 4WVPE 2DE8A 1Y3VA 2VWNA 5HM9A 2FOHA 1WCZA 2UWLA 3O8BA 1Z8JB 2GT8A 3SU6A 1V2UT 2ULLA 3K65B 3HGNA 3DFJA 1VGCB 1G3BA 1GHZA 2ZCLP 5A2MH 1BJVA 2UUJB 1S6FA 1HDTH 2C8WB 1UHBA 1AVWA 1S5SA 1N8OB 1HLTH 1Y59T 4JZDH 4CR5A 1BA8B 1P09A 1GBFA 1HNEE 1UTKA 1GJ7B 4ZXXH 4U2WA 2Z3DA 1ESBA 1W14U 1Y3XA 1FV9A 4AFZA 4I8HA 1JMOH 1QFKH 1AQ7A 1HAVB 2C8XB 2CMYA 1BHXF 4KGAA 1AGJA 4IMZA 1DLKB 2GDEH 1JOUB 1UTQA 1RGQA 1NFWA 1OSSA 2A5KA 2TGDA 2WPKS 1IQEA 1MTNB 1FMGA 2Y6TA 2G51A 1FAKH 2J9NA 3D23A 1ELTA 4CH2B 1O2ZA 3TGKE 2AERH 3OU0A 2FWWA 2ZU4A 1EJAA 3UNSA 1CT0E 1P2JA 2NU3E 2SGDE 3ZYEA 1LDTT 2H2ZA 5JYIA 1CU1A 1DUAA 3E8LA 4R8TB 2AMQA 1GWAA 4BXSA 3UPEA 1K9OE 4Q80A 1C5YB 3GICB 5EQQA 1HYLA 4MDSA 1EZQA 1DWBH 1P9SA 3ATIA 4Y6DA 1UVOA 2C3SA 4NIYA 3R3GB 3A81A 1CA0C 1GI0A 2IPHA 1MKWK 2GGVB 2J2UA 1C2LA 2BDHA 2CV3A 1ANCA 1HBTH 4GHTA 1O3NA 1G36A 3PWCA 2HNTC 3ATMA 1GBBA 5FHTA 1W7XH 1BOQA 1CVWH 4E06H 3OYPA 3LGTA 1FY1A 3RXMA 1YPLH 1MTVA 4X2VA 5GJ4B 5T6FA 2R0LA 4HI3A 4YZUA 3NKKA 1QQUA 1BBRK 1YPEH 2TPIZ 2H1UA 2AH4X 1K28D 3M5LA 1G3DA 2VVUA 3HK3B 3SORA 3UQVA 1NZQH 2ZU5A 3BN9A 5DP6A 1BRUP 2IJOB 2WV5A 4NCYA 1O2IA 1C9PA 1O2YA 2ZZUH 6ESTA 1QURH 4K2YA 3E91A 2YOLA 1NRRH 3SV7A 2AS9A 1AZ8A 3A7YA 1GBMA 3RXOA 3M36A 2A7CA 1NM6A 1FY5A 4Y7BA 2BMGB 3DHKH 1KLIH 3QGJA 1OWKA 4OS2A 1Y3UA 1O5BB 4GSOA 1Y5UT 2C90B 4AG2A 4NIXA 3S9AA 3HGPA 4WXIA 3LGYA 3SV8A 4O97A 1UCYH 5DJ7A 1C2HA 2H9HA 2A4RA 1V2VT 4BTIB 3MI4A 4ISNA 4AX9H 1AVGH 4I32A 4BTTB 1GHWH 1F5KU 2ANMH 2B5TB 1HAYB 1SGPE 1ZHPA 3EE0B 3ENSB 1ANDA 3MH7A 4ABIA 3FFGA 1IQLA 4X1NU 5JDUB 4X8UH 3AW1A 3UREA 3ZYDA 3QWCH 1C5NH 1VJAU 1GMDF 2VIWA 1TMBH 3U1JB 5C5OA 1MH0A 2BLOA 3ZVDA 1C2FA 3NCLA 1SFIA 5E2OA 2F9OA 3GDUA 1SQAA 1AHTH 1WU1A 3MTYA 1BITA 1J8AA 2BY7X 2KAIA 2BQWB 1GBIA 3UFAA 4ABHA 1O3OA 2OCVB 4GUXA 1ELGA 1FIZA 2Z7FE 3OY5U 4D9QA 3JZ2B 4FUHA 2P95A 5TJXA 3I29A 4HTCH 1P06A 2OLGA 2Z9LA 4E05H 2HNTF 1QB6A 2D2DA 1GHAF 4IC5A 5ESTE 3AASA 1O2WA 2W7UA 1V2MT 3OTJE 1ZPZA 3SU3A 4RKOB 1GL0E 2BDAA 4LK4A 1CA8B 2GV7A 3PB1E 2ANYA 2F9PA 2XBWA 1OYQA 3F9FA 3Q77A 4CRGA 3ZZ3A 2OQ5A 1AU8A 4CBOA 2QAAA 1BTXA 5AVDA 1JWTA 4F4OC 1F5RA 2TGPZ 1C1UH 4JK5A 3RUOA 1HPGA 3PLBA 4ABEA 3LGWA 4PROA 1SQOA 2Y7XA 4DOQA 5AFYH 2Y5HA 2BVXH 4JYUH 1PPCE 1CT4E 1SSXA 1T32A 1GBAA 1ZHRA 2BB4A 4CRBA 3PTBA 5HYOA 1GHAG 1T7CA 4Y8ZA 1CHOF 3U8OH 1NRPH 1AI8H 2HNTE 1BTZA 1MBQA 1NY22 3HPTB 4IS5A 1O3HA 4FUDA 2PUQH 3U1IB 2HRVA 1GBDA 4I8GA 2FXRA 2Z9GA 3W94A 2P59A 2HWLB 4SGBE 2V3HH 2VIDA 5HXFA 1BHXB 2OINA 1C5LH 2EI7A 2EA3A 1FZZA 2FTMA 1T4VH 1IAUA 1EJMA 1CHGA 2H9TH 2ODPA 4UDWH 2CJIA 1EPTB 1IOEA 4U32A 1QA7A 2I6QA 1ZMJA 5JPMH 2BDCA 1O3PB 1C2GA 1MQ5A 4Q7ZA 7ESTE 4MPVA 3SNBA 3RXFA 1IQJA 1E37B 2PKAA 3IWMA 1MKXK 3LOXA 5FPTA 2O8MA 2ZDAH 1KLTA 2G8TA 3ZVCA 2PKSB 4ZHAA 2VWLA 1BB0B 1KXCA 1QCPA 1ZZZA 1ABJH 1E34B 4AZ2B 1GI3A 1P10A 2WPLS 4B76A 1T8MA 2JH0D 1TONA 1ELAA 2BX4A 3E16B 1ANBA 2XYAA 2IOTA 4SGAE 1SOTA 1AFQB 4IW4E 1G2LA 1W10U 2OC0A 1QQ4A 1O3EA 4DCDA 4ESTE 1MBMA 1E35B 1O3LA 3A8AA 3QTVH 1N6YA 1TQ7B 1YCPM 2Z3CA 4UEHH 2ZCKP 2H6MA 2WPHS 1OP0A 1YC0A 3A85A 1O34A 1HB0B 1QB9A 1S85A 1C1SA 3FZZA 1O2NA 3LGVA 1B0EA 2XC4A 1GJCB 1SLXB 2FOBA 1QBVH 1KXFA 1SGEE 2DE9A 3RXSA 3STJA 3SOSA 4MNVA 1O2XA 4X2XA 2UUKB 2VIVA 1GL1A 5C1UA 1DICA 1L1GA 1QTFA 2UUYA 2A32A 1KXAA 1Z1JA 1MZAA 4X1RU 1P04A 3PROA 1CGIE 4X0WU 3U8RH 1TGTA 1TGCA 3K2UA 4LZ4B 5E0JA 3NPSA 1C1WH 1RIWB 1TNLA 1GPZA 1ID5H 2QV1A 2W26A 1OWEA 2B9LA 2ESTE 5DP5A 2OC8A 3BEIB 3BEFB 3KQCA 4UONA 3MNSA 3BEUA 4H42U 4U30A 4FUJA 3E1XB 1LQEA 4E7RG 5GPIB 4ZKSU 2D26C 1KSNA 1AMHA 3RXGA 3AVZA 2V6NA 2PUXB 1O5EH 3SO3A 1OKXA 2ODQA 3C27B 3M7UA 3Q3KA 3TPIZ 3RDZA 3RMOH 1PQAA 4AFQA 1C5RA 3M5MA 1AZZA 2GX4A 1EZSC 1OP8A 4KELA 2FP7B 1XUIA 4LOYH 4BAMB 1KXBA 1UCYK 1QA0A 1AUTC 1FNIA 3ESTA 4XE4A 2ILNA 1GHYH 4FVBA 1ELDE 4XBDA 3LGUA 5EOKA 1LPKB 1UVUH 4E7NA 2QF0A 3ZZ5A 3B8JA 2QC2A 3PWBA 1O0DH 4CBNA 1GG6B 1EASA 3RMLH 3MOCA 2GMTC 1T8LA 4MLFB 2WUBA 2A7HA 3V3MA 1KIGH 1BZXE 2ZGJA 1Q2WA 2ZIQH 3TJOA 5LPFA 2ZU3A 4AYYB 4XOJA 4KP0A 1FUJA 5F8XA 2GCHG 4JZIA 3VB7A 1FDPA 3MNCA 1TPAE 5H4IB 4TY6A 2ZWLH 1C4U2 3T28A 3VGCB 1EATA 3PLKA 1ANEA 2FS8A 3A7TA 1EB1H 4TWYA 1AB9C 2H9EH 4KTSA 1UTLM 3O8DA 4WY3A 4H4FA 1GCTB 2P94A 5EXMA 1K1MA 1P57B 5EXLA 2A2QH 3MU5A 3T5FH 2ZGXH 2SGFE 2ZGBH 3U69H 2BVRH 4INLA 1CHOG 3GISB 1EAIA 1OOKB 1SGTA 3F9EA 1V2KT 1B5GH 2WUCA 2ANKH 3ZZBA 1RJXB 4INKA 3SV2H 2OC1A 5T6DA 1G32B 1C2DA 4WMFA 5DO4H 1O36A 1J17T 3Q3XA 3STIA 1XVMA 3RXHA 1QB1A 5HMAA 4BANB 2FOFA 2ZFTA 3QZRA 3RXDA 2ZU2A 2G81E 6CHAC 3RLWH 2BHGA 3SV6A 4BNRA 2LNCA 2FYRA 2W7SA 1C2IA 3O8RA 5C67A 4I8KA 5G4BA 4A5TS 1TPSA 3MH6A 2Y81A 4K8BA 2Z9IA 2WPJS 2QY0B 3EA7A 2ZPSA 3TIUA 3KQBA 4Q7YA 2VVCA 1WBGB 3ZVAA 1TPOA 1JIRA 1XUKA 1PQ7A 1SGFA 4A1TA 4DG4A 2G4UA 3Q76A 3SNCA 1NROH 3ZV8A 5E2PA 1AE5A 3RM0H 1O2UA 4D7GA 2FIRH 1UK2A 2FOMB 1QHRB 1D6WA 1A61H 1RS0A 1JBUH 4WMDA 1P2OA 2WV4A 1BRAA 2PTCE 1TABE 1GI6A 4A7IB 1TNGA 4X2YA 2PTNA 5PTPA 1V2WT 5DP8A 3URDA 3ZVBA 3V7TA 1DT2A 2FMJA 3UOUA 2WPMS 3HATH 5GDSH 2F3CE 1O3BA 9LPRA 4JZFH 1J14A 4X2WA 1PPGE 1QR3E 3FP7E 4Q7XA 1DWCH 3LH1A 5DKMA 1P03A 3S9CA 1FY4A 1GI4A 2V3OH 1SGYE 2THFB 1T8NA 4Y76A 1DS2E 1TOMH 2FI3E 2YNAA 3A88A 1GBKA 1V2RT 3BIVH 2BZAA 4M7GA 3CS0A 1SLWB 1VGCC 3SNEA 1AWFH 1ZGVA 1AKSA 3QUMP 2Y5FA 4GVUA 1S0QA 4DVAU 4ZKRU 1O5GH 1OXGA 3SJKA 4FUIA 1D3DB 1NRSH 1QRWA 1XKBC 1K1OA 1JXPA 3ATLA 1ZMLA 4X1PU 4FVDA 4Z0KA 5C1YA 3UIRA 3L6PA 1DWEH 1CA0B 3RP2A 5EXNA 3RXCA 1QBNA 3TGIE 1D4PB 2BLWA 1GDUA 8KME2 2F9UA 1MMJN 1C5MD 1GHVH 1FJSA 1SR5C 2SNWA 1OX1A 3LIWA 1VITG 2PW8H 2FPZA 1A2CH 2FX6A 1GMHG 2R0KA 3UNQA 1BDAA 1DM4B 4D9RA 1BJUA 1GBLA 3RLYH 2QIQA 1UTMA 3SI4H 3UWJH 2ALVA 1ELVA 3ELAH 1OWJA 1YPGH 2SFAA 1K1LA 3PLPA 2FS9A 1SOZA 2W5EA 1LHGH 1C1OA 2A45B 2B8OH 1KTTB 1BUIA 1FN8A 1TMUH 2WINI 3RXUA 3A87A 3A7ZA 1TNKA 4KTUA 3NXPA 3GY8A 5JBCS 4ZHMU 2HGTH 1Y3YA 1P2QA 3A7WA 3E3TA 5EPNA 1TWXB 1XUJA 1N8OC 4B74A 4B71A 1OP2A 5JB8S 4B73A 5GCHG 2J34A 1UVPA 1HAGE 1O2SA 1O5AB 1HXFH 2Y5GA 3GDVA 1GVKB 1K2I1 1F0UA 1K21H 2QA9E 3A7VA 3TJNA 3ZZCA 4X1SU 1EX3A 2Z94A 3GCNA 3MO9A 1HJ8A 1HAOH 5L6NH 2A2XH 1XVOA 2VWOA 4AGJA 1UO6A 2ZDLA 2FDAA 2PKAB 2G5VA 2VINA 4ISIH 1SGCA 1C5QA 3A7XA 3VB3A 2FLBH 1EUFA 1W2KH 4VGCB 3ZV9A 1P2MA 2V35A 3GCTF 3VGCC 3A89A 1S84A 5LPRA 2Y7ZA 1G37A 1O30A 4HZHA 4B75A 2Y80A 1C1RA 1HCGA 1H9IE 1OS8A 1SG8B 2RDLA 4WMEA 1E0FD 1NFUA 1EZUC 4TPYA 1A7SA 3RXQA 2CN0H 1A5GH 2G55A 3BTME 2EC9H 3S9BA 1FONA 2R9PA 1QJ6B 2JH6D 1O2QA 4ZUHA 2JH5D 4NA9H 5BRRE 1F92A 1SI5H 2RA3A 1O35A 5EPYA 4JZ1A 3PO1C 4HGCA 2FTLE 1MCTA 2UUFB 2J92A 8GCHF 3TJUA 1S82A 4FUCA 4D8NA 2VIQA 3TK6A 2ZHQH 1BTPA 1ACBE 4K60A 4OS6A 7GCHG 1ZPCA 2GV6A 4BAHB 2VU8E 4K1SA 3R0FA 1GMCG 2GTBA 4TPIZ 1F0RA 3T29A 4JCNA 2GCHF 1O38A 2GP9B 2FM2A 2IN2A 1H9LB 4LXBH 2SGEE 4TY7A 3E0NB 2H5CA 2PR3A 5FCRA 1TBRH 2CHAB 5F8ZA 1NU9A 5A09A 3VEQB 1DFPA 1XX9A 5ETXA 1GMCF 1HAIH 1O5DH 3Q00A 2UWPA 1W11U 7GCHF 1TB6H 1ZPBA 3M35A 1O3FA 5F6MA 1SBWA 3B9FH 3FANA 1MTSA 2ZFSA 2R3UA 1TFXA 2M5TA 3ZZ7A 4OGXA 3LC3A 3RXKA 1EPTA 3MMGA 4MTBA 1P3EA 1WSSH 4DW2U 2QN5T 5A0CA 1W7GH 2QGRA 3SV9A 1NO9H 1ESTA 5AHGH 1KDQB 4GAWA 2QYIA 3SUFA 5F8TA 3MU1A 1ABIH 1ORFA 2LPRA 4BTUB 1THPB 2FOCA 2PGQB 3E6PH 3RXPA 1YCPH 1CO7E 3KEEA 1IQFA 4I33A 3JZ1B 3QO6A 3PM3A 4I8LA 1S83A 4CHAB 1T8OA 1Z6JH 3M7QA 3MU4A 3KIDU 1TLDA 1ARBA 2QXJA 2TBSA 3BG8A 5CHAB 2I6SA 2FZZA 1FLEE 1PYTC 1FI8A 1GMDG 2AEIH 1SGFG 1P0SH 4Z6AH 5L2YH 3M3VA 3V0XA 1F0TA 4ABGA 1SQTA 2ZECA 4ABJA 4DY7B 1WQVH 4X8VH 5EU8A 3IITA 2ASUB 3UTUH 2JETB 3P8GA 5TCCA 1HAVA 2NU1E 1SB1H 1XUFA 3P17H 3EDXB 1ZTLA 5EQRA 1YGCH 5IDKA 4K69A 1SPJA 1T31A 1YKTA 1PPEE 1AD8H 3TK5A 4Y10E 1ARCA 3D49H 5ESBA 4WH8A 4ZAEA 4JZEH 3F68H 1C5TA 4X6MA 1O2KA 3AAUA 2KAIB 4UD9H 4NIWA 1DY9A 3RU4T 1DX5M 1MTUA 1EQ9A 1V3XA 2VVVA 2WPIS 4UFGH 5B6OA 1MKWH 3PTNA 1TMTH 3RU4D 1CQQA 3M5NA 1Z1IA 2CXVA 3FZDA 1HAZB 4YT7H 5C20A 2BY8X 1THRH 4YLUA 1SMFE 3T2NA 2XC0A 3A8BA 4FUEA 4NFEA 2ZTYA 5DP7A 3TLOA 1C5VA 2TRMA 5DGJA 1JRSA 2AMDA 2SGAA 2P8OB 1TAWA 2Q6DA 3W95A 1PPZA 1GG6C 1YPHC 1PPFE 1DPOA 1K1JA 2A5AA 5DP3A 4NG9H 3H7TA 4DT7B 3A82A 1LHEH 1D3QB 1EXFA 5T3HA 3V12A 4IN2A 1ELCA 1O3JA 1RD3B 1TGBA 1CSOE 1GBTA 1S0RA 2XRCA 2G52A 3MFJA 2BTCE 5SGAE 3ZZ6A 4MNWA 4FU8A 1A4WH 4X6PA 2A4GA 2BY9X 4YO9A 1C5WB 1GI7B 3K6ZA 4FUBA 3SZNA 2SGQE 1D9IA 2VB0A 2WYGA 4HFPB 1O39A 2ZC9H 3BSQA 3K6YA 3SU2A 3UR9A 2O8UA 2R3YA 1Y8TA 1W8BH 3RC6A 1TE0A 1F2SE 2VH0A 1EOLA 1YF4A 3SGQE 4ABBA 2QCYA 1S81A 1ZSLA 1GJ4H 2A1DB 1TA2A 2PLXA 1SFQB 1LVBA 4RSPA 1C1MA 2STAE 3RXEA 4NSYA 2BQ6B 3M3SA 2ZHWH 2B7DH 3RXRA 4MQAA 3Q3YA 3T27A 3PMJA 1SL3A 3PYHA 4NWKA 1UTPA 2VGCB 2ZCHP 5EGMA 1LMWB 2FLRH 1FPHH 4AOQA 1P2KA 4ZXYH 1W0YH 5JBTA 5J4SA 1P3CA 3LJJA 4GCHF 1YM0A 3K9XB 1HAXB 1HFDA 2R2WU 4J1YA 2GKVE 1WQSA 4A92A 4FU9A 2NU4E 1VJ9U 1A3EH 4GCHG 1F5LA 2D8WA 1HJAC 1DDJA 1EOJA 3MU8A 1TGSZ 1TOCB 3VPKA 5BPEA 2OC7A 2XC5A 1MCVA 4OGYA 4Y0YE 3SJOA 4TWWA 3TJVA 4F49A 1H8IH 1IQNA 3RXVA 3RXJA 3QZQA 2BLQA 2O9QA 3DA9B 1Y3WA 2C4FH 2BVSH 2CHAC 4JYTA 1MD7A 3LC5A 1KTSB 2QXIA 3FP6E 2FI4E 1MTNC 1P11E 1J16A 1MU8B 4UE7H 3GCHC 3CENA 2XBXA 2BD3A 8GCHG 3P70B 1XUHA 2BLVA 2W3KA 4GHQA 4MPXA 5JBAS 3MNBA 1E36B 2PV9B 2SGPE 4Y7AA 3BF6H 4I31A 3P8NA 2BOHB 1ELEE 2ZFQH 1O37A 3M61U 2BDBA 1VCWA 1QNJA 1TPPA 1A5HA 2BD5A 2V0BA 3VB4A 2QXHA 1BIOA 1C5OH 1GBCA 1UK4A 1UTNA 5GXPA 2ZDNA 2CF8H 3N7OA 3LT3A 1GCTC 4WWYA 3T26A 3F9HA 1D3TB 3GCTG 1F7ZA 4ZHLU 4AFSA 3M37A 7LPRA 4FUGA 2TGAA 2BY6X 2BYAX 1B0FA 1KXEA 1KXDA 1KYNA 1L2EA 2GZ7A 1P8VC 2FX4A 3SUGA 1TALA 3TGJE 5K0HA 1GHBF 3KN2A 1HGTH 2FESH 3GYLB 2XCNA 1FAXA 1GI8B 5FX5A 1V2ST 2Q1JA 1O5FH 1AY6H 1FY8E 2ZQ1A 5FPYA 1TNJA 4X6NA 3ZZAA 2AIPA 1DUEA 3GY4A 1GJAB 4XBBA 3MH4A 1CGJE 5JB9S 1QL8A 1SHYA 2RG3A 1YBWA 4XBCA 5A0BA 2GZ8A 2ODYB 2P93A 1EPTC 1LPGB 2G5NA 3DUXH 3TH3H 1C4Y2 2ZDMA 3ZZ8A 3BV9B 1S6HA 2ZTZA 1O2MA 1FXYA 3SI3H 1Z8GA 1IHSH 1UTOA 3DD2H 1YPMH 4ISLA 1PPBH 2ZFFH 3ODDA 1MU6B 1TRNA 3RU4E 3H5CB 4CRCA 1DLEA 2P16A 3C1KA 1RTLA 2GVFA 2F9VA 1YLDA 1VITF 2FYQA 1ZMNA 3PMHB 2AYWA 3GY3A 3BIUH 1MAYA 5DP4A 2K1QA 1QRXA 1DY8A 1LVYA 4OS1A 1GCDA 2PSXA 1PPHE 1UK3A 4WF8A 3EA9A 1O3KA 2GCTB 1WTHD 5FAHA 1MUEB 3TVJB 4MG3A 3SUEA 5EG4A 1WTGH 4A6LA 1UJ1A 5DPAA 1IQIA 1C1VH 2GZ9A 4CREA 4DIIH 4QT8C 3SU1A 1HJ9A 1IQMA 1DWDH 4NFFA 4KKDA 2HPPH 2OXSA 1P01A 1UCYE 2PFEA 3EYDA 1MTWA 2ZGCA 4MNYA 5A8ZA 1LHDH 1AE8H 1DXPA 1N6XA 1C5UA 1O2PA 3SJIA 2BD7A 1A1RA 1LQDB 3T25A 3ATKA 2AMPA 4ISHH 1LPZB 1ETTH 8LPRA 2BDGA 4NGAH 3RXBA 1LTOA 1AO5A 2XBVA 3D65E 1AUJA 1TGNA 5CE1A 3BG4C 1C5PA 1L1JA 2O8TA 3B23B 1V2JT 2CF9H 4I7YH 1GI9B 3ZZ4A 2BXTH 1QL9A 2ZF0H 3P95A 3F9GA 1H9HE 1EP5A 2A5IA 1XMNB 1JRTA 1BBRH 2ZKSA 1KLJH 1ZR0A 3SN8A 3O8CA 5CHAC 2P8OC 4WH6A 1TX8A 1OWIA 1UVSH 1O3AA 4ISOA 2FO9A 1ETSH 4LZ1H 1GGDB 4AG1A 1QJ1B 5L2ZH 1WAYB 1L0ZA 4YTAA 2JETC 4WJG2 3P8OA 2ZNKH 1C5ZB 4A1VA 3MYWA 1QJ7B 5A8XA 2ZG0H 2QF3A 3BTEE 1BMLA 1VR1H 2F83A 5FBEA 4NIVA 5LH8A 4XFQA 1A46H 1UHBB 1M9UA 3VB5A 2R2MB 2O8LA 3QGNB 1D6RA 1K1NA 1Z8IB 5HM2A 1GJDB 1G2MA 3NK8A 3PMAB 1UTJA 1P2IA 1RTFB 2J4IA 3GY7A 2ANWA 1O3GA 1RRKA 1HXEH 1O2RA 1GBHA 4AORA 1RFNA 1EZXC 3ATWA 3WY8A 4BAQB 1OWDA 2C8ZB 3VFEA 2Z3EA 4IN1A 1KY9A 1PQ8A 1ESAA 1K1PA 1T4UH 2ZU1A 1BRBE 2WYJA 7KMEH 6GCHG 1SC8U 3ODFA 1C1PA 3VXFH 1C2EA 1GMHF 2HOBA 4K5ZA 1GJ8B 1BMNH 1HIAA 2NU2E 1HAPH 5FPSA 1LKBA 3P8FA 2BOKA 4XSKU 1ZLRA 3RXTA 2O8WA 1L1NA 4BXWA 1IQGA 4BOHA 3LJOA 3ZVFA 6LPRA 1BTHH 1AFQC 1ZGIA 2PGBB 4X6OA 4ZROA 3RXIA 1MQ6A 1HJAB 4X8SH 2Q6GA 2ALPA 3E90B 1TIOA 2SNVA 1RIWC 3F6UH 4GLYA 4UFDH 1EP6A 2HLCA 3S0NA 4NSVA 3T62A 1Y5BT 3MO3A 1F0SA 1BCUH 1XM1A 4CH8B 3FP8E 1J15A 1H1BA 1HIAB 3SU4A 1HUTH 3UR6A 2QXGA 1AIXH 3TITA 3LDXH 3RXAA 3NZIA 2PWXA 3SU5A 3BTDE 5C3NA 1P12E 3SNDA 1O2VA 2Z6BD 4BAKB 5I46H 1W0ZU 1DANH 4DURA 1AWHB 4YOJA 2BQ7B 3CP7A 2VH6A 1MD8A 1FIWA 3LKWA
chains in the Genus database with same CATH superfamily
2GMTB 1V2NT 3QN7A 1JIMA 1ZHMA 5GWZA 1XXFA 1EJNA 4Q2KA 1YPJH 1YPKH 1VKYA 3LU9B 2YNBA 3MU0A 1H8ED 4H6TA 3LONA 3QLPH 4MNXA 1U6QA 3RC4A 4BAOB 1NN6A 2ZPRA 4FXGH 1NTPA 1VITH 3U28C 1TQ0B 2W3IA 3HKIB 2ZHDA 3GYMA 2STBE 4K3JA 3BTHE 1UMAH 2ZI2H 2TIOA 3GDSA 5GCHF 2B0FA 2ZQ2A 2F9BH 2ZPQA 2XW9A 1SGIB 2IJD1 2UWOA 2RA0A 1C5SA 3BTWE 4CHAC 4TYDA 3BTKE 4YT6H 5LPEA 1L4DA 1MAXA 1O2LA 1TBQH 2F9NA 3SHCH 2OBQA 5FBIA 1O31A 4MPUA 3I77A 2CGAA 2J38A 4OS5A 1IQKA 1V6DA 1V2QT 2VIOA 3OY6U 2BD2A 5CMXH 3CS7A 1TX6A 2ZGHA 4P02A 5E0HA 5C2ZA 4Y79A 1PYTD 3SW2B 4NA8A 1SHHB 1QGFA 1W12U 1DOJA 3RMNH 4A1XA 3SZEA 1XUGA 5DG6A 3ZVEA 2GDDA 1ELBA 2TGTA 1C4V2 1LKAA 4U01A 2J94A 1ZRBA 4K8YA 1O2HA 4Y11E 4CRAA 3MHWU 4ABDA 2BX3A 1LO6A 2OUAA 5K7RA 2BZ6H 1C1TA 4MPWA 9ESTA 3UQOA 4F48B 2Y82A 3P6ZB 3SUDA 2JKHA 3SNAA 4B6EA 2XNIA 1YLCA 4FUFA 2P3FH 1QY6A 1BTWA 3PO1B 2ZEBA 3KF2A 3GY2A 1V2TT 5FL7D 1BQYA 1DITH 1GGDC 1V2OT 2BD9A 1NRQH 1QL7A 4B2BA 4D76A 2XBYA 3A80A 4X1QU 1G9IE 4UFFH 4IBLH 2ZDKA 1TYNA 2P3TB 2PSYA 2VIPA 1ZTJA 2OQUA 1CBWC 1C2JA 1G3CA 3PMBB 2XWAA 2J98B 1TNHA 1BTYA 4KTCA 3KQDA 3TNSA 3QX5H 1V2LT 3U8TH 4YOIA 4CR9A 1FN6A 4B2CA 1NPMA 1SLVB 3NUMA 1P2NA 2PKSC 1UVTH 1GBEA 3M7TA 1NFXA 5L30H 1A0LA 4K1EA 3SJ8A 4ASHA 3KHVA 2AGEX 6GCHF 4UFEH 1NT1A 1YP9A 2ZHEH 4AGKA 1GHBG 2BXUH 4FOUC 1ZRKA 3SHAH 1VCPA 3AW0A 4YLQH 4CRDA 1O32A 3DT0H 1FQ3A 1Z7KA 4Y0ZE 1BT7A 4I8JA 1HAHH 2BD4A 1A3BH 3RM2H 1ZSKA 1LCYA 2YMSD 5AFZH 2FOGA 5C1XA 5E0GA 5JBBS 2C8YB 3SYJA 2F4LA 4AYVB 1KDQA 1SGRE 1VZQH 3BTFE 3UWIA 1P9UA 4O03A 5FCKA 3RXLA 3UNRA 1O3DA 3L33A 2G4TA 2VJ1A 3HK6B 4JK6A 1OYTH 1SKYE 2GD4B 1NU7B 3VB6A 3S69A 2VNTA 3OX7U 4Z1MD 1ZJDA 1K22H 2P3UB 1LHFH 2KFWA 1G30B 1GJ6A 1PQ5A 5I25A 1Q31A 3FAOA 1CGHA 4NWLA 4ZMAH 1LHCH 4B1TA 3SJ9A 3SGBE 3ITIA 2XTTB 1BMAA 4JYVH 2A31A 5A0AE 1N1LA 2XXLA 1RTKA 4JMYA 4O3TA 3IG6B 3M5OA 4D7FA 4H6SB 2KZ4A 1YCPK 2JIZD 2ZO3H 4DJZB 5IYTA 1AB9B 4B2AA 1BBRE 3AAVA 2GT7A 1WV7H 1DSTA 3SU0A 5DSFA 2FOAA 1CBWB 2L6OA 2HVYB 3F2GA 2XWBI 1ZTKA 1GVLA 3GY5A 3S7HB 1SQRA 1C5XB 1XKAC 1P02A 3TH2H 4ABFA 3P92A 1G3EA 1GJBB 2A4QA 5EODA 3ZZ9A 2EY4C 1GHXH 1C1NA 1TBZH 2A0QB 3M3TA 1GDQA 3VXEH 2Z9JA 3EGKH 4B6FA 1QRZA 4YESB 5C5NA 1C1QA 1GI5A 3I78A 2XCFA 1ZJKA 2PHBA 1EKBB 2F91A 1ZYOA 1O3MA 3BTGE 5T6GA 1A0JA 1C2MA 2AGIX 1TNIA 1EB2A 1GJ5H 1A5IA 4O3UA 5TCAA 3G01A 1Z71A 1O33A 3MH5A 5HGGA 1SVPA 1W3CA 3KYFA 1E38B 1HV7A 2BD8A 3L3TA 4IMQA 3U9AH 1O2GH 1PFXC 2C93B 4X8TH 3S7KB 1ZOMA 5A8YA 1DVAH 1MKXH 3KL6A 4AFUA 4K1TA 1GBJA 3SGAE 5EQSA 1TRMA 3F1SB 1GVZA 1WYKA 2KR7A 2J95A 2GCTC 1C9TA 3KCGH 2VGCC 1BMFD 2D1JA 4ABAA 8ESTE 1O2OA 1TX7A 3KQEA 5AF9H 1EAXA 1YWUA 2Q6FA 3GCOA 4AB9A 4RT0A 3EAJA 2OP9A 1NFYA 3URCA 5FXLA 1BRCE 5J4QA 3FVFB 2LELA 5EW2H 1ETRH 1FPCH 2A4OA 2HALA 2ZDVH 3LH3A 3GOVB 3UOPA 1BTUA 2FODA 3UY9A 1YPHE 1GDNA 3LPRA 1QIXB 1J9CH 3BTQE 1NRNH 1MZDA 1TA6A 1QBOA 4OS7A 2BDIA 3ZZDA 1Q3XA 2EEKA 1D3PB 4FU7A 1ELFA 1SGQE 1IHTH 4ZH8A 1DSUA 1GI2A 5LGOA 4YM9A 1EAWA 3QK1A 2ZA5A 2ZHFH 4Y71A 2A7JA 1ZSJA 3NWUA 5FX6A 3DFLA 1Z8RA 4GPGA 1BMMH 5E8EH 1OWHA 1X7AC 4J2YB 3TK9A 4MVNA 2HVXA 1YYY1 1Z6EA 1O3CA 3MO6A 1NESE 2AHME 3EA8A 1W13U 3A83A 5DP9A 1O3IA 2FI5E 1H8DH 1LVMA 1PJPA 2AIQA 1DXWA 4AB8A 1AFEH 4DIHH 1LVOA 1Y5AT 3F2FA 1C2KA 3D62A 3MNXA 2AGGX 3DSOA 4DGJA 3BTTE 3QDZB 3A84A 1P05A 1INCA 4YOGA 2ZP0H 5EW1H 1K1IA 1OPHB 2VWMA 1SLUB 1TRYA 1O5CB 1QZ8A 4RKJB 1FY3A 4OS4A 3SQHE 4Y8XA 3H7OA 2HPQH 3PV4A 2EI6A 1HRTH 4IGDA 3DCLA 1RXPA 3N7DA 3TH4H 1O2JA 2K0QA 1CE5A 3ZVGA 2BDYA 5GIBA 3A86A 3OEED 2OBOA 1GJ9B 2Z9KA 1NS3A 4R0IA 1AN1E 1O2TA 2ZTXA 1THSH 2H5DA 3SBKA 1SGNE 1EAUA 3GCHB 4IC6A 4Q4LA 4XDEA 3V13A 2ZFRH 4THNH 1L4ZA 4RN6A 3E0PB 3UUZA 2NU0E 2FOEA 3RC5A 4Y8YA 3OSYA 5DK1A 3TNTA 4DT4A 4NZQA 1IQHA 3BG4B 3EQ0H 1NC6A 1DE7H 4AN7A 1WOFA 2EI8A 3A8DA 3RMMH 1AKSB 1AVXA 4INHA 2BM2A 2VBCA 3HKJB 3F0OA 2NWNA 3LGIA 3U98H 4CRFA 2ZFPH 1GI1A 5ABWA 3A8CA 5F03A 2OTVA 4ZKNU 2G00A 4NA7A 2OD3B 3KNXA 1H4WA 1WUNH 3GY6A 3KGPA 1CT2E 2DUCA 1SGDE 3QTOH 3SQEE 1VCQA 4ZKOU 4VGCC 2AFQB 3TU7H 1B7XB 3MWIU 1XXDA 2FEQH 6CHAB 4O9VA 2RCEA 4NZLA 4WXVA 2BY5X 1A0HB 1V2PT 4Q63A 2KCAA 4WVPE 2DE8A 1Y3VA 2VWNA 5HM9A 2FOHA 1WCZA 2UWLA 3O8BA 1Z8JB 2GT8A 3SU6A 1V2UT 2ULLA 3K65B 3HGNA 3DFJA 1VGCB 1G3BA 1GHZA 1YY3A 2ZCLP 5A2MH 1BJVA 2UUJB 1S6FA 2JJ2D 1HDTH 2C8WB 1UHBA 1AVWA 1S5SA 1N8OB 1HLTH 1Y59T 4JZDH 4CR5A 1BA8B 2WV9A 1P09A 1GBFA 1HNEE 1UTKA 1GJ7B 4ZXXH 2WSSD 4U2WA 2Z3DA 1ESBA 1W14U 1Y3XA 1FV9A 4AFZA 4I8HA 1JMOH 1QFKH 1AQ7A 1HAVB 2C8XB 2CMYA 1BHXF 4KGAA 1AGJA 4IMZA 1DLKB 2GDEH 1JOUB 1UTQA 4M9FA 5KGOA 1RGQA 1NFWA 1OSSA 2A5KA 2TGDA 2WPKS 1IQEA 1MTNB 1FMGA 2Y6TA 2G51A 4P00A 1FAKH 2J9NA 3D23A 1ELTA 4CH2B 1O2ZA 3TGKE 2AERH 3OU0A 2FWWA 2ZU4A 3EE7A 1EJAA 3UNSA 1CT0E 1P2JA 2NU3E 2SGDE 1FX0B 3ZYEA 1LDTT 2H2ZA 5JYIA 1CU1A 1DUAA 3E8LA 4R8TB 2AMQA 1GWAA 4BXSA 3UPEA 1K9OE 4Q80A 1C5YB 3GICB 5EQQA 1HYLA 4MDSA 1EZQA 1DWBH 1P9SA 3ATIA 4Y6DA 1UVOA 2C3SA 4NIYA 3R3GB 3A81A 1CA0C 1GI0A 2IPHA 1MKWK 2GGVB 2J2UA 1C2LA 2BDHA 2CV3A 1ANCA 1HBTH 4GHTA 1O3NA 1G36A 3PWCA 5KECA 2KM0A 2HNTC 3ATMA 1GBBA 5FHTA 1W7XH 1BOQA 1CVWH 4E06H 3OTPA 3LGTA 3OYPA 1FY1A 3RXMA 1YPLH 1MTVA 4X2VA 5GJ4B 5T6FA 2R0LA 4HI3A 4YZUA 3NKKA 3FO8D 4RI0A 1QQUA 1BBRK 1YPEH 2TPIZ 2H1UA 2AH4X 1K28D 3M5LA 1G3DA 2VVUA 3HK3B 3SORA 3UQVA 1NZQH 2ZU5A 3BN9A 5DP6A 1BRUP 2IJOB 2WV5A 4NCYA 1O2IA 1C9PA 1O2YA 2XOKD 2ZZUH 1QURH 6ESTA 4K2YA 3E91A 2YOLA 1NRRH 3SV7A 2GJGA 2AS9A 1AZ8A 3A7YA 1GBMA 3RXOA 3WWFA 3M36A 2A7CA 1NM6A 1FY5A 4Y7BA 2BMGB 3DHKH 1KLIH 3QGJA 1OWKA 4OS2A 1Y3UA 1O5BB 4GSOA 1Y5UT 2C90B 4AG2A 4NIXA 3S9AA 3HGPA 4WXIA 3LGYA 3SV8A 4O97A 1UCYH 5DJ7A 5C0UA 1C2HA 2H9HA 2YMSB 2A4RA 1V2VT 4BTIB 3MI4A 1EFRD 4ISNA 4AX9H 1AVGH 4I32A 4BTTB 1GHWH 1F5KU 2ANMH 2B5TB 1HAYB 1SGPE 1ZHPA 3EE0B 3ENSB 1WXRA 1ANDA 3MH7A 4ABIA 3FFGA 1IQLA 4X1NU 5JDUB 4X8UH 3AW1A 3UREA 3ZYDA 3QWCH 1C5NH 1VJAU 1GMDF 2VIWA 1TMBH 3U1JB 5C5OA 1MH0A 2BLOA 3ZVDA 3W1EA 1C2FA 4ACBA 3NCLA 1SFIA 5E2OA 5EJLA 2F9OA 3GDUA 1SQAA 1AHTH 1WU1A 3MTYA 1BITA 1J8AA 2BY7X 2KAIA 2BQWB 1GBIA 3UFAA 4ABHA 1O3OA 2OCVB 4GUXA 1ELGA 1FIZA 2Z7FE 3OY5U 5C0TA 4D9QA 3JZ2B 4FUHA 2P95A 3FKSD 2QF4A 5TJXA 3I29A 4HTCH 1P06A 2OLGA 2Z9LA 4E05H 2HNTF 1QB6A 2D2DA 1GHAF 4IC5A 5ESTE 3AASA 1O2WA 2W7UA 1V2MT 3OTJE 1ZPZA 3SU3A 4RKOB 1GL0E 2BDAA 4LK4A 1CA8B 2GV7A 3PB1E 2ANYA 2F9PA 2XBWA 1OYQA 3F9FA 3Q77A 4CRGA 3ZZ3A 2OQ5A 1AU8A 4CBOA 2QAAA 1BTXA 5AVDA 1JWTA 4F4OC 1F5RA 2TGPZ 1C1UH 4JK5A 2KX4A 3RUOA 1HPGA 1COWD 3PLBA 4ABEA 3LGWA 4PROA 1SQOA 2Y7XA 4DOQA 5AFYH 2Y5HA 2BVXH 4JYUH 1PPCE 1CT4E 1SSXA 1T32A 1GBAA 1ZHRA 2BB4A 4CRBA 3PTBA 5HYOA 1GHAG 1T7CA 4Y8ZA 1CHOF 5GNDA 3U8OH 1NRPH 1AI8H 2HNTE 1BTZA 1MBQA 1NY22 3HPTB 4IS5A 1O3HA 4FUDA 2PUQH 3U1IB 2HRVA 1GBDA 4I8GA 2FXRA 2Z9GA 3W94A 2P59A 2HWLB 4SGBE 2V3HH 2VIDA 5HXFA 1BHXB 2OINA 1C5LH 3PV2A 2EI7A 2FTMA 2EA3A 1FZZA 1OHHD 1T4VH 1IAUA 1EJMA 1CHGA 2H9TH 3DSGA 2L74A 2ODPA 4ZCNA 4UDWH 2CJIA 1EPTB 1IOEA 2XNDD 4U32A 1QA7A 2I6QA 1ZMJA 5JPMH 2BDCA 1O3PB 1C2GA 1MQ5A 4Q7ZA 7ESTE 4MPVA 3SNBA 3RXFA 5HIZA 1IQJA 1E37B 2PKAA 3IWMA 1MKXK 3LOXA 5FPTA 2O8MA 2ZDAH 1KLTA 2G8TA 3ZVCA 2PKSB 4ZHAA 2VWLA 1BB0B 1KXCA 1QCPA 1ZZZA 1ABJH 1E34B 4AZ2B 1GI3A 1P10A 2WPLS 4B76A 1T8MA 2JH0D 1TONA 1ELAA 2BX4A 3E16B 1ANBA 2XYAA 2IOTA 4SGAE 1SOTA 1AFQB 4IW4E 1G2LA 2V3MA 1W10U 2OC0A 1QQ4A 3DSPA 1O3EA 4DCDA 4ESTE 1MBMA 1E35B 1O3LA 3A8AA 3QTVH 4XD7D 3VG8A 1N6YA 1TQ7B 1YCPM 2Z3CA 4UEHH 2ZCKP 2H6MA 2WPHS 2HLDD 1OP0A 1YC0A 3A85A 5EJZA 1O34A 1HB0B 1QB9A 1S85A 1C1SA 3FZZA 1O2NA 3LGVA 1B0EA 2XC4A 1GJCB 1SLXB 2FOBA 1QBVH 1KXFA 1SGEE 2DE9A 3RXSA 3STJA 3SOSA 4MNVA 1O2XA 4X2XA 2UUKB 2VIVA 5DN6D 1GL1A 5C1UA 1DICA 1L1GA 1QTFA 2UUYA 2A32A 1KXAA 1Z1JA 1MZAA 4X1RU 1P04A 3PROA 1CGIE 4X0WU 3U8RH 1TGTA 1TGCA 3N7EA 3K2UA 4LZ4B 5E0JA 3NPSA 1C1WH 1RIWB 1TNLA 1GPZA 1ID5H 4AC9A 2QV1A 2W26A 1OWEA 2B9LA 2ESTE 5DP5A 2OC8A 2PP6A 3BEIB 3BEFB 2F43B 3KQCA 4UONA 3MNSA 3BEUA 4H42U 4U30A 4FUJA 3E1XB 1LQEA 4E7RG 5GPIB 4ZKSU 2D26C 2KCYA 1KSNA 1AMHA 3RXGA 3AVZA 1E1RD 2V6NA 2PUXB 1O5EH 3SO3A 1OKXA 2ODQA 3C27B 3M7UA 3Q3KA 3TPIZ 3RDZA 3RMOH 1PQAA 4AFQA 4YXWD 1C5RA 3M5MA 1AZZA 2GX4A 1EZSC 1OP8A 4KELA 2FP7B 1XUIA 4LOYH 3N99A 4BAMB 1KXBA 1UCYK 1QA0A 1AUTC 1FNIA 3ESTA 4XE4A 1E79D 2ILNA 1GHYH 4FVBA 1ELDE 4XBDA 3LGUA 5EOKA 1LPKB 1UVUH 4E7NA 2QF0A 3ZZ5A 3B8JA 2QC2A 3PWBA 1O0DH 4CBNA 1GG6B 1EASA 3RMLH 3MOCA 2GMTC 1T8LA 4MLFB 2WUBA 2A7HA 3V3MA 1KIGH 1BZXE 2ZGJA 1Q2WA 2ZIQH 3TJOA 5LPFA 2ZU3A 4AYYB 4XOJA 4KP0A 1FUJA 5F8XA 2GCHG 4JZIA 3VB7A 1FDPA 3MNCA 1TPAE 5H4IB 4TY6A 2ZWLH 1C4U2 3T28A 3VGCB 1EATA 3PLKA 1ANEA 2FS8A 3A7TA 1EB1H 4TWYA 1AB9C 2H9EH 4KTSA 1UTLM 3O8DA 5C17A 4WY3A 4H4FA 1GCTB 2P94A 5EXMA 1K1MA 1P57B 5EXLA 2A2QH 3MU5A 3T5FH 2ZGXH 2SGFE 2ZGBH 3U69H 2BVRH 4INLA 1CHOG 3OAAD 3GISB 1EAIA 1OOKB 1SGTA 3F9EA 1V2KT 1B5GH 2WUCA 2ANKH 3ZZBA 1RJXB 4INKA 3SV2H 2OC1A 5T6DA 1G32B 1C2DA 4WMFA 5DO4H 1O36A 1J17T 4XRNA 3Q3XA 3STIA 1XVMA 3RXHA 1QB1A 5HMAA 4BANB 3WWBA 2FOFA 2ZFTA 3QZRA 3RXDA 2ZU2A 2G81E 6CHAC 3RLWH 2BHGA 1NBMD 3SV6A 4BNRA 2K8IA 2LNCA 2FYRA 2W7SA 1C2IA 3O8RA 5EIYA 5C67A 4I8KA 5G4BA 4A5TS 1TPSA 3MH6A 2Y81A 4K8BA 2Z9IA 2WPJS 2QY0B 3EA7A 2ZPSA 3TIUA 3KQBA 4Q7YA 2VVCA 1WBGB 3ZVAA 1TPOA 1JIRA 1XUKA 1PQ7A 1SGFA 4A1TA 4DG4A 2G4UA 3Q76A 3SNCA 1NROH 3ZV8A 5E2PA 1AE5A 1W0KD 3RM0H 1O2UA 4D7GA 2FIRH 1UK2A 2FOMB 1QHRB 1D6WA 2JJ1D 1A61H 1RS0A 1JBUH 4WMDA 1P2OA 2WV4A 1BRAA 2PTCE 1TABE 1GI6A 3F3BA 4A7IB 5CHBA 1TNGA 4X2YA 2PTNA 5PTPA 1V2WT 5DP8A 3URDA 3ZVBA 3V7TA 1DT2A 2FMJA 3UOUA 2WPMS 3HATH 5GDSH 2F3CE 1O3BA 9LPRA 4JZFH 1J14A 4X2WA 1PPGE 1QR3E 3OE7D 4TSFD 3FP7E 4Q7XA 1DWCH 3LH1A 5DKMA 1P03A 3S9CA 1FY4A 1GI4A 2V3OH 1SGYE 2THFB 1T8NA 4Y76A 1DS2E 1TOMH 2FI3E 2YNAA 3A88A 1GBKA 1V2RT 3BIVH 2BZAA 4M7GA 3CS0A 1SLWB 1VGCC 3SNEA 1AWFH 1ZGVA 1AKSA 3QUMP 2Y5FA 4GVUA 1S0QA 4DVAU 4ZKRU 1O5GH 2W6JD 1OXGA 3OEHD 3SJKA 4FUIA 1D3DB 1NRSH 1QRWA 1XKBC 1K1OA 1YLNA 1JXPA 3ATLA 1ZMLA 4X1PU 4FVDA 4Z0KA 5C1YA 3UIRA 3L6PA 1DWEH 1CA0B 3RP2A 5EXNA 3RXCA 1QBNA 3TGIE 1D4PB 4I86A 5EJ1A 1KMHB 2BLWA 1GDUA 8KME2 2V7QD 2F9UA 1MMJN 1C5MD 1GHVH 1FJSA 1SR5C 2SNWA 1OX1A 3LIWA 1VITG 2PW8H 2FPZA 1A2CH 2FX6A 1GMHG 2R0KA 3UNQA 1BDAA 1DM4B 4D9RA 1W0JD 1BJUA 1GBLA 3RLYH 2QIQA 1UTMA 3SI4H 3UWJH 2ALVA 1ELVA 3ELAH 1OWJA 1YPGH 2SFAA 1K1LA 3PLPA 2FS9A 1SOZA 2W5EA 1LHGH 1C1OA 2A45B 2B8OH 1KTTB 1BUIA 1FN8A 1TMUH 2WINI 3RXUA 1H8HD 3A87A 3A7ZA 1TNKA 4KTUA 3NXPA 3GY8A 5JBCS 4ZHMU 2HGTH 1Y3YA 1P2QA 3A7WA 3E3TA 5EPNA 3UAIC 1TWXB 1XUJA 1N8OC 4B74A 4B71A 2M2AA 1OP2A 2KCOA 5JB8S 4B73A 5GCHG 2J34A 1UVPA 1HAGE 1O2SA 1O5AB 1HXFH 2Y5GA 3GDVA 1GVKB 1K2I1 1F0UA 1MABB 1K21H 2QA9E 3A7VA 3TJNA 3ZZCA 4X1SU 1EX3A 2Z94A 3GCNA 3AK5A 3MO9A 2LP6A 1HJ8A 1HAOH 5L6NH 2A2XH 1XVOA 2VWOA 4AGJA 1WDIA 1UO6A 2ZDLA 2FDAA 2PKAB 2G5VA 2VINA 4ISIH 1SGCA 1C5QA 3A7XA 3VB3A 2FLBH 1EUFA 1W2KH 4VGCB 3ZV9A 1P2MA 2V35A 3GCTF 3VGCC 3A89A 1S84A 5LPRA 2Y7ZA 1G37A 1O30A 4HZHA 4B75A 2Y80A 1C1RA 1HCGA 1H9IE 1OS8A 1SG8B 2RDLA 4WMEA 1E0FD 1NFUA 5HKKD 1EZUC 4TPYA 1A7SA 3RXQA 5F53A 2CN0H 1A5GH 2G55A 3BTME 2EC9H 3S9BA 1FONA 2R9PA 1QJ6B 2JH6D 1O2QA 4ZUHA 2JH5D 4NA9H 5BRRE 1F92A 1SI5H 2RA3A 1O35A 5EPYA 4JZ1A 3PO1C 4HGCA 2FTLE 1MCTA 2UUFB 2J92A 8GCHF 3TJUA 1S82A 4FUCA 4D8NA 2VIQA 3TK6A 2ZHQH 2OK5A 1BTPA 1ACBE 4K60A 4OS6A 7GCHG 1ZPCA 2GV6A 4BAHB 2VU8E 4K1SA 3R0FA 1GMCG 2GTBA 4TPIZ 2WPDD 1F0RA 3T29A 4JCNA 2GCHF 5CDFE 1O38A 2GP9B 2FM2A 2IN2A 1H9LB 4LXBH 2SGEE 4TY7A 3E0NB 2H5CA 3F0PA 3FN8A 2PR3A 5FCRA 1TBRH 2CHAB 5F8ZA 1NU9A 5A09A 3VEQB 1DFPA 1XX9A 5ETXA 1GMCF 1HAIH 1O5DH 3KQ5A 3Q00A 2UWPA 1W11U 7GCHF 1TB6H 1ZPBA 3M35A 1O3FA 5F6MA 1SBWA 3B9FH 3FANA 3PRBA 1MTSA 2ZFSA 2R3UA 1TFXA 2M5TA 3ZZ7A 4OGXA 3LC3A 3RXKA 1EPTA 3MMGA 4MTBA 1P3EA 1WSSH 4DW2U 2J5UA 2QN5T 5A0CA 1W7GH 2QGRA 3SV9A 1NO9H 1ESTA 5AHGH 1KDQB 4GAWA 2QYIA 3SUFA 5F8TA 3MU1A 5HIYA 1ABIH 1ORFA 2LPRA 4BTUB 1THPB 2FOCA 2PGQB 3E6PH 3RXPA 1YCPH 1CO7E 3KEEA 1IQFA 4I33A 3JZ1B 3QO6A 3PM3A 4I8LA 1S83A 4CHAB 1T8OA 1Z6JH 3M7QA 3MU4A 3KIDU 1TLDA 5C94A 1ARBA 2QXJA 2TBSA 3BG8A 5CHAB 4ASUD 2I6SA 2FZZA 1FLEE 1PYTC 1FI8A 1GMDG 2AEIH 1SGFG 1P0SH 4Z6AH 5L2YH 3M3VA 3V0XA 1F0TA 4ABGA 1SQTA 2ZECA 4ABJA 4DY7B 1WQVH 4X8VH 5EU8A 3IITA 2WZQA 2ASUB 3UTUH 2JETB 3P8GA 5TCCA 1HAVA 2NU1E 5IK2D 1SB1H 1XUFA 3P17H 3EDXB 1ZTLA 2CK3D 5EQRA 1YGCH 5IDKA 4K69A 1SPJA 1T31A 1YKTA 1PPEE 1AD8H 3TK5A 4Y10E 1ARCA 3WW7A 2J98A 3D49H 5ESBA 4WH8A 4ZAEA 4JZEH 3F68H 1C5TA 4X6MA 1O2KA 2QF5A 3AAUA 2KAIB 4HG6A 4UD9H 4NIWA 1DY9A 3RU4T 1DX5M 1MTUA 1EQ9A 1V3XA 2VVVA 2WPIS 3CNRA 4UFGH 5B6OA 1MKWH 3PTNA 1TMTH 3RU4D 1CQQA 3M5NA 1Z1IA 2CXVA 3FZDA 1HAZB 4YT7H 5C20A 2BY8X 2QE7D 1THRH 4YLUA 1SMFE 3T2NA 2XC0A 3A8BA 4FUEA 4NFEA 2ZTYA 5DP7A 3TLOA 1C5VA 2TRMA 5DGJA 1JRSA 2AMDA 2SGAA 4TT3D 2P8OB 1TAWA 2Q6DA 3W95A 1PPZA 1GG6C 1YPHC 1PPFE 1DPOA 1K1JA 2A5AA 5DP3A 4NG9H 3H7TA 4DT7B 3A82A 1LHEH 1D3QB 1EXFA 5T3HA 3V12A 4IN2A 1ELCA 1O3JA 1RD3B 1TGBA 1CSOE 1GBTA 2KCPA 1S0RA 2XRCA 2G52A 3MFJA 2BTCE 5SGAE 3ZZ6A 4MNWA 4FU8A 1A4WH 4X6PA 2A4GA 2BY9X 4YO9A 3H09A 1C5WB 1GI7B 3K6ZA 4FUBA 3SZNA 2SGQE 1D9IA 2VB0A 2WYGA 4HFPB 1O39A 2ZC9H 3BSQA 3K6YA 4FETA 3SU2A 3UR9A 2O8UA 4RT1A 2R3YA 1Y8TA 1W8BH 3RC6A 1TE0A 1F2SE 2VH0A 1EOLA 1YF4A 3SGQE 4ABBA 2QCYA 1S81A 1ZSLA 1GJ4H 2A1DB 1TA2A 2PLXA 1SFQB 1LVBA 4RSPA 1C1MA 2STAE 3RXEA 4NSYA 2BQ6B 3M3SA 2ZHWH 2B7DH 3RXRA 4MQAA 3Q3YA 3T27A 3PMJA 1SL3A 3PYHA 4NWKA 1UTPA 2VGCB 2ZCHP 5EGMA 5KEDA 1LMWB 2FLRH 1FPHH 4AOQA 1P2KA 4ZXYH 1W0YH 5JBTA 5J4SA 1P3CA 3LJJA 4GCHF 1YM0A 3K9XB 1HAXB 1HFDA 2R2WU 4J1YA 2GKVE 1WQSA 4A92A 4FU9A 2NU4E 1VJ9U 1A3EH 4GCHG 1F5LA 2D8WA 1HJAC 1DDJA 1EOJA 3MU8A 1TGSZ 1TOCB 1UW7A 3VPKA 5BPEA 2OC7A 2XC5A 1MCVA 4OGYA 4Y0YE 2RFKC 3SJOA 4TWWA 3TJVA 4F49A 1H8IH 1IQNA 3RXVA 3RXJA 3QZQA 2BLQA 2O9QA 3DA9B 1Y3WA 2C4FH 2BVSH 2CHAC 4JYTA 1MD7A 3LC5A 1KTSB 2QXIA 3FP6E 2FI4E 1MTNC 1P11E 1J16A 1MU8B 4UE7H 3GCHC 3CENA 2XBXA 2BD3A 8GCHG 3OFND 1XUHA 3P70B 2BLVA 2W3KA 4GHQA 4MPXA 5JBAS 3MNBA 1E36B 2PV9B 2SGPE 4Y7AA 3BF6H 4I31A 3P8NA 2BOHB 1ELEE 2ZFQH 1O37A 3M61U 2BDBA 1VCWA 1QNJA 1TPPA 1A5HA 2BD5A 3PV5A 2V0BA 3VB4A 2QXHA 1BIOA 1C5OH 1GBCA 1UK4A 1UTNA 5GXPA 2W6ID 2ZDNA 2CF8H 3N7OA 3LT3A 1GCTC 4WWYA 3T26A 3F9HA 1D3TB 3GCTG 1F7ZA 4ZHLU 4AFSA 3M37A 7LPRA 4FUGA 2TGAA 2BY6X 2BYAX 1B0FA 1KXEA 1KXDA 1KYNA 1L2EA 2GZ7A 1P8VC 2WHXA 2FX4A 3SUGA 1TALA 3TGJE 5K0HA 1GHBF 3KN2A 1HGTH 2FESH 3GYLB 2XCNA 1FAXA 1GI8B 5FX5A 1V2ST 2Q1JA 1O5FH 1AY6H 1FY8E 2ZQ1A 5FPYA 1TNJA 4X6NA 3ZZAA 2AIPA 1DUEA 3GY4A 1GJAB 4XBBA 3MH4A 1CGJE 5JB9S 1QL8A 1SHYA 2RG3A 1YBWA 4XBCA 3FOAA 5A0BA 2GZ8A 2ODYB 2P93A 1EPTC 3GS9A 1LPGB 2G5NA 3DUXH 4OM9A 3TH3H 1C4Y2 2ZDMA 3ZZ8A 3BV9B 1S6HA 2ZTZA 1O2MA 5T1VA 1FXYA 3SI3H 1Z8GA 1IHSH 1UTOA 3DD2H 1YPMH 4ISLA 1PPBH 2ZFFH 3ODDA 1MU6B 1TRNA 3RU4E 3H5CB 4CRCA 1DLEA 2P16A 3C1KA 1RTLA 2GVFA 2F9VA 1YLDA 1VITF 2FYQA 1ZMNA 3PMHB 2AYWA 3GY3A 3BIUH 1MAYA 3NRLA 5DP4A 2K1QA 1QRXA 1DY8A 1LVYA 4OS1A 1GCDA 2PSXA 1PPHE 2YMSC 1UK3A 4WF8A 3EA9A 1O3KA 2GCTB 1WTHD 5FAHA 1MUEB 3TVJB 4MG3A 3SUEA 5EG4A 1WTGH 4A6LA 1UJ1A 5DPAA 1IQIA 1C1VH 2GZ9A 4CREA 4DIIH 4QT8C 3SU1A 1HJ9A 2IPQX 1E1QD 1IQMA 1DWDH 4NFFA 4KKDA 2HPPH 4ACAA 2OXSA 1P01A 1UCYE 2PFEA 3EYDA 1MTWA 2ZGCA 4MNYA 5A8ZA 1LHDH 1AE8H 1DXPA 1N6XA 1C5UA 1O2PA 3SJIA 2BD7A 1A1RA 1LQDB 3T25A 3ATKA 2AMPA 4ISHH 1LPZB 1ETTH 8LPRA 2BDGA 4NGAH 3RXBA 1LTOA 1AO5A 2XBVA 3D65E 1AUJA 1TGNA 5CE1A 3BG4C 1C5PA 1L1JA 2O8TA 3B23B 1V2JT 3KYGA 2CF9H 4I7YH 1GI9B 3ZZ4A 2BXTH 1QL9A 2ZF0H 3P95A 3F9GA 1H9HE 1EP5A 2A5IA 1XMNB 1JRTA 1BBRH 2ZKSA 1KLJH 1ZR0A 3SN8A 3O8CA 5CHAC 2P8OC 4WH6A 1TX8A 1OWIA 1UVSH 1O3AA 4ISOA 2FO9A 1ETSH 4LZ1H 1GGDB 4AG1A 1QJ1B 5L2ZH 1WAYB 1L0ZA 4YTAA 2JETC 4WJG2 3P8OA 2ZNKH 1C5ZB 4A1VA 3MYWA 1QJ7B 5A8XA 2ZG0H 2QF3A 3BTEE 1BMLA 1VR1H 2F83A 5FBEA 4NIVA 5LH8A 4XFQA 1A46H 1UHBB 1M9UA 3VB5A 2R2MB 2O8LA 3QGNB 1D6RA 1K1NA 1Z8IB 5HM2A 1GJDB 1G2MA 3NK8A 3PMAB 1UTJA 1P2IA 1RTFB 2J4IA 3GY7A 2ANWA 1K0HA 1O3GA 1RRKA 1HXEH 1O2RA 1GBHA 4AORA 1RFNA 1EZXC 3ATWA 3WY8A 4BAQB 1OWDA 2C8ZB 3VFEA 2Z3EA 4IN1A 5B6LA 1KY9A 1PQ8A 3F2HA 1ESAA 1K1PA 1T4UH 2ZU1A 1BRBE 2WYJA 7KMEH 6GCHG 1SC8U 3ODFA 1C1PA 3VXFH 1C2EA 1GMHF 2HOBA 4K5ZA 1GJ8B 1BMNH 1HIAA 2NU2E 1HAPH 5FPSA 1LKBA 3P8FA 2BOKA 4XSKU 1ZLRA 3RXTA 2O8WA 1L1NA 4BXWA 1IQGA 4BOHA 3LJOA 3ZVFA 6LPRA 2EQNA 1BTHH 1AFQC 3UB0A 3MQKC 1ZGIA 2PGBB 4F55A 4X6OA 4ZROA 3RXIA 1MQ6A 1HJAB 4X8SH 2Q6GA 2ALPA 3E90B 1TIOA 2SNVA 1RIWC 3F6UH 4GLYA 2RDEA 1EP6A 2HLCA 4UFDH 3S0NA 4NSVA 3T62A 1Y5BT 3MO3A 1F0SA 1BCUH 1NBME 1XM1A 4CH8B 3FP8E 1J15A 1H1BA 1HIAB 3SU4A 1HUTH 3UR6A 2QXGA 1AIXH 3TITA 3LDXH 3RXAA 3NZIA 2PWXA 3PRDA 3SU5A 3BTDE 5C3NA 2J97A 1S6LA 1P12E 3SNDA 1O2VA 2Z6BD 4BAKB 2JDID 5I46H 1W0ZU 1DANH 4DURA 1AWHB 4YOJA 2BQ7B 3CP7A 2VH6A 1MD8A 1FIWA 3ZIAD 3LKWA
chains in the Genus database with same CATH topology
2GMTB 1V2NT 3QN7A 1JIMA 1ZHMA 5GWZA 1XXFA 1EJNA 4Q2KA 1YPJH 1YPKH 3LU9B 2YNBA 3MU0A 4H6TA 3LONA 3QLPH 4MNXA 1U6QA 3RC4A 4BAOB 1NN6A 2ZPRA 4FXGH 1NTPA 1VITH 1TQ0B 2W3IA 3HKIB 2ZHDA 3GYMA 2STBE 4K3JA 3BTHE 1UMAH 2ZI2H 2TIOA 3GDSA 5GCHF 2B0FA 2ZQ2A 2F9BH 2ZPQA 2XW9A 1SGIB 2UWOA 2RA0A 1C5SA 3BTWE 4CHAC 4TYDA 3BTKE 4YT6H 5LPEA 1L4DA 1MAXA 1O2LA 1TBQH 2F9NA 3SHCH 2OBQA 5FBIA 1O31A 4MPUA 3I77A 2CGAA 2J38A 4OS5A 1IQKA 1V6DA 1V2QT 2VIOA 3OY6U 2BD2A 5CMXH 3CS7A 1TX6A 2ZGHA 5E0HA 5C2ZA 4Y79A 1PYTD 3SW2B 4NA8A 1SHHB 1QGFA 1W12U 1DOJA 3RMNH 4A1XA 1XUGA 5DG6A 3ZVEA 2GDDA 1ELBA 2TGTA 1C4V2 1LKAA 4U01A 2J94A 1ZRBA 4K8YA 1O2HA 4Y11E 4CRAA 3MHWU 4ABDA 2BX3A 1LO6A 2OUAA 5K7RA 2BZ6H 1C1TA 4MPWA 9ESTA 3UQOA 2Y82A 3P6ZB 3SUDA 2JKHA 3SNAA 2XNIA 1YLCA 4FUFA 2P3FH 1QY6A 1BTWA 3PO1B 2ZEBA 3KF2A 3GY2A 1V2TT 1BQYA 1DITH 1GGDC 1V2OT 2BD9A 1NRQH 1QL7A 4B2BA 4D76A 2XBYA 3A80A 4X1QU 1G9IE 4UFFH 4IBLH 2ZDKA 1TYNA 2P3TB 2PSYA 2VIPA 1ZTJA 2OQUA 1CBWC 1C2JA 1G3CA 3PMBB 2XWAA 1TNHA 1BTYA 4KTCA 3KQDA 3TNSA 3QX5H 1V2LT 3U8TH 4YOIA 4CR9A 1FN6A 4B2CA 1NPMA 1SLVB 3NUMA 1P2NA 2PKSC 1UVTH 1GBEA 3M7TA 1NFXA 5L30H 1A0LA 4K1EA 3SJ8A 4ASHA 3KHVA 2AGEX 6GCHF 4UFEH 1NT1A 1YP9A 2ZHEH 4AGKA 1GHBG 2BXUH 1ZRKA 3SHAH 1VCPA 3AW0A 4YLQH 4CRDA 1O32A 3DT0H 1FQ3A 1Z7KA 4Y0ZE 1BT7A 4I8JA 1HAHH 2BD4A 1A3BH 3RM2H 1ZSKA 1LCYA 5AFZH 2FOGA 5C1XA 5E0GA 5JBBS 2C8YB 4AYVB 1KDQA 1SGRE 1VZQH 3BTFE 3UWIA 1P9UA 4O03A 5FCKA 3RXLA 3UNRA 1O3DA 3L33A 2VJ1A 2G4TA 3HK6B 4JK6A 1OYTH 2GD4B 1NU7B 3VB6A 3S69A 2VNTA 3OX7U 1ZJDA 1K22H 2P3UB 1LHFH 1G30B 1GJ6A 1PQ5A 5I25A 1Q31A 3FAOA 1CGHA 4NWLA 4ZMAH 1LHCH 4B1TA 3SJ9A 3SGBE 3ITIA 2XTTB 1BMAA 4JYVH 2A31A 5A0AE 1N1LA 2XXLA 1RTKA 4JMYA 4O3TA 3IG6B 3M5OA 4D7FA 4H6SB 1YCPK 4DJZB 2ZO3H 5IYTA 1AB9B 4B2AA 1BBRE 3AAVA 2GT7A 1WV7H 1DSTA 3SU0A 2FOAA 1CBWB 2XWBI 1ZTKA 1GVLA 3GY5A 3S7HB 1C5XB 1XKAC 1P02A 3TH2H 4ABFA 3P92A 1G3EA 1GJBB 2A4QA 5EODA 3ZZ9A 2A0QB 1GHXH 1C1NA 1TBZH 3M3TA 3VXEH 1GDQA 2Z9JA 3EGKH 1QRZA 4YESB 5C5NA 1C1QA 1GI5A 3I78A 2XCFA 1ZJKA 2PHBA 1EKBB 2F91A 1ZYOA 1O3MA 3BTGE 5T6GA 1A0JA 1C2MA 2AGIX 1TNIA 1EB2A 1GJ5H 1A5IA 4O3UA 5TCAA 3G01A 1Z71A 1O33A 3MH5A 5HGGA 1SVPA 1W3CA 1E38B 1HV7A 2BD8A 3L3TA 4IMQA 3U9AH 1O2GH 1PFXC 2C93B 4X8TH 3S7KB 1ZOMA 5A8YA 1DVAH 1MKXH 3KL6A 4AFUA 4K1TA 1GBJA 3SGAE 5EQSA 1TRMA 3F1SB 1GVZA 1WYKA 2J95A 2GCTC 1C9TA 3KCGH 2VGCC 2D1JA 4ABAA 8ESTE 1O2OA 1TX7A 3KQEA 5AF9H 1EAXA 2Q6FA 3GCOA 4AB9A 3EAJA 2OP9A 1NFYA 3URCA 5FXLA 1BRCE 5J4QA 3FVFB 5EW2H 1ETRH 1FPCH 2A4OA 2HALA 2ZDVH 3LH3A 3GOVB 3UOPA 1BTUA 2FODA 3UY9A 1YPHE 1GDNA 3LPRA 1QIXB 1J9CH 3BTQE 1NRNH 1MZDA 1TA6A 1QBOA 4OS7A 2BDIA 3ZZDA 1Q3XA 2EEKA 1D3PB 4FU7A 1ELFA 1SGQE 1IHTH 4ZH8A 1DSUA 1GI2A 5LGOA 4YM9A 1EAWA 3QK1A 2ZA5A 2ZHFH 4Y71A 2A7JA 1ZSJA 3NWUA 5FX6A 3DFLA 1Z8RA 4GPGA 1BMMH 5E8EH 1OWHA 1X7AC 4J2YB 3TK9A 4MVNA 2HVXA 1YYY1 1Z6EA 1O3CA 3MO6A 1NESE 3EA8A 1W13U 3A83A 5DP9A 1O3IA 2FI5E 1H8DH 1LVMA 1PJPA 2AIQA 1DXWA 4AB8A 1AFEH 4DIHH 1LVOA 1Y5AT 1C2KA 3D62A 3MNXA 2AGGX 4DGJA 3BTTE 3QDZB 3A84A 1P05A 1INCA 4YOGA 2ZP0H 5EW1H 1K1IA 1OPHB 2VWMA 1SLUB 1TRYA 1O5CB 4RKJB 1FY3A 4OS4A 3SQHE 4Y8XA 3H7OA 2HPQH 3PV4A 2EI6A 1HRTH 4IGDA 1RXPA 3TH4H 1O2JA 1CE5A 3ZVGA 2BDYA 5GIBA 3A86A 2OBOA 1GJ9B 2Z9KA 1NS3A 4R0IA 1AN1E 1O2TA 2ZTXA 1THSH 2H5DA 3SBKA 1SGNE 1EAUA 3GCHB 4IC6A 4XDEA 3V13A 2ZFRH 4THNH 1L4ZA 4RN6A 3E0PB 3UUZA 2NU0E 2FOEA 3RC5A 4Y8YA 3OSYA 5DK1A 3TNTA 4NZQA 1IQHA 3BG4B 3EQ0H 1NC6A 1DE7H 4AN7A 1WOFA 2EI8A 3A8DA 3RMMH 1AKSB 1AVXA 4INHA 2BM2A 3HKJB 2NWNA 3LGIA 3U98H 4CRFA 2ZFPH 1GI1A 5ABWA 3A8CA 5F03A 2OTVA 4ZKNU 2G00A 4NA7A 2OD3B 3KNXA 1H4WA 1WUNH 3GY6A 3KGPA 1CT2E 2DUCA 1SGDE 3QTOH 3SQEE 1VCQA 4ZKOU 4VGCC 2AFQB 3TU7H 1B7XB 3MWIU 1XXDA 2FEQH 6CHAB 4O9VA 2RCEA 4NZLA 4WXVA 2BY5X 1A0HB 1V2PT 4WVPE 2DE8A 1Y3VA 2VWNA 5HM9A 2FOHA 1WCZA 2UWLA 3O8BA 1Z8JB 2GT8A 3SU6A 1V2UT 2ULLA 3K65B 3HGNA 3DFJA 1VGCB 1G3BA 1GHZA 2ZCLP 5A2MH 1BJVA 2UUJB 1S6FA 1HDTH 2C8WB 1UHBA 1AVWA 1S5SA 1N8OB 1HLTH 1Y59T 4JZDH 4CR5A 1BA8B 1P09A 1GBFA 1HNEE 1UTKA 1GJ7B 4ZXXH 4U2WA 2Z3DA 1ESBA 1W14U 1Y3XA 1FV9A 4AFZA 4I8HA 1JMOH 1QFKH 1AQ7A 1HAVB 2C8XB 2CMYA 1BHXF 4KGAA 1AGJA 4IMZA 1DLKB 2GDEH 1JOUB 1UTQA 1RGQA 1NFWA 1OSSA 2A5KA 2TGDA 2WPKS 1IQEA 1MTNB 1FMGA 2Y6TA 2G51A 1FAKH 2J9NA 3D23A 1ELTA 4CH2B 1O2ZA 3TGKE 2AERH 3OU0A 2FWWA 2ZU4A 1EJAA 3UNSA 1CT0E 1P2JA 2NU3E 2SGDE 3ZYEA 1LDTT 2H2ZA 5JYIA 1CU1A 1DUAA 3E8LA 4R8TB 2AMQA 1GWAA 4BXSA 3UPEA 1K9OE 4Q80A 1C5YB 3GICB 5EQQA 1HYLA 4MDSA 1EZQA 1DWBH 1P9SA 3ATIA 4Y6DA 1UVOA 2C3SA 4NIYA 3R3GB 3A81A 1CA0C 1GI0A 2IPHA 1MKWK 2GGVB 2J2UA 1C2LA 2BDHA 2CV3A 1ANCA 1HBTH 4GHTA 1O3NA 1G36A 3PWCA 2HNTC 3ATMA 1GBBA 5FHTA 1W7XH 1BOQA 1CVWH 4E06H 3OYPA 3LGTA 1FY1A 3RXMA 1YPLH 1MTVA 4X2VA 5GJ4B 5T6FA 2R0LA 4HI3A 4YZUA 3NKKA 1QQUA 1BBRK 1YPEH 2TPIZ 2H1UA 2AH4X 1K28D 3M5LA 1G3DA 2VVUA 3HK3B 3SORA 3UQVA 1NZQH 2ZU5A 3BN9A 5DP6A 1BRUP 2IJOB 2WV5A 4NCYA 1O2IA 1C9PA 1O2YA 2ZZUH 6ESTA 1QURH 4K2YA 3E91A 2YOLA 1NRRH 3SV7A 2AS9A 1AZ8A 3A7YA 1GBMA 3RXOA 3M36A 2A7CA 1NM6A 1FY5A 4Y7BA 2BMGB 3DHKH 1KLIH 3QGJA 1OWKA 4OS2A 1Y3UA 1O5BB 4GSOA 1Y5UT 2C90B 4AG2A 4NIXA 3S9AA 3HGPA 4WXIA 3LGYA 3SV8A 4O97A 1UCYH 5DJ7A 1C2HA 2H9HA 2A4RA 1V2VT 4BTIB 3MI4A 4ISNA 4AX9H 1AVGH 4I32A 4BTTB 1GHWH 1F5KU 2ANMH 2B5TB 1HAYB 1SGPE 1ZHPA 3EE0B 3ENSB 1ANDA 3MH7A 4ABIA 3FFGA 1IQLA 4X1NU 5JDUB 4X8UH 3AW1A 3UREA 3ZYDA 3QWCH 1C5NH 1VJAU 1GMDF 2VIWA 1TMBH 3U1JB 5C5OA 1MH0A 2BLOA 3ZVDA 1C2FA 3NCLA 1SFIA 5E2OA 2F9OA 3GDUA 1SQAA 1AHTH 1WU1A 3MTYA 1BITA 1J8AA 2BY7X 2KAIA 2BQWB 1GBIA 3UFAA 4ABHA 1O3OA 2OCVB 4GUXA 1ELGA 1FIZA 2Z7FE 3OY5U 4D9QA 3JZ2B 4FUHA 2P95A 5TJXA 3I29A 4HTCH 1P06A 2OLGA 2Z9LA 4E05H 2HNTF 1QB6A 2D2DA 1GHAF 4IC5A 5ESTE 3AASA 1O2WA 2W7UA 1V2MT 3OTJE 1ZPZA 3SU3A 4RKOB 1GL0E 2BDAA 4LK4A 1CA8B 2GV7A 3PB1E 2ANYA 2F9PA 2XBWA 1OYQA 3F9FA 3Q77A 4CRGA 3ZZ3A 2OQ5A 1AU8A 4CBOA 2QAAA 1BTXA 5AVDA 1JWTA 4F4OC 1F5RA 2TGPZ 1C1UH 4JK5A 3RUOA 1HPGA 3PLBA 4ABEA 3LGWA 4PROA 1SQOA 2Y7XA 4DOQA 5AFYH 2Y5HA 2BVXH 4JYUH 1PPCE 1CT4E 1SSXA 1T32A 1GBAA 1ZHRA 2BB4A 4CRBA 3PTBA 5HYOA 1GHAG 1T7CA 4Y8ZA 1CHOF 3U8OH 1NRPH 1AI8H 2HNTE 1BTZA 1MBQA 1NY22 3HPTB 4IS5A 1O3HA 4FUDA 2PUQH 3U1IB 2HRVA 1GBDA 4I8GA 2FXRA 2Z9GA 3W94A 2P59A 2HWLB 4SGBE 2V3HH 2VIDA 5HXFA 1BHXB 2OINA 1C5LH 2EI7A 2EA3A 1FZZA 2FTMA 1T4VH 1IAUA 1EJMA 1CHGA 2H9TH 2ODPA 4UDWH 2CJIA 1EPTB 1IOEA 4U32A 1QA7A 2I6QA 1ZMJA 5JPMH 2BDCA 1O3PB 1C2GA 1MQ5A 4Q7ZA 7ESTE 4MPVA 3SNBA 3RXFA 1IQJA 1E37B 2PKAA 3IWMA 1MKXK 3LOXA 5FPTA 2O8MA 2ZDAH 1KLTA 2G8TA 3ZVCA 2PKSB 4ZHAA 2VWLA 1BB0B 1KXCA 1QCPA 1ZZZA 1ABJH 1E34B 4AZ2B 1GI3A 1P10A 2WPLS 4B76A 1T8MA 2JH0D 1TONA 1ELAA 2BX4A 3E16B 1ANBA 2XYAA 2IOTA 4SGAE 1SOTA 1AFQB 4IW4E 1G2LA 1W10U 2OC0A 1QQ4A 1O3EA 4DCDA 4ESTE 1MBMA 1E35B 1O3LA 3A8AA 3QTVH 1N6YA 1TQ7B 1YCPM 2Z3CA 4UEHH 2ZCKP 2H6MA 2WPHS 1OP0A 1YC0A 3A85A 1O34A 1HB0B 1QB9A 1S85A 1C1SA 3FZZA 1O2NA 3LGVA 1B0EA 2XC4A 1GJCB 1SLXB 2FOBA 1QBVH 1KXFA 1SGEE 2DE9A 3RXSA 3STJA 3SOSA 4MNVA 1O2XA 4X2XA 2UUKB 2VIVA 1GL1A 5C1UA 1DICA 1L1GA 1QTFA 2UUYA 2A32A 1KXAA 1Z1JA 1MZAA 4X1RU 1P04A 3PROA 1CGIE 4X0WU 3U8RH 1TGTA 1TGCA 3K2UA 4LZ4B 5E0JA 3NPSA 1C1WH 1RIWB 1TNLA 1GPZA 1ID5H 2QV1A 2W26A 1OWEA 2B9LA 2ESTE 5DP5A 2OC8A 3BEIB 3BEFB 3KQCA 4UONA 3MNSA 3BEUA 4H42U 4U30A 4FUJA 3E1XB 1LQEA 4E7RG 5GPIB 4ZKSU 2D26C 1KSNA 1AMHA 3RXGA 3AVZA 2V6NA 2PUXB 1O5EH 3SO3A 1OKXA 2ODQA 3C27B 3M7UA 3Q3KA 3TPIZ 3RDZA 3RMOH 1PQAA 4AFQA 1C5RA 3M5MA 1AZZA 2GX4A 1EZSC 1OP8A 4KELA 2FP7B 1XUIA 4LOYH 4BAMB 1KXBA 1UCYK 1QA0A 1AUTC 1FNIA 3ESTA 4XE4A 2ILNA 1GHYH 4FVBA 1ELDE 4XBDA 3LGUA 5EOKA 1LPKB 1UVUH 4E7NA 2QF0A 3ZZ5A 3B8JA 2QC2A 3PWBA 1O0DH 4CBNA 1GG6B 1EASA 3RMLH 3MOCA 2GMTC 1T8LA 4MLFB 2WUBA 2A7HA 3V3MA 1KIGH 1BZXE 2ZGJA 1Q2WA 2ZIQH 3TJOA 5LPFA 2ZU3A 4AYYB 4XOJA 4KP0A 1FUJA 5F8XA 2GCHG 4JZIA 3VB7A 1FDPA 3MNCA 1TPAE 5H4IB 4TY6A 2ZWLH 1C4U2 3T28A 3VGCB 1EATA 3PLKA 1ANEA 2FS8A 3A7TA 1EB1H 4TWYA 1AB9C 2H9EH