4X37A

Gallus interleukin-1 mutant - e118k
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
159
structure length
159
Chain Sequence
b'AFRYTRSQSFDIFDINQKCFVLESPTQLVALHLQGPSSSQKVRLNIALYRPRGPRGSAGTGQMPVALGIKGYKLYMSCVMSGTEPTLQLEEADVMRDIDSVELTRFIFYRLDSPTKGTTRFESAAFPGWFICTSLQPRQPVGITNQPDQVNIATYKLSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IL-1 beta
publication title Gallus interleukin-1 mutant - E118K
rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 28
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4x37A00
1TWMA 2AAIB 3FGMA 4I4QA 3WMVA 4QD2B 3A21A 1G9BA 1DLLA 3VWCA 4ZFUB 4LO1A 3V0BA 2HZ9A 4I1BA 1R8OA 3PG0A 2F8XC 4D0ZA 5FZUA 5GAQA 3ZXDA 4LO7C 1VCLA 3JUTA 2WRYA 1AVAC 4ZGRB 4GAIA 3N7MA 3AZWA 1M2TB 1E0OA 4EKXB 2VSAA 3IM5A 2NM1A 3NBEA 5HPZA 2D1ZA 2F2FA 1AVUA 3HMYA 1DIWA 4EFRA 2VUAA 4F83A 3BADA 1YYNA 2NP0A 3O4DA 3V0AB 1IT0A 1V6UA 4I7IA 1G9AA 4XFUA 9ILBA 3NBNA 2D23A 3CA5A 1T4QA 4USPA 1DQGA 5G00A 3HN1A 1FV2A 3MALA 3V0AA 4I4RA 3AKHA 3HOMA 2Y9FA 4EEEB 1HCEA 1JLYA 4IONA 4JPZA 2L5XA 4I4OA 3CA3A 2FFVA 4KEKA 5JLVA 2FDBM 4ZFWB 1SR4C 3CA0A 3H6QA 1Z2VA 3IIRA 4J2KA 3VUOA 1EYLA 3AH2A 3CRGA 3AH1A 3BAHA 3OJVA 5E24E 4I4UA 3VT2A 4OWLA 4Q91A 3BX1C 3OGFA 1S0GA 1KNMA 3O3QA 2DRYA 3NBCA 4G6JA 2LIEA 3BRDA 3KMVA 1WD3A 1BFBA 1HCDA 1I1EA 3O49A 4QD2C 1S0DA 4IQPA 2AFGA 2RG9B 3S8KA 4OEFA 1DQOA 5BOWA 1FWVA 1XYFA 1HIBA 2BEAA 4LO0C 2Q3NB 3N7JA 3N7LA 2FFUA 1FMZA 4EFPA 2K43A 2NZ9A 1ITBA 1JTCA 4A7KA 4JKXB 4CJMA 4DENA 1RMLA 3BAQA 3FJBA 4IY8A 4I37A 1EPWA 4XFSA 2BEBA 1BASA 1JT5A 3IAGC 4FGFA 3F62B 4L4HA 3FJ9A 4OWJA 1GGPB 3HSMA 1PUUB 1MD6A 4Q9PA 3FUQA 1J0SA 4F34A 3FJIA 3OJMA 21BIA 2Y9XE 2IWTB 1RG8A 1G9DA 4AN7B 4GAFA 5FNXA 1IRPA 3ZX7A 1FV3A 3BRGC 3O44A 4Q9GA 4TLPA 2Y9GA 3FJDA 2ZQNA 1K5UA 1BLDA 1I1BA 2Q9XA 4J2SA 3OBRA 3V0BB 1MC9A 3WA1A 3NJ5A 3AKGA 1FQ9A 3FJKA 3EF2A 5DUYA 1XHBA 31BIA 3I2AA 3QR5A 3OBTA 4I4PA 2LIQA 2R9KB 5BQUC 3LLPA 1M16A 5BXTA 1SR4A 1V6VA 4JQ0A 5BVPI 4OEEA 2HWAA 4J2YA 1FGAA 1CVSA 5EHAA 4Z9WB 4LO2A 1G82A 1ISZA 3HALA 4OEGA 5DVHA 3BRFA 2D43A 1QQKA 2KLLA 1OQLB 3AKIA 1YBIA 1EVTA 3BAVA 1W3FA 2VLCA 2Z49A 3FFZA 2X2TA 2ET2A 2J3PA 1W3GA 1V6XA 3WINC 5EG6C 1IJTA 3ILAA 4QO3A 3BA4A 2VXRA 5BP5A 3FJFA 4USOA 4D8HA 3UJ0A 1BFCA 4LO3C 3V79C 1ABRB 1II4A 1P63A 4X3AA 2D22A 3VSZA 1G9CA 3FJJA 3Q7XA 1HKNA 3FJHA 2GZBA 3OGGA 2Z48A 5BXSA 4ZFYB 2E4MA 2ZR1B 1PWAA 1ISXA 2KKIA 1HWNB 4QALA 2M49A 1BA7A 4LO1C 1BARA 4JRAA 3W9TA 3BAUA 4R6UB 4X39A 3WO4A 4KBBA 4DCKC 1Z0HA 3BAOA 3P6JA 4I96A 3IM7A 1CE7B 1JY0A 2KH2A 4I2SA 3CA4A 8I1BA 1Z4SA 1L2HA 4QKSA 1IHKA 2F2FC 1AFCA 3VEQA 3FJ8A 4IY9A 1ISVA 4I0YA 3FUOA 1ONKB 3CA1A 1ILR1 2GO2A 1DJSB 5D62A 1FWUA 2AXMA 3AH4A 4JKQA 5EC5A 2RQ9A 1Q1UA 4LO7B 3UDAA 3Q7WA 4QKRA 1PZZA 1Q04A 1IOBA 1S0EA 4J23B 1S0CA 2KI6B 5BQUA 4P0LA 4X38A 1AVWB 4IZEA 2NVHA 4OW4A 1A8DA 2NTDA 3AJ5A 4II0A 5F8YA 3BAGA 1ISWA 4G6MA 1WBCA 3NBDA 4ISQA 3AZVA 5F8SA 1QXMA 4QC4A 3H6RA 3RTIB 3RMXA 3WO3A 3PHZA 3BA7A 4L4IA 2ERMA 2DRZA 3N0KA 1AVXB 1SZ6B 1BFGA 4QBVA 3MPPG 4EB2B 1XG6A 2K4AB 1ISYA 4IZXA 2IHOA 3O5WB 3RTJB 1WBAA 3WINA 2HW9A 1RZOB 4P6AA 3D7WB 4PC4A 1RY7A 2AQZA 2D7RA 3O4CA 4H04A 1V6WA 4LO3A 2DREA 2I1BA 4AN6A 4ZOTA 3BB2A 1FN0A 1W3AA 3FJAA 1TIEA 4GOVA 5BXPA 1HWPB 4P0JA 4G1RA 3B9UA 4IHZA 2NYYA 2Y9WC 4I4VA 6I1BA 1BLAA 3I29B 4ENDA 4DEPA 3O4AA 4A7ZA 3AJ6A 1DFCA 3Q7YA 1T9FA 2K8RA 2UUSA 3N7KA 1JT7A 2DS0A 3PMEA 2D44A 4H9WA 4OUJA 3LTQA 3VSFA 4LO0A 2D20A 3CRIA 1F31A 5F8WA 3S8JA 2P23A 2RSTA 1DZCA 3WO2A 4HJJA 3R4SA 3CRHA 3AKFA 2P39A 4JP0A 1WD4A 5FNWA 4A7YA 3E8LC 1BFFA 1PUMB 4I4XA 1HWOB 3ZC8A 2QN4A 4G9MA 1S0BA 5F90A 1NUNA 1K5VA 2WBCA 3CAHA 4GP0A 4GP3A 4I3NA 4X37A 4XKIA 4I4SA 5D61A 4I4YA 3A07A 7I1BA 1QQLA 4ZBVB 2FGFA 3RSJA 1FMMS 4I8MA 4ZKTB 5JMCA 1TOOA 4QBCA 3T8SA 3TC2A 1PC8B 5B2HA 4I1EA 3CU1B 1S0FA 2VU9A 1YXWA 4KC3A 1YTOA 2XOAA 4XFTA 41BIA 1TWEA 4LO2C 4LO8B 3A23A 1S0LA 3PUBA 3VT1A 3K1XA 4EFQA 4D0TA 2VXTI 5FZYA 3UJ4A 3C9ZA 3WMUA 3O4BA 1JT4A 3RMYA 2X2SA 1AXMA 2HWMA 2MIBA 4I6IA 4ISRA 4G9NA 1N4KA 3I2XA 3H6SE 2BFHA 5BP5C 3A22A 1AF9A 1TFMB 3UD9A 3H6RB 4Z8SB 1IRAX 2YUGA 1IILA 2D7IA 4WBCA 1JT3A 1XZZA 1NZKA 1UPSA 4P0KA 2E4MC 3O4OA 1Q03A 4HA2A 4ZA3B 3R4UA 4FVVA 4HR6C 4JAWA 1R8NA 2ESUA 2KI4A 5DSSB 1D0HA 3P53A 3FJCA 2D24A 3POKA 2MC2A 4YOLA 3JRRA 1TTUA 3UD7A 1DFQA 3VT0A 4KEJA 1YF8B 3P6IA 4OWKA 5I1BA 2FO1A 4KEIA 5FZZA 2MLLB 4IYBA 3UD8A 3SNVA 1JLXA 4ZLBB 3ZXGA 4J2XA 5DZUA 3BTAA 3BA5A 2VSEA 3CQAA 1EV2A 2ZQOA 3FJEA 5D63A 3ZC9A 3OJ2A 3IM6A 3QYDA 1DZDA 3HBWA 1HWMB 1TP0A 4GOYA 1JQZA 3CA6A 3F1RA 2QYIB 5BXRA
chains in the Genus database with same CATH superfamily
1TWMA 2AAIB 3FGMA 4I4QA 3WMVA 4QD2B 3A21A 1G9BA 1DLLA 3VWCA 4ZFUB 4LO1A 3V0BA 2HZ9A 4I1BA 1R8OA 3PG0A 2F8XC 4D0ZA 5FZUA 5GAQA 3ZXDA 4LO7C 1VCLA 3JUTA 2WRYA 1AVAC 4ZGRB 4GAIA 3N7MA 3AZWA 1M2TB 1E0OA 4EKXB 2VSAA 3IM5A 2NM1A 3NBEA 5HPZA 2D1ZA 2F2FA 1AVUA 3HMYA 1DIWA 4EFRA 2VUAA 4F83A 3BADA 1YYNA 2NP0A 3O4DA 3V0AB 1IT0A 1V6UA 4I7IA 1G9AA 4XFUA 9ILBA 3NBNA 2D23A 3CA5A 1T4QA 4USPA 1DQGA 5G00A 3HN1A 1FV2A 3MALA 3V0AA 4I4RA 3AKHA 3HOMA 2Y9FA 4EEEB 1HCEA 1JLYA 4IONA 4JPZA 2L5XA 4I4OA 3CA3A 2FFVA 4KEKA 5JLVA 2FDBM 4ZFWB 1SR4C 3CA0A 3H6QA 1Z2VA 3IIRA 4J2KA 3VUOA 1EYLA 3AH2A 3CRGA 3AH1A 3BAHA 3OJVA 5E24E 4I4UA 3VT2A 4OWLA 4Q91A 3BX1C 3OGFA 1S0GA 1KNMA 3O3QA 2DRYA 3NBCA 4G6JA 2LIEA 3BRDA 3KMVA 1WD3A 1BFBA 1HCDA 1I1EA 3O49A 4QD2C 1S0DA 4IQPA 2AFGA 2RG9B 3S8KA 4OEFA 1DQOA 5BOWA 1FWVA 1XYFA 1HIBA 2BEAA 4LO0C 2Q3NB 3N7JA 3N7LA 2FFUA 1FMZA 4EFPA 2K43A 2NZ9A 1ITBA 1JTCA 4A7KA 4JKXB 4CJMA 4DENA 1RMLA 3BAQA 3FJBA 4IY8A 4I37A 1EPWA 4MZHA 4XFSA 2BEBA 1BASA 1JT5A 3IAGC 4FGFA 3F62B 4L4HA 3FJ9A 4H75A 4OWJA 1GGPB 3HSMA 1PUUB 1MD6A 4Q9PA 3FUQA 1J0SA 4F34A 3FJIA 3OJMA 21BIA 2Y9XE 2IWTB 1RG8A 1G9DA 4AN7B 4GAFA 5FNXA 1IRPA 3ZX7A 1FV3A 3BRGC 3O44A 4Q9GA 4TLPA 2Y9GA 3FJDA 2ZQNA 1K5UA 1BLDA 1I1BA 2Q9XA 4J2SA 3OBRA 3V0BB 1MC9A 3WA1A 3NJ5A 3AKGA 1FQ9A 3FJKA 3EF2A 5DUYA 1XHBA 31BIA 3I2AA 3QR5A 3OBTA 4I4PA 2LIQA 2R9KB 5BQUC 3LLPA 1M16A 5BXTA 1SR4A 1V6VA 4JQ0A 5BVPI 4OEEA 2HWAA 4J2YA 1FGAA 1CVSA 5EHAA 4Z9WB 4LO2A 1G82A 1ISZA 3HALA 4OEGA 5DVHA 3BRFA 2D43A 1QQKA 2KLLA 1OQLB 3AKIA 1YBIA 1EVTA 3BAVA 1W3FA 2VLCA 2Z49A 3FFZA 2X2TA 2ET2A 2J3PA 1W3GA 1V6XA 3WINC 5EG6C 1IJTA 3ILAA 4QO3A 3BA4A 2VXRA 5BP5A 3FJFA 4USOA 4D8HA 3UJ0A 1BFCA 4LO3C 3V79C 1ABRB 1II4A 1P63A 4X3AA 2D22A 3VSZA 1G9CA 3FJJA 3Q7XA 1HKNA 3FJHA 2GZBA 3OGGA 2Z48A 5BXSA 4ZFYB 2E4MA 2ZR1B 1PWAA 1ISXA 2KKIA 1HWNB 4QALA 2M49A 1BA7A 4LO1C 1BARA 4JRAA 3W9TA 3BAUA 4R6UB 4X39A 3WO4A 4KBBA 4DCKC 1Z0HA 4MZFB 3BAOA 3P6JA 4I96A 3IM7A 1CE7B 1JY0A 2KH2A 4I2SA 3CA4A 8I1BA 1Z4SA 1L2HA 4QKSA 1IHKA 2F2FC 1AFCA 3VEQA 3FJ8A 4IY9A 1ISVA 4I0YA 3FUOA 1ONKB 3CA1A 1ILR1 2GO2A 1DJSB 5D62A 1FWUA 2AXMA 3AH4A 4JKQA 5EC5A 2RQ9A 1Q1UA 4LO7B 3UDAA 3Q7WA 4QKRA 1PZZA 1Q04A 1IOBA 1S0EA 4J23B 1S0CA 2KI6B 5BQUA 4P0LA 4X38A 1AVWB 4IZEA 2NVHA 4OW4A 1A8DA 2NTDA 3AJ5A 4II0A 5F8YA 3BAGA 1ISWA 4G6MA 1WBCA 3NBDA 4ISQA 3AZVA 5F8SA 1QXMA 4QC4A 3H6RA 3RTIB 3RMXA 3WO3A 3PHZA 3BA7A 4L4IA 2ERMA 2DRZA 3N0KA 1AVXB 1SZ6B 1BFGA 4QBVA 3MPPG 4EB2B 1XG6A 2K4AB 1ISYA 4IZXA 2IHOA 3O5WB 3RTJB 1WBAA 3WINA 2HW9A 1RZOB 4P6AA 3D7WB 4PC4A 1RY7A 2AQZA 2D7RA 3O4CA 4H04A 1V6WA 4LO3A 2DREA 2I1BA 4AN6A 4UY4A 2NS2A 4ZOTA 3BB2A 1FN0A 1W3AA 3FJAA 1TIEA 4GOVA 5BXPA 1HWPB 4P0JA 4G1RA 3B9UA 4IHZA 2NYYA 2Y9WC 4I4VA 6I1BA 1BLAA 3I29B 4ENDA 4DEPA 3O4AA 4A7ZA 3AJ6A 1DFCA 3Q7YA 1T9FA 2K8RA 2UUSA 3N7KA 1JT7A 2DS0A 3PMEA 2D44A 4H9WA 4OUJA 3LTQA 3VSFA 4LO0A 2D20A 3CRIA 1F31A 5F8WA 3S8JA 2P23A 2RSTA 1DZCA 3WO2A 4HJJA 3R4SA 3CRHA 4MZGB 3AKFA 2P39A 4JP0A 1WD4A 5FNWA 4A7YA 3E8LC 1BFFA 1PUMB 4I4XA 1HWOB 3ZC8A 2QN4A 4G9MA 1S0BA 5F90A 1NUNA 1K5VA 2WBCA 3CAHA 4GP0A 4GP3A 4I3NA 4X37A 4XKIA 4I4SA 5D61A 4I4YA 3A07A 7I1BA 1QQLA 4ZBVB 2FGFA 3RSJA 1FMMS 4I8MA 4ZKTB 5JMCA 1TOOA 4QBCA 3T8SA 3TC2A 1PC8B 5B2HA 4I1EA 3CU1B 1S0FA 2VU9A 1YXWA 4KC3A 1YTOA 2XOAA 4XFTA 41BIA 1TWEA 4LO2C 4LO8B 3A23A 1S0LA 3PUBA 3VT1A 3K1XA 4EFQA 4D0TA 2VXTI 5FZYA 3UJ4A 3C9ZA 3WMUA 3O4BA 1JT4A 3RMYA 2X2SA 1AXMA 2HWMA 2MIBA 4I6IA 4ISRA 4G9NA 1N4KA 3I2XA 3H6SE 2BFHA 5BP5C 3A22A 1AF9A 1TFMB 3UD9A 3H6RB 4Z8SB 1IRAX 2YUGA 1IILA 2D7IA 4WBCA 1JT3A 1XZZA 1NZKA 1UPSA 4P0KA 2E4MC 3O4OA 1Q03A 4HA2A 4ZA3B 3R4UA 4FVVA 4HR6C 4JAWA 1R8NA 2ESUA 2KI4A 5DSSB 1D0HA 3P53A 3FJCA 2D24A 3POKA 2MC2A 4YOLA 3JRRA 1TTUA 3UD7A 1DFQA 3VT0A 4KEJA 1YF8B 3P6IA 4OWKA 5I1BA 2FO1A 4KEIA 5FZZA 2MLLB 4IYBA 3UD8A 3SNVA 1JLXA 4ZLBB 3ZXGA 4J2XA 5DZUA 3BTAA 3BA5A 2VSEA 3CQAA 1EV2A 2ZQOA 3FJEA 5D63A 3ZC9A 3OJ2A 3IM6A 3QYDA 1DZDA 3HBWA 1HWMB 1TP0A 4GOYA 1JQZA 3CA6A 3F1RA 2QYIB 5BXRA
chains in the Genus database with same CATH topology
1TWMA 2AAIB 3FGMA 4I4QA 3WMVA 4QD2B 3A21A 1G9BA 1DLLA 3VWCA 4ZFUB 4LO1A 3V0BA 2HZ9A 4I1BA 1R8OA 3PG0A 2F8XC 4D0ZA 5FZUA 5GAQA 3ZXDA 4LO7C 1VCLA 3JUTA 2WRYA 1AVAC 4ZGRB 4GAIA 3N7MA 3AZWA 1M2TB 1E0OA 4EKXB 2VSAA 3IM5A 2NM1A 3NBEA 5HPZA 2D1ZA 2F2FA 1AVUA 3HMYA 1DIWA 4EFRA 2VUAA 4F83A 3BADA 1YYNA 2NP0A 3O4DA 3V0AB 1IT0A 1V6UA 4I7IA 1G9AA 4XFUA 9ILBA 3NBNA 2D23A 3CA5A 1T4QA 4USPA 1DQGA 5G00A 3HN1A 1FV2A 3MALA 3V0AA 4I4RA 3AKHA 3HOMA 2Y9FA 4EEEB 1HCEA 1JLYA 4IONA 4JPZA 2L5XA 4I4OA 3CA3A 2FFVA 4KEKA 5JLVA 2FDBM 4ZFWB 1SR4C 3CA0A 3H6QA 1Z2VA 3IIRA 4J2KA 3VUOA 1EYLA 3AH2A 3CRGA 3AH1A 3BAHA 3OJVA 5E24E 4I4UA 3VT2A 4OWLA 4Q91A 3BX1C 3OGFA 1S0GA 1KNMA 3O3QA 2DRYA 3NBCA 4G6JA 2LIEA 3BRDA 3KMVA 1WD3A 1BFBA 1HCDA 1I1EA 3O49A 4QD2C 1S0DA 4IQPA 2AFGA 2RG9B 3S8KA 4OEFA 1DQOA 5BOWA 1FWVA 1XYFA 1HIBA 2BEAA 4LO0C 2Q3NB 3N7JA 3N7LA 2FFUA 1FMZA 4EFPA 2K43A 2NZ9A 1ITBA 1JTCA 4A7KA 4JKXB 4CJMA 4DENA 1RMLA 3BAQA 3FJBA 4IY8A 4I37A 1EPWA 4MZHA 4XFSA 2BEBA 1BASA 1JT5A 3IAGC 4FGFA 3F62B 4L4HA 3FJ9A 4H75A 4OWJA 1GGPB 3HSMA 1PUUB 1MD6A 4Q9PA 3FUQA 1J0SA 4F34A 3FJIA 3OJMA 21BIA 2Y9XE 2IWTB 1RG8A 1G9DA 4AN7B 4GAFA 5FNXA 1IRPA 3ZX7A 1FV3A 3BRGC 3O44A 4Q9GA 4TLPA 2Y9GA 3FJDA 2ZQNA 1K5UA 1BLDA 1I1BA 2Q9XA 4J2SA 3OBRA 3V0BB 1MC9A 3WA1A 3NJ5A 3AKGA 1FQ9A 3FJKA 3EF2A 5DUYA 1XHBA 31BIA 3I2AA 3QR5A 3OBTA 4I4PA 2LIQA 2R9KB 5BQUC 3LLPA 1M16A 5BXTA 1SR4A 1V6VA 4JQ0A 5BVPI 4OEEA 2HWAA 4J2YA 1FGAA 1CVSA 5EHAA 4Z9WB 4LO2A 1G82A 1ISZA 3HALA 4OEGA 5DVHA 3BRFA 2D43A 1QQKA 2KLLA 1OQLB 3AKIA 1YBIA 1EVTA 3BAVA 1W3FA 2VLCA 2Z49A 3FFZA 2X2TA 2ET2A 2J3PA 1W3GA 1V6XA 3WINC 5EG6C 1IJTA 3ILAA 4QO3A 3BA4A 2VXRA 5BP5A 3FJFA 4USOA 4D8HA 3UJ0A 1BFCA 4LO3C 3V79C 1ABRB 1II4A 1P63A 4X3AA 2D22A 3VSZA 1G9CA 3FJJA 3Q7XA 1HKNA 3FJHA 2GZBA 3OGGA 2Z48A 5BXSA 4ZFYB 2E4MA 2ZR1B 1PWAA 1ISXA 2KKIA 1HWNB 4QALA 2M49A 1BA7A 4LO1C 1BARA 4JRAA 3W9TA 3BAUA 4R6UB 4X39A 3WO4A 4KBBA 4DCKC 1Z0HA 4MZFB 3BAOA 3P6JA 4I96A 3IM7A 1CE7B 1JY0A 2KH2A 4I2SA 3CA4A 8I1BA 1Z4SA 1L2HA 4QKSA 1IHKA 2F2FC 1AFCA 3VEQA 3FJ8A 4IY9A 1ISVA 4I0YA 3FUOA 1ONKB 3CA1A 1ILR1 2GO2A 1DJSB 5D62A 1FWUA 2AXMA 3AH4A 4JKQA 5EC5A 2RQ9A 1Q1UA 4LO7B 3UDAA 3Q7WA 4QKRA 1PZZA 1Q04A 1IOBA 1S0EA 4J23B 1S0CA 2KI6B 5BQUA 4P0LA 4X38A 1AVWB 4IZEA 2NVHA 4OW4A 1A8DA 2NTDA 3AJ5A 4II0A 5F8YA 3BAGA 1ISWA 4G6MA 1WBCA 3NBDA 4ISQA 3AZVA 5F8SA 1QXMA 4QC4A 3H6RA 3RTIB 3RMXA 3WO3A 3PHZA 3BA7A 4L4IA 2ERMA 2DRZA 3N0KA 1AVXB 1SZ6B 1BFGA 4QBVA 3MPPG 4EB2B 1XG6A 2K4AB 1ISYA 4IZXA 2IHOA 3O5WB 3RTJB 1WBAA 3WINA 2HW9A 1RZOB 4P6AA 3D7WB 4PC4A 1RY7A 2AQZA 2D7RA 3O4CA 4H04A 1V6WA 4LO3A 2DREA 2I1BA 4AN6A 4UY4A 2NS2A 4ZOTA 3BB2A 1FN0A 1W3AA 3FJAA 1TIEA 4GOVA 5BXPA 1HWPB 4P0JA 4G1RA 3B9UA 4IHZA 2NYYA 2Y9WC 4I4VA 6I1BA 1BLAA 3I29B 4ENDA 4DEPA 3O4AA 4A7ZA 3AJ6A 1DFCA 3Q7YA 1T9FA 2K8RA 2UUSA 3N7KA 1JT7A 2DS0A 3PMEA 2D44A 4H9WA 4OUJA 3LTQA 3VSFA 4LO0A 2D20A 3CRIA 1F31A 5F8WA 3S8JA 2P23A 2RSTA 1DZCA 3WO2A 4HJJA 3R4SA 3CRHA 4MZGB 3AKFA 2P39A 4JP0A 1WD4A 5FNWA 4A7YA 3E8LC 1BFFA 1PUMB 4I4XA 1HWOB 3ZC8A 2QN4A 4G9MA 1S0BA 5F90A 1NUNA 1K5VA 2WBCA 3CAHA 4GP0A 4GP3A 4I3NA 4X37A 4XKIA 4I4SA 5D61A 4I4YA 3A07A 7I1BA 1QQLA 4ZBVB 2FGFA 3RSJA 1FMMS 4I8MA 4ZKTB 5JMCA 1TOOA 4QBCA 3T8SA 3TC2A 1PC8B 5B2HA 4I1EA 3CU1B 1S0FA 2VU9A 1YXWA 4KC3A 1YTOA 2XOAA 4XFTA 41BIA 1TWEA 4LO2C 4LO8B 3A23A 1S0LA 3PUBA 3VT1A 3K1XA 4EFQA 4D0TA 2VXTI 5FZYA 3UJ4A 3C9ZA 3WMUA 3O4BA 1JT4A 3RMYA 2X2SA 1AXMA 2HWMA 2MIBA 4I6IA 4ISRA 4G9NA 1N4KA 3I2XA 3H6SE 2BFHA 5BP5C 3A22A 1AF9A 1TFMB 3UD9A 3H6RB 4Z8SB 1IRAX 2YUGA 1IILA 2D7IA 4WBCA 1JT3A 1XZZA 1NZKA 1UPSA 4P0KA 2E4MC 3O4OA 1Q03A 4HA2A 4ZA3B 3R4UA 4FVVA 4HR6C 4JAWA 1R8NA 2ESUA 2KI4A 5DSSB 1D0HA 3P53A 3FJCA 2D24A 3POKA 2MC2A 4YOLA 3JRRA 1TTUA 3UD7A 1DFQA 3VT0A 4KEJA 1YF8B 3P6IA 4OWKA 5I1BA 2FO1A 4KEIA 5FZZA 2MLLB 4IYBA 3UD8A 3SNVA 1JLXA 4ZLBB 3ZXGA 4J2XA 5DZUA 3BTAA 3BA5A 2VSEA 3CQAA 1EV2A 2ZQOA 3FJEA 5D63A 3ZC9A 3OJ2A 3IM6A 3QYDA 1DZDA 3HBWA 1HWMB 1TP0A 4GOYA 1JQZA 3CA6A 3F1RA 2QYIB 5BXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWM A;  2AAI B;  3FGM A;  4I4Q A;  3WMV A;  4QD2 B;  3A21 A;  1G9B A;  1DLL A;  3VWC A;  4ZFU B;  4LO1 A;  3V0B A;  2HZ9 A;  4I1B A;  1R8O A;  3PG0 A;  2F8X C;  4D0Z A;  5FZU A;  5GAQ A;  3ZXD A;  4LO7 C;  1VCL A;  3JUT A;  2WRY A;  1AVA C;  4ZGR B;  4GAI A;  3N7M A;  3AZW A;  1M2T B;  1E0O A;  4EKX B;  2VSA A;  3IM5 A;  2NM1 A;  3NBE A;  5HPZ A;  2D1Z A;  2F2F A;  1AVU A;  3HMY A;  1DIW A;  4EFR A;  2VUA A;  4F83 A;  3BAD A;  1YYN A;  2NP0 A;  3O4D A;  3V0A B;  1IT0 A;  1V6U A;  4I7I A;  1G9A A;  4XFU A;  9ILB A;  3NBN A;  2D23 A;  3CA5 A;  1T4Q A;  4USP A;  1DQG A;  5G00 A;  3HN1 A;  1FV2 A;  3MAL A;  3V0A A;  4I4R A;  3AKH A;  3HOM A;  2Y9F A;  4EEE B;  1HCE A;  1JLY A;  4ION A;  4JPZ A;  2L5X A;  4I4O A;  3CA3 A;  2FFV A;  4KEK A;  5JLV A;  2FDB M;  4ZFW B;  1SR4 C;  3CA0 A;  3H6Q A;  1Z2V A;  3IIR A;  4J2K A;  3VUO A;  1EYL A;  3AH2 A;  3CRG A;  3AH1 A;  3BAH A;  3OJV A;  5E24 E;  4I4U A;  3VT2 A;  4OWL A;  4Q91 A;  3BX1 C;  3OGF A;  1S0G A;  1KNM A;  3O3Q A;  2DRY A;  3NBC A;  4G6J A;  2LIE A;  3BRD A;  3KMV A;  1WD3 A;  1BFB A;  1HCD A;  1I1E A;  3O49 A;  4QD2 C;  1S0D A;  4IQP A;  2AFG A;  2RG9 B;  3S8K A;  4OEF A;  1DQO A;  5BOW A;  1FWV A;  1XYF A;  1HIB A;  2BEA A;  4LO0 C;  2Q3N B;  3N7J A;  3N7L A;  2FFU A;  1FMZ A;  4EFP A;  2K43 A;  2NZ9 A;  1ITB A;  1JTC A;  4A7K A;  4JKX B;  4CJM A;  4DEN A;  1RML A;  3BAQ A;  3FJB A;  4IY8 A;  4I37 A;  1EPW A;  4XFS A;  2BEB A;  1BAS A;  1JT5 A;  3IAG C;  4FGF A;  3F62 B;  4L4H A;  3FJ9 A;  4OWJ A;  1GGP B;  3HSM A;  1PUU B;  1MD6 A;  4Q9P A;  3FUQ A;  1J0S A;  4F34 A;  3FJI A;  3OJM A;  21BI A;  2Y9X E;  2IWT B;  1RG8 A;  1G9D A;  4AN7 B;  4GAF A;  5FNX A;  1IRP A;  3ZX7 A;  1FV3 A;  3BRG C;  3O44 A;  4Q9G A;  4TLP A;  2Y9G A;  3FJD A;  2ZQN A;  1K5U A;  1BLD A;  1I1B A;  2Q9X A;  4J2S A;  3OBR A;  3V0B B;  1MC9 A;  3WA1 A;  3NJ5 A;  3AKG A;  1FQ9 A;  3FJK A;  3EF2 A;  5DUY A;  1XHB A;  31BI A;  3I2A A;  3QR5 A;  3OBT A;  4I4P A;  2LIQ A;  2R9K B;  5BQU C;  3LLP A;  1M16 A;  5BXT A;  1SR4 A;  1V6V A;  4JQ0 A;  5BVP I;  4OEE A;  2HWA A;  4J2Y A;  1FGA A;  1CVS A;  5EHA A;  4Z9W B;  4LO2 A;  1G82 A;  1ISZ A;  3HAL A;  4OEG A;  5DVH A;  3BRF A;  2D43 A;  1QQK A;  2KLL A;  1OQL B;  3AKI A;  1YBI A;  1EVT A;  3BAV A;  1W3F A;  2VLC A;  2Z49 A;  3FFZ A;  2X2T A;  2ET2 A;  2J3P A;  1W3G A;  1V6X A;  3WIN C;  5EG6 C;  1IJT A;  3ILA A;  4QO3 A;  3BA4 A;  2VXR A;  5BP5 A;  3FJF A;  4USO A;  4D8H A;  3UJ0 A;  1BFC A;  4LO3 C;  3V79 C;  1ABR B;  1II4 A;  1P63 A;  4X3A A;  2D22 A;  3VSZ A;  1G9C A;  3FJJ A;  3Q7X A;  1HKN A;  3FJH A;  2GZB A;  3OGG A;  2Z48 A;  5BXS A;  4ZFY B;  2E4M A;  2ZR1 B;  1PWA A;  1ISX A;  2KKI A;  1HWN B;  4QAL A;  2M49 A;  1BA7 A;  4LO1 C;  1BAR A;  4JRA A;  3W9T A;  3BAU A;  4R6U B;  4X39 A;  3WO4 A;  4KBB A;  4DCK C;  1Z0H A;  3BAO A;  3P6J A;  4I96 A;  3IM7 A;  1CE7 B;  1JY0 A;  2KH2 A;  4I2S A;  3CA4 A;  8I1B A;  1Z4S A;  1L2H A;  4QKS A;  1IHK A;  2F2F C;  1AFC A;  3VEQ A;  3FJ8 A;  4IY9 A;  1ISV A;  4I0Y A;  3FUO A;  1ONK B;  3CA1 A;  1ILR 1;  2GO2 A;  1DJS B;  5D62 A;  1FWU A;  2AXM A;  3AH4 A;  4JKQ A;  5EC5 A;  2RQ9 A;  1Q1U A;  4LO7 B;  3UDA A;  3Q7W A;  4QKR A;  1PZZ A;  1Q04 A;  1IOB A;  1S0E A;  4J23 B;  1S0C A;  2KI6 B;  5BQU A;  4P0L A;  4X38 A;  1AVW B;  4IZE A;  2NVH A;  4OW4 A;  1A8D A;  2NTD A;  3AJ5 A;  4II0 A;  5F8Y A;  3BAG A;  1ISW A;  4G6M A;  1WBC A;  3NBD A;  4ISQ A;  3AZV A;  5F8S A;  1QXM A;  4QC4 A;  3H6R A;  3RTI B;  3RMX A;  3WO3 A;  3PHZ A;  3BA7 A;  4L4I A;  2ERM A;  2DRZ A;  3N0K A;  1AVX B;  1SZ6 B;  1BFG A;  4QBV A;  3MPP G;  4EB2 B;  1XG6 A;  2K4A B;  1ISY A;  4IZX A;  2IHO A;  3O5W B;  3RTJ B;  1WBA A;  3WIN A;  2HW9 A;  1RZO B;  4P6A A;  3D7W B;  4PC4 A;  1RY7 A;  2AQZ A;  2D7R A;  3O4C A;  4H04 A;  1V6W A;  4LO3 A;  2DRE A;  2I1B A;  4AN6 A;  4ZOT A;  3BB2 A;  1FN0 A;  1W3A A;  3FJA A;  1TIE A;  4GOV A;  5BXP A;  1HWP B;  4P0J A;  4G1R A;  3B9U A;  4IHZ A;  2NYY A;  2Y9W C;  4I4V A;  6I1B A;  1BLA A;  3I29 B;  4END A;  4DEP A;  3O4A A;  4A7Z A;  3AJ6 A;  1DFC A;  3Q7Y A;  1T9F A;  2K8R A;  2UUS A;  3N7K A;  1JT7 A;  2DS0 A;  3PME A;  2D44 A;  4H9W A;  4OUJ A;  3LTQ A;  3VSF A;  4LO0 A;  2D20 A;  3CRI A;  1F31 A;  5F8W A;  3S8J A;  2P23 A;  2RST A;  1DZC A;  3WO2 A;  4HJJ A;  3R4S A;  3CRH A;  3AKF A;  2P39 A;  4JP0 A;  1WD4 A;  5FNW A;  4A7Y A;  3E8L C;  1BFF A;  1PUM B;  4I4X A;  1HWO B;  3ZC8 A;  2QN4 A;  4G9M A;  1S0B A;  5F90 A;  1NUN A;  1K5V A;  2WBC A;  3CAH A;  4GP0 A;  4GP3 A;  4I3N A;  4X37 A;  4XKI A;  4I4S A;  5D61 A;  4I4Y A;  3A07 A;  7I1B A;  1QQL A;  4ZBV B;  2FGF A;  3RSJ A;  1FMM S;  4I8M A;  4ZKT B;  5JMC A;  1TOO A;  4QBC A;  3T8S A;  3TC2 A;  1PC8 B;  5B2H A;  4I1E A;  3CU1 B;  1S0F A;  2VU9 A;  1YXW A;  4KC3 A;  1YTO A;  2XOA A;  4XFT A;  41BI A;  1TWE A;  4LO2 C;  4LO8 B;  3A23 A;  1S0L A;  3PUB A;  3VT1 A;  3K1X A;  4EFQ A;  4D0T A;  2VXT I;  5FZY A;  3UJ4 A;  3C9Z A;  3WMU A;  3O4B A;  1JT4 A;  3RMY A;  2X2S A;  1AXM A;  2HWM A;  2MIB A;  4I6I A;  4ISR A;  4G9N A;  1N4K A;  3I2X A;  3H6S E;  2BFH A;  5BP5 C;  3A22 A;  1AF9 A;  1TFM B;  3UD9 A;  3H6R B;  4Z8S B;  1IRA X;  2YUG A;  1IIL A;  2D7I A;  4WBC A;  1JT3 A;  1XZZ A;  1NZK A;  1UPS A;  4P0K A;  2E4M C;  3O4O A;  1Q03 A;  4HA2 A;  4ZA3 B;  3R4U A;  4FVV A;  4HR6 C;  4JAW A;  1R8N A;  2ESU A;  2KI4 A;  5DSS B;  1D0H A;  3P53 A;  3FJC A;  2D24 A;  3POK A;  2MC2 A;  4YOL A;  3JRR A;  1TTU A;  3UD7 A;  1DFQ A;  3VT0 A;  4KEJ A;  1YF8 B;  3P6I A;  4OWK A;  5I1B A;  2FO1 A;  4KEI A;  5FZZ A;  2MLL B;  4IYB A;  3UD8 A;  3SNV A;  1JLX A;  4ZLB B;  3ZXG A;  4J2X A;  5DZU A;  3BTA A;  3BA5 A;  2VSE A;  3CQA A;  1EV2 A;  2ZQO A;  3FJE A;  5D63 A;  3ZC9 A;  3OJ2 A;  3IM6 A;  3QYD A;  1DZD A;  3HBW A;  1HWM B;  1TP0 A;  4GOY A;  1JQZ A;  3CA6 A;  3F1R A;  2QYI B;  5BXR A; 
#chains in the Genus database with same CATH topology
 1TWM A;  2AAI B;  3FGM A;  4I4Q A;  3WMV A;  4QD2 B;  3A21 A;  1G9B A;  1DLL A;  3VWC A;  4ZFU B;  4LO1 A;  3V0B A;  2HZ9 A;  4I1B A;  1R8O A;  3PG0 A;  2F8X C;  4D0Z A;  5FZU A;  5GAQ A;  3ZXD A;  4LO7 C;  1VCL A;  3JUT A;  2WRY A;  1AVA C;  4ZGR B;  4GAI A;  3N7M A;  3AZW A;  1M2T B;  1E0O A;  4EKX B;  2VSA A;  3IM5 A;  2NM1 A;  3NBE A;  5HPZ A;  2D1Z A;  2F2F A;  1AVU A;  3HMY A;  1DIW A;  4EFR A;  2VUA A;  4F83 A;  3BAD A;  1YYN A;  2NP0 A;  3O4D A;  3V0A B;  1IT0 A;  1V6U A;  4I7I A;  1G9A A;  4XFU A;  9ILB A;  3NBN A;  2D23 A;  3CA5 A;  1T4Q A;  4USP A;  1DQG A;  5G00 A;  3HN1 A;  1FV2 A;  3MAL A;  3V0A A;  4I4R A;  3AKH A;  3HOM A;  2Y9F A;  4EEE B;  1HCE A;  1JLY A;  4ION A;  4JPZ A;  2L5X A;  4I4O A;  3CA3 A;  2FFV A;  4KEK A;  5JLV A;  2FDB M;  4ZFW B;  1SR4 C;  3CA0 A;  3H6Q A;  1Z2V A;  3IIR A;  4J2K A;  3VUO A;  1EYL A;  3AH2 A;  3CRG A;  3AH1 A;  3BAH A;  3OJV A;  5E24 E;  4I4U A;  3VT2 A;  4OWL A;  4Q91 A;  3BX1 C;  3OGF A;  1S0G A;  1KNM A;  3O3Q A;  2DRY A;  3NBC A;  4G6J A;  2LIE A;  3BRD A;  3KMV A;  1WD3 A;  1BFB A;  1HCD A;  1I1E A;  3O49 A;  4QD2 C;  1S0D A;  4IQP A;  2AFG A;  2RG9 B;  3S8K A;  4OEF A;  1DQO A;  5BOW A;  1FWV A;  1XYF A;  1HIB A;  2BEA A;  4LO0 C;  2Q3N B;  3N7J A;  3N7L A;  2FFU A;  1FMZ A;  4EFP A;  2K43 A;  2NZ9 A;  1ITB A;  1JTC A;  4A7K A;  4JKX B;  4CJM A;  4DEN A;  1RML A;  3BAQ A;  3FJB A;  4IY8 A;  4I37 A;  1EPW A;  4MZH A;  4XFS A;  2BEB A;  1BAS A;  1JT5 A;  3IAG C;  4FGF A;  3F62 B;  4L4H A;  3FJ9 A;  4H75 A;  4OWJ A;  1GGP B;  3HSM A;  1PUU B;  1MD6 A;  4Q9P A;  3FUQ A;  1J0S A;  4F34 A;  3FJI A;  3OJM A;  21BI A;  2Y9X E;  2IWT B;  1RG8 A;  1G9D A;  4AN7 B;  4GAF A;  5FNX A;  1IRP A;  3ZX7 A;  1FV3 A;  3BRG C;  3O44 A;  4Q9G A;  4TLP A;  2Y9G A;  3FJD A;  2ZQN A;  1K5U A;  1BLD A;  1I1B A;  2Q9X A;  4J2S A;  3OBR A;  3V0B B;  1MC9 A;  3WA1 A;  3NJ5 A;  3AKG A;  1FQ9 A;  3FJK A;  3EF2 A;  5DUY A;  1XHB A;  31BI A;  3I2A A;  3QR5 A;  3OBT A;  4I4P A;  2LIQ A;  2R9K B;  5BQU C;  3LLP A;  1M16 A;  5BXT A;  1SR4 A;  1V6V A;  4JQ0 A;  5BVP I;  4OEE A;  2HWA A;  4J2Y A;  1FGA A;  1CVS A;  5EHA A;  4Z9W B;  4LO2 A;  1G82 A;  1ISZ A;  3HAL A;  4OEG A;  5DVH A;  3BRF A;  2D43 A;  1QQK A;  2KLL A;  1OQL B;  3AKI A;  1YBI A;  1EVT A;  3BAV A;  1W3F A;  2VLC A;  2Z49 A;  3FFZ A;  2X2T A;  2ET2 A;  2J3P A;  1W3G A;  1V6X A;  3WIN C;  5EG6 C;  1IJT A;  3ILA A;  4QO3 A;  3BA4 A;  2VXR A;  5BP5 A;  3FJF A;  4USO A;  4D8H A;  3UJ0 A;  1BFC A;  4LO3 C;  3V79 C;  1ABR B;  1II4 A;  1P63 A;  4X3A A;  2D22 A;  3VSZ A;  1G9C A;  3FJJ A;  3Q7X A;  1HKN A;  3FJH A;  2GZB A;  3OGG A;  2Z48 A;  5BXS A;  4ZFY B;  2E4M A;  2ZR1 B;  1PWA A;  1ISX A;  2KKI A;  1HWN B;  4QAL A;  2M49 A;  1BA7 A;  4LO1 C;  1BAR A;  4JRA A;  3W9T A;  3BAU A;  4R6U B;  4X39 A;  3WO4 A;  4KBB A;  4DCK C;  1Z0H A;  4MZF B;  3BAO A;  3P6J A;  4I96 A;  3IM7 A;  1CE7 B;  1JY0 A;  2KH2 A;  4I2S A;  3CA4 A;  8I1B A;  1Z4S A;  1L2H A;  4QKS A;  1IHK A;  2F2F C;  1AFC A;  3VEQ A;  3FJ8 A;  4IY9 A;  1ISV A;  4I0Y A;  3FUO A;  1ONK B;  3CA1 A;  1ILR 1;  2GO2 A;  1DJS B;  5D62 A;  1FWU A;  2AXM A;  3AH4 A;  4JKQ A;  5EC5 A;  2RQ9 A;  1Q1U A;  4LO7 B;  3UDA A;  3Q7W A;  4QKR A;  1PZZ A;  1Q04 A;  1IOB A;  1S0E A;  4J23 B;  1S0C A;  2KI6 B;  5BQU A;  4P0L A;  4X38 A;  1AVW B;  4IZE A;  2NVH A;  4OW4 A;  1A8D A;  2NTD A;  3AJ5 A;  4II0 A;  5F8Y A;  3BAG A;  1ISW A;  4G6M A;  1WBC A;  3NBD A;  4ISQ A;  3AZV A;  5F8S A;  1QXM A;  4QC4 A;  3H6R A;  3RTI B;  3RMX A;  3WO3 A;  3PHZ A;  3BA7 A;  4L4I A;  2ERM A;  2DRZ A;  3N0K A;  1AVX B;  1SZ6 B;  1BFG A;  4QBV A;  3MPP G;  4EB2 B;  1XG6 A;  2K4A B;  1ISY A;  4IZX A;  2IHO A;  3O5W B;  3RTJ B;  1WBA A;  3WIN A;  2HW9 A;  1RZO B;  4P6A A;  3D7W B;  4PC4 A;  1RY7 A;  2AQZ A;  2D7R A;  3O4C A;  4H04 A;  1V6W A;  4LO3 A;  2DRE A;  2I1B A;  4AN6 A;  4UY4 A;  2NS2 A;  4ZOT A;  3BB2 A;  1FN0 A;  1W3A A;  3FJA A;  1TIE A;  4GOV A;  5BXP A;  1HWP B;  4P0J A;  4G1R A;  3B9U A;  4IHZ A;  2NYY A;  2Y9W C;  4I4V A;  6I1B A;  1BLA A;  3I29 B;  4END A;  4DEP A;  3O4A A;  4A7Z A;  3AJ6 A;  1DFC A;  3Q7Y A;  1T9F A;  2K8R A;  2UUS A;  3N7K A;  1JT7 A;  2DS0 A;  3PME A;  2D44 A;  4H9W A;  4OUJ A;  3LTQ A;  3VSF A;  4LO0 A;  2D20 A;  3CRI A;  1F31 A;  5F8W A;  3S8J A;  2P23 A;  2RST A;  1DZC A;  3WO2 A;  4HJJ A;  3R4S A;  3CRH A;  4MZG B;  3AKF A;  2P39 A;  4JP0 A;  1WD4 A;  5FNW A;  4A7Y A;  3E8L C;  1BFF A;  1PUM B;  4I4X A;  1HWO B;  3ZC8 A;  2QN4 A;  4G9M A;  1S0B A;  5F90 A;  1NUN A;  1K5V A;  2WBC A;  3CAH A;  4GP0 A;  4GP3 A;  4I3N A;  4X37 A;  4XKI A;  4I4S A;  5D61 A;  4I4Y A;  3A07 A;  7I1B A;  1QQL A;  4ZBV B;  2FGF A;  3RSJ A;  1FMM S;  4I8M A;  4ZKT B;  5JMC A;  1TOO A;  4QBC A;  3T8S A;  3TC2 A;  1PC8 B;  5B2H A;  4I1E A;  3CU1 B;  1S0F A;  2VU9 A;  1YXW A;  4KC3 A;  1YTO A;  2XOA A;  4XFT A;  41BI A;  1TWE A;  4LO2 C;  4LO8 B;  3A23 A;  1S0L A;  3PUB A;  3VT1 A;  3K1X A;  4EFQ A;  4D0T A;  2VXT I;  5FZY A;  3UJ4 A;  3C9Z A;  3WMU A;  3O4B A;  1JT4 A;  3RMY A;  2X2S A;  1AXM A;  2HWM A;  2MIB A;  4I6I A;  4ISR A;  4G9N A;  1N4K A;  3I2X A;  3H6S E;  2BFH A;  5BP5 C;  3A22 A;  1AF9 A;  1TFM B;  3UD9 A;  3H6R B;  4Z8S B;  1IRA X;  2YUG A;  1IIL A;  2D7I A;  4WBC A;  1JT3 A;  1XZZ A;  1NZK A;  1UPS A;  4P0K A;  2E4M C;  3O4O A;  1Q03 A;  4HA2 A;  4ZA3 B;  3R4U A;  4FVV A;  4HR6 C;  4JAW A;  1R8N A;  2ESU A;  2KI4 A;  5DSS B;  1D0H A;  3P53 A;  3FJC A;  2D24 A;  3POK A;  2MC2 A;  4YOL A;  3JRR A;  1TTU A;  3UD7 A;  1DFQ A;  3VT0 A;  4KEJ A;  1YF8 B;  3P6I A;  4OWK A;  5I1B A;  2FO1 A;  4KEI A;  5FZZ A;  2MLL B;  4IYB A;  3UD8 A;  3SNV A;  1JLX A;  4ZLB B;  3ZXG A;  4J2X A;  5DZU A;  3BTA A;  3BA5 A;  2VSE A;  3CQA A;  1EV2 A;  2ZQO A;  3FJE A;  5D63 A;  3ZC9 A;  3OJ2 A;  3IM6 A;  3QYD A;  1DZD A;  3HBW A;  1HWM B;  1TP0 A;  4GOY A;  1JQZ A;  3CA6 A;  3F1R A;  2QYI B;  5BXR A; 
#chains in the Genus database with same CATH homology
 1TWM A;  2AAI B;  3FGM A;  4I4Q A;  3WMV A;  4QD2 B;  3A21 A;  1G9B A;  1DLL A;  3VWC A;  4ZFU B;  4LO1 A;  3V0B A;  2HZ9 A;  4I1B A;  1R8O A;  3PG0 A;  2F8X C;  4D0Z A;  5FZU A;  5GAQ A;  3ZXD A;  4LO7 C;  1VCL A;  3JUT A;  2WRY A;  1AVA C;  4ZGR B;  4GAI A;  3N7M A;  3AZW A;  1M2T B;  1E0O A;  4EKX B;  2VSA A;  3IM5 A;  2NM1 A;  3NBE A;  5HPZ A;  2D1Z A;  2F2F A;  1AVU A;  3HMY A;  1DIW A;  4EFR A;  2VUA A;  4F83 A;  3BAD A;  1YYN A;  2NP0 A;  3O4D A;  3V0A B;  1IT0 A;  1V6U A;  4I7I A;  1G9A A;  4XFU A;  9ILB A;  3NBN A;  2D23 A;  3CA5 A;  1T4Q A;  4USP A;  1DQG A;  5G00 A;  3HN1 A;  1FV2 A;  3MAL A;  3V0A A;  4I4R A;  3AKH A;  3HOM A;  2Y9F A;  4EEE B;  1HCE A;  1JLY A;  4ION A;  4JPZ A;  2L5X A;  4I4O A;  3CA3 A;  2FFV A;  4KEK A;  5JLV A;  2FDB M;  4ZFW B;  1SR4 C;  3CA0 A;  3H6Q A;  1Z2V A;  3IIR A;  4J2K A;  3VUO A;  1EYL A;  3AH2 A;  3CRG A;  3AH1 A;  3BAH A;  3OJV A;  5E24 E;  4I4U A;  3VT2 A;  4OWL A;  4Q91 A;  3BX1 C;  3OGF A;  1S0G A;  1KNM A;  3O3Q A;  2DRY A;  3NBC A;  4G6J A;  2LIE A;  3BRD A;  3KMV A;  1WD3 A;  1BFB A;  1HCD A;  1I1E A;  3O49 A;  4QD2 C;  1S0D A;  4IQP A;  2AFG A;  2RG9 B;  3S8K A;  4OEF A;  1DQO A;  5BOW A;  1FWV A;  1XYF A;  1HIB A;  2BEA A;  4LO0 C;  2Q3N B;  3N7J A;  3N7L A;  2FFU A;  1FMZ A;  4EFP A;  2K43 A;  2NZ9 A;  1ITB A;  1JTC A;  4A7K A;  4JKX B;  4CJM A;  4DEN A;  1RML A;  3BAQ A;  3FJB A;  4IY8 A;  4I37 A;  1EPW A;  4MZH A;  4XFS A;  2BEB A;  1BAS A;  1JT5 A;  3IAG C;  4FGF A;  3F62 B;  4L4H A;  3FJ9 A;  4H75 A;  4OWJ A;  1GGP B;  3HSM A;  1PUU B;  1MD6 A;  4Q9P A;  3FUQ A;  1J0S A;  4F34 A;  3FJI A;  3OJM A;  21BI A;  2Y9X E;  2IWT B;  1RG8 A;  1G9D A;  4AN7 B;  4GAF A;  5FNX A;  1IRP A;  3ZX7 A;  1FV3 A;  3BRG C;  3O44 A;  4Q9G A;  4TLP A;  2Y9G A;  3FJD A;  2ZQN A;  1K5U A;  1BLD A;  1I1B A;  2Q9X A;  4J2S A;  3OBR A;  3V0B B;  1MC9 A;  3WA1 A;  3NJ5 A;  3AKG A;  1FQ9 A;  3FJK A;  3EF2 A;  5DUY A;  1XHB A;  31BI A;  3I2A A;  3QR5 A;  3OBT A;  4I4P A;  2LIQ A;  2R9K B;  5BQU C;  3LLP A;  1M16 A;  5BXT A;  1SR4 A;  1V6V A;  4JQ0 A;  5BVP I;  4OEE A;  2HWA A;  4J2Y A;  1FGA A;  1CVS A;  5EHA A;  4Z9W B;  4LO2 A;  1G82 A;  1ISZ A;  3HAL A;  4OEG A;  5DVH A;  3BRF A;  2D43 A;  1QQK A;  2KLL A;  1OQL B;  3AKI A;  1YBI A;  1EVT A;  3BAV A;  1W3F A;  2VLC A;  2Z49 A;  3FFZ A;  2X2T A;  2ET2 A;  2J3P A;  1W3G A;  1V6X A;  3WIN C;  5EG6 C;  1IJT A;  3ILA A;  4QO3 A;  3BA4 A;  2VXR A;  5BP5 A;  3FJF A;  4USO A;  4D8H A;  3UJ0 A;  1BFC A;  4LO3 C;  3V79 C;  1ABR B;  1II4 A;  1P63 A;  4X3A A;  2D22 A;  3VSZ A;  1G9C A;  3FJJ A;  3Q7X A;  1HKN A;  3FJH A;  2GZB A;  3OGG A;  2Z48 A;  5BXS A;  4ZFY B;  2E4M A;  2ZR1 B;  1PWA A;  1ISX A;  2KKI A;  1HWN B;  4QAL A;  2M49 A;  1BA7 A;  4LO1 C;  1BAR A;  4JRA A;  3W9T A;  3BAU A;  4R6U B;  4X39 A;  3WO4 A;  4KBB A;  4DCK C;  1Z0H A;  4MZF B;  3BAO A;  3P6J A;  4I96 A;  3IM7 A;  1CE7 B;  1JY0 A;  2KH2 A;  4I2S A;  3CA4 A;  8I1B A;  1Z4S A;  1L2H A;  4QKS A;  1IHK A;  2F2F C;  1AFC A;  3VEQ A;  3FJ8 A;  4IY9 A;  1ISV A;  4I0Y A;  3FUO A;  1ONK B;  3CA1 A;  1ILR 1;  2GO2 A;  1DJS B;  5D62 A;  1FWU A;  2AXM A;  3AH4 A;  4JKQ A;  5EC5 A;  2RQ9 A;  1Q1U A;  4LO7 B;  3UDA A;  3Q7W A;  4QKR A;  1PZZ A;  1Q04 A;  1IOB A;  1S0E A;  4J23 B;  1S0C A;  2KI6 B;  5BQU A;  4P0L A;  4X38 A;  1AVW B;  4IZE A;  2NVH A;  4OW4 A;  1A8D A;  2NTD A;  3AJ5 A;  4II0 A;  5F8Y A;  3BAG A;  1ISW A;  4G6M A;  1WBC A;  3NBD A;  4ISQ A;  3AZV A;  5F8S A;  1QXM A;  4QC4 A;  3H6R A;  3RTI B;  3RMX A;  3WO3 A;  3PHZ A;  3BA7 A;  4L4I A;  2ERM A;  2DRZ A;  3N0K A;  1AVX B;  1SZ6 B;  1BFG A;  4QBV A;  3MPP G;  4EB2 B;  1XG6 A;  2K4A B;  1ISY A;  4IZX A;  2IHO A;  3O5W B;  3RTJ B;  1WBA A;  3WIN A;  2HW9 A;  1RZO B;  4P6A A;  3D7W B;  4PC4 A;  1RY7 A;  2AQZ A;  2D7R A;  3O4C A;  4H04 A;  1V6W A;  4LO3 A;  2DRE A;  2I1B A;  4AN6 A;  4UY4 A;  2NS2 A;  4ZOT A;  3BB2 A;  1FN0 A;  1W3A A;  3FJA A;  1TIE A;  4GOV A;  5BXP A;  1HWP B;  4P0J A;  4G1R A;  3B9U A;  4IHZ A;  2NYY A;  2Y9W C;  4I4V A;  6I1B A;  1BLA A;  3I29 B;  4END A;  4DEP A;  3O4A A;  4A7Z A;  3AJ6 A;  1DFC A;  3Q7Y A;  1T9F A;  2K8R A;  2UUS A;  3N7K A;  1JT7 A;  2DS0 A;  3PME A;  2D44 A;  4H9W A;  4OUJ A;  3LTQ A;  3VSF A;  4LO0 A;  2D20 A;  3CRI A;  1F31 A;  5F8W A;  3S8J A;  2P23 A;  2RST A;  1DZC A;  3WO2 A;  4HJJ A;  3R4S A;  3CRH A;  4MZG B;  3AKF A;  2P39 A;  4JP0 A;  1WD4 A;  5FNW A;  4A7Y A;  3E8L C;  1BFF A;  1PUM B;  4I4X A;  1HWO B;  3ZC8 A;  2QN4 A;  4G9M A;  1S0B A;  5F90 A;  1NUN A;  1K5V A;  2WBC A;  3CAH A;  4GP0 A;  4GP3 A;  4I3N A;  4X37 A;  4XKI A;  4I4S A;  5D61 A;  4I4Y A;  3A07 A;  7I1B A;  1QQL A;  4ZBV B;  2FGF A;  3RSJ A;  1FMM S;  4I8M A;  4ZKT B;  5JMC A;  1TOO A;  4QBC A;  3T8S A;  3TC2 A;  1PC8 B;  5B2H A;  4I1E A;  3CU1 B;  1S0F A;  2VU9 A;  1YXW A;  4KC3 A;  1YTO A;  2XOA A;  4XFT A;  41BI A;  1TWE A;  4LO2 C;  4LO8 B;  3A23 A;  1S0L A;  3PUB A;  3VT1 A;  3K1X A;  4EFQ A;  4D0T A;  2VXT I;  5FZY A;  3UJ4 A;  3C9Z A;  3WMU A;  3O4B A;  1JT4 A;  3RMY A;  2X2S A;  1AXM A;  2HWM A;  2MIB A;  4I6I A;  4ISR A;  4G9N A;  1N4K A;  3I2X A;  3H6S E;  2BFH A;  5BP5 C;  3A22 A;  1AF9 A;  1TFM B;  3UD9 A;  3H6R B;  4Z8S B;  1IRA X;  2YUG A;  1IIL A;  2D7I A;  4WBC A;  1JT3 A;  1XZZ A;  1NZK A;  1UPS A;  4P0K A;  2E4M C;  3O4O A;  1Q03 A;  4HA2 A;  4ZA3 B;  3R4U A;  4FVV A;  4HR6 C;  4JAW A;  1R8N A;  2ESU A;  2KI4 A;  5DSS B;  1D0H A;  3P53 A;  3FJC A;  2D24 A;  3POK A;  2MC2 A;  4YOL A;  3JRR A;  1TTU A;  3UD7 A;  1DFQ A;  3VT0 A;  4KEJ A;  1YF8 B;  3P6I A;  4OWK A;  5I1B A;  2FO1 A;  4KEI A;  5FZZ A;  2MLL B;  4IYB A;  3UD8 A;  3SNV A;  1JLX A;  4ZLB B;  3ZXG A;  4J2X A;  5DZU A;  3BTA A;  3BA5 A;  2VSE A;  3CQA A;  1EV2 A;  2ZQO A;  3FJE A;  5D63 A;  3ZC9 A;  3OJ2 A;  3IM6 A;  3QYD A;  1DZD A;  3HBW A;  1HWM B;  1TP0 A;  4GOY A;  1JQZ A;  3CA6 A;  3F1R A;  2QYI B;  5BXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...