4X38A

Gallus interleukin-1 beta mutant - e118a
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
159
structure length
149
Chain Sequence
b'AFRYTRSQSFDIFDINQKCFVLESPTQLVALHLQSQKVRLNIALYRPRGTGQMPVALGIKGYKLYMSCVMSGTEPTLQLEEADVMRDIDSVELTRFIFYRLDSPTAGTTRFESAAFPGWFICTSLQPRQPVGITNQPDQVNIATYKLSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IL-1 beta
publication title Gallus interleukin-1 beta mutant - E118A
rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 32
structure length 149
sequence length 159
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4x38A00
4LO1C 4J2SA 2RSTA 2DREA 4EFQA 4X38A 3BADA 1HWMB 4LO3C 2Y9FA 1SZ6B 1BASA 3AKGA 3OJVA 4HA2A 2Y9XE 3O4OA 4GP0A 1VCLA 5D62A 3IM5A 3WO3A 3FFZA 1T4QA 3V0BA 4HJJA 1HKNA 3CQAA 1A8DA 3ZC9A 4G9MA 5FZUA 3RMXA 3UD9A 2D20A 1R8NA 2KKIA 1WD4A 1JT5A 2NM1A 1PZZA 1DLLA 1QQKA 2D44A 1D0HA 3P6JA 1ISWA 3UJ4A 1DZDA 5EG6C 3QYDA 1RY7A 1Q1UA 1PC8B 2YUGA 1G9BA 3N0KA 3V0BB 4KEIA 1G9CA 1BLDA 3O3QA 3FJBA 1SR4A 1IRPA 3VUOA 2L5XA 4HR6C 1ISZA 3VT1A 2GZBA 3RSJA 4EKXB 5DUYA 3QR5A 1EV2A 3D7WB 1JY0A 3Q7YA 4QALA 2F8XC 5F8SA 1I1EA 1MC9A 4I4RA 1G9AA 3HALA 4X37A 1DFCA 3BRGC 3IM7A 1FV2A 2VSAA 3AH2A 3FJFA 4QO3A 3PUBA 1IRAX 1V6VA 3I2XA 2MIBA 3POKA 3AJ5A 4A7ZA 1RG8A 3O44A 2QN4A 2VSEA 3MALA 3LTQA 3CA6A 1W3GA 3PMEA 1SR4C 3AKHA 5BXSA 5B2HA 3HMYA 3O4AA 4Q9GA 4I8MA 4GOVA 1YYNA 1M16A 9ILBA 3S8JA 3AH4A 3ZXDA 1OQLB 2BEAA 1S0EA 4GAIA 3BAVA 4OEEA 4I4UA 2P23A 4I6IA 1I1BA 1BFFA 2M49A 4ZOTA 4LO0A 1S0CA 1TWEA 4II0A 2IWTB 1Q03A 4I4YA 4IY9A 3ZC8A 4DEPA 4FVVA 4EEEB 4EB2B 2E4MA 3AJ6A 4I4PA 5BOWA 5DSSB 2ERMA 4LO2C 1AFCA 3OBTA 1FWVA 1KNMA 1HCDA 2NZ9A 3WMVA 4ZKTB 3BX1C 5FZZA 4IZEA 1K5UA 1DJSB 1EVTA 5FNWA 2Y9GA 4G6MA 4JKQA 2MC2A 2R9KB 4DENA 1AXMA 1BFGA 1DQGA 3PHZA 3FJCA 3CA1A 1IT0A 3N7KA 4LO0C 2KH2A 3CA0A 4J23B 1HWNB 1BA7A 2K8RA 4A7YA 3ILAA 6I1BA 5F90A 1S0FA 4QKSA 2E4MC 1JLYA 1BFCA 1J0SA 4J2KA 1TP0A 4I1BA 1CE7B 1DFQA 3OJ2A 2Q9XA 1MD6A 2FO1A 3H6RA 2DRYA 1II4A 2P39A 4H9WA 2ZQNA 1HIBA 1ISXA 3MPPG 5BXPA 1FN0A 3CRIA 3ZXGA 4QBVA 1ISVA 3BB2A 1T9FA 4ZFYB 1JT3A 5JLVA 1YTOA 1XZZA 3IIRA 1AVAC 3N7JA 4I2SA 2MLLB 2VU9A 4X3AA 4WBCA 4QD2B 1HWPB 2NYYA 2X2TA 1DIWA 3SNVA 4D0ZA 3A21A 4QD2C 4ISRA 3BAOA 1BFBA 4JAWA 3CA4A 1M2TB 1NUNA 2J3PA 4OW4A 1W3AA 1PUUB 3H6RB 1S0DA 2NTDA 2Y9WC 4Z8SB 1IILA 1V6WA 4F83A 2AFGA 3F1RA 5DZUA 4IYBA 4OUJA 2D23A 4LO8B 2WRYA 1EPWA 1YBIA 3UDAA 3S8KA 1AVUA 3CA3A 3BRDA 5HPZA 5DVHA 1NZKA 1HCEA 4Q9PA 2HW9A 1FQ9A 1JT7A 4G6JA 4D0TA 2AXMA 4KC3A 4KEJA 1QXMA 3K1XA 3UD8A 2VXTI 1QQLA 1R8OA 3CAHA 2ZQOA 2RG9B 4I3NA 3KMVA 3WMUA 1TIEA 3FUOA 3FJAA 4J2XA 1DQOA 3BA4A 2K43A 2UUSA 3C9ZA 1HWOB 4AN7B 1XYFA 5E24E 4ZFUB 4USOA 1E0OA 3FJHA 2HWAA 4OWKA 1IJTA 4L4IA 2BFHA 3O4DA 3V0AA 1UPSA 2HZ9A 2D7RA 3N7MA 4GOYA 2WBCA 3NBDA 4ZGRB 5EHAA 1WBAA 4ENDA 3FUQA 1AF9A 1AVXB 1K5VA 5BXTA 2VLCA 2KI4A 3O5WB 4I4QA 2Z49A 2VXRA 4ZBVB 3RTIB 4ISQA 2D1ZA 3P6IA 5F8YA 3FJJA 4JKXB 1ILR1 1JQZA 4XFSA 2FFVA 3Q7XA 3WA1A 3W9TA 4G1RA 2RQ9A 3AKIA 3O4BA 4OWJA 5FNXA 3N7LA 3FJEA 1Q04A 5BVPI 4PC4A 4AN6A 1S0BA 3HN1A 1WBCA 4XKIA 3VWCA 3BRFA 4QC4A 2I1BA 3O4CA 3A22A 4P0KA 31BIA 3JRRA 2LIQA 2Z48A 2FGFA 1G9DA 3OJMA 3NJ5A 3R4SA 2BEBA 1G82A 2DRZA 1L2HA 3VSFA 3FJKA 3RMYA 4Z9WB 5I1BA 3OGGA 4QBCA 4IONA 1PWAA 3BTAA 3HOMA 1DZCA 1ITBA 3A23A 3UD7A 2QYIB 1YXWA 3IM6A 3OBRA 2ZR1B 3CRHA 3BAQA 4OEGA 1S0LA 1EYLA 2NP0A 3TC2A 4I96A 4I37A 1V6UA 1Z4SA 1XHBA 2NVHA 3P53A 3Q7WA 4I4SA 4EFPA 4J2YA 3WINA 2Q3NB 4I0YA 3V79C 4P0JA 2D43A 3BAHA 2AQZA 1Z0HA 2D7IA 5BP5A 2FFUA 3UJ0A 41BIA 2DS0A 3EF2A 3VT2A 2KI6B 3AKFA 4XFUA 4GP3A 1IOBA 1JT4A 7I1BA 1TWMA 3AZVA 2FDBM 3FJ9A 3I2AA 4USPA 1P63A 1FGAA 4CJMA 2KLLA 3WO2A 3BAGA 4P0LA 2X2SA 5EC5A 4P6AA 4IY8A 2IHOA 4DCKC 5D61A 4JPZA 3HSMA 4FGFA 4EFRA 1IHKA 4XFTA 4I4XA 4TLPA 3WINC 5D63A 2D22A 1JTCA 1S0GA 4I4OA 2GO2A 4IQPA 1ISYA 1TFMB 1FV3A 3ZX7A 5BP5C 1N4KA 3BAUA 5F8WA 1FMMS 8I1BA 3FGMA 5JMCA 3OGFA 1RZOB 1BARA 2K4AB 5G00A 3CU1B 3FJIA 2F2FA 2ESUA 3FJDA 4F34A 3FJ8A 4H04A 3T8SA 3I29B 1TTUA 3RTJB 4LO7B 4QKRA 2AAIB 3A07A 4I7IA 1CVSA 3AZWA 4JP0A 5BQUA 3IAGC 1FMZA 4LO7C 4L4HA 4OEFA 3R4UA 4LO2A 3HBWA 1V6XA 1GGPB 4I1EA 1AVWB 3AH1A 3JUTA 2VUAA 3H6SE 4JQ0A 1BLAA 1FWUA 3H6QA 3NBNA 3CA5A 3NBCA 3VT0A 4IHZA 3PG0A 3VEQA 1ONKB 2F2FC 1W3FA 3LLPA 4X39A 4D8HA 3V0AB 3E8LC 4KBBA 4LO1A 4Q91A 2ET2A 3BA5A 1YF8B 4ZA3B 4LO3A 2XOAA 1Z2VA 5BQUC 4KEKA 4OWLA 3VSZA 3F62B 1F31A 4I4VA 5GAQA 4GAFA 2LIEA 3CRGA 1JLXA 5FZYA 1XG6A 3NBEA 2HWMA 3O49A 4IZXA 1PUMB 5BXRA 2D24A 1RMLA 21BIA 3B9UA 4ZLBB 1ABRB 4ZFWB 1WD3A 4R6UB 4A7KA 1TOOA 4YOLA 4G9NA 4JRAA 3BA7A 3WO4A
chains in the Genus database with same CATH superfamily
4LO1C 4J2SA 2RSTA 2DREA 4EFQA 4X38A 3BADA 1HWMB 4LO3C 2Y9FA 1SZ6B 1BASA 3AKGA 3OJVA 4HA2A 4MZGB 2Y9XE 3O4OA 4GP0A 1VCLA 5D62A 3IM5A 3WO3A 3FFZA 1T4QA 3V0BA 4HJJA 1HKNA 3CQAA 1A8DA 3ZC9A 4G9MA 5FZUA 3RMXA 3UD9A 2D20A 1R8NA 2KKIA 1WD4A 1JT5A 2NM1A 1PZZA 1DLLA 1QQKA 2D44A 1D0HA 3P6JA 1ISWA 3UJ4A 1DZDA 5EG6C 3QYDA 1RY7A 1Q1UA 1PC8B 2YUGA 1G9BA 3N0KA 3V0BB 4KEIA 1G9CA 1BLDA 3O3QA 3FJBA 1SR4A 1IRPA 3VUOA 2L5XA 4HR6C 1ISZA 3VT1A 2GZBA 3RSJA 4EKXB 5DUYA 3QR5A 1EV2A 3D7WB 1JY0A 3Q7YA 4QALA 2F8XC 5F8SA 1I1EA 1MC9A 4I4RA 1G9AA 3HALA 4X37A 1DFCA 3BRGC 3IM7A 1FV2A 2VSAA 3AH2A 3FJFA 4QO3A 3PUBA 1IRAX 1V6VA 3I2XA 2MIBA 3POKA 3AJ5A 4A7ZA 1RG8A 3O44A 2QN4A 2VSEA 3MALA 3LTQA 3CA6A 1W3GA 3PMEA 1SR4C 3AKHA 5BXSA 5B2HA 3HMYA 3O4AA 4Q9GA 4I8MA 4MZHA 4GOVA 1YYNA 1M16A 9ILBA 3S8JA 3AH4A 3ZXDA 1OQLB 2BEAA 1S0EA 4GAIA 3BAVA 4OEEA 4I4UA 2P23A 4I6IA 1I1BA 1BFFA 2M49A 4ZOTA 4LO0A 1S0CA 1TWEA 4II0A 2IWTB 1Q03A 4I4YA 4IY9A 3ZC8A 4DEPA 4FVVA 4EEEB 4EB2B 2E4MA 3AJ6A 4I4PA 5BOWA 5DSSB 2ERMA 4LO2C 1AFCA 3OBTA 1FWVA 1KNMA 1HCDA 2NZ9A 3WMVA 4ZKTB 3BX1C 5FZZA 4IZEA 1K5UA 1DJSB 1EVTA 5FNWA 2Y9GA 4G6MA 4JKQA 2MC2A 2R9KB 4DENA 1AXMA 1BFGA 1DQGA 3PHZA 3FJCA 3CA1A 1IT0A 3N7KA 4LO0C 2KH2A 3CA0A 4J23B 1HWNB 1BA7A 2K8RA 4A7YA 3ILAA 6I1BA 5F90A 1S0FA 4QKSA 2E4MC 1JLYA 1BFCA 1J0SA 4J2KA 1TP0A 4I1BA 1CE7B 1DFQA 3OJ2A 2Q9XA 1MD6A 2FO1A 3H6RA 2DRYA 1II4A 2P39A 4H9WA 2ZQNA 1HIBA 1ISXA 3MPPG 5BXPA 1FN0A 3CRIA 3ZXGA 4QBVA 1ISVA 3BB2A 1T9FA 4ZFYB 1JT3A 5JLVA 1YTOA 1XZZA 3IIRA 1AVAC 3N7JA 4I2SA 2MLLB 2VU9A 4X3AA 4WBCA 4QD2B 1HWPB 2NYYA 2X2TA 1DIWA 3SNVA 4D0ZA 3A21A 4QD2C 4ISRA 3BAOA 1BFBA 4JAWA 3CA4A 1M2TB 1NUNA 2J3PA 4OW4A 1W3AA 1PUUB 3H6RB 1S0DA 2NTDA 2Y9WC 4Z8SB 1IILA 1V6WA 4F83A 2AFGA 3F1RA 5DZUA 4IYBA 4OUJA 2D23A 4LO8B 2WRYA 1EPWA 1YBIA 3UDAA 3S8KA 1AVUA 3CA3A 3BRDA 5HPZA 5DVHA 1NZKA 1HCEA 4Q9PA 2HW9A 1FQ9A 1JT7A 4G6JA 4D0TA 2AXMA 4KC3A 4MZFB 4KEJA 1QXMA 3K1XA 3UD8A 2VXTI 1QQLA 1R8OA 3CAHA 2ZQOA 2RG9B 4I3NA 3KMVA 3WMUA 1TIEA 3FUOA 3FJAA 4J2XA 1DQOA 3BA4A 2K43A 2UUSA 3C9ZA 1HWOB 4AN7B 1XYFA 5E24E 4ZFUB 4USOA 1E0OA 3FJHA 2HWAA 4OWKA 1IJTA 4L4IA 2BFHA 3O4DA 3V0AA 1UPSA 2HZ9A 2D7RA 3N7MA 4GOYA 2WBCA 3NBDA 4ZGRB 5EHAA 1WBAA 4ENDA 3FUQA 1AF9A 1AVXB 1K5VA 5BXTA 2VLCA 2KI4A 3O5WB 4I4QA 2Z49A 2VXRA 4ZBVB 3RTIB 4ISQA 2D1ZA 3P6IA 5F8YA 3FJJA 4JKXB 1ILR1 1JQZA 4XFSA 2FFVA 3Q7XA 3WA1A 3W9TA 4H75A 4G1RA 2RQ9A 3AKIA 3O4BA 4OWJA 5FNXA 3N7LA 3FJEA 1Q04A 5BVPI 4PC4A 4AN6A 1S0BA 3HN1A 1WBCA 4XKIA 3VWCA 3BRFA 4QC4A 2I1BA 3O4CA 3A22A 4P0KA 31BIA 3JRRA 2LIQA 2Z48A 2FGFA 1G9DA 3OJMA 3NJ5A 3R4SA 2BEBA 1G82A 2DRZA 1L2HA 3VSFA 3FJKA 3RMYA 4Z9WB 5I1BA 3OGGA 4QBCA 4IONA 1PWAA 3BTAA 3HOMA 1DZCA 1ITBA 3A23A 3UD7A 2QYIB 1YXWA 3IM6A 3OBRA 2ZR1B 3CRHA 3BAQA 4OEGA 1S0LA 1EYLA 2NP0A 3TC2A 4I96A 4I37A 1V6UA 1Z4SA 1XHBA 2NVHA 3P53A 3Q7WA 4I4SA 4EFPA 4J2YA 3WINA 2Q3NB 4I0YA 3V79C 4P0JA 2D43A 3BAHA 2AQZA 1Z0HA 2D7IA 5BP5A 2FFUA 3UJ0A 41BIA 2DS0A 3EF2A 3VT2A 2KI6B 3AKFA 4XFUA 4GP3A 1IOBA 1JT4A 7I1BA 1TWMA 3AZVA 2FDBM 3FJ9A 3I2AA 4USPA 1P63A 1FGAA 4CJMA 2KLLA 3WO2A 3BAGA 4P0LA 2X2SA 5EC5A 4P6AA 4IY8A 2IHOA 4DCKC 5D61A 4JPZA 3HSMA 4FGFA 4EFRA 1IHKA 4XFTA 4I4XA 4TLPA 3WINC 5D63A 2D22A 1JTCA 1S0GA 4I4OA 2GO2A 4IQPA 1ISYA 1TFMB 1FV3A 3ZX7A 5BP5C 1N4KA 3BAUA 5F8WA 1FMMS 8I1BA 3FGMA 5JMCA 3OGFA 1RZOB 1BARA 2K4AB 5G00A 3CU1B 3FJIA 2F2FA 2ESUA 3FJDA 4F34A 3FJ8A 4H04A 3T8SA 3I29B 1TTUA 3RTJB 4LO7B 4QKRA 2AAIB 3A07A 4I7IA 1CVSA 3AZWA 4JP0A 5BQUA 3IAGC 1FMZA 4LO7C 4L4HA 4OEFA 3R4UA 4LO2A 3HBWA 1V6XA 1GGPB 4I1EA 1AVWB 3AH1A 3JUTA 2VUAA 3H6SE 4JQ0A 1BLAA 4UY4A 1FWUA 3H6QA 3NBNA 3CA5A 3NBCA 3VT0A 4IHZA 3PG0A 3VEQA 1ONKB 2F2FC 1W3FA 3LLPA 4X39A 4D8HA 3V0AB 3E8LC 4KBBA 4LO1A 4Q91A 2ET2A 3BA5A 1YF8B 4ZA3B 4LO3A 2XOAA 1Z2VA 5BQUC 4KEKA 4OWLA 3VSZA 3F62B 1F31A 4I4VA 5GAQA 4GAFA 2LIEA 3CRGA 1JLXA 5FZYA 1XG6A 3NBEA 2HWMA 3O49A 4IZXA 1PUMB 5BXRA 2D24A 2NS2A 1RMLA 21BIA 3B9UA 4ZLBB 1ABRB 4ZFWB 1WD3A 4R6UB 4A7KA 1TOOA 4YOLA 4G9NA 4JRAA 3BA7A 3WO4A
chains in the Genus database with same CATH topology
4LO1C 4J2SA 2RSTA 2DREA 4EFQA 4X38A 3BADA 1HWMB 4LO3C 2Y9FA 1SZ6B 1BASA 3AKGA 3OJVA 4HA2A 4MZGB 2Y9XE 3O4OA 4GP0A 1VCLA 5D62A 3IM5A 3WO3A 3FFZA 1T4QA 3V0BA 4HJJA 1HKNA 3CQAA 1A8DA 3ZC9A 4G9MA 5FZUA 3RMXA 3UD9A 2D20A 1R8NA 2KKIA 1WD4A 1JT5A 2NM1A 1PZZA 1DLLA 1QQKA 2D44A 1D0HA 3P6JA 1ISWA 3UJ4A 1DZDA 5EG6C 3QYDA 1RY7A 1Q1UA 1PC8B 2YUGA 1G9BA 3N0KA 3V0BB 4KEIA 1G9CA 1BLDA 3O3QA 3FJBA 1SR4A 1IRPA 3VUOA 2L5XA 4HR6C 1ISZA 3VT1A 2GZBA 3RSJA 4EKXB 5DUYA 3QR5A 1EV2A 3D7WB 1JY0A 3Q7YA 4QALA 2F8XC 5F8SA 1I1EA 1MC9A 4I4RA 1G9AA 3HALA 4X37A 1DFCA 3BRGC 3IM7A 1FV2A 2VSAA 3AH2A 3FJFA 4QO3A 3PUBA 1IRAX 1V6VA 3I2XA 2MIBA 3POKA 3AJ5A 4A7ZA 1RG8A 3O44A 2QN4A 2VSEA 3MALA 3LTQA 3CA6A 1W3GA 3PMEA 1SR4C 3AKHA 5BXSA 5B2HA 3HMYA 3O4AA 4Q9GA 4I8MA 4MZHA 4GOVA 1YYNA 1M16A 9ILBA 3S8JA 3AH4A 3ZXDA 1OQLB 2BEAA 1S0EA 4GAIA 3BAVA 4OEEA 4I4UA 2P23A 4I6IA 1I1BA 1BFFA 2M49A 4ZOTA 4LO0A 1S0CA 1TWEA 4II0A 2IWTB 1Q03A 4I4YA 4IY9A 3ZC8A 4DEPA 4FVVA 4EEEB 4EB2B 2E4MA 3AJ6A 4I4PA 5BOWA 5DSSB 2ERMA 4LO2C 1AFCA 3OBTA 1FWVA 1KNMA 1HCDA 2NZ9A 3WMVA 4ZKTB 3BX1C 5FZZA 4IZEA 1K5UA 1DJSB 1EVTA 5FNWA 2Y9GA 4G6MA 4JKQA 2MC2A 2R9KB 4DENA 1AXMA 1BFGA 1DQGA 3PHZA 3FJCA 3CA1A 1IT0A 3N7KA 4LO0C 2KH2A 3CA0A 4J23B 1HWNB 1BA7A 2K8RA 4A7YA 3ILAA 6I1BA 5F90A 1S0FA 4QKSA 2E4MC 1JLYA 1BFCA 1J0SA 4J2KA 1TP0A 4I1BA 1CE7B 1DFQA 3OJ2A 2Q9XA 1MD6A 2FO1A 3H6RA 2DRYA 1II4A 2P39A 4H9WA 2ZQNA 1HIBA 1ISXA 3MPPG 5BXPA 1FN0A 3CRIA 3ZXGA 4QBVA 1ISVA 3BB2A 1T9FA 4ZFYB 1JT3A 5JLVA 1YTOA 1XZZA 3IIRA 1AVAC 3N7JA 4I2SA 2MLLB 2VU9A 4X3AA 4WBCA 4QD2B 1HWPB 2NYYA 2X2TA 1DIWA 3SNVA 4D0ZA 3A21A 4QD2C 4ISRA 3BAOA 1BFBA 4JAWA 3CA4A 1M2TB 1NUNA 2J3PA 4OW4A 1W3AA 1PUUB 3H6RB 1S0DA 2NTDA 2Y9WC 4Z8SB 1IILA 1V6WA 4F83A 2AFGA 3F1RA 5DZUA 4IYBA 4OUJA 2D23A 4LO8B 2WRYA 1EPWA 1YBIA 3UDAA 3S8KA 1AVUA 3CA3A 3BRDA 5HPZA 5DVHA 1NZKA 1HCEA 4Q9PA 2HW9A 1FQ9A 1JT7A 4G6JA 4D0TA 2AXMA 4KC3A 4MZFB 4KEJA 1QXMA 3K1XA 3UD8A 2VXTI 1QQLA 1R8OA 3CAHA 2ZQOA 2RG9B 4I3NA 3KMVA 3WMUA 1TIEA 3FUOA 3FJAA 4J2XA 1DQOA 3BA4A 2K43A 2UUSA 3C9ZA 1HWOB 4AN7B 1XYFA 5E24E 4ZFUB 4USOA 1E0OA 3FJHA 2HWAA 4OWKA 1IJTA 4L4IA 2BFHA 3O4DA 3V0AA 1UPSA 2HZ9A 2D7RA 3N7MA 4GOYA 2WBCA 3NBDA 4ZGRB 5EHAA 1WBAA 4ENDA 3FUQA 1AF9A 1AVXB 1K5VA 5BXTA 2VLCA 2KI4A 3O5WB 4I4QA 2Z49A 2VXRA 4ZBVB 3RTIB 4ISQA 2D1ZA 3P6IA 5F8YA 3FJJA 4JKXB 1ILR1 1JQZA 4XFSA 2FFVA 3Q7XA 3WA1A 3W9TA 4H75A 4G1RA 2RQ9A 3AKIA 3O4BA 4OWJA 5FNXA 3N7LA 3FJEA 1Q04A 5BVPI 4PC4A 4AN6A 1S0BA 3HN1A 1WBCA 4XKIA 3VWCA 3BRFA 4QC4A 2I1BA 3O4CA 3A22A 4P0KA 31BIA 3JRRA 2LIQA 2Z48A 2FGFA 1G9DA 3OJMA 3NJ5A 3R4SA 2BEBA 1G82A 2DRZA 1L2HA 3VSFA 3FJKA 3RMYA 4Z9WB 5I1BA 3OGGA 4QBCA 4IONA 1PWAA 3BTAA 3HOMA 1DZCA 1ITBA 3A23A 3UD7A 2QYIB 1YXWA 3IM6A 3OBRA 2ZR1B 3CRHA 3BAQA 4OEGA 1S0LA 1EYLA 2NP0A 3TC2A 4I96A 4I37A 1V6UA 1Z4SA 1XHBA 2NVHA 3P53A 3Q7WA 4I4SA 4EFPA 4J2YA 3WINA 2Q3NB 4I0YA 3V79C 4P0JA 2D43A 3BAHA 2AQZA 1Z0HA 2D7IA 5BP5A 2FFUA 3UJ0A 41BIA 2DS0A 3EF2A 3VT2A 2KI6B 3AKFA 4XFUA 4GP3A 1IOBA 1JT4A 7I1BA 1TWMA 3AZVA 2FDBM 3FJ9A 3I2AA 4USPA 1P63A 1FGAA 4CJMA 2KLLA 3WO2A 3BAGA 4P0LA 2X2SA 5EC5A 4P6AA 4IY8A 2IHOA 4DCKC 5D61A 4JPZA 3HSMA 4FGFA 4EFRA 1IHKA 4XFTA 4I4XA 4TLPA 3WINC 5D63A 2D22A 1JTCA 1S0GA 4I4OA 2GO2A 4IQPA 1ISYA 1TFMB 1FV3A 3ZX7A 5BP5C 1N4KA 3BAUA 5F8WA 1FMMS 8I1BA 3FGMA 5JMCA 3OGFA 1RZOB 1BARA 2K4AB 5G00A 3CU1B 3FJIA 2F2FA 2ESUA 3FJDA 4F34A 3FJ8A 4H04A 3T8SA 3I29B 1TTUA 3RTJB 4LO7B 4QKRA 2AAIB 3A07A 4I7IA 1CVSA 3AZWA 4JP0A 5BQUA 3IAGC 1FMZA 4LO7C 4L4HA 4OEFA 3R4UA 4LO2A 3HBWA 1V6XA 1GGPB 4I1EA 1AVWB 3AH1A 3JUTA 2VUAA 3H6SE 4JQ0A 1BLAA 4UY4A 1FWUA 3H6QA 3NBNA 3CA5A 3NBCA 3VT0A 4IHZA 3PG0A 3VEQA 1ONKB 2F2FC 1W3FA 3LLPA 4X39A 4D8HA 3V0AB 3E8LC 4KBBA 4LO1A 4Q91A 2ET2A 3BA5A 1YF8B 4ZA3B 4LO3A 2XOAA 1Z2VA 5BQUC 4KEKA 4OWLA 3VSZA 3F62B 1F31A 4I4VA 5GAQA 4GAFA 2LIEA 3CRGA 1JLXA 5FZYA 1XG6A 3NBEA 2HWMA 3O49A 4IZXA 1PUMB 5BXRA 2D24A 2NS2A 1RMLA 21BIA 3B9UA 4ZLBB 1ABRB 4ZFWB 1WD3A 4R6UB 4A7KA 1TOOA 4YOLA 4G9NA 4JRAA 3BA7A 3WO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LO1 C;  4J2S A;  2RST A;  2DRE A;  4EFQ A;  4X38 A;  3BAD A;  1HWM B;  4LO3 C;  2Y9F A;  1SZ6 B;  1BAS A;  3AKG A;  3OJV A;  4HA2 A;  2Y9X E;  3O4O A;  4GP0 A;  1VCL A;  5D62 A;  3IM5 A;  3WO3 A;  3FFZ A;  1T4Q A;  3V0B A;  4HJJ A;  1HKN A;  3CQA A;  1A8D A;  3ZC9 A;  4G9M A;  5FZU A;  3RMX A;  3UD9 A;  2D20 A;  1R8N A;  2KKI A;  1WD4 A;  1JT5 A;  2NM1 A;  1PZZ A;  1DLL A;  1QQK A;  2D44 A;  1D0H A;  3P6J A;  1ISW A;  3UJ4 A;  1DZD A;  5EG6 C;  3QYD A;  1RY7 A;  1Q1U A;  1PC8 B;  2YUG A;  1G9B A;  3N0K A;  3V0B B;  4KEI A;  1G9C A;  1BLD A;  3O3Q A;  3FJB A;  1SR4 A;  1IRP A;  3VUO A;  2L5X A;  4HR6 C;  1ISZ A;  3VT1 A;  2GZB A;  3RSJ A;  4EKX B;  5DUY A;  3QR5 A;  1EV2 A;  3D7W B;  1JY0 A;  3Q7Y A;  4QAL A;  2F8X C;  5F8S A;  1I1E A;  1MC9 A;  4I4R A;  1G9A A;  3HAL A;  4X37 A;  1DFC A;  3BRG C;  3IM7 A;  1FV2 A;  2VSA A;  3AH2 A;  3FJF A;  4QO3 A;  3PUB A;  1IRA X;  1V6V A;  3I2X A;  2MIB A;  3POK A;  3AJ5 A;  4A7Z A;  1RG8 A;  3O44 A;  2QN4 A;  2VSE A;  3MAL A;  3LTQ A;  3CA6 A;  1W3G A;  3PME A;  1SR4 C;  3AKH A;  5BXS A;  5B2H A;  3HMY A;  3O4A A;  4Q9G A;  4I8M A;  4GOV A;  1YYN A;  1M16 A;  9ILB A;  3S8J A;  3AH4 A;  3ZXD A;  1OQL B;  2BEA A;  1S0E A;  4GAI A;  3BAV A;  4OEE A;  4I4U A;  2P23 A;  4I6I A;  1I1B A;  1BFF A;  2M49 A;  4ZOT A;  4LO0 A;  1S0C A;  1TWE A;  4II0 A;  2IWT B;  1Q03 A;  4I4Y A;  4IY9 A;  3ZC8 A;  4DEP A;  4FVV A;  4EEE B;  4EB2 B;  2E4M A;  3AJ6 A;  4I4P A;  5BOW A;  5DSS B;  2ERM A;  4LO2 C;  1AFC A;  3OBT A;  1FWV A;  1KNM A;  1HCD A;  2NZ9 A;  3WMV A;  4ZKT B;  3BX1 C;  5FZZ A;  4IZE A;  1K5U A;  1DJS B;  1EVT A;  5FNW A;  2Y9G A;  4G6M A;  4JKQ A;  2MC2 A;  2R9K B;  4DEN A;  1AXM A;  1BFG A;  1DQG A;  3PHZ A;  3FJC A;  3CA1 A;  1IT0 A;  3N7K A;  4LO0 C;  2KH2 A;  3CA0 A;  4J23 B;  1HWN B;  1BA7 A;  2K8R A;  4A7Y A;  3ILA A;  6I1B A;  5F90 A;  1S0F A;  4QKS A;  2E4M C;  1JLY A;  1BFC A;  1J0S A;  4J2K A;  1TP0 A;  4I1B A;  1CE7 B;  1DFQ A;  3OJ2 A;  2Q9X A;  1MD6 A;  2FO1 A;  3H6R A;  2DRY A;  1II4 A;  2P39 A;  4H9W A;  2ZQN A;  1HIB A;  1ISX A;  3MPP G;  5BXP A;  1FN0 A;  3CRI A;  3ZXG A;  4QBV A;  1ISV A;  3BB2 A;  1T9F A;  4ZFY B;  1JT3 A;  5JLV A;  1YTO A;  1XZZ A;  3IIR A;  1AVA C;  3N7J A;  4I2S A;  2MLL B;  2VU9 A;  4X3A A;  4WBC A;  4QD2 B;  1HWP B;  2NYY A;  2X2T A;  1DIW A;  3SNV A;  4D0Z A;  3A21 A;  4QD2 C;  4ISR A;  3BAO A;  1BFB A;  4JAW A;  3CA4 A;  1M2T B;  1NUN A;  2J3P A;  4OW4 A;  1W3A A;  1PUU B;  3H6R B;  1S0D A;  2NTD A;  2Y9W C;  4Z8S B;  1IIL A;  1V6W A;  4F83 A;  2AFG A;  3F1R A;  5DZU A;  4IYB A;  4OUJ A;  2D23 A;  4LO8 B;  2WRY A;  1EPW A;  1YBI A;  3UDA A;  3S8K A;  1AVU A;  3CA3 A;  3BRD A;  5HPZ A;  5DVH A;  1NZK A;  1HCE A;  4Q9P A;  2HW9 A;  1FQ9 A;  1JT7 A;  4G6J A;  4D0T A;  2AXM A;  4KC3 A;  4KEJ A;  1QXM A;  3K1X A;  3UD8 A;  2VXT I;  1QQL A;  1R8O A;  3CAH A;  2ZQO A;  2RG9 B;  4I3N A;  3KMV A;  3WMU A;  1TIE A;  3FUO A;  3FJA A;  4J2X A;  1DQO A;  3BA4 A;  2K43 A;  2UUS A;  3C9Z A;  1HWO B;  4AN7 B;  1XYF A;  5E24 E;  4ZFU B;  4USO A;  1E0O A;  3FJH A;  2HWA A;  4OWK A;  1IJT A;  4L4I A;  2BFH A;  3O4D A;  3V0A A;  1UPS A;  2HZ9 A;  2D7R A;  3N7M A;  4GOY A;  2WBC A;  3NBD A;  4ZGR B;  5EHA A;  1WBA A;  4END A;  3FUQ A;  1AF9 A;  1AVX B;  1K5V A;  5BXT A;  2VLC A;  2KI4 A;  3O5W B;  4I4Q A;  2Z49 A;  2VXR A;  4ZBV B;  3RTI B;  4ISQ A;  2D1Z A;  3P6I A;  5F8Y A;  3FJJ A;  4JKX B;  1ILR 1;  1JQZ A;  4XFS A;  2FFV A;  3Q7X A;  3WA1 A;  3W9T A;  4G1R A;  2RQ9 A;  3AKI A;  3O4B A;  4OWJ A;  5FNX A;  3N7L A;  3FJE A;  1Q04 A;  5BVP I;  4PC4 A;  4AN6 A;  1S0B A;  3HN1 A;  1WBC A;  4XKI A;  3VWC A;  3BRF A;  4QC4 A;  2I1B A;  3O4C A;  3A22 A;  4P0K A;  31BI A;  3JRR A;  2LIQ A;  2Z48 A;  2FGF A;  1G9D A;  3OJM A;  3NJ5 A;  3R4S A;  2BEB A;  1G82 A;  2DRZ A;  1L2H A;  3VSF A;  3FJK A;  3RMY A;  4Z9W B;  5I1B A;  3OGG A;  4QBC A;  4ION A;  1PWA A;  3BTA A;  3HOM A;  1DZC A;  1ITB A;  3A23 A;  3UD7 A;  2QYI B;  1YXW A;  3IM6 A;  3OBR A;  2ZR1 B;  3CRH A;  3BAQ A;  4OEG A;  1S0L A;  1EYL A;  2NP0 A;  3TC2 A;  4I96 A;  4I37 A;  1V6U A;  1Z4S A;  1XHB A;  2NVH A;  3P53 A;  3Q7W A;  4I4S A;  4EFP A;  4J2Y A;  3WIN A;  2Q3N B;  4I0Y A;  3V79 C;  4P0J A;  2D43 A;  3BAH A;  2AQZ A;  1Z0H A;  2D7I A;  5BP5 A;  2FFU A;  3UJ0 A;  41BI A;  2DS0 A;  3EF2 A;  3VT2 A;  2KI6 B;  3AKF A;  4XFU A;  4GP3 A;  1IOB A;  1JT4 A;  7I1B A;  1TWM A;  3AZV A;  2FDB M;  3FJ9 A;  3I2A A;  4USP A;  1P63 A;  1FGA A;  4CJM A;  2KLL A;  3WO2 A;  3BAG A;  4P0L A;  2X2S A;  5EC5 A;  4P6A A;  4IY8 A;  2IHO A;  4DCK C;  5D61 A;  4JPZ A;  3HSM A;  4FGF A;  4EFR A;  1IHK A;  4XFT A;  4I4X A;  4TLP A;  3WIN C;  5D63 A;  2D22 A;  1JTC A;  1S0G A;  4I4O A;  2GO2 A;  4IQP A;  1ISY A;  1TFM B;  1FV3 A;  3ZX7 A;  5BP5 C;  1N4K A;  3BAU A;  5F8W A;  1FMM S;  8I1B A;  3FGM A;  5JMC A;  3OGF A;  1RZO B;  1BAR A;  2K4A B;  5G00 A;  3CU1 B;  3FJI A;  2F2F A;  2ESU A;  3FJD A;  4F34 A;  3FJ8 A;  4H04 A;  3T8S A;  3I29 B;  1TTU A;  3RTJ B;  4LO7 B;  4QKR A;  2AAI B;  3A07 A;  4I7I A;  1CVS A;  3AZW A;  4JP0 A;  5BQU A;  3IAG C;  1FMZ A;  4LO7 C;  4L4H A;  4OEF A;  3R4U A;  4LO2 A;  3HBW A;  1V6X A;  1GGP B;  4I1E A;  1AVW B;  3AH1 A;  3JUT A;  2VUA A;  3H6S E;  4JQ0 A;  1BLA A;  1FWU A;  3H6Q A;  3NBN A;  3CA5 A;  3NBC A;  3VT0 A;  4IHZ A;  3PG0 A;  3VEQ A;  1ONK B;  2F2F C;  1W3F A;  3LLP A;  4X39 A;  4D8H A;  3V0A B;  3E8L C;  4KBB A;  4LO1 A;  4Q91 A;  2ET2 A;  3BA5 A;  1YF8 B;  4ZA3 B;  4LO3 A;  2XOA A;  1Z2V A;  5BQU C;  4KEK A;  4OWL A;  3VSZ A;  3F62 B;  1F31 A;  4I4V A;  5GAQ A;  4GAF A;  2LIE A;  3CRG A;  1JLX A;  5FZY A;  1XG6 A;  3NBE A;  2HWM A;  3O49 A;  4IZX A;  1PUM B;  5BXR A;  2D24 A;  1RML A;  21BI A;  3B9U A;  4ZLB B;  1ABR B;  4ZFW B;  1WD3 A;  4R6U B;  4A7K A;  1TOO A;  4YOL A;  4G9N A;  4JRA A;  3BA7 A;  3WO4 A; 
#chains in the Genus database with same CATH topology
 4LO1 C;  4J2S A;  2RST A;  2DRE A;  4EFQ A;  4X38 A;  3BAD A;  1HWM B;  4LO3 C;  2Y9F A;  1SZ6 B;  1BAS A;  3AKG A;  3OJV A;  4HA2 A;  4MZG B;  2Y9X E;  3O4O A;  4GP0 A;  1VCL A;  5D62 A;  3IM5 A;  3WO3 A;  3FFZ A;  1T4Q A;  3V0B A;  4HJJ A;  1HKN A;  3CQA A;  1A8D A;  3ZC9 A;  4G9M A;  5FZU A;  3RMX A;  3UD9 A;  2D20 A;  1R8N A;  2KKI A;  1WD4 A;  1JT5 A;  2NM1 A;  1PZZ A;  1DLL A;  1QQK A;  2D44 A;  1D0H A;  3P6J A;  1ISW A;  3UJ4 A;  1DZD A;  5EG6 C;  3QYD A;  1RY7 A;  1Q1U A;  1PC8 B;  2YUG A;  1G9B A;  3N0K A;  3V0B B;  4KEI A;  1G9C A;  1BLD A;  3O3Q A;  3FJB A;  1SR4 A;  1IRP A;  3VUO A;  2L5X A;  4HR6 C;  1ISZ A;  3VT1 A;  2GZB A;  3RSJ A;  4EKX B;  5DUY A;  3QR5 A;  1EV2 A;  3D7W B;  1JY0 A;  3Q7Y A;  4QAL A;  2F8X C;  5F8S A;  1I1E A;  1MC9 A;  4I4R A;  1G9A A;  3HAL A;  4X37 A;  1DFC A;  3BRG C;  3IM7 A;  1FV2 A;  2VSA A;  3AH2 A;  3FJF A;  4QO3 A;  3PUB A;  1IRA X;  1V6V A;  3I2X A;  2MIB A;  3POK A;  3AJ5 A;  4A7Z A;  1RG8 A;  3O44 A;  2QN4 A;  2VSE A;  3MAL A;  3LTQ A;  3CA6 A;  1W3G A;  3PME A;  1SR4 C;  3AKH A;  5BXS A;  5B2H A;  3HMY A;  3O4A A;  4Q9G A;  4I8M A;  4MZH A;  4GOV A;  1YYN A;  1M16 A;  9ILB A;  3S8J A;  3AH4 A;  3ZXD A;  1OQL B;  2BEA A;  1S0E A;  4GAI A;  3BAV A;  4OEE A;  4I4U A;  2P23 A;  4I6I A;  1I1B A;  1BFF A;  2M49 A;  4ZOT A;  4LO0 A;  1S0C A;  1TWE A;  4II0 A;  2IWT B;  1Q03 A;  4I4Y A;  4IY9 A;  3ZC8 A;  4DEP A;  4FVV A;  4EEE B;  4EB2 B;  2E4M A;  3AJ6 A;  4I4P A;  5BOW A;  5DSS B;  2ERM A;  4LO2 C;  1AFC A;  3OBT A;  1FWV A;  1KNM A;  1HCD A;  2NZ9 A;  3WMV A;  4ZKT B;  3BX1 C;  5FZZ A;  4IZE A;  1K5U A;  1DJS B;  1EVT A;  5FNW A;  2Y9G A;  4G6M A;  4JKQ A;  2MC2 A;  2R9K B;  4DEN A;  1AXM A;  1BFG A;  1DQG A;  3PHZ A;  3FJC A;  3CA1 A;  1IT0 A;  3N7K A;  4LO0 C;  2KH2 A;  3CA0 A;  4J23 B;  1HWN B;  1BA7 A;  2K8R A;  4A7Y A;  3ILA A;  6I1B A;  5F90 A;  1S0F A;  4QKS A;  2E4M C;  1JLY A;  1BFC A;  1J0S A;  4J2K A;  1TP0 A;  4I1B A;  1CE7 B;  1DFQ A;  3OJ2 A;  2Q9X A;  1MD6 A;  2FO1 A;  3H6R A;  2DRY A;  1II4 A;  2P39 A;  4H9W A;  2ZQN A;  1HIB A;  1ISX A;  3MPP G;  5BXP A;  1FN0 A;  3CRI A;  3ZXG A;  4QBV A;  1ISV A;  3BB2 A;  1T9F A;  4ZFY B;  1JT3 A;  5JLV A;  1YTO A;  1XZZ A;  3IIR A;  1AVA C;  3N7J A;  4I2S A;  2MLL B;  2VU9 A;  4X3A A;  4WBC A;  4QD2 B;  1HWP B;  2NYY A;  2X2T A;  1DIW A;  3SNV A;  4D0Z A;  3A21 A;  4QD2 C;  4ISR A;  3BAO A;  1BFB A;  4JAW A;  3CA4 A;  1M2T B;  1NUN A;  2J3P A;  4OW4 A;  1W3A A;  1PUU B;  3H6R B;  1S0D A;  2NTD A;  2Y9W C;  4Z8S B;  1IIL A;  1V6W A;  4F83 A;  2AFG A;  3F1R A;  5DZU A;  4IYB A;  4OUJ A;  2D23 A;  4LO8 B;  2WRY A;  1EPW A;  1YBI A;  3UDA A;  3S8K A;  1AVU A;  3CA3 A;  3BRD A;  5HPZ A;  5DVH A;  1NZK A;  1HCE A;  4Q9P A;  2HW9 A;  1FQ9 A;  1JT7 A;  4G6J A;  4D0T A;  2AXM A;  4KC3 A;  4MZF B;  4KEJ A;  1QXM A;  3K1X A;  3UD8 A;  2VXT I;  1QQL A;  1R8O A;  3CAH A;  2ZQO A;  2RG9 B;  4I3N A;  3KMV A;  3WMU A;  1TIE A;  3FUO A;  3FJA A;  4J2X A;  1DQO A;  3BA4 A;  2K43 A;  2UUS A;  3C9Z A;  1HWO B;  4AN7 B;  1XYF A;  5E24 E;  4ZFU B;  4USO A;  1E0O A;  3FJH A;  2HWA A;  4OWK A;  1IJT A;  4L4I A;  2BFH A;  3O4D A;  3V0A A;  1UPS A;  2HZ9 A;  2D7R A;  3N7M A;  4GOY A;  2WBC A;  3NBD A;  4ZGR B;  5EHA A;  1WBA A;  4END A;  3FUQ A;  1AF9 A;  1AVX B;  1K5V A;  5BXT A;  2VLC A;  2KI4 A;  3O5W B;  4I4Q A;  2Z49 A;  2VXR A;  4ZBV B;  3RTI B;  4ISQ A;  2D1Z A;  3P6I A;  5F8Y A;  3FJJ A;  4JKX B;  1ILR 1;  1JQZ A;  4XFS A;  2FFV A;  3Q7X A;  3WA1 A;  3W9T A;  4H75 A;  4G1R A;  2RQ9 A;  3AKI A;  3O4B A;  4OWJ A;  5FNX A;  3N7L A;  3FJE A;  1Q04 A;  5BVP I;  4PC4 A;  4AN6 A;  1S0B A;  3HN1 A;  1WBC A;  4XKI A;  3VWC A;  3BRF A;  4QC4 A;  2I1B A;  3O4C A;  3A22 A;  4P0K A;  31BI A;  3JRR A;  2LIQ A;  2Z48 A;  2FGF A;  1G9D A;  3OJM A;  3NJ5 A;  3R4S A;  2BEB A;  1G82 A;  2DRZ A;  1L2H A;  3VSF A;  3FJK A;  3RMY A;  4Z9W B;  5I1B A;  3OGG A;  4QBC A;  4ION A;  1PWA A;  3BTA A;  3HOM A;  1DZC A;  1ITB A;  3A23 A;  3UD7 A;  2QYI B;  1YXW A;  3IM6 A;  3OBR A;  2ZR1 B;  3CRH A;  3BAQ A;  4OEG A;  1S0L A;  1EYL A;  2NP0 A;  3TC2 A;  4I96 A;  4I37 A;  1V6U A;  1Z4S A;  1XHB A;  2NVH A;  3P53 A;  3Q7W A;  4I4S A;  4EFP A;  4J2Y A;  3WIN A;  2Q3N B;  4I0Y A;  3V79 C;  4P0J A;  2D43 A;  3BAH A;  2AQZ A;  1Z0H A;  2D7I A;  5BP5 A;  2FFU A;  3UJ0 A;  41BI A;  2DS0 A;  3EF2 A;  3VT2 A;  2KI6 B;  3AKF A;  4XFU A;  4GP3 A;  1IOB A;  1JT4 A;  7I1B A;  1TWM A;  3AZV A;  2FDB M;  3FJ9 A;  3I2A A;  4USP A;  1P63 A;  1FGA A;  4CJM A;  2KLL A;  3WO2 A;  3BAG A;  4P0L A;  2X2S A;  5EC5 A;  4P6A A;  4IY8 A;  2IHO A;  4DCK C;  5D61 A;  4JPZ A;  3HSM A;  4FGF A;  4EFR A;  1IHK A;  4XFT A;  4I4X A;  4TLP A;  3WIN C;  5D63 A;  2D22 A;  1JTC A;  1S0G A;  4I4O A;  2GO2 A;  4IQP A;  1ISY A;  1TFM B;  1FV3 A;  3ZX7 A;  5BP5 C;  1N4K A;  3BAU A;  5F8W A;  1FMM S;  8I1B A;  3FGM A;  5JMC A;  3OGF A;  1RZO B;  1BAR A;  2K4A B;  5G00 A;  3CU1 B;  3FJI A;  2F2F A;  2ESU A;  3FJD A;  4F34 A;  3FJ8 A;  4H04 A;  3T8S A;  3I29 B;  1TTU A;  3RTJ B;  4LO7 B;  4QKR A;  2AAI B;  3A07 A;  4I7I A;  1CVS A;  3AZW A;  4JP0 A;  5BQU A;  3IAG C;  1FMZ A;  4LO7 C;  4L4H A;  4OEF A;  3R4U A;  4LO2 A;  3HBW A;  1V6X A;  1GGP B;  4I1E A;  1AVW B;  3AH1 A;  3JUT A;  2VUA A;  3H6S E;  4JQ0 A;  1BLA A;  4UY4 A;  1FWU A;  3H6Q A;  3NBN A;  3CA5 A;  3NBC A;  3VT0 A;  4IHZ A;  3PG0 A;  3VEQ A;  1ONK B;  2F2F C;  1W3F A;  3LLP A;  4X39 A;  4D8H A;  3V0A B;  3E8L C;  4KBB A;  4LO1 A;  4Q91 A;  2ET2 A;  3BA5 A;  1YF8 B;  4ZA3 B;  4LO3 A;  2XOA A;  1Z2V A;  5BQU C;  4KEK A;  4OWL A;  3VSZ A;  3F62 B;  1F31 A;  4I4V A;  5GAQ A;  4GAF A;  2LIE A;  3CRG A;  1JLX A;  5FZY A;  1XG6 A;  3NBE A;  2HWM A;  3O49 A;  4IZX A;  1PUM B;  5BXR A;  2D24 A;  2NS2 A;  1RML A;  21BI A;  3B9U A;  4ZLB B;  1ABR B;  4ZFW B;  1WD3 A;  4R6U B;  4A7K A;  1TOO A;  4YOL A;  4G9N A;  4JRA A;  3BA7 A;  3WO4 A; 
#chains in the Genus database with same CATH homology
 4LO1 C;  4J2S A;  2RST A;  2DRE A;  4EFQ A;  4X38 A;  3BAD A;  1HWM B;  4LO3 C;  2Y9F A;  1SZ6 B;  1BAS A;  3AKG A;  3OJV A;  4HA2 A;  4MZG B;  2Y9X E;  3O4O A;  4GP0 A;  1VCL A;  5D62 A;  3IM5 A;  3WO3 A;  3FFZ A;  1T4Q A;  3V0B A;  4HJJ A;  1HKN A;  3CQA A;  1A8D A;  3ZC9 A;  4G9M A;  5FZU A;  3RMX A;  3UD9 A;  2D20 A;  1R8N A;  2KKI A;  1WD4 A;  1JT5 A;  2NM1 A;  1PZZ A;  1DLL A;  1QQK A;  2D44 A;  1D0H A;  3P6J A;  1ISW A;  3UJ4 A;  1DZD A;  5EG6 C;  3QYD A;  1RY7 A;  1Q1U A;  1PC8 B;  2YUG A;  1G9B A;  3N0K A;  3V0B B;  4KEI A;  1G9C A;  1BLD A;  3O3Q A;  3FJB A;  1SR4 A;  1IRP A;  3VUO A;  2L5X A;  4HR6 C;  1ISZ A;  3VT1 A;  2GZB A;  3RSJ A;  4EKX B;  5DUY A;  3QR5 A;  1EV2 A;  3D7W B;  1JY0 A;  3Q7Y A;  4QAL A;  2F8X C;  5F8S A;  1I1E A;  1MC9 A;  4I4R A;  1G9A A;  3HAL A;  4X37 A;  1DFC A;  3BRG C;  3IM7 A;  1FV2 A;  2VSA A;  3AH2 A;  3FJF A;  4QO3 A;  3PUB A;  1IRA X;  1V6V A;  3I2X A;  2MIB A;  3POK A;  3AJ5 A;  4A7Z A;  1RG8 A;  3O44 A;  2QN4 A;  2VSE A;  3MAL A;  3LTQ A;  3CA6 A;  1W3G A;  3PME A;  1SR4 C;  3AKH A;  5BXS A;  5B2H A;  3HMY A;  3O4A A;  4Q9G A;  4I8M A;  4MZH A;  4GOV A;  1YYN A;  1M16 A;  9ILB A;  3S8J A;  3AH4 A;  3ZXD A;  1OQL B;  2BEA A;  1S0E A;  4GAI A;  3BAV A;  4OEE A;  4I4U A;  2P23 A;  4I6I A;  1I1B A;  1BFF A;  2M49 A;  4ZOT A;  4LO0 A;  1S0C A;  1TWE A;  4II0 A;  2IWT B;  1Q03 A;  4I4Y A;  4IY9 A;  3ZC8 A;  4DEP A;  4FVV A;  4EEE B;  4EB2 B;  2E4M A;  3AJ6 A;  4I4P A;  5BOW A;  5DSS B;  2ERM A;  4LO2 C;  1AFC A;  3OBT A;  1FWV A;  1KNM A;  1HCD A;  2NZ9 A;  3WMV A;  4ZKT B;  3BX1 C;  5FZZ A;  4IZE A;  1K5U A;  1DJS B;  1EVT A;  5FNW A;  2Y9G A;  4G6M A;  4JKQ A;  2MC2 A;  2R9K B;  4DEN A;  1AXM A;  1BFG A;  1DQG A;  3PHZ A;  3FJC A;  3CA1 A;  1IT0 A;  3N7K A;  4LO0 C;  2KH2 A;  3CA0 A;  4J23 B;  1HWN B;  1BA7 A;  2K8R A;  4A7Y A;  3ILA A;  6I1B A;  5F90 A;  1S0F A;  4QKS A;  2E4M C;  1JLY A;  1BFC A;  1J0S A;  4J2K A;  1TP0 A;  4I1B A;  1CE7 B;  1DFQ A;  3OJ2 A;  2Q9X A;  1MD6 A;  2FO1 A;  3H6R A;  2DRY A;  1II4 A;  2P39 A;  4H9W A;  2ZQN A;  1HIB A;  1ISX A;  3MPP G;  5BXP A;  1FN0 A;  3CRI A;  3ZXG A;  4QBV A;  1ISV A;  3BB2 A;  1T9F A;  4ZFY B;  1JT3 A;  5JLV A;  1YTO A;  1XZZ A;  3IIR A;  1AVA C;  3N7J A;  4I2S A;  2MLL B;  2VU9 A;  4X3A A;  4WBC A;  4QD2 B;  1HWP B;  2NYY A;  2X2T A;  1DIW A;  3SNV A;  4D0Z A;  3A21 A;  4QD2 C;  4ISR A;  3BAO A;  1BFB A;  4JAW A;  3CA4 A;  1M2T B;  1NUN A;  2J3P A;  4OW4 A;  1W3A A;  1PUU B;  3H6R B;  1S0D A;  2NTD A;  2Y9W C;  4Z8S B;  1IIL A;  1V6W A;  4F83 A;  2AFG A;  3F1R A;  5DZU A;  4IYB A;  4OUJ A;  2D23 A;  4LO8 B;  2WRY A;  1EPW A;  1YBI A;  3UDA A;  3S8K A;  1AVU A;  3CA3 A;  3BRD A;  5HPZ A;  5DVH A;  1NZK A;  1HCE A;  4Q9P A;  2HW9 A;  1FQ9 A;  1JT7 A;  4G6J A;  4D0T A;  2AXM A;  4KC3 A;  4MZF B;  4KEJ A;  1QXM A;  3K1X A;  3UD8 A;  2VXT I;  1QQL A;  1R8O A;  3CAH A;  2ZQO A;  2RG9 B;  4I3N A;  3KMV A;  3WMU A;  1TIE A;  3FUO A;  3FJA A;  4J2X A;  1DQO A;  3BA4 A;  2K43 A;  2UUS A;  3C9Z A;  1HWO B;  4AN7 B;  1XYF A;  5E24 E;  4ZFU B;  4USO A;  1E0O A;  3FJH A;  2HWA A;  4OWK A;  1IJT A;  4L4I A;  2BFH A;  3O4D A;  3V0A A;  1UPS A;  2HZ9 A;  2D7R A;  3N7M A;  4GOY A;  2WBC A;  3NBD A;  4ZGR B;  5EHA A;  1WBA A;  4END A;  3FUQ A;  1AF9 A;  1AVX B;  1K5V A;  5BXT A;  2VLC A;  2KI4 A;  3O5W B;  4I4Q A;  2Z49 A;  2VXR A;  4ZBV B;  3RTI B;  4ISQ A;  2D1Z A;  3P6I A;  5F8Y A;  3FJJ A;  4JKX B;  1ILR 1;  1JQZ A;  4XFS A;  2FFV A;  3Q7X A;  3WA1 A;  3W9T A;  4H75 A;  4G1R A;  2RQ9 A;  3AKI A;  3O4B A;  4OWJ A;  5FNX A;  3N7L A;  3FJE A;  1Q04 A;  5BVP I;  4PC4 A;  4AN6 A;  1S0B A;  3HN1 A;  1WBC A;  4XKI A;  3VWC A;  3BRF A;  4QC4 A;  2I1B A;  3O4C A;  3A22 A;  4P0K A;  31BI A;  3JRR A;  2LIQ A;  2Z48 A;  2FGF A;  1G9D A;  3OJM A;  3NJ5 A;  3R4S A;  2BEB A;  1G82 A;  2DRZ A;  1L2H A;  3VSF A;  3FJK A;  3RMY A;  4Z9W B;  5I1B A;  3OGG A;  4QBC A;  4ION A;  1PWA A;  3BTA A;  3HOM A;  1DZC A;  1ITB A;  3A23 A;  3UD7 A;  2QYI B;  1YXW A;  3IM6 A;  3OBR A;  2ZR1 B;  3CRH A;  3BAQ A;  4OEG A;  1S0L A;  1EYL A;  2NP0 A;  3TC2 A;  4I96 A;  4I37 A;  1V6U A;  1Z4S A;  1XHB A;  2NVH A;  3P53 A;  3Q7W A;  4I4S A;  4EFP A;  4J2Y A;  3WIN A;  2Q3N B;  4I0Y A;  3V79 C;  4P0J A;  2D43 A;  3BAH A;  2AQZ A;  1Z0H A;  2D7I A;  5BP5 A;  2FFU A;  3UJ0 A;  41BI A;  2DS0 A;  3EF2 A;  3VT2 A;  2KI6 B;  3AKF A;  4XFU A;  4GP3 A;  1IOB A;  1JT4 A;  7I1B A;  1TWM A;  3AZV A;  2FDB M;  3FJ9 A;  3I2A A;  4USP A;  1P63 A;  1FGA A;  4CJM A;  2KLL A;  3WO2 A;  3BAG A;  4P0L A;  2X2S A;  5EC5 A;  4P6A A;  4IY8 A;  2IHO A;  4DCK C;  5D61 A;  4JPZ A;  3HSM A;  4FGF A;  4EFR A;  1IHK A;  4XFT A;  4I4X A;  4TLP A;  3WIN C;  5D63 A;  2D22 A;  1JTC A;  1S0G A;  4I4O A;  2GO2 A;  4IQP A;  1ISY A;  1TFM B;  1FV3 A;  3ZX7 A;  5BP5 C;  1N4K A;  3BAU A;  5F8W A;  1FMM S;  8I1B A;  3FGM A;  5JMC A;  3OGF A;  1RZO B;  1BAR A;  2K4A B;  5G00 A;  3CU1 B;  3FJI A;  2F2F A;  2ESU A;  3FJD A;  4F34 A;  3FJ8 A;  4H04 A;  3T8S A;  3I29 B;  1TTU A;  3RTJ B;  4LO7 B;  4QKR A;  2AAI B;  3A07 A;  4I7I A;  1CVS A;  3AZW A;  4JP0 A;  5BQU A;  3IAG C;  1FMZ A;  4LO7 C;  4L4H A;  4OEF A;  3R4U A;  4LO2 A;  3HBW A;  1V6X A;  1GGP B;  4I1E A;  1AVW B;  3AH1 A;  3JUT A;  2VUA A;  3H6S E;  4JQ0 A;  1BLA A;  4UY4 A;  1FWU A;  3H6Q A;  3NBN A;  3CA5 A;  3NBC A;  3VT0 A;  4IHZ A;  3PG0 A;  3VEQ A;  1ONK B;  2F2F C;  1W3F A;  3LLP A;  4X39 A;  4D8H A;  3V0A B;  3E8L C;  4KBB A;  4LO1 A;  4Q91 A;  2ET2 A;  3BA5 A;  1YF8 B;  4ZA3 B;  4LO3 A;  2XOA A;  1Z2V A;  5BQU C;  4KEK A;  4OWL A;  3VSZ A;  3F62 B;  1F31 A;  4I4V A;  5GAQ A;  4GAF A;  2LIE A;  3CRG A;  1JLX A;  5FZY A;  1XG6 A;  3NBE A;  2HWM A;  3O49 A;  4IZX A;  1PUM B;  5BXR A;  2D24 A;  2NS2 A;  1RML A;  21BI A;  3B9U A;  4ZLB B;  1ABR B;  4ZFW B;  1WD3 A;  4R6U B;  4A7K A;  1TOO A;  4YOL A;  4G9N A;  4JRA A;  3BA7 A;  3WO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...