4X39A

Gallus interleukin-1 beta mutant - t117a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
159
structure length
154
Chain Sequence
b'AFRYTRSQSFDIFDINQKCFVLESPTQLVALHLQGPSSSQKVRLNIALYRPRAGTGQMPVALGIKGYKLYMSCVMSGTEPTLQLEEADVMRDIDSVELTRFIFYRLDSPAEGTTRFESAAFPGWFICTSLQPRQPVGITNQPDQVNIATYKLSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IL-1 beta
publication title Gallus interleukin-1 beta mutant - T117A
rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 29
structure length 154
sequence length 159
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4x39A00
3UDAA 4QC4A 3N7KA 3O4CA 3VEQA 5D61A 4LO1C 3FJDA 1G9BA 3BRDA 1IOBA 1JTCA 3AKHA 4LO1A 3CQAA 4ISRA 5EC5A 5F90A 3WA1A 1DFQA 2RG9B 4LO7B 4OWJA 5BQUC 1JT5A 1F31A 3RSJA 1G9DA 3O4AA 2Y9GA 4A7ZA 4HA2A 3HSMA 5BQUA 41BIA 1WBCA 2KI4A 3O4DA 3UJ0A 3V0BA 1JT7A 3ILAA 4FVVA 2M49A 1JLXA 2WRYA 4Q9GA 4I6IA 4H9WA 5BOWA 1NUNA 2D43A 1DFCA 1SR4A 4HJJA 4WBCA 3FJ8A 1Q1UA 3O4OA 3MALA 2FDBM 1XYFA 3BAOA 2L5XA 4I4PA 4QKSA 1QQLA 3QR5A 4EFRA 4I37A 5BXRA 2NM1A 1XZZA 3WO4A 4X38A 4KC3A 1HWPB 1RMLA 2E4MA 3AZWA 5FZUA 4OW4A 1S0DA 2NVHA 1YXWA 3P53A 1HCDA 4JAWA 1YYNA 3PMEA 3CA3A 3VSFA 1SZ6B 1XHBA 5FNXA 3IM5A 4IZXA 1RY7A 3N7MA 3F1RA 4DENA 3HALA 3N0KA 4I4RA 3FUOA 3KMVA 3E8LC 3TC2A 4PC4A 3I2AA 3AJ6A 1OQLB 4KEJA 4I7IA 1D0HA 4JPZA 4I4QA 3K1XA 1P63A 4G1RA 2KLLA 1VCLA 3Q7WA 1IHKA 4GOYA 1DIWA 1TWMA 4G9NA 4EB2B 1RG8A 2Y9XE 1IRAX 3Q7YA 4IYBA 1JY0A 4J2XA 3NBCA 2F8XC 1V6XA 1UPSA 7I1BA 4X39A 2KKIA 1EYLA 3V0AA 5DSSB 4I4YA 3UJ4A 3AH4A 1RZOB 3BAUA 3LLPA 4F34A 4AN7B 2FFUA 3UD8A 1Q04A 4P0JA 5EHAA 3T8SA 2D7IA 3AKIA 1ONKB 6I1BA 1R8OA 5BXTA 5I1BA 1FV2A 1G9CA 4LO3C 1I1EA 4IHZA 3UD9A 3RTJB 2HWAA 2P39A 1S0BA 4A7YA 4LO3A 3VUOA 3Q7XA 5E24E 3VSZA 3MPPG 4OWLA 1L2HA 1FN0A 4OEFA 1HKNA 3JUTA 1BFBA 1M16A 2NP0A 1DZDA 1PUMB 4TLPA 4EKXB 4USOA 1MC9A 1T4QA 3O4BA 4LO2A 3O5WB 3LTQA 2R9KB 3H6SE 1TOOA 3RMYA 1PWAA 1FQ9A 4F83A 4J2KA 2ET2A 1YF8B 5F8YA 2FGFA 4IQPA 2FO1A 1G82A 3CA1A 1BASA 3CA5A 3AKGA 3OBTA 2MIBA 1W3GA 1I1BA 4GAIA 1T9FA 5DZUA 5DVHA 1S0LA 2D20A 2K43A 3FJAA 4I4OA 4I4XA 3W9TA 2GO2A 3AJ5A 3IIRA 1XG6A 4Z8SB 3OJ2A 1IRPA 1EV2A 4IY8A 3F62B 4AN6A 4ZFUB 3FJJA 3HBWA 1TFMB 4L4IA 3V0AB 1SR4C 1BA7A 4OWKA 2FFVA 2LIQA 3A21A 3CA6A 1DQGA 3BA7A 1FMZA 4FGFA 4DEPA 2RSTA 5F8SA 4J2SA 3ZX7A 1ISZA 21BIA 4XFTA 1M2TB 2AAIB 4ZKTB 2Y9WC 1ITBA 1TTUA 2E4MC 3ZXDA 1ISVA 4LO0A 3V79C 3HN1A 3PG0A 4ZFYB 1IILA 4ZGRB 1K5VA 2I1BA 4QKRA 5EG6C 3VT2A 4JQ0A 2VU9A 9ILBA 1ILR1 2K8RA 4JRAA 31BIA 4QD2C 1HWNB 3H6RA 4OUJA 3P6JA 1ISWA 4I4UA 3OGFA 3BAGA 2UUSA 4P6AA 2GZBA 1HIBA 3VT1A 2J3PA 4Q91A 3CRHA 3O49A 2Q9XA 4I2SA 3BADA 3WMVA 4IONA 1TP0A 3FJCA 2D24A 1S0CA 3EF2A 3S8KA 1FV3A 1AFCA 4I8MA 4LO8B 1V6VA 2ZQOA 3V0BB 2RQ9A 1FMMS 3AH1A 3R4SA 4X37A 1S0GA 1WD4A 5DUYA 5JLVA 1YBIA 1S0FA 2Z49A 4ZA3B 1V6WA 2D7RA 1BLDA 3S8JA 4QO3A 4QALA 1IT0A 2VXTI 1WD3A 2VSEA 1V6UA 1AVXB 1J0SA 3FJBA 3OGGA 1CE7B 2KI6B 1ABRB 3H6QA 3N7LA 1ISYA 4I96A 1JQZA 4JKXB 4L4HA 1Q03A 4LO2C 3NBNA 2IHOA 5FNWA 4G9MA 5BP5C 3BTAA 4ZOTA 1BARA 5BP5A 3FJHA 2VUAA 4OEEA 2KH2A 4EFQA 4Q9PA 3IM6A 4QD2B 2ERMA 4ENDA 3CA4A 5BVPI 1IJTA 3CAHA 1WBAA 3P6IA 4I1BA 4HR6C 1JT3A 2VXRA 1Z0HA 2NTDA 2K4AB 1W3FA 1A8DA 2BEAA 3VWCA 3QYDA 3NBDA 3CRGA 2Y9FA 4I4SA 2BFHA 1MD6A 4D0TA 1TWEA 4JP0A 1S0EA 2MLLB 1HCEA 3CRIA 1W3AA 4P0KA 4EFPA 3WO3A 2X2SA 1Z4SA 4QBCA 4P0LA 4A7KA 1AVWB 1JT4A 3UD7A 2DRZA 3NJ5A 4ZBVB 2ZR1B 2X2TA 5D63A 1E0OA 2AXMA 3PUBA 2Z48A 3RMXA 1BFGA 1FWVA 3IM7A 1KNMA 4I3NA 4JKQA 2QN4A 5BXSA 1DZCA 4J23B 4LO0C 2DS0A 1BFFA 4I1EA 5FZYA 3VT0A 4II0A 2NYYA 2DREA 4DCKC 1PC8B 1ISXA 1PZZA 2QYIB 2VSAA 2Q3NB 4CJMA 3ZXGA 1CVSA 2D44A 2NZ9A 3FJ9A 4ZLBB 1AF9A 3HOMA 4XKIA 1HWOB 3BA4A 2HW9A 2D1ZA 3CA0A 4ISQA 1K5UA 1N4KA 3BAQA 4I0YA 1AVUA 1AVAC 1G9AA 1GGPB 3FUQA 1PUUB 3A23A 2YUGA 5F8WA 1TIEA 1NZKA 3AZVA 3RTIB 3D7WB 1DQOA 8I1BA 2BEBA 4D8HA 1AXMA 1JLYA 3POKA 5FZZA 1FWUA 4GP0A 4H04A 5BXPA 3AH2A 3FJFA 3NBEA 3WMUA 4I4VA 2HWMA 4EEEB 4X3AA 1DJSB 2ESUA 5B2HA 3O3QA 2AFGA 1QQKA 3WINC 1EVTA 4IZEA 4KBBA 3BA5A 3IAGC 3BAVA 3B9UA 4LO7C 3WINA 2DRYA 4USPA 3BRGC 5JMCA 3ZC9A 1Z2VA 5D62A 3FFZA 1EPWA 1BFCA 3CU1B 4KEKA 5GAQA 2F2FC 1QXMA 5G00A 3BRFA 4XFSA 4GAFA 4IY9A 2F2FA 4R6UB 2AQZA 3JRRA 3FJIA 3BB2A 4G6JA 3WO2A 2XOAA 1YTOA 2IWTB 4GP3A 3AKFA 2VLCA 4QBVA 3PHZA 1R8NA 1DLLA 2WBCA 4KEIA 4YOLA 3ZC8A 3H6RB 3R4UA 4OEGA 4Z9WB 3OJVA 3SNVA 3O44A 1BLAA 3FJEA 3A22A 3I29B 3FJKA 3OBRA 2LIEA 3N7JA 3FGMA 1II4A 1HWMB 2D22A 2P23A 3OJMA 2D23A 3C9ZA 4ZFWB 2ZQNA 2HZ9A 5HPZA 4D0ZA 3BX1C 4G6MA 3BAHA 4J2YA 3A07A 4GOVA 4XFUA 1FGAA 2MC2A 3HMYA 3I2XA
chains in the Genus database with same CATH superfamily
3UDAA 4QC4A 3N7KA 3O4CA 3VEQA 5D61A 4LO1C 3FJDA 1G9BA 3BRDA 1IOBA 1JTCA 3AKHA 4LO1A 3CQAA 4ISRA 5EC5A 5F90A 3WA1A 1DFQA 2RG9B 4LO7B 4OWJA 5BQUC 1JT5A 1F31A 3RSJA 1G9DA 3O4AA 2Y9GA 4A7ZA 4HA2A 3HSMA 5BQUA 41BIA 1WBCA 2KI4A 3O4DA 3UJ0A 3V0BA 1JT7A 3ILAA 4FVVA 2M49A 1JLXA 2WRYA 4Q9GA 4I6IA 4H9WA 5BOWA 1NUNA 2D43A 1DFCA 1SR4A 4HJJA 4WBCA 3FJ8A 1Q1UA 3O4OA 3MALA 2FDBM 1XYFA 3BAOA 2L5XA 4I4PA 4QKSA 1QQLA 3QR5A 4EFRA 4I37A 5BXRA 2NM1A 1XZZA 3WO4A 4X38A 4KC3A 1HWPB 1RMLA 2E4MA 3AZWA 5FZUA 4OW4A 1S0DA 2NVHA 1YXWA 3P53A 1HCDA 4JAWA 1YYNA 3PMEA 3CA3A 3VSFA 1SZ6B 1XHBA 5FNXA 3IM5A 4IZXA 1RY7A 3N7MA 3F1RA 4DENA 3HALA 3N0KA 4I4RA 3FUOA 3KMVA 3E8LC 3TC2A 4PC4A 3I2AA 3AJ6A 1OQLB 4KEJA 4I7IA 1D0HA 4JPZA 4I4QA 3K1XA 1P63A 4G1RA 2KLLA 1VCLA 3Q7WA 1IHKA 4GOYA 1DIWA 1TWMA 4G9NA 4EB2B 1RG8A 2Y9XE 1IRAX 3Q7YA 4IYBA 1JY0A 4J2XA 3NBCA 2F8XC 1V6XA 1UPSA 7I1BA 4X39A 2KKIA 1EYLA 3V0AA 5DSSB 4I4YA 3UJ4A 3AH4A 1RZOB 3BAUA 3LLPA 4F34A 4AN7B 2FFUA 3UD8A 1Q04A 4P0JA 5EHAA 3T8SA 2D7IA 3AKIA 1ONKB 6I1BA 1R8OA 5BXTA 5I1BA 1FV2A 1G9CA 4LO3C 1I1EA 4IHZA 3UD9A 3RTJB 2HWAA 2P39A 1S0BA 4A7YA 4LO3A 3VUOA 3Q7XA 5E24E 3VSZA 3MPPG 4OWLA 1L2HA 1FN0A 4OEFA 1HKNA 3JUTA 1BFBA 1M16A 2NP0A 1DZDA 1PUMB 4TLPA 4EKXB 4USOA 1MC9A 1T4QA 3O4BA 4LO2A 3O5WB 3LTQA 2R9KB 3H6SE 1TOOA 3RMYA 1PWAA 1FQ9A 4F83A 4J2KA 2ET2A 1YF8B 5F8YA 2FGFA 4IQPA 2FO1A 1G82A 3CA1A 1BASA 3CA5A 3AKGA 3OBTA 2MIBA 1W3GA 1I1BA 4GAIA 1T9FA 5DZUA 5DVHA 1S0LA 2D20A 2K43A 3FJAA 4I4OA 4I4XA 3W9TA 2GO2A 3AJ5A 3IIRA 1XG6A 4Z8SB 3OJ2A 1IRPA 1EV2A 4IY8A 3F62B 4AN6A 4ZFUB 3FJJA 3HBWA 1TFMB 4L4IA 3V0AB 1SR4C 1BA7A 4OWKA 2FFVA 2LIQA 3A21A 3CA6A 1DQGA 3BA7A 1FMZA 4FGFA 4DEPA 2RSTA 5F8SA 4J2SA 3ZX7A 1ISZA 21BIA 4XFTA 1M2TB 2AAIB 4ZKTB 2Y9WC 1ITBA 1TTUA 2E4MC 3ZXDA 1ISVA 4LO0A 3V79C 3HN1A 3PG0A 4ZFYB 1IILA 4ZGRB 1K5VA 2I1BA 4QKRA 5EG6C 3VT2A 4JQ0A 2VU9A 9ILBA 1ILR1 2K8RA 4JRAA 31BIA 4QD2C 1HWNB 3H6RA 4OUJA 3P6JA 1ISWA 4I4UA 3OGFA 3BAGA 2UUSA 4P6AA 2GZBA 1HIBA 3VT1A 2J3PA 4Q91A 3CRHA 3O49A 2Q9XA 4I2SA 3BADA 3WMVA 4IONA 1TP0A 3FJCA 2D24A 1S0CA 3EF2A 3S8KA 1FV3A 1AFCA 4I8MA 4LO8B 1V6VA 2ZQOA 3V0BB 2RQ9A 1FMMS 3AH1A 3R4SA 4X37A 1S0GA 1WD4A 5DUYA 5JLVA 4MZHA 1YBIA 1S0FA 2NS2A 2Z49A 4ZA3B 1V6WA 2D7RA 1BLDA 3S8JA 4QO3A 4QALA 1IT0A 2VXTI 1WD3A 2VSEA 1V6UA 1AVXB 1J0SA 3FJBA 3OGGA 1CE7B 2KI6B 1ABRB 3H6QA 3N7LA 1ISYA 4I96A 1JQZA 4JKXB 4L4HA 1Q03A 4LO2C 3NBNA 2IHOA 5FNWA 4G9MA 5BP5C 3BTAA 4ZOTA 1BARA 5BP5A 3FJHA 2VUAA 4OEEA 2KH2A 4EFQA 4Q9PA 3IM6A 4QD2B 2ERMA 4ENDA 3CA4A 5BVPI 1IJTA 3CAHA 1WBAA 3P6IA 4I1BA 4HR6C 1JT3A 2VXRA 4MZFB 1Z0HA 2NTDA 2K4AB 1W3FA 1A8DA 2BEAA 3VWCA 3QYDA 3NBDA 3CRGA 2Y9FA 4I4SA 2BFHA 1MD6A 4D0TA 1TWEA 4JP0A 1S0EA 2MLLB 1HCEA 4MZGB 3CRIA 1W3AA 4P0KA 4EFPA 3WO3A 2X2SA 1Z4SA 4QBCA 4P0LA 4A7KA 1AVWB 1JT4A 3UD7A 2DRZA 3NJ5A 4ZBVB 2ZR1B 2X2TA 5D63A 1E0OA 4UY4A 2AXMA 3PUBA 2Z48A 3RMXA 1BFGA 1FWVA 3IM7A 1KNMA 4I3NA 4JKQA 2QN4A 5BXSA 1DZCA 4J23B 4LO0C 2DS0A 1BFFA 4I1EA 5FZYA 3VT0A 4II0A 2NYYA 2DREA 4DCKC 1PC8B 1ISXA 1PZZA 2QYIB 2VSAA 2Q3NB 4CJMA 3ZXGA 1CVSA 2D44A 2NZ9A 3FJ9A 4ZLBB 1AF9A 3HOMA 4XKIA 1HWOB 3BA4A 2HW9A 2D1ZA 3CA0A 4ISQA 1K5UA 1N4KA 3BAQA 4I0YA 1AVUA 1AVAC 1G9AA 1GGPB 3FUQA 1PUUB 3A23A 2YUGA 5F8WA 1TIEA 1NZKA 3AZVA 3RTIB 3D7WB 1DQOA 8I1BA 2BEBA 4H75A 4D8HA 1AXMA 1JLYA 3POKA 5FZZA 1FWUA 4GP0A 4H04A 5BXPA 3AH2A 3FJFA 3NBEA 3WMUA 4I4VA 2HWMA 4EEEB 4X3AA 1DJSB 2ESUA 5B2HA 3O3QA 2AFGA 1QQKA 3WINC 1EVTA 4IZEA 4KBBA 3BA5A 3IAGC 3BAVA 3B9UA 4LO7C 3WINA 2DRYA 4USPA 3BRGC 5JMCA 3ZC9A 1Z2VA 5D62A 3FFZA 1EPWA 1BFCA 3CU1B 4KEKA 5GAQA 2F2FC 1QXMA 5G00A 3BRFA 4XFSA 4GAFA 4IY9A 2F2FA 4R6UB 2AQZA 3JRRA 3FJIA 3BB2A 4G6JA 3WO2A 2XOAA 1YTOA 2IWTB 4GP3A 3AKFA 2VLCA 4QBVA 3PHZA 1R8NA 1DLLA 2WBCA 4KEIA 4YOLA 3ZC8A 3H6RB 3R4UA 4OEGA 4Z9WB 3OJVA 3SNVA 3O44A 1BLAA 3FJEA 3A22A 3I29B 3FJKA 3OBRA 2LIEA 3N7JA 3FGMA 1II4A 1HWMB 2D22A 2P23A 3OJMA 2D23A 3C9ZA 4ZFWB 2ZQNA 2HZ9A 5HPZA 4D0ZA 3BX1C 4G6MA 3BAHA 4J2YA 3A07A 4GOVA 4XFUA 1FGAA 2MC2A 3HMYA 3I2XA
chains in the Genus database with same CATH topology
3UDAA 4QC4A 3N7KA 3O4CA 3VEQA 5D61A 4LO1C 3FJDA 1G9BA 3BRDA 1IOBA 1JTCA 3AKHA 4LO1A 3CQAA 4ISRA 5EC5A 5F90A 3WA1A 1DFQA 2RG9B 4LO7B 4OWJA 5BQUC 1JT5A 1F31A 3RSJA 1G9DA 3O4AA 2Y9GA 4A7ZA 4HA2A 3HSMA 5BQUA 41BIA 1WBCA 2KI4A 3O4DA 3UJ0A 3V0BA 1JT7A 3ILAA 4FVVA 2M49A 1JLXA 2WRYA 4Q9GA 4I6IA 4H9WA 5BOWA 1NUNA 2D43A 1DFCA 1SR4A 4HJJA 4WBCA 3FJ8A 1Q1UA 3O4OA 3MALA 2FDBM 1XYFA 3BAOA 2L5XA 4I4PA 4QKSA 1QQLA 3QR5A 4EFRA 4I37A 5BXRA 2NM1A 1XZZA 3WO4A 4X38A 4KC3A 1HWPB 1RMLA 2E4MA 3AZWA 5FZUA 4OW4A 1S0DA 2NVHA 1YXWA 3P53A 1HCDA 4JAWA 1YYNA 3PMEA 3CA3A 3VSFA 1SZ6B 1XHBA 5FNXA 3IM5A 4IZXA 1RY7A 3N7MA 3F1RA 4DENA 3HALA 3N0KA 4I4RA 3FUOA 3KMVA 3E8LC 3TC2A 4PC4A 3I2AA 3AJ6A 1OQLB 4KEJA 4I7IA 1D0HA 4JPZA 4I4QA 3K1XA 1P63A 4G1RA 2KLLA 1VCLA 3Q7WA 1IHKA 4GOYA 1DIWA 1TWMA 4G9NA 4EB2B 1RG8A 2Y9XE 1IRAX 3Q7YA 4IYBA 1JY0A 4J2XA 3NBCA 2F8XC 1V6XA 1UPSA 7I1BA 4X39A 2KKIA 1EYLA 3V0AA 5DSSB 4I4YA 3UJ4A 3AH4A 1RZOB 3BAUA 3LLPA 4F34A 4AN7B 2FFUA 3UD8A 1Q04A 4P0JA 5EHAA 3T8SA 2D7IA 3AKIA 1ONKB 6I1BA 1R8OA 5BXTA 5I1BA 1FV2A 1G9CA 4LO3C 1I1EA 4IHZA 3UD9A 3RTJB 2HWAA 2P39A 1S0BA 4A7YA 4LO3A 3VUOA 3Q7XA 5E24E 3VSZA 3MPPG 4OWLA 1L2HA 1FN0A 4OEFA 1HKNA 3JUTA 1BFBA 1M16A 2NP0A 1DZDA 1PUMB 4TLPA 4EKXB 4USOA 1MC9A 1T4QA 3O4BA 4LO2A 3O5WB 3LTQA 2R9KB 3H6SE 1TOOA 3RMYA 1PWAA 1FQ9A 4F83A 4J2KA 2ET2A 1YF8B 5F8YA 2FGFA 4IQPA 2FO1A 1G82A 3CA1A 1BASA 3CA5A 3AKGA 3OBTA 2MIBA 1W3GA 1I1BA 4GAIA 1T9FA 5DZUA 5DVHA 1S0LA 2D20A 2K43A 3FJAA 4I4OA 4I4XA 3W9TA 2GO2A 3AJ5A 3IIRA 1XG6A 4Z8SB 3OJ2A 1IRPA 1EV2A 4IY8A 3F62B 4AN6A 4ZFUB 3FJJA 3HBWA 1TFMB 4L4IA 3V0AB 1SR4C 1BA7A 4OWKA 2FFVA 2LIQA 3A21A 3CA6A 1DQGA 3BA7A 1FMZA 4FGFA 4DEPA 2RSTA 5F8SA 4J2SA 3ZX7A 1ISZA 21BIA 4XFTA 1M2TB 2AAIB 4ZKTB 2Y9WC 1ITBA 1TTUA 2E4MC 3ZXDA 1ISVA 4LO0A 3V79C 3HN1A 3PG0A 4ZFYB 1IILA 4ZGRB 1K5VA 2I1BA 4QKRA 5EG6C 3VT2A 4JQ0A 2VU9A 9ILBA 1ILR1 2K8RA 4JRAA 31BIA 4QD2C 1HWNB 3H6RA 4OUJA 3P6JA 1ISWA 4I4UA 3OGFA 3BAGA 2UUSA 4P6AA 2GZBA 1HIBA 3VT1A 2J3PA 4Q91A 3CRHA 3O49A 2Q9XA 4I2SA 3BADA 3WMVA 4IONA 1TP0A 3FJCA 2D24A 1S0CA 3EF2A 3S8KA 1FV3A 1AFCA 4I8MA 4LO8B 1V6VA 2ZQOA 3V0BB 2RQ9A 1FMMS 3AH1A 3R4SA 4X37A 1S0GA 1WD4A 5DUYA 5JLVA 4MZHA 1YBIA 1S0FA 2NS2A 2Z49A 4ZA3B 1V6WA 2D7RA 1BLDA 3S8JA 4QO3A 4QALA 1IT0A 2VXTI 1WD3A 2VSEA 1V6UA 1AVXB 1J0SA 3FJBA 3OGGA 1CE7B 2KI6B 1ABRB 3H6QA 3N7LA 1ISYA 4I96A 1JQZA 4JKXB 4L4HA 1Q03A 4LO2C 3NBNA 2IHOA 5FNWA 4G9MA 5BP5C 3BTAA 4ZOTA 1BARA 5BP5A 3FJHA 2VUAA 4OEEA 2KH2A 4EFQA 4Q9PA 3IM6A 4QD2B 2ERMA 4ENDA 3CA4A 5BVPI 1IJTA 3CAHA 1WBAA 3P6IA 4I1BA 4HR6C 1JT3A 2VXRA 4MZFB 1Z0HA 2NTDA 2K4AB 1W3FA 1A8DA 2BEAA 3VWCA 3QYDA 3NBDA 3CRGA 2Y9FA 4I4SA 2BFHA 1MD6A 4D0TA 1TWEA 4JP0A 1S0EA 2MLLB 1HCEA 4MZGB 3CRIA 1W3AA 4P0KA 4EFPA 3WO3A 2X2SA 1Z4SA 4QBCA 4P0LA 4A7KA 1AVWB 1JT4A 3UD7A 2DRZA 3NJ5A 4ZBVB 2ZR1B 2X2TA 5D63A 1E0OA 4UY4A 2AXMA 3PUBA 2Z48A 3RMXA 1BFGA 1FWVA 3IM7A 1KNMA 4I3NA 4JKQA 2QN4A 5BXSA 1DZCA 4J23B 4LO0C 2DS0A 1BFFA 4I1EA 5FZYA 3VT0A 4II0A 2NYYA 2DREA 4DCKC 1PC8B 1ISXA 1PZZA 2QYIB 2VSAA 2Q3NB 4CJMA 3ZXGA 1CVSA 2D44A 2NZ9A 3FJ9A 4ZLBB 1AF9A 3HOMA 4XKIA 1HWOB 3BA4A 2HW9A 2D1ZA 3CA0A 4ISQA 1K5UA 1N4KA 3BAQA 4I0YA 1AVUA 1AVAC 1G9AA 1GGPB 3FUQA 1PUUB 3A23A 2YUGA 5F8WA 1TIEA 1NZKA 3AZVA 3RTIB 3D7WB 1DQOA 8I1BA 2BEBA 4H75A 4D8HA 1AXMA 1JLYA 3POKA 5FZZA 1FWUA 4GP0A 4H04A 5BXPA 3AH2A 3FJFA 3NBEA 3WMUA 4I4VA 2HWMA 4EEEB 4X3AA 1DJSB 2ESUA 5B2HA 3O3QA 2AFGA 1QQKA 3WINC 1EVTA 4IZEA 4KBBA 3BA5A 3IAGC 3BAVA 3B9UA 4LO7C 3WINA 2DRYA 4USPA 3BRGC 5JMCA 3ZC9A 1Z2VA 5D62A 3FFZA 1EPWA 1BFCA 3CU1B 4KEKA 5GAQA 2F2FC 1QXMA 5G00A 3BRFA 4XFSA 4GAFA 4IY9A 2F2FA 4R6UB 2AQZA 3JRRA 3FJIA 3BB2A 4G6JA 3WO2A 2XOAA 1YTOA 2IWTB 4GP3A 3AKFA 2VLCA 4QBVA 3PHZA 1R8NA 1DLLA 2WBCA 4KEIA 4YOLA 3ZC8A 3H6RB 3R4UA 4OEGA 4Z9WB 3OJVA 3SNVA 3O44A 1BLAA 3FJEA 3A22A 3I29B 3FJKA 3OBRA 2LIEA 3N7JA 3FGMA 1II4A 1HWMB 2D22A 2P23A 3OJMA 2D23A 3C9ZA 4ZFWB 2ZQNA 2HZ9A 5HPZA 4D0ZA 3BX1C 4G6MA 3BAHA 4J2YA 3A07A 4GOVA 4XFUA 1FGAA 2MC2A 3HMYA 3I2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UDA A;  4QC4 A;  3N7K A;  3O4C A;  3VEQ A;  5D61 A;  4LO1 C;  3FJD A;  1G9B A;  3BRD A;  1IOB A;  1JTC A;  3AKH A;  4LO1 A;  3CQA A;  4ISR A;  5EC5 A;  5F90 A;  3WA1 A;  1DFQ A;  2RG9 B;  4LO7 B;  4OWJ A;  5BQU C;  1JT5 A;  1F31 A;  3RSJ A;  1G9D A;  3O4A A;  2Y9G A;  4A7Z A;  4HA2 A;  3HSM A;  5BQU A;  41BI A;  1WBC A;  2KI4 A;  3O4D A;  3UJ0 A;  3V0B A;  1JT7 A;  3ILA A;  4FVV A;  2M49 A;  1JLX A;  2WRY A;  4Q9G A;  4I6I A;  4H9W A;  5BOW A;  1NUN A;  2D43 A;  1DFC A;  1SR4 A;  4HJJ A;  4WBC A;  3FJ8 A;  1Q1U A;  3O4O A;  3MAL A;  2FDB M;  1XYF A;  3BAO A;  2L5X A;  4I4P A;  4QKS A;  1QQL A;  3QR5 A;  4EFR A;  4I37 A;  5BXR A;  2NM1 A;  1XZZ A;  3WO4 A;  4X38 A;  4KC3 A;  1HWP B;  1RML A;  2E4M A;  3AZW A;  5FZU A;  4OW4 A;  1S0D A;  2NVH A;  1YXW A;  3P53 A;  1HCD A;  4JAW A;  1YYN A;  3PME A;  3CA3 A;  3VSF A;  1SZ6 B;  1XHB A;  5FNX A;  3IM5 A;  4IZX A;  1RY7 A;  3N7M A;  3F1R A;  4DEN A;  3HAL A;  3N0K A;  4I4R A;  3FUO A;  3KMV A;  3E8L C;  3TC2 A;  4PC4 A;  3I2A A;  3AJ6 A;  1OQL B;  4KEJ A;  4I7I A;  1D0H A;  4JPZ A;  4I4Q A;  3K1X A;  1P63 A;  4G1R A;  2KLL A;  1VCL A;  3Q7W A;  1IHK A;  4GOY A;  1DIW A;  1TWM A;  4G9N A;  4EB2 B;  1RG8 A;  2Y9X E;  1IRA X;  3Q7Y A;  4IYB A;  1JY0 A;  4J2X A;  3NBC A;  2F8X C;  1V6X A;  1UPS A;  7I1B A;  4X39 A;  2KKI A;  1EYL A;  3V0A A;  5DSS B;  4I4Y A;  3UJ4 A;  3AH4 A;  1RZO B;  3BAU A;  3LLP A;  4F34 A;  4AN7 B;  2FFU A;  3UD8 A;  1Q04 A;  4P0J A;  5EHA A;  3T8S A;  2D7I A;  3AKI A;  1ONK B;  6I1B A;  1R8O A;  5BXT A;  5I1B A;  1FV2 A;  1G9C A;  4LO3 C;  1I1E A;  4IHZ A;  3UD9 A;  3RTJ B;  2HWA A;  2P39 A;  1S0B A;  4A7Y A;  4LO3 A;  3VUO A;  3Q7X A;  5E24 E;  3VSZ A;  3MPP G;  4OWL A;  1L2H A;  1FN0 A;  4OEF A;  1HKN A;  3JUT A;  1BFB A;  1M16 A;  2NP0 A;  1DZD A;  1PUM B;  4TLP A;  4EKX B;  4USO A;  1MC9 A;  1T4Q A;  3O4B A;  4LO2 A;  3O5W B;  3LTQ A;  2R9K B;  3H6S E;  1TOO A;  3RMY A;  1PWA A;  1FQ9 A;  4F83 A;  4J2K A;  2ET2 A;  1YF8 B;  5F8Y A;  2FGF A;  4IQP A;  2FO1 A;  1G82 A;  3CA1 A;  1BAS A;  3CA5 A;  3AKG A;  3OBT A;  2MIB A;  1W3G A;  1I1B A;  4GAI A;  1T9F A;  5DZU A;  5DVH A;  1S0L A;  2D20 A;  2K43 A;  3FJA A;  4I4O A;  4I4X A;  3W9T A;  2GO2 A;  3AJ5 A;  3IIR A;  1XG6 A;  4Z8S B;  3OJ2 A;  1IRP A;  1EV2 A;  4IY8 A;  3F62 B;  4AN6 A;  4ZFU B;  3FJJ A;  3HBW A;  1TFM B;  4L4I A;  3V0A B;  1SR4 C;  1BA7 A;  4OWK A;  2FFV A;  2LIQ A;  3A21 A;  3CA6 A;  1DQG A;  3BA7 A;  1FMZ A;  4FGF A;  4DEP A;  2RST A;  5F8S A;  4J2S A;  3ZX7 A;  1ISZ A;  21BI A;  4XFT A;  1M2T B;  2AAI B;  4ZKT B;  2Y9W C;  1ITB A;  1TTU A;  2E4M C;  3ZXD A;  1ISV A;  4LO0 A;  3V79 C;  3HN1 A;  3PG0 A;  4ZFY B;  1IIL A;  4ZGR B;  1K5V A;  2I1B A;  4QKR A;  5EG6 C;  3VT2 A;  4JQ0 A;  2VU9 A;  9ILB A;  1ILR 1;  2K8R A;  4JRA A;  31BI A;  4QD2 C;  1HWN B;  3H6R A;  4OUJ A;  3P6J A;  1ISW A;  4I4U A;  3OGF A;  3BAG A;  2UUS A;  4P6A A;  2GZB A;  1HIB A;  3VT1 A;  2J3P A;  4Q91 A;  3CRH A;  3O49 A;  2Q9X A;  4I2S A;  3BAD A;  3WMV A;  4ION A;  1TP0 A;  3FJC A;  2D24 A;  1S0C A;  3EF2 A;  3S8K A;  1FV3 A;  1AFC A;  4I8M A;  4LO8 B;  1V6V A;  2ZQO A;  3V0B B;  2RQ9 A;  1FMM S;  3AH1 A;  3R4S A;  4X37 A;  1S0G A;  1WD4 A;  5DUY A;  5JLV A;  1YBI A;  1S0F A;  2Z49 A;  4ZA3 B;  1V6W A;  2D7R A;  1BLD A;  3S8J A;  4QO3 A;  4QAL A;  1IT0 A;  2VXT I;  1WD3 A;  2VSE A;  1V6U A;  1AVX B;  1J0S A;  3FJB A;  3OGG A;  1CE7 B;  2KI6 B;  1ABR B;  3H6Q A;  3N7L A;  1ISY A;  4I96 A;  1JQZ A;  4JKX B;  4L4H A;  1Q03 A;  4LO2 C;  3NBN A;  2IHO A;  5FNW A;  4G9M A;  5BP5 C;  3BTA A;  4ZOT A;  1BAR A;  5BP5 A;  3FJH A;  2VUA A;  4OEE A;  2KH2 A;  4EFQ A;  4Q9P A;  3IM6 A;  4QD2 B;  2ERM A;  4END A;  3CA4 A;  5BVP I;  1IJT A;  3CAH A;  1WBA A;  3P6I A;  4I1B A;  4HR6 C;  1JT3 A;  2VXR A;  1Z0H A;  2NTD A;  2K4A B;  1W3F A;  1A8D A;  2BEA A;  3VWC A;  3QYD A;  3NBD A;  3CRG A;  2Y9F A;  4I4S A;  2BFH A;  1MD6 A;  4D0T A;  1TWE A;  4JP0 A;  1S0E A;  2MLL B;  1HCE A;  3CRI A;  1W3A A;  4P0K A;  4EFP A;  3WO3 A;  2X2S A;  1Z4S A;  4QBC A;  4P0L A;  4A7K A;  1AVW B;  1JT4 A;  3UD7 A;  2DRZ A;  3NJ5 A;  4ZBV B;  2ZR1 B;  2X2T A;  5D63 A;  1E0O A;  2AXM A;  3PUB A;  2Z48 A;  3RMX A;  1BFG A;  1FWV A;  3IM7 A;  1KNM A;  4I3N A;  4JKQ A;  2QN4 A;  5BXS A;  1DZC A;  4J23 B;  4LO0 C;  2DS0 A;  1BFF A;  4I1E A;  5FZY A;  3VT0 A;  4II0 A;  2NYY A;  2DRE A;  4DCK C;  1PC8 B;  1ISX A;  1PZZ A;  2QYI B;  2VSA A;  2Q3N B;  4CJM A;  3ZXG A;  1CVS A;  2D44 A;  2NZ9 A;  3FJ9 A;  4ZLB B;  1AF9 A;  3HOM A;  4XKI A;  1HWO B;  3BA4 A;  2HW9 A;  2D1Z A;  3CA0 A;  4ISQ A;  1K5U A;  1N4K A;  3BAQ A;  4I0Y A;  1AVU A;  1AVA C;  1G9A A;  1GGP B;  3FUQ A;  1PUU B;  3A23 A;  2YUG A;  5F8W A;  1TIE A;  1NZK A;  3AZV A;  3RTI B;  3D7W B;  1DQO A;  8I1B A;  2BEB A;  4D8H A;  1AXM A;  1JLY A;  3POK A;  5FZZ A;  1FWU A;  4GP0 A;  4H04 A;  5BXP A;  3AH2 A;  3FJF A;  3NBE A;  3WMU A;  4I4V A;  2HWM A;  4EEE B;  4X3A A;  1DJS B;  2ESU A;  5B2H A;  3O3Q A;  2AFG A;  1QQK A;  3WIN C;  1EVT A;  4IZE A;  4KBB A;  3BA5 A;  3IAG C;  3BAV A;  3B9U A;  4LO7 C;  3WIN A;  2DRY A;  4USP A;  3BRG C;  5JMC A;  3ZC9 A;  1Z2V A;  5D62 A;  3FFZ A;  1EPW A;  1BFC A;  3CU1 B;  4KEK A;  5GAQ A;  2F2F C;  1QXM A;  5G00 A;  3BRF A;  4XFS A;  4GAF A;  4IY9 A;  2F2F A;  4R6U B;  2AQZ A;  3JRR A;  3FJI A;  3BB2 A;  4G6J A;  3WO2 A;  2XOA A;  1YTO A;  2IWT B;  4GP3 A;  3AKF A;  2VLC A;  4QBV A;  3PHZ A;  1R8N A;  1DLL A;  2WBC A;  4KEI A;  4YOL A;  3ZC8 A;  3H6R B;  3R4U A;  4OEG A;  4Z9W B;  3OJV A;  3SNV A;  3O44 A;  1BLA A;  3FJE A;  3A22 A;  3I29 B;  3FJK A;  3OBR A;  2LIE A;  3N7J A;  3FGM A;  1II4 A;  1HWM B;  2D22 A;  2P23 A;  3OJM A;  2D23 A;  3C9Z A;  4ZFW B;  2ZQN A;  2HZ9 A;  5HPZ A;  4D0Z A;  3BX1 C;  4G6M A;  3BAH A;  4J2Y A;  3A07 A;  4GOV A;  4XFU A;  1FGA A;  2MC2 A;  3HMY A;  3I2X A; 
#chains in the Genus database with same CATH topology
 3UDA A;  4QC4 A;  3N7K A;  3O4C A;  3VEQ A;  5D61 A;  4LO1 C;  3FJD A;  1G9B A;  3BRD A;  1IOB A;  1JTC A;  3AKH A;  4LO1 A;  3CQA A;  4ISR A;  5EC5 A;  5F90 A;  3WA1 A;  1DFQ A;  2RG9 B;  4LO7 B;  4OWJ A;  5BQU C;  1JT5 A;  1F31 A;  3RSJ A;  1G9D A;  3O4A A;  2Y9G A;  4A7Z A;  4HA2 A;  3HSM A;  5BQU A;  41BI A;  1WBC A;  2KI4 A;  3O4D A;  3UJ0 A;  3V0B A;  1JT7 A;  3ILA A;  4FVV A;  2M49 A;  1JLX A;  2WRY A;  4Q9G A;  4I6I A;  4H9W A;  5BOW A;  1NUN A;  2D43 A;  1DFC A;  1SR4 A;  4HJJ A;  4WBC A;  3FJ8 A;  1Q1U A;  3O4O A;  3MAL A;  2FDB M;  1XYF A;  3BAO A;  2L5X A;  4I4P A;  4QKS A;  1QQL A;  3QR5 A;  4EFR A;  4I37 A;  5BXR A;  2NM1 A;  1XZZ A;  3WO4 A;  4X38 A;  4KC3 A;  1HWP B;  1RML A;  2E4M A;  3AZW A;  5FZU A;  4OW4 A;  1S0D A;  2NVH A;  1YXW A;  3P53 A;  1HCD A;  4JAW A;  1YYN A;  3PME A;  3CA3 A;  3VSF A;  1SZ6 B;  1XHB A;  5FNX A;  3IM5 A;  4IZX A;  1RY7 A;  3N7M A;  3F1R A;  4DEN A;  3HAL A;  3N0K A;  4I4R A;  3FUO A;  3KMV A;  3E8L C;  3TC2 A;  4PC4 A;  3I2A A;  3AJ6 A;  1OQL B;  4KEJ A;  4I7I A;  1D0H A;  4JPZ A;  4I4Q A;  3K1X A;  1P63 A;  4G1R A;  2KLL A;  1VCL A;  3Q7W A;  1IHK A;  4GOY A;  1DIW A;  1TWM A;  4G9N A;  4EB2 B;  1RG8 A;  2Y9X E;  1IRA X;  3Q7Y A;  4IYB A;  1JY0 A;  4J2X A;  3NBC A;  2F8X C;  1V6X A;  1UPS A;  7I1B A;  4X39 A;  2KKI A;  1EYL A;  3V0A A;  5DSS B;  4I4Y A;  3UJ4 A;  3AH4 A;  1RZO B;  3BAU A;  3LLP A;  4F34 A;  4AN7 B;  2FFU A;  3UD8 A;  1Q04 A;  4P0J A;  5EHA A;  3T8S A;  2D7I A;  3AKI A;  1ONK B;  6I1B A;  1R8O A;  5BXT A;  5I1B A;  1FV2 A;  1G9C A;  4LO3 C;  1I1E A;  4IHZ A;  3UD9 A;  3RTJ B;  2HWA A;  2P39 A;  1S0B A;  4A7Y A;  4LO3 A;  3VUO A;  3Q7X A;  5E24 E;  3VSZ A;  3MPP G;  4OWL A;  1L2H A;  1FN0 A;  4OEF A;  1HKN A;  3JUT A;  1BFB A;  1M16 A;  2NP0 A;  1DZD A;  1PUM B;  4TLP A;  4EKX B;  4USO A;  1MC9 A;  1T4Q A;  3O4B A;  4LO2 A;  3O5W B;  3LTQ A;  2R9K B;  3H6S E;  1TOO A;  3RMY A;  1PWA A;  1FQ9 A;  4F83 A;  4J2K A;  2ET2 A;  1YF8 B;  5F8Y A;  2FGF A;  4IQP A;  2FO1 A;  1G82 A;  3CA1 A;  1BAS A;  3CA5 A;  3AKG A;  3OBT A;  2MIB A;  1W3G A;  1I1B A;  4GAI A;  1T9F A;  5DZU A;  5DVH A;  1S0L A;  2D20 A;  2K43 A;  3FJA A;  4I4O A;  4I4X A;  3W9T A;  2GO2 A;  3AJ5 A;  3IIR A;  1XG6 A;  4Z8S B;  3OJ2 A;  1IRP A;  1EV2 A;  4IY8 A;  3F62 B;  4AN6 A;  4ZFU B;  3FJJ A;  3HBW A;  1TFM B;  4L4I A;  3V0A B;  1SR4 C;  1BA7 A;  4OWK A;  2FFV A;  2LIQ A;  3A21 A;  3CA6 A;  1DQG A;  3BA7 A;  1FMZ A;  4FGF A;  4DEP A;  2RST A;  5F8S A;  4J2S A;  3ZX7 A;  1ISZ A;  21BI A;  4XFT A;  1M2T B;  2AAI B;  4ZKT B;  2Y9W C;  1ITB A;  1TTU A;  2E4M C;  3ZXD A;  1ISV A;  4LO0 A;  3V79 C;  3HN1 A;  3PG0 A;  4ZFY B;  1IIL A;  4ZGR B;  1K5V A;  2I1B A;  4QKR A;  5EG6 C;  3VT2 A;  4JQ0 A;  2VU9 A;  9ILB A;  1ILR 1;  2K8R A;  4JRA A;  31BI A;  4QD2 C;  1HWN B;  3H6R A;  4OUJ A;  3P6J A;  1ISW A;  4I4U A;  3OGF A;  3BAG A;  2UUS A;  4P6A A;  2GZB A;  1HIB A;  3VT1 A;  2J3P A;  4Q91 A;  3CRH A;  3O49 A;  2Q9X A;  4I2S A;  3BAD A;  3WMV A;  4ION A;  1TP0 A;  3FJC A;  2D24 A;  1S0C A;  3EF2 A;  3S8K A;  1FV3 A;  1AFC A;  4I8M A;  4LO8 B;  1V6V A;  2ZQO A;  3V0B B;  2RQ9 A;  1FMM S;  3AH1 A;  3R4S A;  4X37 A;  1S0G A;  1WD4 A;  5DUY A;  5JLV A;  4MZH A;  1YBI A;  1S0F A;  2NS2 A;  2Z49 A;  4ZA3 B;  1V6W A;  2D7R A;  1BLD A;  3S8J A;  4QO3 A;  4QAL A;  1IT0 A;  2VXT I;  1WD3 A;  2VSE A;  1V6U A;  1AVX B;  1J0S A;  3FJB A;  3OGG A;  1CE7 B;  2KI6 B;  1ABR B;  3H6Q A;  3N7L A;  1ISY A;  4I96 A;  1JQZ A;  4JKX B;  4L4H A;  1Q03 A;  4LO2 C;  3NBN A;  2IHO A;  5FNW A;  4G9M A;  5BP5 C;  3BTA A;  4ZOT A;  1BAR A;  5BP5 A;  3FJH A;  2VUA A;  4OEE A;  2KH2 A;  4EFQ A;  4Q9P A;  3IM6 A;  4QD2 B;  2ERM A;  4END A;  3CA4 A;  5BVP I;  1IJT A;  3CAH A;  1WBA A;  3P6I A;  4I1B A;  4HR6 C;  1JT3 A;  2VXR A;  4MZF B;  1Z0H A;  2NTD A;  2K4A B;  1W3F A;  1A8D A;  2BEA A;  3VWC A;  3QYD A;  3NBD A;  3CRG A;  2Y9F A;  4I4S A;  2BFH A;  1MD6 A;  4D0T A;  1TWE A;  4JP0 A;  1S0E A;  2MLL B;  1HCE A;  4MZG B;  3CRI A;  1W3A A;  4P0K A;  4EFP A;  3WO3 A;  2X2S A;  1Z4S A;  4QBC A;  4P0L A;  4A7K A;  1AVW B;  1JT4 A;  3UD7 A;  2DRZ A;  3NJ5 A;  4ZBV B;  2ZR1 B;  2X2T A;  5D63 A;  1E0O A;  4UY4 A;  2AXM A;  3PUB A;  2Z48 A;  3RMX A;  1BFG A;  1FWV A;  3IM7 A;  1KNM A;  4I3N A;  4JKQ A;  2QN4 A;  5BXS A;  1DZC A;  4J23 B;  4LO0 C;  2DS0 A;  1BFF A;  4I1E A;  5FZY A;  3VT0 A;  4II0 A;  2NYY A;  2DRE A;  4DCK C;  1PC8 B;  1ISX A;  1PZZ A;  2QYI B;  2VSA A;  2Q3N B;  4CJM A;  3ZXG A;  1CVS A;  2D44 A;  2NZ9 A;  3FJ9 A;  4ZLB B;  1AF9 A;  3HOM A;  4XKI A;  1HWO B;  3BA4 A;  2HW9 A;  2D1Z A;  3CA0 A;  4ISQ A;  1K5U A;  1N4K A;  3BAQ A;  4I0Y A;  1AVU A;  1AVA C;  1G9A A;  1GGP B;  3FUQ A;  1PUU B;  3A23 A;  2YUG A;  5F8W A;  1TIE A;  1NZK A;  3AZV A;  3RTI B;  3D7W B;  1DQO A;  8I1B A;  2BEB A;  4H75 A;  4D8H A;  1AXM A;  1JLY A;  3POK A;  5FZZ A;  1FWU A;  4GP0 A;  4H04 A;  5BXP A;  3AH2 A;  3FJF A;  3NBE A;  3WMU A;  4I4V A;  2HWM A;  4EEE B;  4X3A A;  1DJS B;  2ESU A;  5B2H A;  3O3Q A;  2AFG A;  1QQK A;  3WIN C;  1EVT A;  4IZE A;  4KBB A;  3BA5 A;  3IAG C;  3BAV A;  3B9U A;  4LO7 C;  3WIN A;  2DRY A;  4USP A;  3BRG C;  5JMC A;  3ZC9 A;  1Z2V A;  5D62 A;  3FFZ A;  1EPW A;  1BFC A;  3CU1 B;  4KEK A;  5GAQ A;  2F2F C;  1QXM A;  5G00 A;  3BRF A;  4XFS A;  4GAF A;  4IY9 A;  2F2F A;  4R6U B;  2AQZ A;  3JRR A;  3FJI A;  3BB2 A;  4G6J A;  3WO2 A;  2XOA A;  1YTO A;  2IWT B;  4GP3 A;  3AKF A;  2VLC A;  4QBV A;  3PHZ A;  1R8N A;  1DLL A;  2WBC A;  4KEI A;  4YOL A;  3ZC8 A;  3H6R B;  3R4U A;  4OEG A;  4Z9W B;  3OJV A;  3SNV A;  3O44 A;  1BLA A;  3FJE A;  3A22 A;  3I29 B;  3FJK A;  3OBR A;  2LIE A;  3N7J A;  3FGM A;  1II4 A;  1HWM B;  2D22 A;  2P23 A;  3OJM A;  2D23 A;  3C9Z A;  4ZFW B;  2ZQN A;  2HZ9 A;  5HPZ A;  4D0Z A;  3BX1 C;  4G6M A;  3BAH A;  4J2Y A;  3A07 A;  4GOV A;  4XFU A;  1FGA A;  2MC2 A;  3HMY A;  3I2X A; 
#chains in the Genus database with same CATH homology
 3UDA A;  4QC4 A;  3N7K A;  3O4C A;  3VEQ A;  5D61 A;  4LO1 C;  3FJD A;  1G9B A;  3BRD A;  1IOB A;  1JTC A;  3AKH A;  4LO1 A;  3CQA A;  4ISR A;  5EC5 A;  5F90 A;  3WA1 A;  1DFQ A;  2RG9 B;  4LO7 B;  4OWJ A;  5BQU C;  1JT5 A;  1F31 A;  3RSJ A;  1G9D A;  3O4A A;  2Y9G A;  4A7Z A;  4HA2 A;  3HSM A;  5BQU A;  41BI A;  1WBC A;  2KI4 A;  3O4D A;  3UJ0 A;  3V0B A;  1JT7 A;  3ILA A;  4FVV A;  2M49 A;  1JLX A;  2WRY A;  4Q9G A;  4I6I A;  4H9W A;  5BOW A;  1NUN A;  2D43 A;  1DFC A;  1SR4 A;  4HJJ A;  4WBC A;  3FJ8 A;  1Q1U A;  3O4O A;  3MAL A;  2FDB M;  1XYF A;  3BAO A;  2L5X A;  4I4P A;  4QKS A;  1QQL A;  3QR5 A;  4EFR A;  4I37 A;  5BXR A;  2NM1 A;  1XZZ A;  3WO4 A;  4X38 A;  4KC3 A;  1HWP B;  1RML A;  2E4M A;  3AZW A;  5FZU A;  4OW4 A;  1S0D A;  2NVH A;  1YXW A;  3P53 A;  1HCD A;  4JAW A;  1YYN A;  3PME A;  3CA3 A;  3VSF A;  1SZ6 B;  1XHB A;  5FNX A;  3IM5 A;  4IZX A;  1RY7 A;  3N7M A;  3F1R A;  4DEN A;  3HAL A;  3N0K A;  4I4R A;  3FUO A;  3KMV A;  3E8L C;  3TC2 A;  4PC4 A;  3I2A A;  3AJ6 A;  1OQL B;  4KEJ A;  4I7I A;  1D0H A;  4JPZ A;  4I4Q A;  3K1X A;  1P63 A;  4G1R A;  2KLL A;  1VCL A;  3Q7W A;  1IHK A;  4GOY A;  1DIW A;  1TWM A;  4G9N A;  4EB2 B;  1RG8 A;  2Y9X E;  1IRA X;  3Q7Y A;  4IYB A;  1JY0 A;  4J2X A;  3NBC A;  2F8X C;  1V6X A;  1UPS A;  7I1B A;  4X39 A;  2KKI A;  1EYL A;  3V0A A;  5DSS B;  4I4Y A;  3UJ4 A;  3AH4 A;  1RZO B;  3BAU A;  3LLP A;  4F34 A;  4AN7 B;  2FFU A;  3UD8 A;  1Q04 A;  4P0J A;  5EHA A;  3T8S A;  2D7I A;  3AKI A;  1ONK B;  6I1B A;  1R8O A;  5BXT A;  5I1B A;  1FV2 A;  1G9C A;  4LO3 C;  1I1E A;  4IHZ A;  3UD9 A;  3RTJ B;  2HWA A;  2P39 A;  1S0B A;  4A7Y A;  4LO3 A;  3VUO A;  3Q7X A;  5E24 E;  3VSZ A;  3MPP G;  4OWL A;  1L2H A;  1FN0 A;  4OEF A;  1HKN A;  3JUT A;  1BFB A;  1M16 A;  2NP0 A;  1DZD A;  1PUM B;  4TLP A;  4EKX B;  4USO A;  1MC9 A;  1T4Q A;  3O4B A;  4LO2 A;  3O5W B;  3LTQ A;  2R9K B;  3H6S E;  1TOO A;  3RMY A;  1PWA A;  1FQ9 A;  4F83 A;  4J2K A;  2ET2 A;  1YF8 B;  5F8Y A;  2FGF A;  4IQP A;  2FO1 A;  1G82 A;  3CA1 A;  1BAS A;  3CA5 A;  3AKG A;  3OBT A;  2MIB A;  1W3G A;  1I1B A;  4GAI A;  1T9F A;  5DZU A;  5DVH A;  1S0L A;  2D20 A;  2K43 A;  3FJA A;  4I4O A;  4I4X A;  3W9T A;  2GO2 A;  3AJ5 A;  3IIR A;  1XG6 A;  4Z8S B;  3OJ2 A;  1IRP A;  1EV2 A;  4IY8 A;  3F62 B;  4AN6 A;  4ZFU B;  3FJJ A;  3HBW A;  1TFM B;  4L4I A;  3V0A B;  1SR4 C;  1BA7 A;  4OWK A;  2FFV A;  2LIQ A;  3A21 A;  3CA6 A;  1DQG A;  3BA7 A;  1FMZ A;  4FGF A;  4DEP A;  2RST A;  5F8S A;  4J2S A;  3ZX7 A;  1ISZ A;  21BI A;  4XFT A;  1M2T B;  2AAI B;  4ZKT B;  2Y9W C;  1ITB A;  1TTU A;  2E4M C;  3ZXD A;  1ISV A;  4LO0 A;  3V79 C;  3HN1 A;  3PG0 A;  4ZFY B;  1IIL A;  4ZGR B;  1K5V A;  2I1B A;  4QKR A;  5EG6 C;  3VT2 A;  4JQ0 A;  2VU9 A;  9ILB A;  1ILR 1;  2K8R A;  4JRA A;  31BI A;  4QD2 C;  1HWN B;  3H6R A;  4OUJ A;  3P6J A;  1ISW A;  4I4U A;  3OGF A;  3BAG A;  2UUS A;  4P6A A;  2GZB A;  1HIB A;  3VT1 A;  2J3P A;  4Q91 A;  3CRH A;  3O49 A;  2Q9X A;  4I2S A;  3BAD A;  3WMV A;  4ION A;  1TP0 A;  3FJC A;  2D24 A;  1S0C A;  3EF2 A;  3S8K A;  1FV3 A;  1AFC A;  4I8M A;  4LO8 B;  1V6V A;  2ZQO A;  3V0B B;  2RQ9 A;  1FMM S;  3AH1 A;  3R4S A;  4X37 A;  1S0G A;  1WD4 A;  5DUY A;  5JLV A;  4MZH A;  1YBI A;  1S0F A;  2NS2 A;  2Z49 A;  4ZA3 B;  1V6W A;  2D7R A;  1BLD A;  3S8J A;  4QO3 A;  4QAL A;  1IT0 A;  2VXT I;  1WD3 A;  2VSE A;  1V6U A;  1AVX B;  1J0S A;  3FJB A;  3OGG A;  1CE7 B;  2KI6 B;  1ABR B;  3H6Q A;  3N7L A;  1ISY A;  4I96 A;  1JQZ A;  4JKX B;  4L4H A;  1Q03 A;  4LO2 C;  3NBN A;  2IHO A;  5FNW A;  4G9M A;  5BP5 C;  3BTA A;  4ZOT A;  1BAR A;  5BP5 A;  3FJH A;  2VUA A;  4OEE A;  2KH2 A;  4EFQ A;  4Q9P A;  3IM6 A;  4QD2 B;  2ERM A;  4END A;  3CA4 A;  5BVP I;  1IJT A;  3CAH A;  1WBA A;  3P6I A;  4I1B A;  4HR6 C;  1JT3 A;  2VXR A;  4MZF B;  1Z0H A;  2NTD A;  2K4A B;  1W3F A;  1A8D A;  2BEA A;  3VWC A;  3QYD A;  3NBD A;  3CRG A;  2Y9F A;  4I4S A;  2BFH A;  1MD6 A;  4D0T A;  1TWE A;  4JP0 A;  1S0E A;  2MLL B;  1HCE A;  4MZG B;  3CRI A;  1W3A A;  4P0K A;  4EFP A;  3WO3 A;  2X2S A;  1Z4S A;  4QBC A;  4P0L A;  4A7K A;  1AVW B;  1JT4 A;  3UD7 A;  2DRZ A;  3NJ5 A;  4ZBV B;  2ZR1 B;  2X2T A;  5D63 A;  1E0O A;  4UY4 A;  2AXM A;  3PUB A;  2Z48 A;  3RMX A;  1BFG A;  1FWV A;  3IM7 A;  1KNM A;  4I3N A;  4JKQ A;  2QN4 A;  5BXS A;  1DZC A;  4J23 B;  4LO0 C;  2DS0 A;  1BFF A;  4I1E A;  5FZY A;  3VT0 A;  4II0 A;  2NYY A;  2DRE A;  4DCK C;  1PC8 B;  1ISX A;  1PZZ A;  2QYI B;  2VSA A;  2Q3N B;  4CJM A;  3ZXG A;  1CVS A;  2D44 A;  2NZ9 A;  3FJ9 A;  4ZLB B;  1AF9 A;  3HOM A;  4XKI A;  1HWO B;  3BA4 A;  2HW9 A;  2D1Z A;  3CA0 A;  4ISQ A;  1K5U A;  1N4K A;  3BAQ A;  4I0Y A;  1AVU A;  1AVA C;  1G9A A;  1GGP B;  3FUQ A;  1PUU B;  3A23 A;  2YUG A;  5F8W A;  1TIE A;  1NZK A;  3AZV A;  3RTI B;  3D7W B;  1DQO A;  8I1B A;  2BEB A;  4H75 A;  4D8H A;  1AXM A;  1JLY A;  3POK A;  5FZZ A;  1FWU A;  4GP0 A;  4H04 A;  5BXP A;  3AH2 A;  3FJF A;  3NBE A;  3WMU A;  4I4V A;  2HWM A;  4EEE B;  4X3A A;  1DJS B;  2ESU A;  5B2H A;  3O3Q A;  2AFG A;  1QQK A;  3WIN C;  1EVT A;  4IZE A;  4KBB A;  3BA5 A;  3IAG C;  3BAV A;  3B9U A;  4LO7 C;  3WIN A;  2DRY A;  4USP A;  3BRG C;  5JMC A;  3ZC9 A;  1Z2V A;  5D62 A;  3FFZ A;  1EPW A;  1BFC A;  3CU1 B;  4KEK A;  5GAQ A;  2F2F C;  1QXM A;  5G00 A;  3BRF A;  4XFS A;  4GAF A;  4IY9 A;  2F2F A;  4R6U B;  2AQZ A;  3JRR A;  3FJI A;  3BB2 A;  4G6J A;  3WO2 A;  2XOA A;  1YTO A;  2IWT B;  4GP3 A;  3AKF A;  2VLC A;  4QBV A;  3PHZ A;  1R8N A;  1DLL A;  2WBC A;  4KEI A;  4YOL A;  3ZC8 A;  3H6R B;  3R4U A;  4OEG A;  4Z9W B;  3OJV A;  3SNV A;  3O44 A;  1BLA A;  3FJE A;  3A22 A;  3I29 B;  3FJK A;  3OBR A;  2LIE A;  3N7J A;  3FGM A;  1II4 A;  1HWM B;  2D22 A;  2P23 A;  3OJM A;  2D23 A;  3C9Z A;  4ZFW B;  2ZQN A;  2HZ9 A;  5HPZ A;  4D0Z A;  3BX1 C;  4G6M A;  3BAH A;  4J2Y A;  3A07 A;  4GOV A;  4XFU A;  1FGA A;  2MC2 A;  3HMY A;  3I2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...