4X39A

Gallus interleukin-1 beta mutant - t117a
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
159
structure length
154
Chain Sequence
AFRYTRSQSFDIFDINQKCFVLESPTQLVALHLQGPSSSQKVRLNIALYRPRAGTGQMPVALGIKGYKLYMSCVMSGTEPTLQLEEADVMRDIDSVELTRFIFYRLDSPAEGTTRFESAAFPGWFICTSLQPRQPVGITNQPDQVNIATYKLSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IL-1 beta
publication title Gallus interleukin-1 beta mutant - T117A
rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 29
structure length 154
sequence length 159
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4x39A00
3CRIA 4EEEB 3A22A 1DIWA 4USPA 4JPZA 1ILR1 3ILAA 3O5WB 1HCDA 3AKGA 4ISRA 4A7KA 1DZCA 3P6IA 3PHZA 1DLLA 2X2SA 4J2KA 4L4HA 3UD9A 4IYBA 5E24E 2MIBA 5I1BA 1PUMB 3ZC9A 5F8WA 1N4KA 5G00A 1S0LA 4P6AA 4QBVA 2XOAA 4LO1C 5BOWA 3HBWA 2D1ZA 4XKIA 4HA2A 4OUJA 3EF2A 2RG9B 4I4RA 3BRFA 3RSJA 1D0HA 3AH1A 3BAHA 4OWJA 4EKXB 4ZA3B 3WINC 1Z2VA 3FJKA 4I4XA 4LO8B 2D24A 3C9ZA 3JUTA 3OBRA 2WRYA 4LO2C 4DEPA 1DFQA 3NBCA 2BFHA 2E4MC 1PC8B 4JP0A 3FJHA 2D7RA 4F34A 2NP0A 3MPPG 3AJ6A 3Q7YA 5D61A 4A7ZA 2ET2A 3I2AA 3FFZA 5DVHA 1WD4A 1FWUA 1MC9A 3RTJB 1EVTA 1JT4A 1ONKB 3UD8A 1EV2A 1UPSA 3UD7A 3RMXA 3IIRA 1PWAA 1BLDA 3LTQA 5FZUA 2L5XA 4GP0A 1QXMA 2HZ9A 4EFPA 1IT0A 4X39A 2KH2A 4JKXB 3BA4A 2D44A 1TIEA 4FGFA 4I1BA 3RTIB 4KBBA 4LO0C 3Q7WA 2FGFA 3FJEA 4P0LA 3A21A 1W3GA 5FNXA 3HOMA 2BEAA 2HWAA 4ZBVB 2Y9XE 1ISXA 2MC2A 3AKHA 4IY8A 5F8YA 5BP5C 4X3AA 4HJJA 3A23A 3JRRA 1W3FA 4XFTA 3LLPA 1TOOA 4QD2B 1S0GA 1V6VA 1JT3A 2IHOA 4I96A 4OEFA 8I1BA 3OGGA 2LIQA 3CAHA 4GP3A 1G9DA 2KI4A 3OJVA 3WO3A 1L2HA 2I1BA 4IY9A 3UJ0A 3T8SA 3FJBA 4IZXA 1RG8A 1XHBA 3FJDA 1ITBA 3K1XA 1NZKA 4GAFA 2VXRA 3ZXDA 1JLYA 4L4IA 4LO1A 5EHAA 1A8DA 1BFFA 4XFSA 5DSSB 3N7MA 4Q9PA 1YBIA 2Y9GA 4GAIA 4G9NA 3WO4A 1FQ9A 3AH2A 3CA0A 3E8LC 3OJMA 3BX1C 5FZZA 3AKIA 3D7WB 5BXPA 3HMYA 9ILBA 3BB2A 5BVPI 1HIBA 1YYNA 2P23A 4LO3A 3BAVA 1Z4SA 2E4MA 1Q04A 1ISVA 1PZZA 3HN1A 4ZFUB 2Y9WC 1IILA 3F1RA 4EB2B 1HWOB 1XYFA 4J2SA 3FUOA 4Z8SB 1SR4C 2D22A 2KLLA 4I37A 2FDBM 1FGAA 4CJMA 5DUYA 4I7IA 2NTDA 4QKSA 4R6UB 5HPZA 1P63A 2DREA 4F83A 3Q7XA 3R4SA 21BIA 1E0OA 6I1BA 2QYIB 3PUBA 1SZ6B 4AN6A 2F2FA 3O4BA 5BXTA 3NJ5A 5B2HA 1AF9A 2R9KB 3IM5A 2AAIB 2KI6B 4LO7C 4A7YA 3VSZA 2D43A 3FGMA 4J23B 3V79C 4Q91A 3H6SE 4IONA 4KC3A 4J2YA 3AH4A 2NM1A 1AVUA 4EFRA 2X2TA 3BADA 3FJFA 4II0A 1S0CA 2IWTB 4QO3A 2M49A 5BQUC 4OEGA 41BIA 3B9UA 4I4YA 1S0BA 1I1BA 3O49A 3S8JA 4QALA 3N7KA 1Q03A 2HW9A 3P53A 4X37A 1HKNA 1TTUA 5JMCA 3CA3A 3I29B 3FJIA 1OQLB 1AVWB 3V0AB 1K5VA 1M16A 4GOYA 4X38A 4G6JA 3O4CA 3CA5A 2VSAA 1NUNA 3BAOA 4AN7B 4ZGRB 3BAQA 3HSMA 2VSEA 3IAGC 1QQKA 3AJ5A 1ISWA 3NBEA 1IJTA 2ZR1B 3KMVA 4IZEA 1FMZA 3N7JA 1FN0A 2P39A 4I6IA 1CE7B 4ZOTA 1FV3A 4IQPA 1AVXB 1RY7A 3H6RB 4DENA 1DQGA 1G9CA 3FJ8A 4G9MA 1ISZA 1HWPB 1JY0A 2ZQOA 3V0AA 1ABRB 3CA6A 3FJCA 3POKA 3FJ9A 4OWKA 5FNWA 4FVVA 4I8MA 1XZZA 3OBTA 1ISYA 4OEEA 3O3QA 4D8HA 1RZOB 31BIA 1S0EA 4ZLBB 3AKFA 3BRDA 2F8XC 1Z0HA 3UJ4A 3N0KA 3WMVA 1IRPA 4OWLA 3ZXGA 4I4SA 1BFGA 1TWMA 3WINA 3H6QA 3VT1A 3QR5A 3AZWA 7I1BA 4H04A 1WBCA 2WBCA 1S0DA 1K5UA 2AQZA 3OJ2A 3H6RA 4LO2A 1FMMS 2RQ9A 4ISQA 4QKRA 5DZUA 4ZFWB 3F62B 2DS0A 4IHZA 3RMYA 1IRAX 2Z48A 1S0FA 3BTAA 5D63A 1AVAC 1IOBA 5F8SA 1V6UA 1HWNB 1R8OA 5F90A 3QYDA 3IM7A 3NBNA 1QQLA 1DFCA 1G82A 4EFQA 3BA7A 2DRYA 4JQ0A 1FWVA 1VCLA 3NBDA 1JT5A 1WD3A 1YTOA 3PG0A 3HALA 1T9FA 4LO0A 4G1RA 3UDAA 3W9TA 1GGPB 3CA4A 2VUAA 4KEIA 3VUOA 1TP0A 3BAUA 3ZC8A 2GZBA 3O4OA 4J2XA 1DZDA 1BLAA 3WMUA 2J3PA 2ESUA 3FJAA 1JLXA 1EPWA 5BP5A 4JKQA 4G6MA 1HWMB 2RSTA 4JRAA 5BXSA 1TWEA 2Q9XA 5FZYA 2UUSA 1KNMA 2FFVA 2Z49A 1BFCA 3CRHA 4YOLA 2D7IA 5EC5A 1Q1UA 3VWCA 1HCEA 4PC4A 3R4UA 1AFCA 1MD6A 3TC2A 1J0SA 1XG6A 1BFBA 1M2TB 1R8NA 4QD2C 5D62A 4WBCA 3VT2A 1AXMA 4LO3C 2LIEA 4D0ZA 3WA1A 1DJSB 2AXMA 2MLLB 4Q9GA 2FFUA 1G9BA 3V0BB 3SNVA 2YUGA 4D0TA 1RMLA 1W3AA 1FV2A 1EYLA 2GO2A 1I1EA 4I4PA 3WO2A 3O4DA 3BRGC 4Z9WB 1WBAA 2ERMA 3IM6A 1JTCA 5BXRA 1V6WA 4P0JA 1DQOA 2NYYA 1JT7A 1JQZA 2VXTI 4JAWA 1V6XA 3A07A 1PUUB 3P6JA 4HR6C 4LO7B 4I3NA 3CA1A 1YF8B 4GOVA 3CQAA 1SR4A 2VU9A 2Q3NB 2K43A 2FO1A 1CVSA 2NVHA 2F2FC 4I2SA 3VSFA 3BA5A 1T4QA 1G9AA 3V0BA 1TFMB 5GAQA 2NZ9A 2AFGA 2HWMA 3N7LA 4I4OA 4I1EA 4ENDA 2BEBA 3PMEA 2K8RA 1BARA 5EG6C 1BA7A 4DCKC 2K4AB 2VLCA 3FUQA 4QC4A 3FJJA 4OW4A 4KEKA 4I4UA 3VT0A 3I2XA 3BAGA 3S8KA 3O4AA 4P0KA 3VEQA 3CRGA 4H9WA 3MALA 2KKIA 1II4A 2ZQNA 4ZKTB 2DRZA 1F31A 5BQUA 4I4VA 4QBCA 3ZX7A 4TLPA 2D23A 4ZFYB 2QN4A 4I4QA 3O44A 3CU1B 1IHKA 4KEJA 2D20A 5JLVA 4I0YA 3AZVA 2Y9FA 1YXWA 3OGFA 1BASA 4XFUA 4USOA
chains in the Genus database with same CATH superfamily
3CRIA 4EEEB 3A22A 4MZGB 1DIWA 4USPA 4JPZA 1ILR1 3ILAA 3O5WB 1HCDA 3AKGA 4ISRA 4A7KA 1DZCA 3P6IA 3PHZA 1DLLA 2X2SA 4J2KA 4L4HA 3UD9A 4IYBA 5E24E 2MIBA 5I1BA 1PUMB 3ZC9A 5F8WA 1N4KA 5G00A 1S0LA 4P6AA 4QBVA 2XOAA 4LO1C 5BOWA 3HBWA 2D1ZA 4XKIA 4HA2A 4OUJA 3EF2A 2RG9B 4I4RA 3BRFA 3RSJA 1D0HA 3AH1A 3BAHA 4OWJA 4EKXB 4ZA3B 3WINC 1Z2VA 3FJKA 4I4XA 4LO8B 2D24A 3C9ZA 3JUTA 3OBRA 2WRYA 4LO2C 4DEPA 1DFQA 3NBCA 2BFHA 2E4MC 1PC8B 4JP0A 3FJHA 2D7RA 4F34A 2NP0A 3MPPG 3AJ6A 3Q7YA 5D61A 4A7ZA 2ET2A 3I2AA 3FFZA 5DVHA 1WD4A 1FWUA 1MC9A 3RTJB 4H75A 1EVTA 1JT4A 1ONKB 3UD8A 1EV2A 1UPSA 3UD7A 3RMXA 3IIRA 1PWAA 1BLDA 3LTQA 5FZUA 2L5XA 4GP0A 1QXMA 2HZ9A 4EFPA 1IT0A 4X39A 2KH2A 4JKXB 3BA4A 2D44A 1TIEA 4FGFA 4I1BA 3RTIB 4KBBA 4LO0C 3Q7WA 2FGFA 3FJEA 4P0LA 3A21A 1W3GA 5FNXA 3HOMA 2BEAA 2HWAA 4ZBVB 2Y9XE 1ISXA 2MC2A 3AKHA 4IY8A 5F8YA 5BP5C 4X3AA 4UY4A 4HJJA 3A23A 3JRRA 1W3FA 4XFTA 3LLPA 1TOOA 4QD2B 1S0GA 1V6VA 1JT3A 2IHOA 4I96A 4OEFA 8I1BA 3OGGA 2LIQA 3CAHA 4GP3A 1G9DA 2KI4A 3OJVA 3WO3A 1L2HA 2I1BA 4IY9A 3UJ0A 3T8SA 3FJBA 4IZXA 1RG8A 1XHBA 3FJDA 1ITBA 3K1XA 1NZKA 4GAFA 2VXRA 3ZXDA 1JLYA 4L4IA 4LO1A 5EHAA 1A8DA 1BFFA 4XFSA 5DSSB 3N7MA 4Q9PA 1YBIA 2Y9GA 4GAIA 4G9NA 3WO4A 1FQ9A 3AH2A 3CA0A 3E8LC 3OJMA 3BX1C 5FZZA 3AKIA 3D7WB 5BXPA 3HMYA 9ILBA 3BB2A 5BVPI 1HIBA 1YYNA 2P23A 4LO3A 3BAVA 1Z4SA 2E4MA 1Q04A 1ISVA 1PZZA 3HN1A 4ZFUB 2Y9WC 1IILA 3F1RA 4EB2B 1HWOB 1XYFA 4J2SA 3FUOA 4Z8SB 1SR4C 2D22A 2KLLA 4I37A 2FDBM 1FGAA 4CJMA 5DUYA 4I7IA 2NTDA 4QKSA 4R6UB 5HPZA 1P63A 2DREA 4F83A 3Q7XA 3R4SA 21BIA 1E0OA 6I1BA 2QYIB 3PUBA 1SZ6B 4AN6A 2F2FA 3O4BA 5BXTA 3NJ5A 5B2HA 1AF9A 2R9KB 3IM5A 2AAIB 2KI6B 4LO7C 4A7YA 3VSZA 2D43A 3FGMA 4J23B 3V79C 4Q91A 3H6SE 4IONA 4KC3A 4J2YA 3AH4A 2NM1A 1AVUA 4EFRA 2X2TA 3BADA 3FJFA 4II0A 1S0CA 2IWTB 4QO3A 2M49A 5BQUC 4OEGA 41BIA 3B9UA 4I4YA 1S0BA 1I1BA 3O49A 3S8JA 4QALA 3N7KA 1Q03A 2HW9A 3P53A 4X37A 1HKNA 1TTUA 5JMCA 3CA3A 3I29B 3FJIA 1OQLB 1AVWB 3V0AB 1K5VA 1M16A 4GOYA 4X38A 4G6JA 3O4CA 3CA5A 2VSAA 1NUNA 3BAOA 4AN7B 4ZGRB 3BAQA 3HSMA 2VSEA 3IAGC 1QQKA 3AJ5A 1ISWA 3NBEA 1IJTA 2ZR1B 3KMVA 4IZEA 1FMZA 3N7JA 1FN0A 2P39A 4I6IA 1CE7B 4ZOTA 1FV3A 4IQPA 2NS2A 1AVXB 1RY7A 3H6RB 4DENA 1DQGA 1G9CA 3FJ8A 4G9MA 1ISZA 1HWPB 1JY0A 2ZQOA 3V0AA 1ABRB 3CA6A 3FJCA 3POKA 3FJ9A 4OWKA 5FNWA 4FVVA 4I8MA 1XZZA 3OBTA 1ISYA 4OEEA 3O3QA 4D8HA 1RZOB 31BIA 1S0EA 4ZLBB 3AKFA 3BRDA 2F8XC 1Z0HA 3UJ4A 3N0KA 3WMVA 1IRPA 4OWLA 3ZXGA 4I4SA 1BFGA 1TWMA 3WINA 3H6QA 3VT1A 3QR5A 3AZWA 7I1BA 4H04A 1WBCA 2WBCA 1S0DA 1K5UA 2AQZA 3OJ2A 3H6RA 4LO2A 1FMMS 2RQ9A 4MZHA 4ISQA 4QKRA 5DZUA 4ZFWB 3F62B 2DS0A 4IHZA 3RMYA 1IRAX 2Z48A 1S0FA 3BTAA 5D63A 1AVAC 1IOBA 5F8SA 1V6UA 1HWNB 1R8OA 5F90A 3QYDA 3IM7A 3NBNA 1QQLA 1DFCA 1G82A 4EFQA 3BA7A 2DRYA 4JQ0A 1FWVA 1VCLA 3NBDA 1JT5A 1WD3A 1YTOA 3PG0A 3HALA 1T9FA 4LO0A 4G1RA 3UDAA 3W9TA 1GGPB 3CA4A 2VUAA 4KEIA 3VUOA 1TP0A 3BAUA 3ZC8A 2GZBA 3O4OA 4J2XA 1DZDA 1BLAA 3WMUA 2J3PA 2ESUA 3FJAA 1JLXA 1EPWA 5BP5A 4JKQA 4G6MA 1HWMB 2RSTA 4JRAA 5BXSA 1TWEA 2Q9XA 5FZYA 2UUSA 1KNMA 2FFVA 2Z49A 1BFCA 3CRHA 4YOLA 2D7IA 5EC5A 1Q1UA 3VWCA 1HCEA 4PC4A 3R4UA 1AFCA 1MD6A 3TC2A 1J0SA 1XG6A 1BFBA 1M2TB 1R8NA 4QD2C 5D62A 4WBCA 3VT2A 1AXMA 4LO3C 2LIEA 4D0ZA 3WA1A 1DJSB 2AXMA 2MLLB 4Q9GA 2FFUA 1G9BA 3V0BB 3SNVA 2YUGA 4D0TA 1RMLA 1W3AA 1FV2A 1EYLA 2GO2A 1I1EA 4I4PA 3WO2A 3O4DA 3BRGC 4Z9WB 1WBAA 2ERMA 3IM6A 1JTCA 5BXRA 1V6WA 4P0JA 1DQOA 2NYYA 1JT7A 1JQZA 2VXTI 4JAWA 1V6XA 3A07A 1PUUB 3P6JA 4HR6C 4LO7B 4I3NA 3CA1A 1YF8B 4GOVA 3CQAA 1SR4A 2VU9A 2Q3NB 2K43A 2FO1A 1CVSA 2NVHA 2F2FC 4I2SA 3VSFA 3BA5A 1T4QA 1G9AA 3V0BA 1TFMB 5GAQA 2NZ9A 2AFGA 2HWMA 3N7LA 4I4OA 4MZFB 4I1EA 4ENDA 2BEBA 3PMEA 2K8RA 1BARA 5EG6C 1BA7A 4DCKC 2K4AB 2VLCA 3FUQA 4QC4A 3FJJA 4OW4A 4KEKA 4I4UA 3VT0A 3I2XA 3BAGA 3S8KA 3O4AA 4P0KA 3VEQA 3CRGA 4H9WA 3MALA 2KKIA 1II4A 2ZQNA 4ZKTB 2DRZA 1F31A 5BQUA 4I4VA 4QBCA 3ZX7A 4TLPA 2D23A 4ZFYB 2QN4A 4I4QA 3O44A 3CU1B 1IHKA 4KEJA 2D20A 5JLVA 4I0YA 3AZVA 2Y9FA 1YXWA 3OGFA 1BASA 4XFUA 4USOA
chains in the Genus database with same CATH topology
3CRIA 4EEEB 3A22A 4MZGB 1DIWA 4USPA 4JPZA 1ILR1 3ILAA 3O5WB 1HCDA 3AKGA 4ISRA 4A7KA 1DZCA 3P6IA 3PHZA 1DLLA 2X2SA 4J2KA 4L4HA 3UD9A 4IYBA 5E24E 2MIBA 5I1BA 1PUMB 3ZC9A 5F8WA 1N4KA 5G00A 1S0LA 4P6AA 4QBVA 2XOAA 4LO1C 5BOWA 3HBWA 2D1ZA 4XKIA 4HA2A 4OUJA 3EF2A 2RG9B 4I4RA 3BRFA 3RSJA 1D0HA 3AH1A 3BAHA 4OWJA 4EKXB 4ZA3B 3WINC 1Z2VA 3FJKA 4I4XA 4LO8B 2D24A 3C9ZA 3JUTA 3OBRA 2WRYA 4LO2C 4DEPA 1DFQA 3NBCA 2BFHA 2E4MC 1PC8B 4JP0A 3FJHA 2D7RA 4F34A 2NP0A 3MPPG 3AJ6A 3Q7YA 5D61A 4A7ZA 2ET2A 3I2AA 3FFZA 5DVHA 1WD4A 1FWUA 1MC9A 3RTJB 4H75A 1EVTA 1JT4A 1ONKB 3UD8A 1EV2A 1UPSA 3UD7A 3RMXA 3IIRA 1PWAA 1BLDA 3LTQA 5FZUA 2L5XA 4GP0A 1QXMA 2HZ9A 4EFPA 1IT0A 4X39A 2KH2A 4JKXB 3BA4A 2D44A 1TIEA 4FGFA 4I1BA 3RTIB 4KBBA 4LO0C 3Q7WA 2FGFA 3FJEA 4P0LA 3A21A 1W3GA 5FNXA 3HOMA 2BEAA 2HWAA 4ZBVB 2Y9XE 1ISXA 2MC2A 3AKHA 4IY8A 5F8YA 5BP5C 4X3AA 4UY4A 4HJJA 3A23A 3JRRA 1W3FA 4XFTA 3LLPA 1TOOA 4QD2B 1S0GA 1V6VA 1JT3A 2IHOA 4I96A 4OEFA 8I1BA 3OGGA 2LIQA 3CAHA 4GP3A 1G9DA 2KI4A 3OJVA 3WO3A 1L2HA 2I1BA 4IY9A 3UJ0A 3T8SA 3FJBA 4IZXA 1RG8A 1XHBA 3FJDA 1ITBA 3K1XA 1NZKA 4GAFA 2VXRA 3ZXDA 1JLYA 4L4IA 4LO1A 5EHAA 1A8DA 1BFFA 4XFSA 5DSSB 3N7MA 4Q9PA 1YBIA 2Y9GA 4GAIA 4G9NA 3WO4A 1FQ9A 3AH2A 3CA0A 3E8LC 3OJMA 3BX1C 5FZZA 3AKIA 3D7WB 5BXPA 3HMYA 9ILBA 3BB2A 5BVPI 1HIBA 1YYNA 2P23A 4LO3A 3BAVA 1Z4SA 2E4MA 1Q04A 1ISVA 1PZZA 3HN1A 4ZFUB 2Y9WC 1IILA 3F1RA 4EB2B 1HWOB 1XYFA 4J2SA 3FUOA 4Z8SB 1SR4C 2D22A 2KLLA 4I37A 2FDBM 1FGAA 4CJMA 5DUYA 4I7IA 2NTDA 4QKSA 4R6UB 5HPZA 1P63A 2DREA 4F83A 3Q7XA 3R4SA 21BIA 1E0OA 6I1BA 2QYIB 3PUBA 1SZ6B 4AN6A 2F2FA 3O4BA 5BXTA 3NJ5A 5B2HA 1AF9A 2R9KB 3IM5A 2AAIB 2KI6B 4LO7C 4A7YA 3VSZA 2D43A 3FGMA 4J23B 3V79C 4Q91A 3H6SE 4IONA 4KC3A 4J2YA 3AH4A 2NM1A 1AVUA 4EFRA 2X2TA 3BADA 3FJFA 4II0A 1S0CA 2IWTB 4QO3A 2M49A 5BQUC 4OEGA 41BIA 3B9UA 4I4YA 1S0BA 1I1BA 3O49A 3S8JA 4QALA 3N7KA 1Q03A 2HW9A 3P53A 4X37A 1HKNA 1TTUA 5JMCA 3CA3A 3I29B 3FJIA 1OQLB 1AVWB 3V0AB 1K5VA 1M16A 4GOYA 4X38A 4G6JA 3O4CA 3CA5A 2VSAA 1NUNA 3BAOA 4AN7B 4ZGRB 3BAQA 3HSMA 2VSEA 3IAGC 1QQKA 3AJ5A 1ISWA 3NBEA 1IJTA 2ZR1B 3KMVA 4IZEA 1FMZA 3N7JA 1FN0A 2P39A 4I6IA 1CE7B 4ZOTA 1FV3A 4IQPA 2NS2A 1AVXB 1RY7A 3H6RB 4DENA 1DQGA 1G9CA 3FJ8A 4G9MA 1ISZA 1HWPB 1JY0A 2ZQOA 3V0AA 1ABRB 3CA6A 3FJCA 3POKA 3FJ9A 4OWKA 5FNWA 4FVVA 4I8MA 1XZZA 3OBTA 1ISYA 4OEEA 3O3QA 4D8HA 1RZOB 31BIA 1S0EA 4ZLBB 3AKFA 3BRDA 2F8XC 1Z0HA 3UJ4A 3N0KA 3WMVA 1IRPA 4OWLA 3ZXGA 4I4SA 1BFGA 1TWMA 3WINA 3H6QA 3VT1A 3QR5A 3AZWA 7I1BA 4H04A 1WBCA 2WBCA 1S0DA 1K5UA 2AQZA 3OJ2A 3H6RA 4LO2A 1FMMS 2RQ9A 4MZHA 4ISQA 4QKRA 5DZUA 4ZFWB 3F62B 2DS0A 4IHZA 3RMYA 1IRAX 2Z48A 1S0FA 3BTAA 5D63A 1AVAC 1IOBA 5F8SA 1V6UA 1HWNB 1R8OA 5F90A 3QYDA 3IM7A 3NBNA 1QQLA 1DFCA 1G82A 4EFQA 3BA7A 2DRYA 4JQ0A 1FWVA 1VCLA 3NBDA 1JT5A 1WD3A 1YTOA 3PG0A 3HALA 1T9FA 4LO0A 4G1RA 3UDAA 3W9TA 1GGPB 3CA4A 2VUAA 4KEIA 3VUOA 1TP0A 3BAUA 3ZC8A 2GZBA 3O4OA 4J2XA 1DZDA 1BLAA 3WMUA 2J3PA 2ESUA 3FJAA 1JLXA 1EPWA 5BP5A 4JKQA 4G6MA 1HWMB 2RSTA 4JRAA 5BXSA 1TWEA 2Q9XA 5FZYA 2UUSA 1KNMA 2FFVA 2Z49A 1BFCA 3CRHA 4YOLA 2D7IA 5EC5A 1Q1UA 3VWCA 1HCEA 4PC4A 3R4UA 1AFCA 1MD6A 3TC2A 1J0SA 1XG6A 1BFBA 1M2TB 1R8NA 4QD2C 5D62A 4WBCA 3VT2A 1AXMA 4LO3C 2LIEA 4D0ZA 3WA1A 1DJSB 2AXMA 2MLLB 4Q9GA 2FFUA 1G9BA 3V0BB 3SNVA 2YUGA 4D0TA 1RMLA 1W3AA 1FV2A 1EYLA 2GO2A 1I1EA 4I4PA 3WO2A 3O4DA 3BRGC 4Z9WB 1WBAA 2ERMA 3IM6A 1JTCA 5BXRA 1V6WA 4P0JA 1DQOA 2NYYA 1JT7A 1JQZA 2VXTI 4JAWA 1V6XA 3A07A 1PUUB 3P6JA 4HR6C 4LO7B 4I3NA 3CA1A 1YF8B 4GOVA 3CQAA 1SR4A 2VU9A 2Q3NB 2K43A 2FO1A 1CVSA 2NVHA 2F2FC 4I2SA 3VSFA 3BA5A 1T4QA 1G9AA 3V0BA 1TFMB 5GAQA 2NZ9A 2AFGA 2HWMA 3N7LA 4I4OA 4MZFB 4I1EA 4ENDA 2BEBA 3PMEA 2K8RA 1BARA 5EG6C 1BA7A 4DCKC 2K4AB 2VLCA 3FUQA 4QC4A 3FJJA 4OW4A 4KEKA 4I4UA 3VT0A 3I2XA 3BAGA 3S8KA 3O4AA 4P0KA 3VEQA 3CRGA 4H9WA 3MALA 2KKIA 1II4A 2ZQNA 4ZKTB 2DRZA 1F31A 5BQUA 4I4VA 4QBCA 3ZX7A 4TLPA 2D23A 4ZFYB 2QN4A 4I4QA 3O44A 3CU1B 1IHKA 4KEJA 2D20A 5JLVA 4I0YA 3AZVA 2Y9FA 1YXWA 3OGFA 1BASA 4XFUA 4USOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CRI A;  4EEE B;  3A22 A;  1DIW A;  4USP A;  4JPZ A;  1ILR 1;  3ILA A;  3O5W B;  1HCD A;  3AKG A;  4ISR A;  4A7K A;  1DZC A;  3P6I A;  3PHZ A;  1DLL A;  2X2S A;  4J2K A;  4L4H A;  3UD9 A;  4IYB A;  5E24 E;  2MIB A;  5I1B A;  1PUM B;  3ZC9 A;  5F8W A;  1N4K A;  5G00 A;  1S0L A;  4P6A A;  4QBV A;  2XOA A;  4LO1 C;  5BOW A;  3HBW A;  2D1Z A;  4XKI A;  4HA2 A;  4OUJ A;  3EF2 A;  2RG9 B;  4I4R A;  3BRF A;  3RSJ A;  1D0H A;  3AH1 A;  3BAH A;  4OWJ A;  4EKX B;  4ZA3 B;  3WIN C;  1Z2V A;  3FJK A;  4I4X A;  4LO8 B;  2D24 A;  3C9Z A;  3JUT A;  3OBR A;  2WRY A;  4LO2 C;  4DEP A;  1DFQ A;  3NBC A;  2BFH A;  2E4M C;  1PC8 B;  4JP0 A;  3FJH A;  2D7R A;  4F34 A;  2NP0 A;  3MPP G;  3AJ6 A;  3Q7Y A;  5D61 A;  4A7Z A;  2ET2 A;  3I2A A;  3FFZ A;  5DVH A;  1WD4 A;  1FWU A;  1MC9 A;  3RTJ B;  1EVT A;  1JT4 A;  1ONK B;  3UD8 A;  1EV2 A;  1UPS A;  3UD7 A;  3RMX A;  3IIR A;  1PWA A;  1BLD A;  3LTQ A;  5FZU A;  2L5X A;  4GP0 A;  1QXM A;  2HZ9 A;  4EFP A;  1IT0 A;  4X39 A;  2KH2 A;  4JKX B;  3BA4 A;  2D44 A;  1TIE A;  4FGF A;  4I1B A;  3RTI B;  4KBB A;  4LO0 C;  3Q7W A;  2FGF A;  3FJE A;  4P0L A;  3A21 A;  1W3G A;  5FNX A;  3HOM A;  2BEA A;  2HWA A;  4ZBV B;  2Y9X E;  1ISX A;  2MC2 A;  3AKH A;  4IY8 A;  5F8Y A;  5BP5 C;  4X3A A;  4HJJ A;  3A23 A;  3JRR A;  1W3F A;  4XFT A;  3LLP A;  1TOO A;  4QD2 B;  1S0G A;  1V6V A;  1JT3 A;  2IHO A;  4I96 A;  4OEF A;  8I1B A;  3OGG A;  2LIQ A;  3CAH A;  4GP3 A;  1G9D A;  2KI4 A;  3OJV A;  3WO3 A;  1L2H A;  2I1B A;  4IY9 A;  3UJ0 A;  3T8S A;  3FJB A;  4IZX A;  1RG8 A;  1XHB A;  3FJD A;  1ITB A;  3K1X A;  1NZK A;  4GAF A;  2VXR A;  3ZXD A;  1JLY A;  4L4I A;  4LO1 A;  5EHA A;  1A8D A;  1BFF A;  4XFS A;  5DSS B;  3N7M A;  4Q9P A;  1YBI A;  2Y9G A;  4GAI A;  4G9N A;  3WO4 A;  1FQ9 A;  3AH2 A;  3CA0 A;  3E8L C;  3OJM A;  3BX1 C;  5FZZ A;  3AKI A;  3D7W B;  5BXP A;  3HMY A;  9ILB A;  3BB2 A;  5BVP I;  1HIB A;  1YYN A;  2P23 A;  4LO3 A;  3BAV A;  1Z4S A;  2E4M A;  1Q04 A;  1ISV A;  1PZZ A;  3HN1 A;  4ZFU B;  2Y9W C;  1IIL A;  3F1R A;  4EB2 B;  1HWO B;  1XYF A;  4J2S A;  3FUO A;  4Z8S B;  1SR4 C;  2D22 A;  2KLL A;  4I37 A;  2FDB M;  1FGA A;  4CJM A;  5DUY A;  4I7I A;  2NTD A;  4QKS A;  4R6U B;  5HPZ A;  1P63 A;  2DRE A;  4F83 A;  3Q7X A;  3R4S A;  21BI A;  1E0O A;  6I1B A;  2QYI B;  3PUB A;  1SZ6 B;  4AN6 A;  2F2F A;  3O4B A;  5BXT A;  3NJ5 A;  5B2H A;  1AF9 A;  2R9K B;  3IM5 A;  2AAI B;  2KI6 B;  4LO7 C;  4A7Y A;  3VSZ A;  2D43 A;  3FGM A;  4J23 B;  3V79 C;  4Q91 A;  3H6S E;  4ION A;  4KC3 A;  4J2Y A;  3AH4 A;  2NM1 A;  1AVU A;  4EFR A;  2X2T A;  3BAD A;  3FJF A;  4II0 A;  1S0C A;  2IWT B;  4QO3 A;  2M49 A;  5BQU C;  4OEG A;  41BI A;  3B9U A;  4I4Y A;  1S0B A;  1I1B A;  3O49 A;  3S8J A;  4QAL A;  3N7K A;  1Q03 A;  2HW9 A;  3P53 A;  4X37 A;  1HKN A;  1TTU A;  5JMC A;  3CA3 A;  3I29 B;  3FJI A;  1OQL B;  1AVW B;  3V0A B;  1K5V A;  1M16 A;  4GOY A;  4X38 A;  4G6J A;  3O4C A;  3CA5 A;  2VSA A;  1NUN A;  3BAO A;  4AN7 B;  4ZGR B;  3BAQ A;  3HSM A;  2VSE A;  3IAG C;  1QQK A;  3AJ5 A;  1ISW A;  3NBE A;  1IJT A;  2ZR1 B;  3KMV A;  4IZE A;  1FMZ A;  3N7J A;  1FN0 A;  2P39 A;  4I6I A;  1CE7 B;  4ZOT A;  1FV3 A;  4IQP A;  1AVX B;  1RY7 A;  3H6R B;  4DEN A;  1DQG A;  1G9C A;  3FJ8 A;  4G9M A;  1ISZ A;  1HWP B;  1JY0 A;  2ZQO A;  3V0A A;  1ABR B;  3CA6 A;  3FJC A;  3POK A;  3FJ9 A;  4OWK A;  5FNW A;  4FVV A;  4I8M A;  1XZZ A;  3OBT A;  1ISY A;  4OEE A;  3O3Q A;  4D8H A;  1RZO B;  31BI A;  1S0E A;  4ZLB B;  3AKF A;  3BRD A;  2F8X C;  1Z0H A;  3UJ4 A;  3N0K A;  3WMV A;  1IRP A;  4OWL A;  3ZXG A;  4I4S A;  1BFG A;  1TWM A;  3WIN A;  3H6Q A;  3VT1 A;  3QR5 A;  3AZW A;  7I1B A;  4H04 A;  1WBC A;  2WBC A;  1S0D A;  1K5U A;  2AQZ A;  3OJ2 A;  3H6R A;  4LO2 A;  1FMM S;  2RQ9 A;  4ISQ A;  4QKR A;  5DZU A;  4ZFW B;  3F62 B;  2DS0 A;  4IHZ A;  3RMY A;  1IRA X;  2Z48 A;  1S0F A;  3BTA A;  5D63 A;  1AVA C;  1IOB A;  5F8S A;  1V6U A;  1HWN B;  1R8O A;  5F90 A;  3QYD A;  3IM7 A;  3NBN A;  1QQL A;  1DFC A;  1G82 A;  4EFQ A;  3BA7 A;  2DRY A;  4JQ0 A;  1FWV A;  1VCL A;  3NBD A;  1JT5 A;  1WD3 A;  1YTO A;  3PG0 A;  3HAL A;  1T9F A;  4LO0 A;  4G1R A;  3UDA A;  3W9T A;  1GGP B;  3CA4 A;  2VUA A;  4KEI A;  3VUO A;  1TP0 A;  3BAU A;  3ZC8 A;  2GZB A;  3O4O A;  4J2X A;  1DZD A;  1BLA A;  3WMU A;  2J3P A;  2ESU A;  3FJA A;  1JLX A;  1EPW A;  5BP5 A;  4JKQ A;  4G6M A;  1HWM B;  2RST A;  4JRA A;  5BXS A;  1TWE A;  2Q9X A;  5FZY A;  2UUS A;  1KNM A;  2FFV A;  2Z49 A;  1BFC A;  3CRH A;  4YOL A;  2D7I A;  5EC5 A;  1Q1U A;  3VWC A;  1HCE A;  4PC4 A;  3R4U A;  1AFC A;  1MD6 A;  3TC2 A;  1J0S A;  1XG6 A;  1BFB A;  1M2T B;  1R8N A;  4QD2 C;  5D62 A;  4WBC A;  3VT2 A;  1AXM A;  4LO3 C;  2LIE A;  4D0Z A;  3WA1 A;  1DJS B;  2AXM A;  2MLL B;  4Q9G A;  2FFU A;  1G9B A;  3V0B B;  3SNV A;  2YUG A;  4D0T A;  1RML A;  1W3A A;  1FV2 A;  1EYL A;  2GO2 A;  1I1E A;  4I4P A;  3WO2 A;  3O4D A;  3BRG C;  4Z9W B;  1WBA A;  2ERM A;  3IM6 A;  1JTC A;  5BXR A;  1V6W A;  4P0J A;  1DQO A;  2NYY A;  1JT7 A;  1JQZ A;  2VXT I;  4JAW A;  1V6X A;  3A07 A;  1PUU B;  3P6J A;  4HR6 C;  4LO7 B;  4I3N A;  3CA1 A;  1YF8 B;  4GOV A;  3CQA A;  1SR4 A;  2VU9 A;  2Q3N B;  2K43 A;  2FO1 A;  1CVS A;  2NVH A;  2F2F C;  4I2S A;  3VSF A;  3BA5 A;  1T4Q A;  1G9A A;  3V0B A;  1TFM B;  5GAQ A;  2NZ9 A;  2AFG A;  2HWM A;  3N7L A;  4I4O A;  4I1E A;  4END A;  2BEB A;  3PME A;  2K8R A;  1BAR A;  5EG6 C;  1BA7 A;  4DCK C;  2K4A B;  2VLC A;  3FUQ A;  4QC4 A;  3FJJ A;  4OW4 A;  4KEK A;  4I4U A;  3VT0 A;  3I2X A;  3BAG A;  3S8K A;  3O4A A;  4P0K A;  3VEQ A;  3CRG A;  4H9W A;  3MAL A;  2KKI A;  1II4 A;  2ZQN A;  4ZKT B;  2DRZ A;  1F31 A;  5BQU A;  4I4V A;  4QBC A;  3ZX7 A;  4TLP A;  2D23 A;  4ZFY B;  2QN4 A;  4I4Q A;  3O44 A;  3CU1 B;  1IHK A;  4KEJ A;  2D20 A;  5JLV A;  4I0Y A;  3AZV A;  2Y9F A;  1YXW A;  3OGF A;  1BAS A;  4XFU A;  4USO A; 
#chains in the Genus database with same CATH topology
 3CRI A;  4EEE B;  3A22 A;  4MZG B;  1DIW A;  4USP A;  4JPZ A;  1ILR 1;  3ILA A;  3O5W B;  1HCD A;  3AKG A;  4ISR A;  4A7K A;  1DZC A;  3P6I A;  3PHZ A;  1DLL A;  2X2S A;  4J2K A;  4L4H A;  3UD9 A;  4IYB A;  5E24 E;  2MIB A;  5I1B A;  1PUM B;  3ZC9 A;  5F8W A;  1N4K A;  5G00 A;  1S0L A;  4P6A A;  4QBV A;  2XOA A;  4LO1 C;  5BOW A;  3HBW A;  2D1Z A;  4XKI A;  4HA2 A;  4OUJ A;  3EF2 A;  2RG9 B;  4I4R A;  3BRF A;  3RSJ A;  1D0H A;  3AH1 A;  3BAH A;  4OWJ A;  4EKX B;  4ZA3 B;  3WIN C;  1Z2V A;  3FJK A;  4I4X A;  4LO8 B;  2D24 A;  3C9Z A;  3JUT A;  3OBR A;  2WRY A;  4LO2 C;  4DEP A;  1DFQ A;  3NBC A;  2BFH A;  2E4M C;  1PC8 B;  4JP0 A;  3FJH A;  2D7R A;  4F34 A;  2NP0 A;  3MPP G;  3AJ6 A;  3Q7Y A;  5D61 A;  4A7Z A;  2ET2 A;  3I2A A;  3FFZ A;  5DVH A;  1WD4 A;  1FWU A;  1MC9 A;  3RTJ B;  4H75 A;  1EVT A;  1JT4 A;  1ONK B;  3UD8 A;  1EV2 A;  1UPS A;  3UD7 A;  3RMX A;  3IIR A;  1PWA A;  1BLD A;  3LTQ A;  5FZU A;  2L5X A;  4GP0 A;  1QXM A;  2HZ9 A;  4EFP A;  1IT0 A;  4X39 A;  2KH2 A;  4JKX B;  3BA4 A;  2D44 A;  1TIE A;  4FGF A;  4I1B A;  3RTI B;  4KBB A;  4LO0 C;  3Q7W A;  2FGF A;  3FJE A;  4P0L A;  3A21 A;  1W3G A;  5FNX A;  3HOM A;  2BEA A;  2HWA A;  4ZBV B;  2Y9X E;  1ISX A;  2MC2 A;  3AKH A;  4IY8 A;  5F8Y A;  5BP5 C;  4X3A A;  4UY4 A;  4HJJ A;  3A23 A;  3JRR A;  1W3F A;  4XFT A;  3LLP A;  1TOO A;  4QD2 B;  1S0G A;  1V6V A;  1JT3 A;  2IHO A;  4I96 A;  4OEF A;  8I1B A;  3OGG A;  2LIQ A;  3CAH A;  4GP3 A;  1G9D A;  2KI4 A;  3OJV A;  3WO3 A;  1L2H A;  2I1B A;  4IY9 A;  3UJ0 A;  3T8S A;  3FJB A;  4IZX A;  1RG8 A;  1XHB A;  3FJD A;  1ITB A;  3K1X A;  1NZK A;  4GAF A;  2VXR A;  3ZXD A;  1JLY A;  4L4I A;  4LO1 A;  5EHA A;  1A8D A;  1BFF A;  4XFS A;  5DSS B;  3N7M A;  4Q9P A;  1YBI A;  2Y9G A;  4GAI A;  4G9N A;  3WO4 A;  1FQ9 A;  3AH2 A;  3CA0 A;  3E8L C;  3OJM A;  3BX1 C;  5FZZ A;  3AKI A;  3D7W B;  5BXP A;  3HMY A;  9ILB A;  3BB2 A;  5BVP I;  1HIB A;  1YYN A;  2P23 A;  4LO3 A;  3BAV A;  1Z4S A;  2E4M A;  1Q04 A;  1ISV A;  1PZZ A;  3HN1 A;  4ZFU B;  2Y9W C;  1IIL A;  3F1R A;  4EB2 B;  1HWO B;  1XYF A;  4J2S A;  3FUO A;  4Z8S B;  1SR4 C;  2D22 A;  2KLL A;  4I37 A;  2FDB M;  1FGA A;  4CJM A;  5DUY A;  4I7I A;  2NTD A;  4QKS A;  4R6U B;  5HPZ A;  1P63 A;  2DRE A;  4F83 A;  3Q7X A;  3R4S A;  21BI A;  1E0O A;  6I1B A;  2QYI B;  3PUB A;  1SZ6 B;  4AN6 A;  2F2F A;  3O4B A;  5BXT A;  3NJ5 A;  5B2H A;  1AF9 A;  2R9K B;  3IM5 A;  2AAI B;  2KI6 B;  4LO7 C;  4A7Y A;  3VSZ A;  2D43 A;  3FGM A;  4J23 B;  3V79 C;  4Q91 A;  3H6S E;  4ION A;  4KC3 A;  4J2Y A;  3AH4 A;  2NM1 A;  1AVU A;  4EFR A;  2X2T A;  3BAD A;  3FJF A;  4II0 A;  1S0C A;  2IWT B;  4QO3 A;  2M49 A;  5BQU C;  4OEG A;  41BI A;  3B9U A;  4I4Y A;  1S0B A;  1I1B A;  3O49 A;  3S8J A;  4QAL A;  3N7K A;  1Q03 A;  2HW9 A;  3P53 A;  4X37 A;  1HKN A;  1TTU A;  5JMC A;  3CA3 A;  3I29 B;  3FJI A;  1OQL B;  1AVW B;  3V0A B;  1K5V A;  1M16 A;  4GOY A;  4X38 A;  4G6J A;  3O4C A;  3CA5 A;  2VSA A;  1NUN A;  3BAO A;  4AN7 B;  4ZGR B;  3BAQ A;  3HSM A;  2VSE A;  3IAG C;  1QQK A;  3AJ5 A;  1ISW A;  3NBE A;  1IJT A;  2ZR1 B;  3KMV A;  4IZE A;  1FMZ A;  3N7J A;  1FN0 A;  2P39 A;  4I6I A;  1CE7 B;  4ZOT A;  1FV3 A;  4IQP A;  2NS2 A;  1AVX B;  1RY7 A;  3H6R B;  4DEN A;  1DQG A;  1G9C A;  3FJ8 A;  4G9M A;  1ISZ A;  1HWP B;  1JY0 A;  2ZQO A;  3V0A A;  1ABR B;  3CA6 A;  3FJC A;  3POK A;  3FJ9 A;  4OWK A;  5FNW A;  4FVV A;  4I8M A;  1XZZ A;  3OBT A;  1ISY A;  4OEE A;  3O3Q A;  4D8H A;  1RZO B;  31BI A;  1S0E A;  4ZLB B;  3AKF A;  3BRD A;  2F8X C;  1Z0H A;  3UJ4 A;  3N0K A;  3WMV A;  1IRP A;  4OWL A;  3ZXG A;  4I4S A;  1BFG A;  1TWM A;  3WIN A;  3H6Q A;  3VT1 A;  3QR5 A;  3AZW A;  7I1B A;  4H04 A;  1WBC A;  2WBC A;  1S0D A;  1K5U A;  2AQZ A;  3OJ2 A;  3H6R A;  4LO2 A;  1FMM S;  2RQ9 A;  4MZH A;  4ISQ A;  4QKR A;  5DZU A;  4ZFW B;  3F62 B;  2DS0 A;  4IHZ A;  3RMY A;  1IRA X;  2Z48 A;  1S0F A;  3BTA A;  5D63 A;  1AVA C;  1IOB A;  5F8S A;  1V6U A;  1HWN B;  1R8O A;  5F90 A;  3QYD A;  3IM7 A;  3NBN A;  1QQL A;  1DFC A;  1G82 A;  4EFQ A;  3BA7 A;  2DRY A;  4JQ0 A;  1FWV A;  1VCL A;  3NBD A;  1JT5 A;  1WD3 A;  1YTO A;  3PG0 A;  3HAL A;  1T9F A;  4LO0 A;  4G1R A;  3UDA A;  3W9T A;  1GGP B;  3CA4 A;  2VUA A;  4KEI A;  3VUO A;  1TP0 A;  3BAU A;  3ZC8 A;  2GZB A;  3O4O A;  4J2X A;  1DZD A;  1BLA A;  3WMU A;  2J3P A;  2ESU A;  3FJA A;  1JLX A;  1EPW A;  5BP5 A;  4JKQ A;  4G6M A;  1HWM B;  2RST A;  4JRA A;  5BXS A;  1TWE A;  2Q9X A;  5FZY A;  2UUS A;  1KNM A;  2FFV A;  2Z49 A;  1BFC A;  3CRH A;  4YOL A;  2D7I A;  5EC5 A;  1Q1U A;  3VWC A;  1HCE A;  4PC4 A;  3R4U A;  1AFC A;  1MD6 A;  3TC2 A;  1J0S A;  1XG6 A;  1BFB A;  1M2T B;  1R8N A;  4QD2 C;  5D62 A;  4WBC A;  3VT2 A;  1AXM A;  4LO3 C;  2LIE A;  4D0Z A;  3WA1 A;  1DJS B;  2AXM A;  2MLL B;  4Q9G A;  2FFU A;  1G9B A;  3V0B B;  3SNV A;  2YUG A;  4D0T A;  1RML A;  1W3A A;  1FV2 A;  1EYL A;  2GO2 A;  1I1E A;  4I4P A;  3WO2 A;  3O4D A;  3BRG C;  4Z9W B;  1WBA A;  2ERM A;  3IM6 A;  1JTC A;  5BXR A;  1V6W A;  4P0J A;  1DQO A;  2NYY A;  1JT7 A;  1JQZ A;  2VXT I;  4JAW A;  1V6X A;  3A07 A;  1PUU B;  3P6J A;  4HR6 C;  4LO7 B;  4I3N A;  3CA1 A;  1YF8 B;  4GOV A;  3CQA A;  1SR4 A;  2VU9 A;  2Q3N B;  2K43 A;  2FO1 A;  1CVS A;  2NVH A;  2F2F C;  4I2S A;  3VSF A;  3BA5 A;  1T4Q A;  1G9A A;  3V0B A;  1TFM B;  5GAQ A;  2NZ9 A;  2AFG A;  2HWM A;  3N7L A;  4I4O A;  4MZF B;  4I1E A;  4END A;  2BEB A;  3PME A;  2K8R A;  1BAR A;  5EG6 C;  1BA7 A;  4DCK C;  2K4A B;  2VLC A;  3FUQ A;  4QC4 A;  3FJJ A;  4OW4 A;  4KEK A;  4I4U A;  3VT0 A;  3I2X A;  3BAG A;  3S8K A;  3O4A A;  4P0K A;  3VEQ A;  3CRG A;  4H9W A;  3MAL A;  2KKI A;  1II4 A;  2ZQN A;  4ZKT B;  2DRZ A;  1F31 A;  5BQU A;  4I4V A;  4QBC A;  3ZX7 A;  4TLP A;  2D23 A;  4ZFY B;  2QN4 A;  4I4Q A;  3O44 A;  3CU1 B;  1IHK A;  4KEJ A;  2D20 A;  5JLV A;  4I0Y A;  3AZV A;  2Y9F A;  1YXW A;  3OGF A;  1BAS A;  4XFU A;  4USO A; 
#chains in the Genus database with same CATH homology
 3CRI A;  4EEE B;  3A22 A;  4MZG B;  1DIW A;  4USP A;  4JPZ A;  1ILR 1;  3ILA A;  3O5W B;  1HCD A;  3AKG A;  4ISR A;  4A7K A;  1DZC A;  3P6I A;  3PHZ A;  1DLL A;  2X2S A;  4J2K A;  4L4H A;  3UD9 A;  4IYB A;  5E24 E;  2MIB A;  5I1B A;  1PUM B;  3ZC9 A;  5F8W A;  1N4K A;  5G00 A;  1S0L A;  4P6A A;  4QBV A;  2XOA A;  4LO1 C;  5BOW A;  3HBW A;  2D1Z A;  4XKI A;  4HA2 A;  4OUJ A;  3EF2 A;  2RG9 B;  4I4R A;  3BRF A;  3RSJ A;  1D0H A;  3AH1 A;  3BAH A;  4OWJ A;  4EKX B;  4ZA3 B;  3WIN C;  1Z2V A;  3FJK A;  4I4X A;  4LO8 B;  2D24 A;  3C9Z A;  3JUT A;  3OBR A;  2WRY A;  4LO2 C;  4DEP A;  1DFQ A;  3NBC A;  2BFH A;  2E4M C;  1PC8 B;  4JP0 A;  3FJH A;  2D7R A;  4F34 A;  2NP0 A;  3MPP G;  3AJ6 A;  3Q7Y A;  5D61 A;  4A7Z A;  2ET2 A;  3I2A A;  3FFZ A;  5DVH A;  1WD4 A;  1FWU A;  1MC9 A;  3RTJ B;  4H75 A;  1EVT A;  1JT4 A;  1ONK B;  3UD8 A;  1EV2 A;  1UPS A;  3UD7 A;  3RMX A;  3IIR A;  1PWA A;  1BLD A;  3LTQ A;  5FZU A;  2L5X A;  4GP0 A;  1QXM A;  2HZ9 A;  4EFP A;  1IT0 A;  4X39 A;  2KH2 A;  4JKX B;  3BA4 A;  2D44 A;  1TIE A;  4FGF A;  4I1B A;  3RTI B;  4KBB A;  4LO0 C;  3Q7W A;  2FGF A;  3FJE A;  4P0L A;  3A21 A;  1W3G A;  5FNX A;  3HOM A;  2BEA A;  2HWA A;  4ZBV B;  2Y9X E;  1ISX A;  2MC2 A;  3AKH A;  4IY8 A;  5F8Y A;  5BP5 C;  4X3A A;  4UY4 A;  4HJJ A;  3A23 A;  3JRR A;  1W3F A;  4XFT A;  3LLP A;  1TOO A;  4QD2 B;  1S0G A;  1V6V A;  1JT3 A;  2IHO A;  4I96 A;  4OEF A;  8I1B A;  3OGG A;  2LIQ A;  3CAH A;  4GP3 A;  1G9D A;  2KI4 A;  3OJV A;  3WO3 A;  1L2H A;  2I1B A;  4IY9 A;  3UJ0 A;  3T8S A;  3FJB A;  4IZX A;  1RG8 A;  1XHB A;  3FJD A;  1ITB A;  3K1X A;  1NZK A;  4GAF A;  2VXR A;  3ZXD A;  1JLY A;  4L4I A;  4LO1 A;  5EHA A;  1A8D A;  1BFF A;  4XFS A;  5DSS B;  3N7M A;  4Q9P A;  1YBI A;  2Y9G A;  4GAI A;  4G9N A;  3WO4 A;  1FQ9 A;  3AH2 A;  3CA0 A;  3E8L C;  3OJM A;  3BX1 C;  5FZZ A;  3AKI A;  3D7W B;  5BXP A;  3HMY A;  9ILB A;  3BB2 A;  5BVP I;  1HIB A;  1YYN A;  2P23 A;  4LO3 A;  3BAV A;  1Z4S A;  2E4M A;  1Q04 A;  1ISV A;  1PZZ A;  3HN1 A;  4ZFU B;  2Y9W C;  1IIL A;  3F1R A;  4EB2 B;  1HWO B;  1XYF A;  4J2S A;  3FUO A;  4Z8S B;  1SR4 C;  2D22 A;  2KLL A;  4I37 A;  2FDB M;  1FGA A;  4CJM A;  5DUY A;  4I7I A;  2NTD A;  4QKS A;  4R6U B;  5HPZ A;  1P63 A;  2DRE A;  4F83 A;  3Q7X A;  3R4S A;  21BI A;  1E0O A;  6I1B A;  2QYI B;  3PUB A;  1SZ6 B;  4AN6 A;  2F2F A;  3O4B A;  5BXT A;  3NJ5 A;  5B2H A;  1AF9 A;  2R9K B;  3IM5 A;  2AAI B;  2KI6 B;  4LO7 C;  4A7Y A;  3VSZ A;  2D43 A;  3FGM A;  4J23 B;  3V79 C;  4Q91 A;  3H6S E;  4ION A;  4KC3 A;  4J2Y A;  3AH4 A;  2NM1 A;  1AVU A;  4EFR A;  2X2T A;  3BAD A;  3FJF A;  4II0 A;  1S0C A;  2IWT B;  4QO3 A;  2M49 A;  5BQU C;  4OEG A;  41BI A;  3B9U A;  4I4Y A;  1S0B A;  1I1B A;  3O49 A;  3S8J A;  4QAL A;  3N7K A;  1Q03 A;  2HW9 A;  3P53 A;  4X37 A;  1HKN A;  1TTU A;  5JMC A;  3CA3 A;  3I29 B;  3FJI A;  1OQL B;  1AVW B;  3V0A B;  1K5V A;  1M16 A;  4GOY A;  4X38 A;  4G6J A;  3O4C A;  3CA5 A;  2VSA A;  1NUN A;  3BAO A;  4AN7 B;  4ZGR B;  3BAQ A;  3HSM A;  2VSE A;  3IAG C;  1QQK A;  3AJ5 A;  1ISW A;  3NBE A;  1IJT A;  2ZR1 B;  3KMV A;  4IZE A;  1FMZ A;  3N7J A;  1FN0 A;  2P39 A;  4I6I A;  1CE7 B;  4ZOT A;  1FV3 A;  4IQP A;  2NS2 A;  1AVX B;  1RY7 A;  3H6R B;  4DEN A;  1DQG A;  1G9C A;  3FJ8 A;  4G9M A;  1ISZ A;  1HWP B;  1JY0 A;  2ZQO A;  3V0A A;  1ABR B;  3CA6 A;  3FJC A;  3POK A;  3FJ9 A;  4OWK A;  5FNW A;  4FVV A;  4I8M A;  1XZZ A;  3OBT A;  1ISY A;  4OEE A;  3O3Q A;  4D8H A;  1RZO B;  31BI A;  1S0E A;  4ZLB B;  3AKF A;  3BRD A;  2F8X C;  1Z0H A;  3UJ4 A;  3N0K A;  3WMV A;  1IRP A;  4OWL A;  3ZXG A;  4I4S A;  1BFG A;  1TWM A;  3WIN A;  3H6Q A;  3VT1 A;  3QR5 A;  3AZW A;  7I1B A;  4H04 A;  1WBC A;  2WBC A;  1S0D A;  1K5U A;  2AQZ A;  3OJ2 A;  3H6R A;  4LO2 A;  1FMM S;  2RQ9 A;  4MZH A;  4ISQ A;  4QKR A;  5DZU A;  4ZFW B;  3F62 B;  2DS0 A;  4IHZ A;  3RMY A;  1IRA X;  2Z48 A;  1S0F A;  3BTA A;  5D63 A;  1AVA C;  1IOB A;  5F8S A;  1V6U A;  1HWN B;  1R8O A;  5F90 A;  3QYD A;  3IM7 A;  3NBN A;  1QQL A;  1DFC A;  1G82 A;  4EFQ A;  3BA7 A;  2DRY A;  4JQ0 A;  1FWV A;  1VCL A;  3NBD A;  1JT5 A;  1WD3 A;  1YTO A;  3PG0 A;  3HAL A;  1T9F A;  4LO0 A;  4G1R A;  3UDA A;  3W9T A;  1GGP B;  3CA4 A;  2VUA A;  4KEI A;  3VUO A;  1TP0 A;  3BAU A;  3ZC8 A;  2GZB A;  3O4O A;  4J2X A;  1DZD A;  1BLA A;  3WMU A;  2J3P A;  2ESU A;  3FJA A;  1JLX A;  1EPW A;  5BP5 A;  4JKQ A;  4G6M A;  1HWM B;  2RST A;  4JRA A;  5BXS A;  1TWE A;  2Q9X A;  5FZY A;  2UUS A;  1KNM A;  2FFV A;  2Z49 A;  1BFC A;  3CRH A;  4YOL A;  2D7I A;  5EC5 A;  1Q1U A;  3VWC A;  1HCE A;  4PC4 A;  3R4U A;  1AFC A;  1MD6 A;  3TC2 A;  1J0S A;  1XG6 A;  1BFB A;  1M2T B;  1R8N A;  4QD2 C;  5D62 A;  4WBC A;  3VT2 A;  1AXM A;  4LO3 C;  2LIE A;  4D0Z A;  3WA1 A;  1DJS B;  2AXM A;  2MLL B;  4Q9G A;  2FFU A;  1G9B A;  3V0B B;  3SNV A;  2YUG A;  4D0T A;  1RML A;  1W3A A;  1FV2 A;  1EYL A;  2GO2 A;  1I1E A;  4I4P A;  3WO2 A;  3O4D A;  3BRG C;  4Z9W B;  1WBA A;  2ERM A;  3IM6 A;  1JTC A;  5BXR A;  1V6W A;  4P0J A;  1DQO A;  2NYY A;  1JT7 A;  1JQZ A;  2VXT I;  4JAW A;  1V6X A;  3A07 A;  1PUU B;  3P6J A;  4HR6 C;  4LO7 B;  4I3N A;  3CA1 A;  1YF8 B;  4GOV A;  3CQA A;  1SR4 A;  2VU9 A;  2Q3N B;  2K43 A;  2FO1 A;  1CVS A;  2NVH A;  2F2F C;  4I2S A;  3VSF A;  3BA5 A;  1T4Q A;  1G9A A;  3V0B A;  1TFM B;  5GAQ A;  2NZ9 A;  2AFG A;  2HWM A;  3N7L A;  4I4O A;  4MZF B;  4I1E A;  4END A;  2BEB A;  3PME A;  2K8R A;  1BAR A;  5EG6 C;  1BA7 A;  4DCK C;  2K4A B;  2VLC A;  3FUQ A;  4QC4 A;  3FJJ A;  4OW4 A;  4KEK A;  4I4U A;  3VT0 A;  3I2X A;  3BAG A;  3S8K A;  3O4A A;  4P0K A;  3VEQ A;  3CRG A;  4H9W A;  3MAL A;  2KKI A;  1II4 A;  2ZQN A;  4ZKT B;  2DRZ A;  1F31 A;  5BQU A;  4I4V A;  4QBC A;  3ZX7 A;  4TLP A;  2D23 A;  4ZFY B;  2QN4 A;  4I4Q A;  3O44 A;  3CU1 B;  1IHK A;  4KEJ A;  2D20 A;  5JLV A;  4I0Y A;  3AZV A;  2Y9F A;  1YXW A;  3OGF A;  1BAS A;  4XFU A;  4USO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...