4X3AA

Gallus interleukin-1 beta mutant - r140a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
159
structure length
147
Chain Sequence
AFRYTRSQSFDIFDINQKCFVLESPTQLVALHLQSSQKVRLNIALYRPRQMPVALGIKGYKLYMSCVMSGTEPTLQLEEADVMRDIDSVELTRFIFYRLDSPTEGTTRFESAAFPGWFICTSLQPAQPVGITNQPDQVNIATYKLSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title gallus interleukin-1 beta mutant - R140A
rcsb
molecule keywords IL-1 beta
molecule tags Immune system
source organism Gallus gallus
total genus 30
structure length 147
sequence length 159
ec nomenclature
pdb deposition date 2014-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4x3aA00
3V0BA 3BAVA 4ISRA 2ZR1B 2D20A 3MALA 1EVTA 2ET2A 3BADA 5BQUC 1AFCA 4QD2B 3OJMA 3O5WB 2Z49A 3V79C 4I4UA 2D44A 1NZKA 4QKSA 4L4HA 4D0ZA 2RG9B 1FV3A 3AKHA 1W3GA 2E4MA 4H9WA 1M16A 1RY7A 3AJ6A 4LO3A 4D0TA 3WO2A 6I1BA 1K5UA 4JRAA 21BIA 4IY9A 3O4CA 3BAOA 1J0SA 2M49A 3WA1A 1KNMA 5D63A 1FWVA 5BXTA 2NM1A 3HBWA 2MLLB 2F8XC 3N7KA 1ISXA 4XFTA 3S8KA 1OQLB 3AH1A 2D22A 4TLPA 3H6SE 3O4AA 1MD6A 3N7JA 1DIWA 4LO7B 2F2FA 3O44A 3BAHA 3BTAA 3F62B 1S0LA 4A7KA 3RTIB 4WBCA 4I4QA 3ILAA 3UD9A 3VT0A 4ZLBB 3D7WB 7I1BA 4ZBVB 1IRPA 3NJ5A 2DRYA 2D23A 3H6RA 3IM7A 3PG0A 1V6WA 3B9UA 4HR6C 3PUBA 1JY0A 2Q9XA 3MPPG 4ZFUB 5G00A 4I1BA 1PWAA 1PC8B 4OEGA 1QQKA 2GZBA 3VT1A 4EB2B 1Q04A 4J23B 1W3AA 1T9FA 4EEEB 2VSEA 1TTUA 3UD8A 3FJ9A 3FJCA 2UUSA 1FV2A 2KI4A 2HZ9A 4G9MA 3AKFA 4EFRA 4A7ZA 1N4KA 3OBTA 5BXPA 2FFUA 3T8SA 4P0LA 1TIEA 3WMUA 5JMCA 5I1BA 3FJ8A 3CA3A 4I4OA 3CA1A 1BARA 3HMYA 3NBEA 2YUGA 3F1RA 3BRGC 4I4RA 2Y9WC 4OEEA 3S8JA 3CRIA 3RMXA 4DCKC 3FUQA 4DEPA 4LO1A 2BEAA 4ZGRB 1IILA 3P53A 4P0KA 4X37A 3OGFA 1WD4A 4I4SA 3OJ2A 1DFQA 4I8MA 4Z9WB 3FJEA 3BB2A 2KI6B 4X38A 4Z8SB 1BFCA 4KEJA 2D7IA 4ZOTA 3E8LC 1UPSA 4LO0C 2X2TA 4QC4A 1BLAA 3BRDA 1HIBA 2I1BA 3I2AA 4IZXA 2Y9FA 2AAIB 2VUAA 3ZC8A 5DUYA 5DZUA 3JRRA 2BFHA 1D0HA 1XG6A 1P63A 4KC3A 4IHZA 4I6IA 2ZQNA 3Q7WA 1Z0HA 3FJAA 4ZFWB 4X3AA 3N7LA 4IY8A 5BQUA 4GP3A 4FGFA 4Q9GA 5FZUA 3KMVA 4FVVA 5HPZA 8I1BA 5DVHA 3RTJB 4LO2C 3HOMA 3FJBA 3IIRA 1Q1UA 1HWNB 4LO7C 3UDAA 1AVUA 5BXRA 2AQZA 3A21A 1JLYA 5BOWA 4I4YA 4R6UB 3EF2A 3PHZA 1JT5A 1HCEA 1EV2A 3BAGA 3CAHA 3FGMA 4OW4A 4QBCA 2D7RA 1EPWA 1V6XA 4AN7B 1TWEA 2K43A 2NTDA 2RSTA 3ZC9A 41BIA 5FNWA 5JLVA 3A22A 4GOVA 5F8SA 3OGGA 3FJIA 3UJ4A 4USOA 3N7MA 4PC4A 4ZFYB 2XOAA 3A23A 2KLLA 3BA4A 1R8NA 3CQAA 1Z4SA 3I2XA 1II4A 1ILR1 3PMEA 3FJDA 3WO4A 3BAQA 1RZOB 3NBDA 2HW9A 1TWMA 1R8OA 1SZ6B 4OWJA 3TC2A 4I37A 3AJ5A 5BP5C 3AH4A 2IWTB 1AVAC 4G9NA 4AN6A 1FGAA 1DZDA 4JQ0A 1T4QA 2D1ZA 4OEFA 5F8YA 3WO3A 1RMLA 2QN4A 4G6MA 4KEKA 3H6RB 2NZ9A 3AZWA 2VSAA 2WBCA 3HSMA 5EG6C 1AVXB 1SR4A 3R4UA 1CVSA 3O3QA 2KKIA 1FMZA 1I1BA 1FMMS 3BX1C 5B2HA 3RMYA 2QYIB 4I96A 5E24E 1Z2VA 2VLCA 4I0YA 1VCLA 3CA5A 2FO1A 3BA7A 4L4IA 2AFGA 4J2YA 3RSJA 2VXRA 1AVWB 1DZCA 4J2XA 3LLPA 1TFMB 1ABRB 1S0BA 2Q3NB 1IT0A 1HWOB 3A07A 4JKQA 4OUJA 1TOOA 2ESUA 31BIA 3FJFA 3LTQA 3AKIA 4XKIA 3SNVA 2X2SA 4I1EA 4ENDA 1IOBA 9ILBA 1YXWA 1F31A 1FQ9A 1G9DA 2BEBA 4USPA 3FJJA 1WBCA 1BASA 4LO0A 4J2SA 1I1EA 1DQOA 1WBAA 1W3FA 1L2HA 1MC9A 1JTCA 4GOYA 4IZEA 4EKXB 2LIQA 2FGFA 2HWMA 4A7YA 2Y9XE 3WINC 3VUOA 3OBRA 2P39A 3FUOA 3V0AB 3CRHA 5DSSB 2LIEA 1YBIA 4GAFA 1JQZA 4II0A 1BLDA 3R4SA 4Q9PA 4HJJA 4D8HA 1G9AA 1YF8B 1S0DA 3O49A 5EC5A 1AXMA 3POKA 5FZYA 2NYYA 3VSFA 4LO8B 1IJTA 4OWLA 1M2TB 2P23A 2D43A 4LO2A 1PUMB 3CA0A 1V6VA 1FN0A 1PUUB 1WD3A 3C9ZA 3V0BB 3FJKA 1DLLA 4HA2A 5GAQA 1JLXA 1PZZA 1QXMA 4DENA 2E4MC 5F8WA 2KH2A 1YYNA 4LO3C 2HWAA 3VWCA 1CE7B 4YOLA 2FDBM 4I4PA 1G9CA 4XFSA 1ONKB 5FNXA 1IRAX 4KBBA 4P0JA 1JT7A 5BVPI 3ZXGA 1XZZA 1G82A 2K8RA 3Q7XA 3IM6A 2NVHA 1ISZA 1XHBA 2MIBA 1YTOA 1RG8A 1E0OA 4QALA 2ZQOA 2F2FC 3HN1A 2MC2A 2DREA 2J3PA 1QQLA 4JAWA 1HWMB 1A8DA 4EFPA 3O4DA 3AKGA 1S0CA 4X39A 3VEQA 1TP0A 3AH2A 3NBNA 4ISQA 4I3NA 3ZXDA 5BP5A 1ISVA 2Z48A 4Q91A 1HCDA 2ERMA 2RQ9A 3CA4A 3UJ0A 3P6JA 1S0GA 1AF9A 4JKXB 1BFGA 5EHAA 4QO3A 5D62A 3NBCA 3I29B 4EFQA 1NUNA 2K4AB 4CJMA 2WRYA 1BFFA 4ZA3B 2GO2A 2Y9GA 2VXTI 1S0FA 2AXMA 1JT4A 2DRZA 2VU9A 3K1XA 3CU1B 1K5VA 3ZX7A 5FZZA 1ISYA 4F34A 4JP0A 4IQPA 3QYDA 3CRGA 4F83A 3BA5A 1SR4C 1HKNA 3N0KA 4J2KA 3CA6A 1DJSB 4I4VA 1GGPB 4QKRA 2DS0A 3QR5A 3HALA 1ISWA 5D61A 1XYFA 4LO1C 4QBVA 1V6UA 1BFBA 4H04A 3IM5A 4ZKTB 3BRFA 1ITBA 4G1RA 4I4XA 3WMVA 4XFUA 1DQGA 3BAUA 3Q7YA 3H6QA 5F90A 3VSZA 3VT2A 4GP0A 4KEIA 3W9TA 3AZVA 4P6AA 2FFVA 4I7IA 1S0EA 2L5XA 3IAGC 4IYBA 2R9KB 3O4OA 3V0AA 1DFCA 1FWUA 3OJVA 4JPZA 2IHOA 1EYLA 1Q03A 1G9BA 4GAIA 1BA7A 1JT3A 3O4BA 4G6JA 4OWKA 5BXSA 4I2SA 3UD7A 4QD2C 4IONA 3WINA 3FFZA 2D24A 3JUTA 2NP0A 1IHKA 1HWPB 3P6IA 3FJHA
chains in the Genus database with same CATH superfamily
3V0BA 3BAVA 4ISRA 2ZR1B 2D20A 3MALA 1EVTA 2ET2A 3BADA 5BQUC 1AFCA 4QD2B 3OJMA 3O5WB 2Z49A 3V79C 4I4UA 2D44A 1NZKA 4QKSA 4L4HA 4D0ZA 2RG9B 1FV3A 3AKHA 1W3GA 2E4MA 4H9WA 4H75A 4MZGB 1M16A 1RY7A 3AJ6A 4LO3A 4D0TA 3WO2A 6I1BA 1K5UA 4JRAA 21BIA 4IY9A 3O4CA 3BAOA 1J0SA 2M49A 3WA1A 1KNMA 5D63A 1FWVA 5BXTA 2NM1A 3HBWA 2MLLB 2F8XC 3N7KA 1ISXA 4XFTA 3S8KA 1OQLB 3AH1A 2D22A 4TLPA 3H6SE 3O4AA 1MD6A 3N7JA 1DIWA 4LO7B 2F2FA 3O44A 3BAHA 3BTAA 3F62B 1S0LA 4A7KA 3RTIB 4WBCA 4I4QA 3ILAA 3UD9A 3VT0A 4ZLBB 3D7WB 7I1BA 4ZBVB 1IRPA 3NJ5A 2DRYA 2D23A 3H6RA 3IM7A 3PG0A 1V6WA 3B9UA 4HR6C 3PUBA 1JY0A 2Q9XA 3MPPG 4ZFUB 5G00A 4I1BA 1PWAA 1PC8B 4OEGA 1QQKA 2GZBA 3VT1A 4EB2B 1Q04A 4J23B 1W3AA 1T9FA 4EEEB 2VSEA 1TTUA 3UD8A 3FJ9A 3FJCA 2UUSA 1FV2A 2KI4A 2HZ9A 4G9MA 3AKFA 4EFRA 4A7ZA 1N4KA 3OBTA 5BXPA 2FFUA 3T8SA 4P0LA 1TIEA 3WMUA 5JMCA 5I1BA 3FJ8A 3CA3A 4I4OA 3CA1A 1BARA 3HMYA 3NBEA 2YUGA 3F1RA 3BRGC 4I4RA 2Y9WC 4OEEA 3S8JA 3CRIA 3RMXA 4DCKC 3FUQA 4DEPA 4LO1A 2BEAA 4ZGRB 1IILA 3P53A 4P0KA 4X37A 3OGFA 1WD4A 4I4SA 3OJ2A 1DFQA 4I8MA 4Z9WB 3FJEA 3BB2A 2KI6B 4X38A 4Z8SB 1BFCA 4KEJA 2D7IA 4ZOTA 3E8LC 1UPSA 4LO0C 2X2TA 4QC4A 1BLAA 3BRDA 1HIBA 2I1BA 3I2AA 4IZXA 2Y9FA 2AAIB 2VUAA 3ZC8A 5DUYA 5DZUA 3JRRA 2BFHA 1D0HA 1XG6A 2NS2A 1P63A 4KC3A 4IHZA 4I6IA 2ZQNA 4UY4A 3Q7WA 1Z0HA 3FJAA 4ZFWB 4X3AA 3N7LA 4IY8A 5BQUA 4GP3A 4FGFA 4Q9GA 5FZUA 3KMVA 4FVVA 5HPZA 8I1BA 5DVHA 3RTJB 4LO2C 3HOMA 3FJBA 3IIRA 1Q1UA 1HWNB 4LO7C 3UDAA 1AVUA 5BXRA 2AQZA 3A21A 1JLYA 5BOWA 4I4YA 4R6UB 3EF2A 3PHZA 4MZFB 1JT5A 1HCEA 1EV2A 3BAGA 3CAHA 3FGMA 4OW4A 4QBCA 2D7RA 1EPWA 1V6XA 4AN7B 1TWEA 2K43A 2NTDA 2RSTA 3ZC9A 41BIA 5FNWA 5JLVA 3A22A 4GOVA 5F8SA 3OGGA 3FJIA 3UJ4A 4USOA 3N7MA 4PC4A 4ZFYB 2XOAA 3A23A 2KLLA 3BA4A 1R8NA 3CQAA 1Z4SA 3I2XA 1II4A 1ILR1 3PMEA 3FJDA 3WO4A 3BAQA 1RZOB 3NBDA 2HW9A 1TWMA 1R8OA 1SZ6B 4OWJA 3TC2A 4I37A 3AJ5A 5BP5C 3AH4A 2IWTB 1AVAC 4G9NA 4AN6A 1FGAA 1DZDA 4JQ0A 1T4QA 2D1ZA 4OEFA 5F8YA 3WO3A 1RMLA 2QN4A 4G6MA 4KEKA 3H6RB 2NZ9A 3AZWA 2VSAA 2WBCA 3HSMA 5EG6C 1AVXB 1SR4A 3R4UA 1CVSA 3O3QA 2KKIA 1FMZA 1I1BA 1FMMS 3BX1C 5B2HA 3RMYA 2QYIB 4I96A 5E24E 1Z2VA 2VLCA 4I0YA 1VCLA 3CA5A 2FO1A 3BA7A 4L4IA 2AFGA 4J2YA 3RSJA 2VXRA 1AVWB 1DZCA 4J2XA 3LLPA 1TFMB 1ABRB 1S0BA 2Q3NB 1IT0A 1HWOB 3A07A 4JKQA 4OUJA 1TOOA 2ESUA 31BIA 3FJFA 3LTQA 3AKIA 4XKIA 3SNVA 2X2SA 4I1EA 4ENDA 1IOBA 9ILBA 1YXWA 1F31A 1FQ9A 1G9DA 2BEBA 4USPA 3FJJA 1WBCA 1BASA 4LO0A 4J2SA 1I1EA 1DQOA 1WBAA 1W3FA 1L2HA 1MC9A 1JTCA 4GOYA 4IZEA 4EKXB 2LIQA 2FGFA 2HWMA 4A7YA 2Y9XE 3WINC 3VUOA 3OBRA 2P39A 3FUOA 3V0AB 3CRHA 5DSSB 2LIEA 1YBIA 4GAFA 1JQZA 4II0A 1BLDA 3R4SA 4Q9PA 4HJJA 4D8HA 1G9AA 1YF8B 1S0DA 3O49A 5EC5A 1AXMA 3POKA 5FZYA 2NYYA 3VSFA 4LO8B 1IJTA 4OWLA 1M2TB 2P23A 2D43A 4LO2A 1PUMB 3CA0A 1V6VA 1FN0A 1PUUB 1WD3A 3C9ZA 3V0BB 3FJKA 1DLLA 4HA2A 5GAQA 1JLXA 1PZZA 1QXMA 4DENA 2E4MC 5F8WA 2KH2A 1YYNA 4LO3C 2HWAA 3VWCA 1CE7B 4YOLA 2FDBM 4I4PA 1G9CA 4XFSA 1ONKB 5FNXA 1IRAX 4KBBA 4P0JA 1JT7A 5BVPI 3ZXGA 1XZZA 1G82A 2K8RA 3Q7XA 3IM6A 2NVHA 1ISZA 1XHBA 2MIBA 1YTOA 1RG8A 1E0OA 4QALA 2ZQOA 2F2FC 3HN1A 2MC2A 2DREA 2J3PA 1QQLA 4JAWA 1HWMB 1A8DA 4EFPA 3O4DA 3AKGA 1S0CA 4X39A 3VEQA 1TP0A 3AH2A 3NBNA 4ISQA 4I3NA 3ZXDA 5BP5A 1ISVA 2Z48A 4Q91A 1HCDA 2ERMA 2RQ9A 3CA4A 3UJ0A 3P6JA 1S0GA 1AF9A 4JKXB 1BFGA 5EHAA 4QO3A 5D62A 3NBCA 3I29B 4EFQA 1NUNA 4MZHA 2K4AB 4CJMA 2WRYA 1BFFA 4ZA3B 2GO2A 2Y9GA 2VXTI 1S0FA 2AXMA 1JT4A 2DRZA 2VU9A 3K1XA 3CU1B 1K5VA 3ZX7A 5FZZA 1ISYA 4F34A 4JP0A 4IQPA 3QYDA 3CRGA 4F83A 3BA5A 1SR4C 1HKNA 3N0KA 4J2KA 3CA6A 1DJSB 4I4VA 1GGPB 4QKRA 2DS0A 3QR5A 3HALA 1ISWA 5D61A 1XYFA 4LO1C 4QBVA 1V6UA 1BFBA 4H04A 3IM5A 4ZKTB 3BRFA 1ITBA 4G1RA 4I4XA 3WMVA 4XFUA 1DQGA 3BAUA 3Q7YA 3H6QA 5F90A 3VSZA 3VT2A 4GP0A 4KEIA 3W9TA 3AZVA 4P6AA 2FFVA 4I7IA 1S0EA 2L5XA 3IAGC 4IYBA 2R9KB 3O4OA 3V0AA 1DFCA 1FWUA 3OJVA 4JPZA 2IHOA 1EYLA 1Q03A 1G9BA 4GAIA 1BA7A 1JT3A 3O4BA 4G6JA 4OWKA 5BXSA 4I2SA 3UD7A 4QD2C 4IONA 3WINA 3FFZA 2D24A 3JUTA 2NP0A 1IHKA 1HWPB 3P6IA 3FJHA
chains in the Genus database with same CATH topology
3V0BA 3BAVA 4ISRA 2ZR1B 2D20A 3MALA 1EVTA 2ET2A 3BADA 5BQUC 1AFCA 4QD2B 3OJMA 3O5WB 2Z49A 3V79C 4I4UA 2D44A 1NZKA 4QKSA 4L4HA 4D0ZA 2RG9B 1FV3A 3AKHA 1W3GA 2E4MA 4H9WA 4H75A 4MZGB 1M16A 1RY7A 3AJ6A 4LO3A 4D0TA 3WO2A 6I1BA 1K5UA 4JRAA 21BIA 4IY9A 3O4CA 3BAOA 1J0SA 2M49A 3WA1A 1KNMA 5D63A 1FWVA 5BXTA 2NM1A 3HBWA 2MLLB 2F8XC 3N7KA 1ISXA 4XFTA 3S8KA 1OQLB 3AH1A 2D22A 4TLPA 3H6SE 3O4AA 1MD6A 3N7JA 1DIWA 4LO7B 2F2FA 3O44A 3BAHA 3BTAA 3F62B 1S0LA 4A7KA 3RTIB 4WBCA 4I4QA 3ILAA 3UD9A 3VT0A 4ZLBB 3D7WB 7I1BA 4ZBVB 1IRPA 3NJ5A 2DRYA 2D23A 3H6RA 3IM7A 3PG0A 1V6WA 3B9UA 4HR6C 3PUBA 1JY0A 2Q9XA 3MPPG 4ZFUB 5G00A 4I1BA 1PWAA 1PC8B 4OEGA 1QQKA 2GZBA 3VT1A 4EB2B 1Q04A 4J23B 1W3AA 1T9FA 4EEEB 2VSEA 1TTUA 3UD8A 3FJ9A 3FJCA 2UUSA 1FV2A 2KI4A 2HZ9A 4G9MA 3AKFA 4EFRA 4A7ZA 1N4KA 3OBTA 5BXPA 2FFUA 3T8SA 4P0LA 1TIEA 3WMUA 5JMCA 5I1BA 3FJ8A 3CA3A 4I4OA 3CA1A 1BARA 3HMYA 3NBEA 2YUGA 3F1RA 3BRGC 4I4RA 2Y9WC 4OEEA 3S8JA 3CRIA 3RMXA 4DCKC 3FUQA 4DEPA 4LO1A 2BEAA 4ZGRB 1IILA 3P53A 4P0KA 4X37A 3OGFA 1WD4A 4I4SA 3OJ2A 1DFQA 4I8MA 4Z9WB 3FJEA 3BB2A 2KI6B 4X38A 4Z8SB 1BFCA 4KEJA 2D7IA 4ZOTA 3E8LC 1UPSA 4LO0C 2X2TA 4QC4A 1BLAA 3BRDA 1HIBA 2I1BA 3I2AA 4IZXA 2Y9FA 2AAIB 2VUAA 3ZC8A 5DUYA 5DZUA 3JRRA 2BFHA 1D0HA 1XG6A 2NS2A 1P63A 4KC3A 4IHZA 4I6IA 2ZQNA 4UY4A 3Q7WA 1Z0HA 3FJAA 4ZFWB 4X3AA 3N7LA 4IY8A 5BQUA 4GP3A 4FGFA 4Q9GA 5FZUA 3KMVA 4FVVA 5HPZA 8I1BA 5DVHA 3RTJB 4LO2C 3HOMA 3FJBA 3IIRA 1Q1UA 1HWNB 4LO7C 3UDAA 1AVUA 5BXRA 2AQZA 3A21A 1JLYA 5BOWA 4I4YA 4R6UB 3EF2A 3PHZA 4MZFB 1JT5A 1HCEA 1EV2A 3BAGA 3CAHA 3FGMA 4OW4A 4QBCA 2D7RA 1EPWA 1V6XA 4AN7B 1TWEA 2K43A 2NTDA 2RSTA 3ZC9A 41BIA 5FNWA 5JLVA 3A22A 4GOVA 5F8SA 3OGGA 3FJIA 3UJ4A 4USOA 3N7MA 4PC4A 4ZFYB 2XOAA 3A23A 2KLLA 3BA4A 1R8NA 3CQAA 1Z4SA 3I2XA 1II4A 1ILR1 3PMEA 3FJDA 3WO4A 3BAQA 1RZOB 3NBDA 2HW9A 1TWMA 1R8OA 1SZ6B 4OWJA 3TC2A 4I37A 3AJ5A 5BP5C 3AH4A 2IWTB 1AVAC 4G9NA 4AN6A 1FGAA 1DZDA 4JQ0A 1T4QA 2D1ZA 4OEFA 5F8YA 3WO3A 1RMLA 2QN4A 4G6MA 4KEKA 3H6RB 2NZ9A 3AZWA 2VSAA 2WBCA 3HSMA 5EG6C 1AVXB 1SR4A 3R4UA 1CVSA 3O3QA 2KKIA 1FMZA 1I1BA 1FMMS 3BX1C 5B2HA 3RMYA 2QYIB 4I96A 5E24E 1Z2VA 2VLCA 4I0YA 1VCLA 3CA5A 2FO1A 3BA7A 4L4IA 2AFGA 4J2YA 3RSJA 2VXRA 1AVWB 1DZCA 4J2XA 3LLPA 1TFMB 1ABRB 1S0BA 2Q3NB 1IT0A 1HWOB 3A07A 4JKQA 4OUJA 1TOOA 2ESUA 31BIA 3FJFA 3LTQA 3AKIA 4XKIA 3SNVA 2X2SA 4I1EA 4ENDA 1IOBA 9ILBA 1YXWA 1F31A 1FQ9A 1G9DA 2BEBA 4USPA 3FJJA 1WBCA 1BASA 4LO0A 4J2SA 1I1EA 1DQOA 1WBAA 1W3FA 1L2HA 1MC9A 1JTCA 4GOYA 4IZEA 4EKXB 2LIQA 2FGFA 2HWMA 4A7YA 2Y9XE 3WINC 3VUOA 3OBRA 2P39A 3FUOA 3V0AB 3CRHA 5DSSB 2LIEA 1YBIA 4GAFA 1JQZA 4II0A 1BLDA 3R4SA 4Q9PA 4HJJA 4D8HA 1G9AA 1YF8B 1S0DA 3O49A 5EC5A 1AXMA 3POKA 5FZYA 2NYYA 3VSFA 4LO8B 1IJTA 4OWLA 1M2TB 2P23A 2D43A 4LO2A 1PUMB 3CA0A 1V6VA 1FN0A 1PUUB 1WD3A 3C9ZA 3V0BB 3FJKA 1DLLA 4HA2A 5GAQA 1JLXA 1PZZA 1QXMA 4DENA 2E4MC 5F8WA 2KH2A 1YYNA 4LO3C 2HWAA 3VWCA 1CE7B 4YOLA 2FDBM 4I4PA 1G9CA 4XFSA 1ONKB 5FNXA 1IRAX 4KBBA 4P0JA 1JT7A 5BVPI 3ZXGA 1XZZA 1G82A 2K8RA 3Q7XA 3IM6A 2NVHA 1ISZA 1XHBA 2MIBA 1YTOA 1RG8A 1E0OA 4QALA 2ZQOA 2F2FC 3HN1A 2MC2A 2DREA 2J3PA 1QQLA 4JAWA 1HWMB 1A8DA 4EFPA 3O4DA 3AKGA 1S0CA 4X39A 3VEQA 1TP0A 3AH2A 3NBNA 4ISQA 4I3NA 3ZXDA 5BP5A 1ISVA 2Z48A 4Q91A 1HCDA 2ERMA 2RQ9A 3CA4A 3UJ0A 3P6JA 1S0GA 1AF9A 4JKXB 1BFGA 5EHAA 4QO3A 5D62A 3NBCA 3I29B 4EFQA 1NUNA 4MZHA 2K4AB 4CJMA 2WRYA 1BFFA 4ZA3B 2GO2A 2Y9GA 2VXTI 1S0FA 2AXMA 1JT4A 2DRZA 2VU9A 3K1XA 3CU1B 1K5VA 3ZX7A 5FZZA 1ISYA 4F34A 4JP0A 4IQPA 3QYDA 3CRGA 4F83A 3BA5A 1SR4C 1HKNA 3N0KA 4J2KA 3CA6A 1DJSB 4I4VA 1GGPB 4QKRA 2DS0A 3QR5A 3HALA 1ISWA 5D61A 1XYFA 4LO1C 4QBVA 1V6UA 1BFBA 4H04A 3IM5A 4ZKTB 3BRFA 1ITBA 4G1RA 4I4XA 3WMVA 4XFUA 1DQGA 3BAUA 3Q7YA 3H6QA 5F90A 3VSZA 3VT2A 4GP0A 4KEIA 3W9TA 3AZVA 4P6AA 2FFVA 4I7IA 1S0EA 2L5XA 3IAGC 4IYBA 2R9KB 3O4OA 3V0AA 1DFCA 1FWUA 3OJVA 4JPZA 2IHOA 1EYLA 1Q03A 1G9BA 4GAIA 1BA7A 1JT3A 3O4BA 4G6JA 4OWKA 5BXSA 4I2SA 3UD7A 4QD2C 4IONA 3WINA 3FFZA 2D24A 3JUTA 2NP0A 1IHKA 1HWPB 3P6IA 3FJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V0B A;  3BAV A;  4ISR A;  2ZR1 B;  2D20 A;  3MAL A;  1EVT A;  2ET2 A;  3BAD A;  5BQU C;  1AFC A;  4QD2 B;  3OJM A;  3O5W B;  2Z49 A;  3V79 C;  4I4U A;  2D44 A;  1NZK A;  4QKS A;  4L4H A;  4D0Z A;  2RG9 B;  1FV3 A;  3AKH A;  1W3G A;  2E4M A;  4H9W A;  1M16 A;  1RY7 A;  3AJ6 A;  4LO3 A;  4D0T A;  3WO2 A;  6I1B A;  1K5U A;  4JRA A;  21BI A;  4IY9 A;  3O4C A;  3BAO A;  1J0S A;  2M49 A;  3WA1 A;  1KNM A;  5D63 A;  1FWV A;  5BXT A;  2NM1 A;  3HBW A;  2MLL B;  2F8X C;  3N7K A;  1ISX A;  4XFT A;  3S8K A;  1OQL B;  3AH1 A;  2D22 A;  4TLP A;  3H6S E;  3O4A A;  1MD6 A;  3N7J A;  1DIW A;  4LO7 B;  2F2F A;  3O44 A;  3BAH A;  3BTA A;  3F62 B;  1S0L A;  4A7K A;  3RTI B;  4WBC A;  4I4Q A;  3ILA A;  3UD9 A;  3VT0 A;  4ZLB B;  3D7W B;  7I1B A;  4ZBV B;  1IRP A;  3NJ5 A;  2DRY A;  2D23 A;  3H6R A;  3IM7 A;  3PG0 A;  1V6W A;  3B9U A;  4HR6 C;  3PUB A;  1JY0 A;  2Q9X A;  3MPP G;  4ZFU B;  5G00 A;  4I1B A;  1PWA A;  1PC8 B;  4OEG A;  1QQK A;  2GZB A;  3VT1 A;  4EB2 B;  1Q04 A;  4J23 B;  1W3A A;  1T9F A;  4EEE B;  2VSE A;  1TTU A;  3UD8 A;  3FJ9 A;  3FJC A;  2UUS A;  1FV2 A;  2KI4 A;  2HZ9 A;  4G9M A;  3AKF A;  4EFR A;  4A7Z A;  1N4K A;  3OBT A;  5BXP A;  2FFU A;  3T8S A;  4P0L A;  1TIE A;  3WMU A;  5JMC A;  5I1B A;  3FJ8 A;  3CA3 A;  4I4O A;  3CA1 A;  1BAR A;  3HMY A;  3NBE A;  2YUG A;  3F1R A;  3BRG C;  4I4R A;  2Y9W C;  4OEE A;  3S8J A;  3CRI A;  3RMX A;  4DCK C;  3FUQ A;  4DEP A;  4LO1 A;  2BEA A;  4ZGR B;  1IIL A;  3P53 A;  4P0K A;  4X37 A;  3OGF A;  1WD4 A;  4I4S A;  3OJ2 A;  1DFQ A;  4I8M A;  4Z9W B;  3FJE A;  3BB2 A;  2KI6 B;  4X38 A;  4Z8S B;  1BFC A;  4KEJ A;  2D7I A;  4ZOT A;  3E8L C;  1UPS A;  4LO0 C;  2X2T A;  4QC4 A;  1BLA A;  3BRD A;  1HIB A;  2I1B A;  3I2A A;  4IZX A;  2Y9F A;  2AAI B;  2VUA A;  3ZC8 A;  5DUY A;  5DZU A;  3JRR A;  2BFH A;  1D0H A;  1XG6 A;  1P63 A;  4KC3 A;  4IHZ A;  4I6I A;  2ZQN A;  3Q7W A;  1Z0H A;  3FJA A;  4ZFW B;  4X3A A;  3N7L A;  4IY8 A;  5BQU A;  4GP3 A;  4FGF A;  4Q9G A;  5FZU A;  3KMV A;  4FVV A;  5HPZ A;  8I1B A;  5DVH A;  3RTJ B;  4LO2 C;  3HOM A;  3FJB A;  3IIR A;  1Q1U A;  1HWN B;  4LO7 C;  3UDA A;  1AVU A;  5BXR A;  2AQZ A;  3A21 A;  1JLY A;  5BOW A;  4I4Y A;  4R6U B;  3EF2 A;  3PHZ A;  1JT5 A;  1HCE A;  1EV2 A;  3BAG A;  3CAH A;  3FGM A;  4OW4 A;  4QBC A;  2D7R A;  1EPW A;  1V6X A;  4AN7 B;  1TWE A;  2K43 A;  2NTD A;  2RST A;  3ZC9 A;  41BI A;  5FNW A;  5JLV A;  3A22 A;  4GOV A;  5F8S A;  3OGG A;  3FJI A;  3UJ4 A;  4USO A;  3N7M A;  4PC4 A;  4ZFY B;  2XOA A;  3A23 A;  2KLL A;  3BA4 A;  1R8N A;  3CQA A;  1Z4S A;  3I2X A;  1II4 A;  1ILR 1;  3PME A;  3FJD A;  3WO4 A;  3BAQ A;  1RZO B;  3NBD A;  2HW9 A;  1TWM A;  1R8O A;  1SZ6 B;  4OWJ A;  3TC2 A;  4I37 A;  3AJ5 A;  5BP5 C;  3AH4 A;  2IWT B;  1AVA C;  4G9N A;  4AN6 A;  1FGA A;  1DZD A;  4JQ0 A;  1T4Q A;  2D1Z A;  4OEF A;  5F8Y A;  3WO3 A;  1RML A;  2QN4 A;  4G6M A;  4KEK A;  3H6R B;  2NZ9 A;  3AZW A;  2VSA A;  2WBC A;  3HSM A;  5EG6 C;  1AVX B;  1SR4 A;  3R4U A;  1CVS A;  3O3Q A;  2KKI A;  1FMZ A;  1I1B A;  1FMM S;  3BX1 C;  5B2H A;  3RMY A;  2QYI B;  4I96 A;  5E24 E;  1Z2V A;  2VLC A;  4I0Y A;  1VCL A;  3CA5 A;  2FO1 A;  3BA7 A;  4L4I A;  2AFG A;  4J2Y A;  3RSJ A;  2VXR A;  1AVW B;  1DZC A;  4J2X A;  3LLP A;  1TFM B;  1ABR B;  1S0B A;  2Q3N B;  1IT0 A;  1HWO B;  3A07 A;  4JKQ A;  4OUJ A;  1TOO A;  2ESU A;  31BI A;  3FJF A;  3LTQ A;  3AKI A;  4XKI A;  3SNV A;  2X2S A;  4I1E A;  4END A;  1IOB A;  9ILB A;  1YXW A;  1F31 A;  1FQ9 A;  1G9D A;  2BEB A;  4USP A;  3FJJ A;  1WBC A;  1BAS A;  4LO0 A;  4J2S A;  1I1E A;  1DQO A;  1WBA A;  1W3F A;  1L2H A;  1MC9 A;  1JTC A;  4GOY A;  4IZE A;  4EKX B;  2LIQ A;  2FGF A;  2HWM A;  4A7Y A;  2Y9X E;  3WIN C;  3VUO A;  3OBR A;  2P39 A;  3FUO A;  3V0A B;  3CRH A;  5DSS B;  2LIE A;  1YBI A;  4GAF A;  1JQZ A;  4II0 A;  1BLD A;  3R4S A;  4Q9P A;  4HJJ A;  4D8H A;  1G9A A;  1YF8 B;  1S0D A;  3O49 A;  5EC5 A;  1AXM A;  3POK A;  5FZY A;  2NYY A;  3VSF A;  4LO8 B;  1IJT A;  4OWL A;  1M2T B;  2P23 A;  2D43 A;  4LO2 A;  1PUM B;  3CA0 A;  1V6V A;  1FN0 A;  1PUU B;  1WD3 A;  3C9Z A;  3V0B B;  3FJK A;  1DLL A;  4HA2 A;  5GAQ A;  1JLX A;  1PZZ A;  1QXM A;  4DEN A;  2E4M C;  5F8W A;  2KH2 A;  1YYN A;  4LO3 C;  2HWA A;  3VWC A;  1CE7 B;  4YOL A;  2FDB M;  4I4P A;  1G9C A;  4XFS A;  1ONK B;  5FNX A;  1IRA X;  4KBB A;  4P0J A;  1JT7 A;  5BVP I;  3ZXG A;  1XZZ A;  1G82 A;  2K8R A;  3Q7X A;  3IM6 A;  2NVH A;  1ISZ A;  1XHB A;  2MIB A;  1YTO A;  1RG8 A;  1E0O A;  4QAL A;  2ZQO A;  2F2F C;  3HN1 A;  2MC2 A;  2DRE A;  2J3P A;  1QQL A;  4JAW A;  1HWM B;  1A8D A;  4EFP A;  3O4D A;  3AKG A;  1S0C A;  4X39 A;  3VEQ A;  1TP0 A;  3AH2 A;  3NBN A;  4ISQ A;  4I3N A;  3ZXD A;  5BP5 A;  1ISV A;  2Z48 A;  4Q91 A;  1HCD A;  2ERM A;  2RQ9 A;  3CA4 A;  3UJ0 A;  3P6J A;  1S0G A;  1AF9 A;  4JKX B;  1BFG A;  5EHA A;  4QO3 A;  5D62 A;  3NBC A;  3I29 B;  4EFQ A;  1NUN A;  2K4A B;  4CJM A;  2WRY A;  1BFF A;  4ZA3 B;  2GO2 A;  2Y9G A;  2VXT I;  1S0F A;  2AXM A;  1JT4 A;  2DRZ A;  2VU9 A;  3K1X A;  3CU1 B;  1K5V A;  3ZX7 A;  5FZZ A;  1ISY A;  4F34 A;  4JP0 A;  4IQP A;  3QYD A;  3CRG A;  4F83 A;  3BA5 A;  1SR4 C;  1HKN A;  3N0K A;  4J2K A;  3CA6 A;  1DJS B;  4I4V A;  1GGP B;  4QKR A;  2DS0 A;  3QR5 A;  3HAL A;  1ISW A;  5D61 A;  1XYF A;  4LO1 C;  4QBV A;  1V6U A;  1BFB A;  4H04 A;  3IM5 A;  4ZKT B;  3BRF A;  1ITB A;  4G1R A;  4I4X A;  3WMV A;  4XFU A;  1DQG A;  3BAU A;  3Q7Y A;  3H6Q A;  5F90 A;  3VSZ A;  3VT2 A;  4GP0 A;  4KEI A;  3W9T A;  3AZV A;  4P6A A;  2FFV A;  4I7I A;  1S0E A;  2L5X A;  3IAG C;  4IYB A;  2R9K B;  3O4O A;  3V0A A;  1DFC A;  1FWU A;  3OJV A;  4JPZ A;  2IHO A;  1EYL A;  1Q03 A;  1G9B A;  4GAI A;  1BA7 A;  1JT3 A;  3O4B A;  4G6J A;  4OWK A;  5BXS A;  4I2S A;  3UD7 A;  4QD2 C;  4ION A;  3WIN A;  3FFZ A;  2D24 A;  3JUT A;  2NP0 A;  1IHK A;  1HWP B;  3P6I A;  3FJH A; 
#chains in the Genus database with same CATH topology
 3V0B A;  3BAV A;  4ISR A;  2ZR1 B;  2D20 A;  3MAL A;  1EVT A;  2ET2 A;  3BAD A;  5BQU C;  1AFC A;  4QD2 B;  3OJM A;  3O5W B;  2Z49 A;  3V79 C;  4I4U A;  2D44 A;  1NZK A;  4QKS A;  4L4H A;  4D0Z A;  2RG9 B;  1FV3 A;  3AKH A;  1W3G A;  2E4M A;  4H9W A;  4H75 A;  4MZG B;  1M16 A;  1RY7 A;  3AJ6 A;  4LO3 A;  4D0T A;  3WO2 A;  6I1B A;  1K5U A;  4JRA A;  21BI A;  4IY9 A;  3O4C A;  3BAO A;  1J0S A;  2M49 A;  3WA1 A;  1KNM A;  5D63 A;  1FWV A;  5BXT A;  2NM1 A;  3HBW A;  2MLL B;  2F8X C;  3N7K A;  1ISX A;  4XFT A;  3S8K A;  1OQL B;  3AH1 A;  2D22 A;  4TLP A;  3H6S E;  3O4A A;  1MD6 A;  3N7J A;  1DIW A;  4LO7 B;  2F2F A;  3O44 A;  3BAH A;  3BTA A;  3F62 B;  1S0L A;  4A7K A;  3RTI B;  4WBC A;  4I4Q A;  3ILA A;  3UD9 A;  3VT0 A;  4ZLB B;  3D7W B;  7I1B A;  4ZBV B;  1IRP A;  3NJ5 A;  2DRY A;  2D23 A;  3H6R A;  3IM7 A;  3PG0 A;  1V6W A;  3B9U A;  4HR6 C;  3PUB A;  1JY0 A;  2Q9X A;  3MPP G;  4ZFU B;  5G00 A;  4I1B A;  1PWA A;  1PC8 B;  4OEG A;  1QQK A;  2GZB A;  3VT1 A;  4EB2 B;  1Q04 A;  4J23 B;  1W3A A;  1T9F A;  4EEE B;  2VSE A;  1TTU A;  3UD8 A;  3FJ9 A;  3FJC A;  2UUS A;  1FV2 A;  2KI4 A;  2HZ9 A;  4G9M A;  3AKF A;  4EFR A;  4A7Z A;  1N4K A;  3OBT A;  5BXP A;  2FFU A;  3T8S A;  4P0L A;  1TIE A;  3WMU A;  5JMC A;  5I1B A;  3FJ8 A;  3CA3 A;  4I4O A;  3CA1 A;  1BAR A;  3HMY A;  3NBE A;  2YUG A;  3F1R A;  3BRG C;  4I4R A;  2Y9W C;  4OEE A;  3S8J A;  3CRI A;  3RMX A;  4DCK C;  3FUQ A;  4DEP A;  4LO1 A;  2BEA A;  4ZGR B;  1IIL A;  3P53 A;  4P0K A;  4X37 A;  3OGF A;  1WD4 A;  4I4S A;  3OJ2 A;  1DFQ A;  4I8M A;  4Z9W B;  3FJE A;  3BB2 A;  2KI6 B;  4X38 A;  4Z8S B;  1BFC A;  4KEJ A;  2D7I A;  4ZOT A;  3E8L C;  1UPS A;  4LO0 C;  2X2T A;  4QC4 A;  1BLA A;  3BRD A;  1HIB A;  2I1B A;  3I2A A;  4IZX A;  2Y9F A;  2AAI B;  2VUA A;  3ZC8 A;  5DUY A;  5DZU A;  3JRR A;  2BFH A;  1D0H A;  1XG6 A;  2NS2 A;  1P63 A;  4KC3 A;  4IHZ A;  4I6I A;  2ZQN A;  4UY4 A;  3Q7W A;  1Z0H A;  3FJA A;  4ZFW B;  4X3A A;  3N7L A;  4IY8 A;  5BQU A;  4GP3 A;  4FGF A;  4Q9G A;  5FZU A;  3KMV A;  4FVV A;  5HPZ A;  8I1B A;  5DVH A;  3RTJ B;  4LO2 C;  3HOM A;  3FJB A;  3IIR A;  1Q1U A;  1HWN B;  4LO7 C;  3UDA A;  1AVU A;  5BXR A;  2AQZ A;  3A21 A;  1JLY A;  5BOW A;  4I4Y A;  4R6U B;  3EF2 A;  3PHZ A;  4MZF B;  1JT5 A;  1HCE A;  1EV2 A;  3BAG A;  3CAH A;  3FGM A;  4OW4 A;  4QBC A;  2D7R A;  1EPW A;  1V6X A;  4AN7 B;  1TWE A;  2K43 A;  2NTD A;  2RST A;  3ZC9 A;  41BI A;  5FNW A;  5JLV A;  3A22 A;  4GOV A;  5F8S A;  3OGG A;  3FJI A;  3UJ4 A;  4USO A;  3N7M A;  4PC4 A;  4ZFY B;  2XOA A;  3A23 A;  2KLL A;  3BA4 A;  1R8N A;  3CQA A;  1Z4S A;  3I2X A;  1II4 A;  1ILR 1;  3PME A;  3FJD A;  3WO4 A;  3BAQ A;  1RZO B;  3NBD A;  2HW9 A;  1TWM A;  1R8O A;  1SZ6 B;  4OWJ A;  3TC2 A;  4I37 A;  3AJ5 A;  5BP5 C;  3AH4 A;  2IWT B;  1AVA C;  4G9N A;  4AN6 A;  1FGA A;  1DZD A;  4JQ0 A;  1T4Q A;  2D1Z A;  4OEF A;  5F8Y A;  3WO3 A;  1RML A;  2QN4 A;  4G6M A;  4KEK A;  3H6R B;  2NZ9 A;  3AZW A;  2VSA A;  2WBC A;  3HSM A;  5EG6 C;  1AVX B;  1SR4 A;  3R4U A;  1CVS A;  3O3Q A;  2KKI A;  1FMZ A;  1I1B A;  1FMM S;  3BX1 C;  5B2H A;  3RMY A;  2QYI B;  4I96 A;  5E24 E;  1Z2V A;  2VLC A;  4I0Y A;  1VCL A;  3CA5 A;  2FO1 A;  3BA7 A;  4L4I A;  2AFG A;  4J2Y A;  3RSJ A;  2VXR A;  1AVW B;  1DZC A;  4J2X A;  3LLP A;  1TFM B;  1ABR B;  1S0B A;  2Q3N B;  1IT0 A;  1HWO B;  3A07 A;  4JKQ A;  4OUJ A;  1TOO A;  2ESU A;  31BI A;  3FJF A;  3LTQ A;  3AKI A;  4XKI A;  3SNV A;  2X2S A;  4I1E A;  4END A;  1IOB A;  9ILB A;  1YXW A;  1F31 A;  1FQ9 A;  1G9D A;  2BEB A;  4USP A;  3FJJ A;  1WBC A;  1BAS A;  4LO0 A;  4J2S A;  1I1E A;  1DQO A;  1WBA A;  1W3F A;  1L2H A;  1MC9 A;  1JTC A;  4GOY A;  4IZE A;  4EKX B;  2LIQ A;  2FGF A;  2HWM A;  4A7Y A;  2Y9X E;  3WIN C;  3VUO A;  3OBR A;  2P39 A;  3FUO A;  3V0A B;  3CRH A;  5DSS B;  2LIE A;  1YBI A;  4GAF A;  1JQZ A;  4II0 A;  1BLD A;  3R4S A;  4Q9P A;  4HJJ A;  4D8H A;  1G9A A;  1YF8 B;  1S0D A;  3O49 A;  5EC5 A;  1AXM A;  3POK A;  5FZY A;  2NYY A;  3VSF A;  4LO8 B;  1IJT A;  4OWL A;  1M2T B;  2P23 A;  2D43 A;  4LO2 A;  1PUM B;  3CA0 A;  1V6V A;  1FN0 A;  1PUU B;  1WD3 A;  3C9Z A;  3V0B B;  3FJK A;  1DLL A;  4HA2 A;  5GAQ A;  1JLX A;  1PZZ A;  1QXM A;  4DEN A;  2E4M C;  5F8W A;  2KH2 A;  1YYN A;  4LO3 C;  2HWA A;  3VWC A;  1CE7 B;  4YOL A;  2FDB M;  4I4P A;  1G9C A;  4XFS A;  1ONK B;  5FNX A;  1IRA X;  4KBB A;  4P0J A;  1JT7 A;  5BVP I;  3ZXG A;  1XZZ A;  1G82 A;  2K8R A;  3Q7X A;  3IM6 A;  2NVH A;  1ISZ A;  1XHB A;  2MIB A;  1YTO A;  1RG8 A;  1E0O A;  4QAL A;  2ZQO A;  2F2F C;  3HN1 A;  2MC2 A;  2DRE A;  2J3P A;  1QQL A;  4JAW A;  1HWM B;  1A8D A;  4EFP A;  3O4D A;  3AKG A;  1S0C A;  4X39 A;  3VEQ A;  1TP0 A;  3AH2 A;  3NBN A;  4ISQ A;  4I3N A;  3ZXD A;  5BP5 A;  1ISV A;  2Z48 A;  4Q91 A;  1HCD A;  2ERM A;  2RQ9 A;  3CA4 A;  3UJ0 A;  3P6J A;  1S0G A;  1AF9 A;  4JKX B;  1BFG A;  5EHA A;  4QO3 A;  5D62 A;  3NBC A;  3I29 B;  4EFQ A;  1NUN A;  4MZH A;  2K4A B;  4CJM A;  2WRY A;  1BFF A;  4ZA3 B;  2GO2 A;  2Y9G A;  2VXT I;  1S0F A;  2AXM A;  1JT4 A;  2DRZ A;  2VU9 A;  3K1X A;  3CU1 B;  1K5V A;  3ZX7 A;  5FZZ A;  1ISY A;  4F34 A;  4JP0 A;  4IQP A;  3QYD A;  3CRG A;  4F83 A;  3BA5 A;  1SR4 C;  1HKN A;  3N0K A;  4J2K A;  3CA6 A;  1DJS B;  4I4V A;  1GGP B;  4QKR A;  2DS0 A;  3QR5 A;  3HAL A;  1ISW A;  5D61 A;  1XYF A;  4LO1 C;  4QBV A;  1V6U A;  1BFB A;  4H04 A;  3IM5 A;  4ZKT B;  3BRF A;  1ITB A;  4G1R A;  4I4X A;  3WMV A;  4XFU A;  1DQG A;  3BAU A;  3Q7Y A;  3H6Q A;  5F90 A;  3VSZ A;  3VT2 A;  4GP0 A;  4KEI A;  3W9T A;  3AZV A;  4P6A A;  2FFV A;  4I7I A;  1S0E A;  2L5X A;  3IAG C;  4IYB A;  2R9K B;  3O4O A;  3V0A A;  1DFC A;  1FWU A;  3OJV A;  4JPZ A;  2IHO A;  1EYL A;  1Q03 A;  1G9B A;  4GAI A;  1BA7 A;  1JT3 A;  3O4B A;  4G6J A;  4OWK A;  5BXS A;  4I2S A;  3UD7 A;  4QD2 C;  4ION A;  3WIN A;  3FFZ A;  2D24 A;  3JUT A;  2NP0 A;  1IHK A;  1HWP B;  3P6I A;  3FJH A; 
#chains in the Genus database with same CATH homology
 3V0B A;  3BAV A;  4ISR A;  2ZR1 B;  2D20 A;  3MAL A;  1EVT A;  2ET2 A;  3BAD A;  5BQU C;  1AFC A;  4QD2 B;  3OJM A;  3O5W B;  2Z49 A;  3V79 C;  4I4U A;  2D44 A;  1NZK A;  4QKS A;  4L4H A;  4D0Z A;  2RG9 B;  1FV3 A;  3AKH A;  1W3G A;  2E4M A;  4H9W A;  4H75 A;  4MZG B;  1M16 A;  1RY7 A;  3AJ6 A;  4LO3 A;  4D0T A;  3WO2 A;  6I1B A;  1K5U A;  4JRA A;  21BI A;  4IY9 A;  3O4C A;  3BAO A;  1J0S A;  2M49 A;  3WA1 A;  1KNM A;  5D63 A;  1FWV A;  5BXT A;  2NM1 A;  3HBW A;  2MLL B;  2F8X C;  3N7K A;  1ISX A;  4XFT A;  3S8K A;  1OQL B;  3AH1 A;  2D22 A;  4TLP A;  3H6S E;  3O4A A;  1MD6 A;  3N7J A;  1DIW A;  4LO7 B;  2F2F A;  3O44 A;  3BAH A;  3BTA A;  3F62 B;  1S0L A;  4A7K A;  3RTI B;  4WBC A;  4I4Q A;  3ILA A;  3UD9 A;  3VT0 A;  4ZLB B;  3D7W B;  7I1B A;  4ZBV B;  1IRP A;  3NJ5 A;  2DRY A;  2D23 A;  3H6R A;  3IM7 A;  3PG0 A;  1V6W A;  3B9U A;  4HR6 C;  3PUB A;  1JY0 A;  2Q9X A;  3MPP G;  4ZFU B;  5G00 A;  4I1B A;  1PWA A;  1PC8 B;  4OEG A;  1QQK A;  2GZB A;  3VT1 A;  4EB2 B;  1Q04 A;  4J23 B;  1W3A A;  1T9F A;  4EEE B;  2VSE A;  1TTU A;  3UD8 A;  3FJ9 A;  3FJC A;  2UUS A;  1FV2 A;  2KI4 A;  2HZ9 A;  4G9M A;  3AKF A;  4EFR A;  4A7Z A;  1N4K A;  3OBT A;  5BXP A;  2FFU A;  3T8S A;  4P0L A;  1TIE A;  3WMU A;  5JMC A;  5I1B A;  3FJ8 A;  3CA3 A;  4I4O A;  3CA1 A;  1BAR A;  3HMY A;  3NBE A;  2YUG A;  3F1R A;  3BRG C;  4I4R A;  2Y9W C;  4OEE A;  3S8J A;  3CRI A;  3RMX A;  4DCK C;  3FUQ A;  4DEP A;  4LO1 A;  2BEA A;  4ZGR B;  1IIL A;  3P53 A;  4P0K A;  4X37 A;  3OGF A;  1WD4 A;  4I4S A;  3OJ2 A;  1DFQ A;  4I8M A;  4Z9W B;  3FJE A;  3BB2 A;  2KI6 B;  4X38 A;  4Z8S B;  1BFC A;  4KEJ A;  2D7I A;  4ZOT A;  3E8L C;  1UPS A;  4LO0 C;  2X2T A;  4QC4 A;  1BLA A;  3BRD A;  1HIB A;  2I1B A;  3I2A A;  4IZX A;  2Y9F A;  2AAI B;  2VUA A;  3ZC8 A;  5DUY A;  5DZU A;  3JRR A;  2BFH A;  1D0H A;  1XG6 A;  2NS2 A;  1P63 A;  4KC3 A;  4IHZ A;  4I6I A;  2ZQN A;  4UY4 A;  3Q7W A;  1Z0H A;  3FJA A;  4ZFW B;  4X3A A;  3N7L A;  4IY8 A;  5BQU A;  4GP3 A;  4FGF A;  4Q9G A;  5FZU A;  3KMV A;  4FVV A;  5HPZ A;  8I1B A;  5DVH A;  3RTJ B;  4LO2 C;  3HOM A;  3FJB A;  3IIR A;  1Q1U A;  1HWN B;  4LO7 C;  3UDA A;  1AVU A;  5BXR A;  2AQZ A;  3A21 A;  1JLY A;  5BOW A;  4I4Y A;  4R6U B;  3EF2 A;  3PHZ A;  4MZF B;  1JT5 A;  1HCE A;  1EV2 A;  3BAG A;  3CAH A;  3FGM A;  4OW4 A;  4QBC A;  2D7R A;  1EPW A;  1V6X A;  4AN7 B;  1TWE A;  2K43 A;  2NTD A;  2RST A;  3ZC9 A;  41BI A;  5FNW A;  5JLV A;  3A22 A;  4GOV A;  5F8S A;  3OGG A;  3FJI A;  3UJ4 A;  4USO A;  3N7M A;  4PC4 A;  4ZFY B;  2XOA A;  3A23 A;  2KLL A;  3BA4 A;  1R8N A;  3CQA A;  1Z4S A;  3I2X A;  1II4 A;  1ILR 1;  3PME A;  3FJD A;  3WO4 A;  3BAQ A;  1RZO B;  3NBD A;  2HW9 A;  1TWM A;  1R8O A;  1SZ6 B;  4OWJ A;  3TC2 A;  4I37 A;  3AJ5 A;  5BP5 C;  3AH4 A;  2IWT B;  1AVA C;  4G9N A;  4AN6 A;  1FGA A;  1DZD A;  4JQ0 A;  1T4Q A;  2D1Z A;  4OEF A;  5F8Y A;  3WO3 A;  1RML A;  2QN4 A;  4G6M A;  4KEK A;  3H6R B;  2NZ9 A;  3AZW A;  2VSA A;  2WBC A;  3HSM A;  5EG6 C;  1AVX B;  1SR4 A;  3R4U A;  1CVS A;  3O3Q A;  2KKI A;  1FMZ A;  1I1B A;  1FMM S;  3BX1 C;  5B2H A;  3RMY A;  2QYI B;  4I96 A;  5E24 E;  1Z2V A;  2VLC A;  4I0Y A;  1VCL A;  3CA5 A;  2FO1 A;  3BA7 A;  4L4I A;  2AFG A;  4J2Y A;  3RSJ A;  2VXR A;  1AVW B;  1DZC A;  4J2X A;  3LLP A;  1TFM B;  1ABR B;  1S0B A;  2Q3N B;  1IT0 A;  1HWO B;  3A07 A;  4JKQ A;  4OUJ A;  1TOO A;  2ESU A;  31BI A;  3FJF A;  3LTQ A;  3AKI A;  4XKI A;  3SNV A;  2X2S A;  4I1E A;  4END A;  1IOB A;  9ILB A;  1YXW A;  1F31 A;  1FQ9 A;  1G9D A;  2BEB A;  4USP A;  3FJJ A;  1WBC A;  1BAS A;  4LO0 A;  4J2S A;  1I1E A;  1DQO A;  1WBA A;  1W3F A;  1L2H A;  1MC9 A;  1JTC A;  4GOY A;  4IZE A;  4EKX B;  2LIQ A;  2FGF A;  2HWM A;  4A7Y A;  2Y9X E;  3WIN C;  3VUO A;  3OBR A;  2P39 A;  3FUO A;  3V0A B;  3CRH A;  5DSS B;  2LIE A;  1YBI A;  4GAF A;  1JQZ A;  4II0 A;  1BLD A;  3R4S A;  4Q9P A;  4HJJ A;  4D8H A;  1G9A A;  1YF8 B;  1S0D A;  3O49 A;  5EC5 A;  1AXM A;  3POK A;  5FZY A;  2NYY A;  3VSF A;  4LO8 B;  1IJT A;  4OWL A;  1M2T B;  2P23 A;  2D43 A;  4LO2 A;  1PUM B;  3CA0 A;  1V6V A;  1FN0 A;  1PUU B;  1WD3 A;  3C9Z A;  3V0B B;  3FJK A;  1DLL A;  4HA2 A;  5GAQ A;  1JLX A;  1PZZ A;  1QXM A;  4DEN A;  2E4M C;  5F8W A;  2KH2 A;  1YYN A;  4LO3 C;  2HWA A;  3VWC A;  1CE7 B;  4YOL A;  2FDB M;  4I4P A;  1G9C A;  4XFS A;  1ONK B;  5FNX A;  1IRA X;  4KBB A;  4P0J A;  1JT7 A;  5BVP I;  3ZXG A;  1XZZ A;  1G82 A;  2K8R A;  3Q7X A;  3IM6 A;  2NVH A;  1ISZ A;  1XHB A;  2MIB A;  1YTO A;  1RG8 A;  1E0O A;  4QAL A;  2ZQO A;  2F2F C;  3HN1 A;  2MC2 A;  2DRE A;  2J3P A;  1QQL A;  4JAW A;  1HWM B;  1A8D A;  4EFP A;  3O4D A;  3AKG A;  1S0C A;  4X39 A;  3VEQ A;  1TP0 A;  3AH2 A;  3NBN A;  4ISQ A;  4I3N A;  3ZXD A;  5BP5 A;  1ISV A;  2Z48 A;  4Q91 A;  1HCD A;  2ERM A;  2RQ9 A;  3CA4 A;  3UJ0 A;  3P6J A;  1S0G A;  1AF9 A;  4JKX B;  1BFG A;  5EHA A;  4QO3 A;  5D62 A;  3NBC A;  3I29 B;  4EFQ A;  1NUN A;  4MZH A;  2K4A B;  4CJM A;  2WRY A;  1BFF A;  4ZA3 B;  2GO2 A;  2Y9G A;  2VXT I;  1S0F A;  2AXM A;  1JT4 A;  2DRZ A;  2VU9 A;  3K1X A;  3CU1 B;  1K5V A;  3ZX7 A;  5FZZ A;  1ISY A;  4F34 A;  4JP0 A;  4IQP A;  3QYD A;  3CRG A;  4F83 A;  3BA5 A;  1SR4 C;  1HKN A;  3N0K A;  4J2K A;  3CA6 A;  1DJS B;  4I4V A;  1GGP B;  4QKR A;  2DS0 A;  3QR5 A;  3HAL A;  1ISW A;  5D61 A;  1XYF A;  4LO1 C;  4QBV A;  1V6U A;  1BFB A;  4H04 A;  3IM5 A;  4ZKT B;  3BRF A;  1ITB A;  4G1R A;  4I4X A;  3WMV A;  4XFU A;  1DQG A;  3BAU A;  3Q7Y A;  3H6Q A;  5F90 A;  3VSZ A;  3VT2 A;  4GP0 A;  4KEI A;  3W9T A;  3AZV A;  4P6A A;  2FFV A;  4I7I A;  1S0E A;  2L5X A;  3IAG C;  4IYB A;  2R9K B;  3O4O A;  3V0A A;  1DFC A;  1FWU A;  3OJV A;  4JPZ A;  2IHO A;  1EYL A;  1Q03 A;  1G9B A;  4GAI A;  1BA7 A;  1JT3 A;  3O4B A;  4G6J A;  4OWK A;  5BXS A;  4I2S A;  3UD7 A;  4QD2 C;  4ION A;  3WIN A;  3FFZ A;  2D24 A;  3JUT A;  2NP0 A;  1IHK A;  1HWP B;  3P6I A;  3FJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...