4X3PA

Sirt2 in complex with a myristoyl peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
297
Chain Sequence
GSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Sirt2 in complex with a myristoyl peptide
rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
total genus 98
structure length 297
sequence length 304
ec nomenclature ec 3.5.1.-:
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4x3pA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4x3pA01
2WVHA 4QELA 2H59A 1T9DA 4BVEA 3RIGA 1YI1A 2H2GA 4RMGA 2H4JA 2EZTA 2FWNA 2QQGA 4IG9A 5BWLA 4BUZA 4UUAA 4BVGA 2OO5C 2Q28A 2C31A 1M2JA 1S5PA 4UTNA 4MQ5A 4GP9A 4JUCA 2H2FA 2H2HA 4Y6OA 1UPCA 1YHYA 4COKA 4HDAA 5EJ5A 2JLAA 2JI7A 4V1CI 4Y6QA 1O96B 4MPPA 3PDHA 3GLTA 1Z8NA 4BV3A 4JUAA 2H2IA 1PYDA 4ZZIA 3PKIA 4C7BA 2Q5LA 2OD9A 2PGOA 4K9QA 2A1UA 3OE1A 1J8FA 1V5GA 4JUFA 3GLSA 1PO7A 2B4YA 4GPEA 4K9MA 5EJ8A 5BWOA 2UZ1B 4J1TC 4I5IA 4JUDX 5EJ9A 2Q29A 3D4BA 1N0HA 1NM5C 3ZGVA 5MFZA 1MA3A 2W93A 4V1CB 2Q5QA 2EZUA 3HWX1 4UU8A 3EYAA 5BWNA 4JSRA 1DJLA 5EJ6A 2JI9A 1UPAA 4JT9A 1PVDA 3F6BX 3U31A 2IHUA 3CLRD 4JU9A 1PT9A 1ZPDA 2UZ1A 3FSJX 3PKJA 5EJ4A 4FZ3A 1BFDA 3U3DA 4KPUA 4BN5A 5K2OA 4X3OA 4UTZA 4V1CA 1PI3A 1YI0A 5DEIA 2OD2A 4UTXA 1O97D 1PNOA 4K9KA 4Q9DA 3GLUA 4MPRA 3K35A 1V5EA 1SZCA 4K9OA 1E3TA 4MPJA 4TWJA 1T9BA 3CLSD 1D4OA 5EJMA 2Q27A 2Q5OA 3JWPA 1U2DC 2AG1A 1YC5A 4BVBA 4O8ZA 3E9YA 2NXWA 3FLMA 4L3OA 5MFPA 2A1TR 2BRUC 3LQ1A 5AHKA 3EA4A 4IAOA 1HZZC 1OZFA 3HWWA 3F6EX 4RMIA 2IHTA 4X3PA 1M2KA 3RIYA 4QPZA 5IMSA 2H4HA 3EY9A 2EZ4A 2DJIA 1U31A 4G1CA 1JSCA 1OZGA 4RJJA 4RJIA 4D5GA 4QQ8A 1QPBA 1Q6ZA 4K9LA 2JIBA 3CF4G 1U28C 1EFVA 3GLRA 1T9CA 2WVAA 2VBFA 1OVMA 4K9PA 2H2DA 1XLTC 2VBGA 4HD8A 2Q5JA 1M2NA 4BVFA 1POXA 4R8MA 1EFPA 2JI6A 2FRDC 5K6TA 2EZ8A 4UTRA 4J16C 4MZXA 1YNOA 2VK4A 3ZG6A 1OZHA 2FSVC 4TWIA 4KGDA 2EZ9A 4UU7A 1SZDA 3IAEA 4K9NA 4RMJA 2JI8A 2FR8C 5K6RA 5MGNA 2PANA 5EJ7A 5FEMA 4JD5A 1Q17A 1V5FA 2VK8A 4ZP1A 2AG0A 5EJAA 1YC2A 4D5EA 4UUBA 3ZGOA 5MF6A 4RMHA 4BN4A 2OD7A 1U2GC 1M2GA 1YBHA 3FZNA 5D7NA 1UPBA 2VJYA 1Y9DA 4F4UA 5DGDA 4UTVA 3JR3A 4KXQA 4L2IA 5K3SA 1Q14A 4FEGA 4BV2A 2QQFA 2JLCA 1PTJC 4GM4A 4JT8A 2HJHA 5DGTA 4JUBA 2WVGA 3IAFA 1PNQA 1MCZA 1POWA 4C78A 2FN3A 1Q1AA 3D7KA 1YHZA 4JU8A 4RJKA 4FEEA 4GM0A 2H4FA 1M2HA 4F56A 4BVHA 1YTLA 4FVTA 3D81A 2X7JA 1T9AA 2OORC 4GG1A 4GM1A 2IHVA 5FYQA 2V3WA 2PGNA 4IF6A 2VK1A 3CLUD 3CLTD 2NYRA 4Y6LA 2VBIA 1ICIA 1S7GA
chains in the Genus database with same CATH superfamily
1W35A 5THXA 5JO0A 2YHBA 4F9FA 2C82A 3FDFA 1F2DA 2O5VA 2CC2A 2IEIA 4P08A 1WB6A 4YQYA 1KAMA 4JP1A 5DI3A 4AWBA 4QODA 3THOA 5A1JA 3EGXA 1QYDA 2PVCA 4UUQA 4IHKA 1UODA 5KYWA 2VPTA 5I6DA 1M0EA 1K9VF 3RCBA 1JN0A 3DDUA 1YR7A 3LCJA 5JO9A 3WA7A 3CNQS 2P40A 2VF4X 4IIUA 5AHWA 5AW8A 1ONOA 1QIDA 2B61A 3LRPA 4O4HB 4OIMA 2CNWD 3FVWA 2YV5A 3GRRA 4TZTA 5CBKA 3VYWA 1G1MA 3H13A 1KTVA 3OZGA 2HWKA 4DJ5X 5FCDA 2W6IA 3QBTA 4FIDA 1U5BA 2YHIB 1F8YA 4BUZA 3LGXA 4IWXA 4YT5A 5J5CA 1C5KA 1DHTA 1ZW6A 4GMHA 3RF7A 1E5QA 2X41A 1F7VA 2W5UA 4XLZA 5IMBA 1ISIA 2AXNA 1SBTA 4BC0A 4ZIRB 4DA4A 4C3VA 3E1SA 4BNZA 3FHLA 2VDKB 3UHPA 4BMZA 2A0WA 1OFHA 3ECSA 5KNBH 1LVUA 3FRIA 4ZKEA 1GSHA 3GPBA 1V9LA 2ORVA 3NPMA 2ZW9A 1J24A 1L4EA 4J49A 3TSZA 4MQ5A 4CM9D 2V7QD 5DTJA 2C83A 2FX5A 2O8NA 2OYSA 4QQFA 4XLTA 5FT9A 1U3VA 1P1IA 2VT2A 3DXXA 1KZ7B 3QE3A 4G5RA 4JUCA 1X1BA 5DWVA 5MN4A 1Q7BA 2HHCA 1DIBA 4QNRA 3TRDA 3X1DA 4ZGGA 3QEJA 1N2ZA 2E4VA 2PV7A 3E70C 3G2JA 1FDUA 4MVJA 1W34A 4E0BA 5IX8A 1X80A 4W4TA 1UPCA 2P62A 3VDQA 2DR2A 1OWPA 1Q83A 4C30A 1PFVA 3W8FA 2Y0DA 3ZS9A 1K6XA 3ZK8A 3IE0A 1IHYA 2WFZA 3MM4A 3UKOA 2H7XA 2X14A 2VDRB 5EKSA 4O02B 4IEIA 4J6FA 2AJ8A 4D74A 5BURA 4F7WA 4L15A 4P3NA 4DEVA 1S2GA 2FWIA 3FNHA 3SS8A 1XALA 2ZIEA 1G6KA 4LTDA 5KYTA 3E84A 3KSZO 4FWIB 4DCVA 4EPVA 2GEKA 4HZIA 2I6QA 2CEAA 1UWKA 5F5XA 2IA5A 2CYAA 3MF4A 5KYYB 1JHVA 2RK4A 1K88A 1W96A 1Y5IA 2YJ5A 2ZR8A 3KPUA 4P93A 2PBLA 3PUJA 3UAOA 3RKUA 4BKPA 1KTIA 1GRRA 3Q2IA 2D2FA 1N4AA 1II9A 1ODLA 4B2IA 3IBGA 3JY6A 3OPVA 2VDJA 1WCIB 2Q4DA 3GNQA 1DWOA 2PGJA 3ESXA 2C4VA 4IH4A 4TWZA 5DHFA 4ZQIA 4XSHA 5ALGA 2P3LA 2M6KA 4XZ3A 4A8TA 2NSDA 2J1LA 5HK8A 1TTQB 2QSJA 2JIQA 3S1LA 4BBZA 4CIDA 3ZPXA 1N92A 2BR5A 4TV8A 2P0AA 1IG3A 2Y1KA 5FBHA 1YR6A 4QYXA 3B1ZA 2EBWA 4C4RA 3BDAA 4DVGA 1FEZA 2PX5A 2Z8YA 3KELA 1V5GA 4P92A 3U7GA 1II8A 3QJ5A 1AK9A 3IVXA 4R0VA 5CGZA 1R5BA 4J0DA 3HPRA 5TGZA 4AKHA 2OL4A 4GHWA 5KKCA 1DL5A 3ZHYA 4QJBA 5C2JB 4RQAA 3L1KA 4U6SA 5JJLA 4K9MA 1S4QA 1RXCA 1PEKE 1RE1A 3CG0A 2F3UA 3PXEA 4LQDA 5T4HA 3I9V1 1DG9A 1JLLA 1K4MA 1ZH0A 1QC5A 2AN5A 2MDTA 3HJUA 4QASA 2JIOA 1AMUA 3EFHA 1RQPA 5K0BA 4KPUB 5CG1A 2HNBA 2ZPTX 3WYDA 3KTOA 2OSVA 2HWXA 4G0OA 3S2UA 2V7GA 3C3BA 4CRWB 1GXSA 3SBDA 1HFJA 4YO8A 1V5WA 1DJNA 4Y1FA 4YT4A 1IUKA 4Z0NA 5DYNA 1GN9A 4YLEA 4XWKA 2JBAA 3B1FA 3V32A 2EFHB 3RIHA 4MEJA 3QVWA 2W00A 4MRMA 1DIOB 4BIIA 5D00A 1LD3A 1DJLA 1TK2A 1K6EA 4LYGA 4G5FA 1YRLA 4LF9B 1GDDA 3I12A 5F73A 3VR2A 1GTRA 4E5YA 3Q4GA 1U6KA 1WL8A 3S2ZA 2EGGA 5TRTA 1RIFA 4F12A 2IHUA 2Y0BA 3QYJA 2KBFA 3K71B 4JLDA 4PRYA 1L7BA 5DCYA 5I4CA 1NXWA 2WKSA 1KZ1A 2OAGA 2YZ2A 4GLBA 3NZEA 1XMOB 2VQEB 3KBOA 1XHLA 1I6WA 5DF1A 4B4VA 2RDMA 3U7IA 5AXAA 1IK6A 3TTWA 1F2TA 2Z57A 4LXXA 3AUTA 3L02A 5EPEA 4NS4A 1YKSA 3F8TA 1E3DA 4AS2A 4EQZA 5A4KA 1UM9B 7ADHA 1IJEA 3A6ZA 3E7PA 3QSYA 2OV8A 4WBNA 3DDOA 2B2NA 5AESA 1GZ5A 3KKLA 5AKEA 4MQLA 4GOOD 2B20A 1UBRS 2ONZA 1O97D 5JRJA 9ATCA 1L5VA 3ENWA 4JYCA 3VJMA 1EUDB 5BSUA 4BJ1A 4O3MA 1S3SA 2HWUA 1Z0JA 1EK6A 1RIIA 4M9ZA 4HVLA 3OOYA 3JQGA 3P2MA 4MP8A 1Y33E 3PFGA 5AH0A 1CCWA 3ZVRA 3X1ZA 3UH1A 4XQ0A 3OJXA 3S70A 4ILKA 1XOIA 4UVIA 4EBFA 1QGAA 4NCJA 3RBXA 1RR6A 1NRXA 1KR2A 1SKYB 3K5HA 4C0KA 2PJDA 3G1UA 2OK8A 3HP1A 1ZFNA 2CXXA 4REMA 4WY5A 4LXTA 1T4MA 2DKOA 1UT8A 4CMEA 3ZNNA 1E5DA 1AA9A 3L4JA 1M1NB 5C8VA 3SX2A 4JB3A 5CT4A 1ZK0A 3UO8B 4GBGA 1KZ6A 1G1AA 1TM2A 3A1WA 4FC7A 3V4PB 1O0BA 2PUWA 4B7UA 4HAYA 2DCUA 3JR7A 2K2WA 3WL8A 3AM5A 3UK1A 4EW2A 3EVAA 5EIFA 4UARA 5JVDF 4MV8A 4O2BB 1L9XA 4H1TA 1ZI8A 3PDWA 5CW1A 5FL7A 5HKLA 2VRCA 4XWOA 1G9SA 4XUDA 5I9SA 4GL2A 1JI3A 3E9YA 3PXXA 4F5WA 3CVVA 2ZI4A 4B83A 5KSYA 5ALPA 4KE9A 1F8UA 3AERB 1SKAA 3B7WA 3GWZA 2IS4A 1GZ7A 4UXHA 5FDFA 1RI5A 3DBRA 5JU6A 3LP5A 1HLGA 4IUCS 4F8JA 3BXEA 4DLLA 4FZRA 1V37A 1E1DA 1WV1A 3QUBA 3N8GA 3AI2A 2AJBA 5KCMA 1IEVA 2NVOA 4L5YA 1EIWA 4CGZA 2IYRA 2PKEA 1NF2A 1NVAA 4WFIA 4IXWA 1KRXA 1ZIYA 4BXOA 1BMQA 1GT6A 3MS4A 4TN1A 2P9TA 4WA8A 3V8PA 4G89A 1IZYA 1EX1A 1QH8B 4MLDA 1TT5B 2O19A 1Z5PA 2YYZA 4WKOA 4YFYA 3ZQ4A 2CL7X 1PGQA 1QGED 4J1TA 4MVJP 3AONB 5CIQA 4G5HA 2JAQA 3SF8B 3OX4A 3MHPA 1JT2A 2EGHA 3TOZA 2H9IA 1PIWA 4LOAA 3V8NA 4YIHA 4AUEA 2BP7B 4QGFA 1ZNQO 3NUGA 2JDIA 4FXPA 4KR9A 1SXJA 2PG3A 4C0BA 4XD2A 3NMUF 1BOOA 4OHZA 1XZEA 2EFYA 3KCQA 3ZGZA 1I7LA 1MAWA 2NU7A 4DIDA 5ITVA 2RGNC 2C3PA 4MEAA 4WZBE 1W52X 4MPTA 3CNLA 4Q12A 2YZ7A 1OILA 4TKVA 1DHRA 2CZGA 2YVQA 2BT4A 3GZNA 3R6LA 4LW8A 1IVSA 1F3LA 3HM2A 2W9XA 3FWPA 3NIWA 3P0FA 1C4WA 1D04A 1GG9A 4KN9S 5AKLA 3KQTA 5H83A 3A3NA 4LMPA 1V0JA 1QK3A 1S7CA 3AIMA 3PFKA 1OLOA 2BJVA 3A4VA 3PZBA 4L0DA 4NPCA 4BFVA 4E5KA 1JEDA 1XEFA 1ZCZA 4XARA 4HFMA 1V7CA 2W7TA 4XPZA 1EG2A 1Q0LA 1QWOA 2ZE6A 4DJEC 1T3ZA 1W25A 2GGSA 4BWVA 2OESA 1XZNA 1XCMA 2X5KO 3DTTA 4KQCA 5FB3A 2ZCJA 3B6IA 2LCIA 3F97A 5DYYA 1LC0A 2X5OA 4WLEA 4JJ8A 1K5GA 3DC2A 3ZNPA 3AVOA 1P9LA 4ARVA 4M76B 3WZ2A 2O8DA 3DTYA 1M2VA 1R4ZA 5D84A 5JG7A 3CRQA 4KRGA 4XJXA 4X7PA 3W1VA 4BNGA 1GTL1 3GLRA 1W7AA 4B44A 4L9AA 2MINB 4UDXX 3HDHA 2CNBA 3C4QA 4H59A 4JHXA 4KMMA 1PWHA 4KZPA 3GMIA 4MV5A 3WP0A 1TW2A 5JCJD 1OAOA 4Q4LA 4BNDB 3I61A 2QX6A 1K66A 1MT3A 2BTQA 4KAAA 4ASUD 4OBBA 3D43A 1Q7TA 1SFRA 1XK7A 4BVFA 3GYGA 2I1LA 3BB4A 4LVOA 5K0JA 2PIDA 3EQ7A 1F0NA 1EVYA 1PT6A 1EK5A 1QRUA 3OLZA 4RPJA 4B6JA 4B79A 1R0CA 3NHRA 1AA6A 4ZRDA 2ADMA 1YS7A 2XGMA 5JV5A 4BO1A 1RKQA 2O7VA 2H08A 3CRW1 3WK6A 4J16C 2VNAA 1R00A 2PPLA 1VGVA 1CY7A 3QVLA 3IJRA 3N86A 3B9PA 4IFTA 1J9EA 2HKIA 4H3SA 3NOVA 4I1RA 4PQYA 4K28A 4KU4A 4QL3A 4U1RA 2XNHA 4BHTA 3LY9A 4UD6A 5E6RA 5A5FA 3T9AA 3H11A 5JATA 1JFFA 1XPUA 4FE3A 4CG1A 2ECFA 1UMBB 3N7UA 2BTOA 4JLSA 2JZNA 4F9TA 3H2IA 1XZIA 2C88A 1U99A 3QKSB 3T1QA 1QG2A 3CM0A 4Q00A 3EQ9A 1NV8A 1M34B 3K2IA 4I9UA 3IAXA 4R3NA 1N3LA 4XB2A 1B6SA 3AZPA 3I2KA 4YJ3B 2QRUA 2ZSEA 3NONA 4JEIA 3RVRA 5LP6F 1CQIA 1MLDA 5IM4A 3SZGA 4KMOA 3VMMA 1SOMA 2OFXA 1VLZA 2XCQA 6REQB 3IPAA 1YJCA 1Q84A 3PNLA 2FN7A 3HJBA 4XW2A 4GO1A 4BFWA 1OYVA 1O2DA 2OV2A 2H1WA 3DL4A 1MUUA 3G2OA 4A8PA 3LP6A 4N6GA 3UOAB 3MRVA 2PBRA 3WQQA 4KO1S 4NR0A 4Q02A 4EJ6A 5L4NA 1HOTA 4TUYB 2FRVA 1KDRA 4QVKA 1DNPA 2GF0A 3F1KA 1G20E 1XVVA 2C1EA 3KT6A 4WXYB 3UJ7A 4F06A 1NVVR 5I45A 4DIOA 1YULA 5IDYA 2XYGA 1SKMA 1AZTA 5JH7B 3MWGA 5E1OA 4Q3EA 3NB0A 4FR0A 1X15A 5IDVA 4K5QA 1V2GA 5DHQA 5KC8A 1GZSA 1MQSA 3THRA 1KWGA 1TADA 3BE5A 4WDQA 2QTWB 5B6PA 3HO6A 5IWAB 2YC4C 1RWOA 1NJGA 3BWCA 5K03A 5DBFA 3I5MA 3FZNA 3VYTB 2BR3A 1QR2A 3IOBA 2PH3A 3MCZA 3MEQA 4BJ6A 1PAUA 4FCTA 3TXAA 4RXMA 2B1RA 4H60A 3KETA 3BXFA 3V6MA 1H2RS 4J0IA 3QW4B 2HEIA 3L4BA 4TLLB 1VXOA 3STXA 5J2TB 1A3CA 1E7WA 4WGGA 1E99A 4QZVA 1RPZA 1T24A 2EBHX 2Y9MB 3WWDA 4C08A 4DRYA 4X63A 5IUKC 3ACCA 3KX2A 1C2YA 3BVPA 4FCCA 4GSYA 4GPZA 2I91A 2YWEA 1L1QA 5I7EA 3VDNB 1XQXA 4OKSA 4MKIA 1U3FA 1P81A 2V0NA 1J97A 3VVBA 3QVTA 4DWOA 2PS0A 1FE8A 2W6OA 3UWDA 3KJGA 1BX1A 1PN3A 1TVCA 1G4HA 4LGMA 5LFAA 3Q5GA 2IXDA 3M6AA 4URYR 3H0CA 5BN5B 3UGQA 3L8CA 3VSEA 4UNRA 3BG5A 1CUDA 4WK0B 3H5IA 1IN6A 1PR5A 1YV9A 2SNIE 3D6MA 3QFRA 3ZEIA 1ACJA 3P0JA 3SOZA 1EDOA 4A6EA 1KJYA 4E08A 4P4TA 5F2KA 4JUBA 1G18A 2Q50A 1APBA 1MO4A 1ZOOA 2OB2A 1XTUA 3MJRA 3JSAA 3R2JA 4DR2B 1IWBB 1CZHA 1MCZA 2GEFA 4F5YA 3SE0A 4D82A 4W9MC 1LI5A 1W4CA 1GL3A 5LR6A 5AT1A 1SU7A 1R6UA 4YWHA 2P1DA 2OLKA 1ISFA 4RFSA 3GT0A 5FULA 3TCNA 4E4TA 4F97A 621PA 1U5AA 5AM1A 4WLOA 3FYDA 3RVMA 1GSIA 5C80A 1ZI6A 3ZVKA 2ADFA 3OFJA 4JI2B 2WBLC 5KDOA 5IFKA 4FVTA 3SNKA 3RYTC 2J4DA 3EGXB 3QU5A 3EIWA 1L7PA 4PAGA 5L95A 2XMGA 5CFLA 1G19A 4D3DA 2QD2A 4HDOB 4P98A 5DHSA 1H0RA 2ESRA 2GXSA 3ENVA 3O7MA 4LOKA 5CB8A 3GBPA 5FWDA 3SC4A 2HNKA 3E5MA 1C0IA 4V2UA 4JROA 5F7ZA 1JQKA 2ECQA 1ECLA 4QOEA 3SJAA 5LUAA 3AEQB 2H9YA 1UWVA 4AUMA 1NSYA 3QXGA 2J9YB 4D8TA 3RK4A 1UXJA 1V6AA 5F35A 2YS7A 3CO0S 4TXHA 1J00A 4ZCSA 4G0PA 1U5BB 3OZBA 3I76A 3HGQA 3PUXA 2OAP1 1YB5A 4BNWA 2VJPA 4L75A 4MUYA 3L6DA 4DDWA 4HC4A 4G56A 3AGQA 1DXYA 2PAFA 4WHMA 2OP0A 2VF8A 2O20A 4I19A 1OD6A 2WYHA 3AZQA 1U3UA 2XQFA 3AQ4A 4MRSA 5LU9A 4QTUB 2FEWB 1KIFA 2AA3A 4NYIR 4OFBA 3PEYA 3MMNA 2OVFA 5H70A 5DK4A 4H1WA 1NQTA 1MVNA 3GZ4A 4P3XA 4Y18A 1PE0A 5HNKA 3I4FA 1TUIA 3UWOA 1TCAA 2RB5A 2HRRA 3A1UA 1OWOA 2HSWA 1MV5A 2XCOA 4AU1A 5B6IA 4J9UE 5ULLA 2XB2A 3G82C 3O26A 3CUTA 3T4PA 2C7VA 1KEWA 4RW0A 2P8JA 3JPWA 16PKA 3DC7A 3VZPA 2FSPA 4XQGA 1HTTA 1KF0A 3RG2A 3FHTA 3OIVA 1H9BA 4M1OA 4O0MA 2FTKE 3RC3A 3PSAA 3M1AA 1CUCA 2B4KA 4J90A 2FQ1A 4UUAA 5J4KA 4QJ3A 5I8ZA 2TMDA 3QM1A 3C6KA 3L3BA 1YS1X 4CDNA 4EO9A 4WLUA 2Q28A 1Q0SA 3EBLA 2OXTA 4IS3A 2NZXA 4GWLA 1Q7CA 1B16A 4MGHA 4DJFC 2PUGA 2C31A 4BEVA 3HUDA 3M4YA 1ADYA 3DHNA 4IDCA 4LPSA 5CA1F 3F4LA 1A5AB 2HLDA 4OLHA 4CNBA 1QGDA 2NV0A 4IICA 4ND6A 2HMUA 1VFPA 1Z68A 3AIKA 4TZKA 1J06A 4I9GA 2ZZMA 3NTXA 5EQFA 3UXEA 4GLFA 3DR5A 2XGJA 2FNAA 3OCCA 5HMLA 1IAVA 1YMQA 4L4YA 3UJAA 4OUKX 3RK0A 4A5OA 3UUWA 4EYOA 4ABTA 1NBME 2EFGA 3QKUA 2CXSA 4RDIA 5JSZA 1X7YB 3P4UA 1B2RA 1WMBA 1YHYA 2VJMA 2EARA 2ETXA 3H5AA 4FFDA 4HDAA 3B2NA 2BELA 3KKKA 3U4QA 4RK1A 2GNAA 1T3TA 5A0VA 3RANA 1II8B 3IUNA 4PPFA 1N5JA 3KB8A 3KOUA 3ZZTA 2Q0HA 4LDJA 2YIDA 4M1WA 2DM6A 4D9EA 6PFKA 1K1EA 2Z9DA 4GH5A 3FW1A 4YRKA 2DPLA 1HG0A 2W2TA 2A5LA 1UK6A 1J8MF 3LUFA 3WI7A 3DF9A 5EMKA 3EF0A 4W9RA 5LB4A 2HB6A 1IVNA 1M7GA 1CYDA 1Z8NA 4TT3A 1IOLA 1JHRA 1Q91A 2OWDA 1M1XB 4NICA 3C3MA 5ADVA 1KI2A 1D2AA 2Z2JA 1P33A 1L5OA 3ZY5A 3PXBA 3R0IA 5LPNA 1L3IA 1QC5B 3PKIA 4BMVA 2Y99A 4BJ3A 1NGSA 4RV4A 5AVJA 2E82A 4MB6A 3WNBA 4BKMA 1XU7A 3D4LA 4HDSB 4FFPA 1T8UA 4D9NA 4RTKA 4B3HA 2OD9A 5IK2A 5ICCA 2ABWA 4G4SP 1V5IA 4AMBA 4IYJA 4CQLA 3TE7A 4OAOA 1LU9A 2Y3IA 3MRSA 1Q20A 1BS9A 3SI7A 4JQCA 4E2XA 3HBMA 5JPCA 4NOMA 4OJTA 5GIPE 3LSYA 5IZCC 2HV8A 1DGQA 3WLPA 2PWAA 2JBAB 2ERYA 3G2PA 1QANA 4F5DA 1GNSA 1T6ZA 1PGJA 2CZCA 3A37A 2HA2A 3TDMA 1D03A 1V9SA 4MRMB 1KR5A 1JR4A 2XPCA 5B1HA 2AN1A 4C87A 5KYNA 1KP3A 5E38A 1Y3AA 3W2TA 3F78A 2VF2A 5JS6A 2XB8A 2PGAA 3HU5A 1NLYA 3BORA 3A8TA 1R6BX 4O0LA 2IC5A 5KNBD 1UJCA 2WF5A 1M74A 2ZWMA 2P9CA 5H9WA 3I6QA 4J1TC 3GT3A 5J4LA 5FOWA 2DOKA 3ULKA 4LYAA 5EJ9A 1F2TB 3E9MA 1U2PA 4GPIB 4BRUA 2ZQZA 2CXPA 2XMQA 4JI8B 3SXPA 1QO7A 2ZG6A 1VE9A 5HDBB 4FIZA 1NR7A 4OU4A 1SQ0A 3WLAA 4I6EA 1PQ4A 1LI4A 2CYCA 4WBNB 5CW2A 2EF0A 4O4JF 2I6GA 1VE6A 4V39A 1M10A 1KEPA 5BSEA 3C8DA 1Z18A 5H3HA 1KAQA 1PCXA 2CJFA 1GCIA 1JAZA 3LGSA 3QH4A 1FS6A 4NF2A 1H8HD 2Z09A 1PZMA 3JQGB 4R98A 4YO7A 2B5OA 2CJXA 1SVLA 3WLIA 1CP2A 4AJ4A 1KI1A 5SYMA 3SZOA 4WCFC 1CJKC 1UPAA 5IG2A 1YJXA 5B4VA 5J58A 4JEHA 4DBVO 3WVNA 1QVWA 4BNLA 3GEGA 3M8KA 1WULS 3LDFA 3PFWO 3A26A 3CPJB 3PKZA 5DM70 2AOVA 1YDEA 4ZJUA 4KH0A 3OZCA 4NU5A 1HYEA 3D7NA 3HR7A 4A9AA 5EJ4A 3LPNA 3OCZA 4X1KA 1NRIA 3FAZA 1WUHS 3NWBA 2AG6A 2MU1A 2PMWB 2V03A 2BMDA 3P9YA 4G8JA 4L0CA 4V2IA 4EFLA 2MMCA 1OZAA 1XTZA 3QK7A 4WBSA 4AX4A 3EX7C 2R6ZA 5EIXA 1YGPA 2KWIA 1UC8A 2ZJ5A 1U2GA 3E9EA 1TF5A 3HY4A 2J7KA 5DEIA 3BCHA 1DOHA 4HH3C 2JFXA 4BKUA 2UVQA 2R5NA 4P5DA 4BIMA 3QPVA 3I6BA 5A9RA 3HZZA 4TTIA 3CIOA 5JRZA 3EYWA 1DKNA 1XQ9A 4CKXA 1GTG1 2V9PA 1O8BA 2BH9A 5HG0A 1U11A 3P0IA 3VPBA 3VR3D 4EW3A 2AT1A 4UMVA 2G4CA 3SR4A 4K87A 2WB4A 3FLAA 3NDBB 1UBNA 3IMEA 2X0EA 2XGSA 2QN6A 2ZWOA 3EC1A 3OJCA 2KHZA 3GDOA 5DNYB 1E3MA 3SY8A 2IV2X 4HWKA 4RK0A 4E6EA 2CUZA 1FF9A 5JZVA 2PKXA 5DULA 1R27A 4MWBA 3W2FA 1ISGA 2V55B 1T8YA 3FA2A 4IX9A 4RSRA 3UMJA 1XMJA 4CYMA 3QBDA 4WEOA 3RSFA 4GWKA 5LDHA 3BOSA 4N7RA 2IL1A 3ZCPA 4RF5A 1HDYA 2W48A 2YWBA 2PSJA 4S04A 5ECYA 4E4YA 1Q1GA 1F8XA 1WABA 2VQ3A 4Y9UA 3JQ8A 2NU7B 3DVLA 4O4LF 5DH9A 2G80A 4H17A 3ZV7A 1GEEA 5CVEA 3BSWA 3GP3A 4OUDA 4AMYA 4AVYA 1Z9BA 4Y7DA 3NHJA 3TEFA 4ZVKA 3CVWA 4YV0A 1DT5A 2GLUA 3HMKA 3THXA 3OZXA 2O23A 3C8HA 1JDSA 2L82A 1DB3A 2II6A 2WSSA 2X5XA 1VKHA 1PUIA 1WDMA 1YDMA 4WCFB 5AHKA 5DNWA 4LKOA 3GH1A 2A58A 5CDHA 1W4ZA 1A5SB 3FLEA 4GMXA 4QECA 2RGBA 1F6DA 5TE9A 3WOHA 1N2XA 3V7NA 3VO8A 1IEWA 3L8DA 3L40A 2ZFUA 1RXVA 1NQ5A 4G07A 1I2ZA 4KQKA 5MN6A 1XYYA 3MJEA 3KKNA 1JG1A 1N0VC 3I1FA 3DR3A 5EMNA 5IHPA 1Z0SA 3WAGA 3TIGA 2ZDQA 3DDHA 2HMAA 2OFOA 2QM3A 2I1VB 5GGXA 2R8YA 1B3RA 1EVQA 3BJMA 3FFWA 1YQEA 1VCIA 4X3PA 4OYRA 1S6YA 5A5VA 2O8DB 3SKYA 421PA 3GRFA 2ZPAA 4OGLA 1M2KA 2ENUA 1O54A 1JDVA 5AM2A 1ECGA 1S3FA 3E1GA 4CBVA 4L3VA 3OT4A 3ICOA 4NDAA 4O3FA 1YR3A 3ZWDA 5FBVB 3IHLA 1JR2A 5GGYA 4EB6A 1U8TA 4G01B 3T7TA 4IDNA 4AECA 1T5SA 1JSCA 2BTQB 4FCVA 2IELA 4KJXA 4Y30A 3HVRA 1FVFA 3BF7A 4TT8A 1GN8A 4BY9E 3PENA 3NS7A 3KDAA 3L7OA 1P0QA 2WJ6A 4IMIB 1CDEA 4IOLA 4PX5A 3K8ZA 4RL6A 4GMDA 4ZXFA 2IGTA 2WQ7A 2W37A 4KFTA 2DQSA 2JKVA 3ZIAD 2V5VA 2Z1DA 5LA6F 3E6AA 2EBFX 4Z4IA 2XMDA 3EGOA 1R0LA 3BH6A 3DKRA 1L5RA 3OZUA 1BWPA 2JAPA 1AS2A 2PWBA 2CHFA 4X62B 2EKDA 3TBFA 2CD9A 2IYTA 2TSYB 1JFFB 2G72A 3H11B 4NOJA 2IZOA 1JU3A 4V0ME 5CPFA 4E2FA 2Y1WA 4F3KA 1KXJA 2XWQA 3GJ6A 3D8TA 2ZWIA 1TJ5A 4OREX 2FE1A 2M98A 5FTMA 3CO5A 4G85A 1N75A 3AIIA 1HG1A 2J6CA 1CTQA 1KMCA 1FRZA 2GJ8A 2H5JA 3LWBA 1V4VA 4HRAA 4LHZA 3T3MB 3W8RA 4FNGA 1FIUA 4H1VA 4F96A 4QHYA 1B42A 1AY0A 4UDYX 1CWUA 5HIAA 3N3BC 4PZCA 1XXHA 4LTNA 3OAAD 4YA6A 3PJDA 3WB9A 1GQSA 2RHWA 4DT1A 4TQGA 2FVXA 2JAUA 1WY7A 1GYRA 1XLVA 2PLWA 3FKSA 1Y3FE 1U7HA 3N05A 2CBXA 4IXMA 4OXKA 3PE3A 1YJQA 2C7PA 5JJ5A 2WLSA 4Q3BA 5E6UB 3W5JA 5F7OA 3GGSA 2AUTA 3ZG6A 4TLDA 2CXUA 3BREA 4NH4A 2EOAA 4YGYA 2D13A 1WE2A 3I5UA 5SICE 1KE1A 5BNZA 2B82A 2W2XA 4I3GA 3UXHA 2VXYA 2XCIA 1K3FA 1NUQA 1Z17A 1SZDA 3HA3A 1HKHA 2HRBA 3HE3A 1M54A 4IZHA 2PS1A 4QQRA 5AJUA 2JH3A 3U1TA 1DEOA 1T91A 2JFPA 3QHQA 1QG0A 4NJEB 5HPYB 2P91A 3CLHA 3FROA 4G84A 3AVTA 1KP2A 1VG8A 4HHEA 2Y77A 4ZALA 1P9NA 4L22A 4IXNA 4BU0A 4ZMBA 1T36B 1PBTA 2CLIB 2FPGA 1U8FO 1X8KA 2Q0QA 3SQNA 2RKBA 3CLTC 2VHEA 2VQ6A 4IDGA 1M6VB 4RZSA 1ZVKA 1EVEA 5FEMA 2O2JA 2YIVX 1E1KA 3M3HA 4UUNA 1ZMOA 2EIXA 3E27A 4DMLA 1JHMA 3PHGA 2APJA 2D1QA 3C6YA 4UDNA 3F6RA 1MG0A 3VISA 2XA9A 4QTTB 4PZAA 5C34B 5JY1A 4OY3A 3B9RA 1XDZA 3QPUA 3PJRA 1ZJ5A 4ZYUA 1ENOA 3HJHA 1MF7A 3H1EA 4UBOA 1QMGA 1KU6A 4RV9A 3SFVA 5FWAA 3H4MA 3AV3A 4G36A 3IKMB 2RGEA 4BJ5A 5KU1A 4C0WA 1H5NA 5IAKA 1IIBA 1PWEA 3EVTA 1RM0A 2O59A 1IJKA 1KK1A 3WIDA 2J6HA 1Z2NX 1E2JA 2VWQA 4RMHA 3CRZA 5AR1A 2EC5A 1D0VA 4I5GA 4Z4FA 3N0VA 3WNVA 1P61B 4PYRA 1XTQA 4QATA 1YBHA 3ZUGA 1P75A 3KVVA 4LRSB 2ZAMA 4NPAA 4DADA 2HC9A 1IYZA 2FUG6 2ZEJA 1Q7RA 1HZJA 2Z9CA 4PRKA 4R2MA 2A1UB 1TO2E 2ERCA 2R6R1 1V8DA 3AYZB 4FQ7A 2FPKA 1U3DA 3U62A 4EM6A 1KQFA 3NAGA 2ZRBA 1JQBA 3UPUA 5EPOA 2BSAA 3TW0A 3Q87B 1UPBA 3SHVA 5A02A 3QU7A 4WTOA 2F3RA 3QRWA 3JVDA 3Q5DA 2XTNA 4RFSB 3ECAA 3S0JA 1ORTA 2M2IA 2OQRA 3I01M 3MPUA 1V26A 1RWKA 4K1LA 4YASA 5SZIA 3K6RA 4LXQA 4LWOA 4C7KA 5H9VA 1T9HA 3O92A 1DC6A 3Q3VA 5T4BA 2CXNA 3LA6A 4XIJA 4R3UC 1XCLA 5LD2C 3QEAZ 1C1DA 5CDFA 5IDXA 4J91A 5HIMA 1KJ8A 1N1GA 1O6ZA 1S96A 2Q6TA 2XTAA 3ACDA 3DE0X 3K1AA 4NU8X 3PGLA 3K30A 4X84A 1E2LA 1WHTB 2EKLA 3KOOA 1ZAKA 1GPUA 4HGYA 2ZIUB 5DCWA 3TI7A 1TRKA 3IPLA 2WWRA 1RM4A 1H2ZA 1YCHA 3CSSA 1AUXA 1TCVA 3OC6A 3SX0A 1CS4C 4LCEA 5JJCA 1X87A 2CNKA 1XCGB 2E9SA 3PFCA 5DVZA 3ZQUA 4A4DA 3GLFB 2VCYA 2BMVA 1QCCA 3THWA 3KSBC 1MKYA 3LO8A 4WJLA 3PA8A 4MINA 1RZRA 1BQ4A 2EYUA 2I22A 5G1OA 2H1FA 4DMHA 2FDCA 1B6GA 4ZJYA 4S2EA 3KFXA 1GGHA 1ICEA 3CXUA 3PQ2A 4B82A 3T52A 1ZONA 2ZITA 3H4IA 4BB6A 1O9GA 4K6HA 2VZEA 3EAQA 5AP9A 3UMRA 5ALHA 2ZSBA 3Q98A 4FUTA 3TNLA 4ZEMA 1SCUA 2YQZA 5ILOA 1WQ3A 1GILA 2IYZA 4LOHA 4DDVA 2FMXA 1E6UA 2C95A 4YUZA 5FA6A 1VCNA 3MOIA 1MN6A 2FSVA 4JENA 4N01A 4XVUA 3STWA 5AW9A 1QIGA 5JSYA 4P5EA 1OFTA 2WAMA 5TGTA 2ZTLA 3P4XA 3PB3A 2Y8EA 3IIKA 4EB8A 1EJ6A 2IHVA 3VZRA 4F5ZA 5CJPA 1GL7A 5BOSB 2RHCA 3DP7A 2WUDA 1VLMA 2P69A 3QNMA 1ORHA 1T0HB 1UMCA 4Y6PA 4C4OA 2G08A 4MA4A 4MGZR 5A7FA 3MLBA 2WIBA 3PX3A 5JVDA 2ZJYA 2BW0A 3QENA 5KTRA 1DJMA 2O3QA 3ZWVA 3NP7A 3V7UA 1IWOA 1Z26A 5AUOB 2J3KA 3DCJA 3ZZNA 5EQJB 2NYRA 1EJ2A 2WKPA 3TJZA 1ZCFA 3JVIA 3OE7D 4BTEA 4X65B 2NV2B 4E5VA 1PUXA 3HM9A 4NK4A 4QEKA 4XWAA 4D4GA 3NX4A 3WK4A 3RU7A 3OPMA 1H2EA 4WXRA 2VSOA 2J87A 4DREA 4IVRA 4WADA 3K3PA 1T9DA 3UMSA 2YY6A 1QOZA 3DKKA 3EE6A 3E03A 4R1PA 4K9RA 2NQTA 2H2GA 4B8YA 4BAGA 2Z3WA 2WWIA 3DVSX 4LTMA 5LD2B 2LDBA 1FK8A 1OV6A 1RFGE 5F4BA 1U2QA 1RQGA 3CRNA 3AT1A 1JRLA 2AV6A 5JBNA 3ISVA 2QTHA 5BUQA 2FWNA 3AUKA 1PG2A 2ZTHA 4K88A 3D0QA 1XDUA 3DZHA 4FYWA 1IHOA 4GOND 4Q1DA 3ROGA 3RR2A 4YUVA 1SCQA 5AUNB 1SUFA 1J0AA 3MAAC 1P62B 1XZFA 1FDVA 3B5IA 3EQ2A 1E20A 4EY3A 4TQ9A 3X44A 1OXKB 1JIJA 3LGAA 2P2LA 4I4LA 3O8OA 5C7IO 2PZAA 3P5SA 1ZP6A 2V6IA 5CB4A 1NFQA 3CB2A 3B13B 4NV3A 4PAOA 4JHLA 1Y8QB 2FXVA 4DCOA 1ORDA 5HSGA 2YJ4A 3GVHA 3L5KA 3HRKA 3C5WP 2IPNA 3OOSA 4PO1A 3FF1A 1K92A 1M5TA 1M2JA 3H8WA 3F5FA 2ZJ2A 4D98A 5BQXA 5C53B 3M49A 3BUSA 1S5PA 3SF0A 1X8XA 3WBJA 2I1QA 2XXBA 4HVAA 1A7KA 4QO8A 4EZEA 2ZUFA 3BMOA 1Z5UA 2H5EA 3KV3O 3I9KA 4GKJB 3T3PB 2XUDA 3QX8A 1G7SA 5KINB 3RTCA 3FRHA 4UEOA 2FQXA 5F1OA 4BNFA 4LJ8A 4YMUA 3UVEA 3STUA 3RW9A 4ZAZA 3SFZA 3WNCA 1SNYA 4KMRA 3CUUA 3KXPA 1V48A 4F4FA 2X76A 5H3CA 4UCXA 2CJPA 3HPQA 5HBGA 1SVSA 2JCVA 3QJYA 4ZAFA 1PJLA 1PZNA 3IVRA 2NLOA 3A36A 1E7MA 1E8MA 3KJQA 3NHBA 3C3WA 2WJ3A 1H23A 1LC3A 4K05A 1R3UA 2R8PA 1NKTA 1AZSC 1D3AA 2JA2A 3WGUA 2DKNA 2OGZA 2B8EA 4C5BA 4CI0B 1Z88A 1DO0A 2UVPA 3T9CA 2PTGA 4CPDA 4C89A 3O8LA 3OHPA 1B73A 1ZN9A 2OHXA 2QROA 1G7TA 5C52B 3RQSA 3A6JA 2YDXA 4HDNB 3ZV3A 2YN0A 3GWGA 4A0HA 3O2SB 1P1CA 2YRWA 3GFRA 3PD1A 2XIQA 4HDRA 3BWDD 3EHEA 3OFNA 3UK2A 1GCGA 2JFWA 4M0UA 5IVHA 5BNTA 2XQGA 2WSYB 2X15A 1NW6A 3E15A 4CJXA 2BYTA 3BD6A 3HBJA 3PQ3A 3T0IA 3ENZA 3LCRA 3EPJA 3MJDA 2XRMA 2BEWA 2NU6A 4KTTE 2W6MA 5I47A 1F3OA 4D41A 3ZGNA 5F2NA 5HS6A 4O5AA 1CERA 4GX0A 1MD9A 2RBEA 4Y2PA 5AVOA 1TMGE 5EZQA 1J09A 2NU9B 3HB4X 6ABPA 5EE1A 1WZNA 1XE3A 3H18A 2BLLA 2R1TA 3F5MA 2Y0PA 1A04A 2ZT5A 3BL6A 1JR3D 2GPBA 5C51B 1HNZB 4IDFA 2AE1A 2W98A 4MKZA 3GCZA 4R4JA 1Z74A 5LP6A 1E2MA 1YHNA 4MQBA 2FY8A 5IJAA 2WTBA 5M7EA 2JJ1A 3GCWA 4X1KB 2OCDA 2AI1A 3OJOA 2ZLBA 3QSGA 3D4BA 3JYQA 4W9NA 4KXLA 3LCVB 5DRTA 1SCJA 3HBAA 2H3EA 3A05A 4IIJB 1KI9A 1SY7A 3SLKA 2HRDA 5L4SA 1FTYA 2R8XA 1VL6A 1VYVA 4CV0A 2JLBA 2REBA 2GAOA 2WIJA 4B3SB 3VGPA 4URZR 1UFKA 1I4EB 4L0QA 5TT1A 3QX7A 5DBGA 3RK1A 1NLFA 1LCIA 1YL5A 1NG1A 1MX3A 3MBKA 4QPNA 4ARCA 4D9BA 2OFWA 2DP4E 3L41A 2Q9UA 1WPXA 1UJMA 1E1RD 3QY0A 3I73A 4JQYA 4OQEA 4OO3A 1C7QA 5AJYA 3SXJA 4MVYA 3G2MA 3HV2A 4HQFA 2HJSA 4CMKA 3AEZA 4RQUA 2H7CA 4IIGA 3G5MA 4RADA 3A4LA 4WPGA 5ELMA 5T64A 4URXR 3ZQKA 1Q0RA 2C98A 3WSVA 2R1VB 3G0GA 5A7HA 5KTPA 1EPUA 2YZMA 2QTZA 4L6CA 1LB1B 1QAMA 4KX3A 1XG5A 4FOOA 3EC7A 4FHEA 1LUAA 2J7PA 3KQLA 1XRSB 1Z5VA 3L6OO 4RKQA 1YI0A 4ZU6X 4LI0A 4OHKA 3TIFA 1NG9A 4KGVA 2J9ZB 3OA2A 1PNOA 1ZMXA 2C4TA 2QU8A 3ON5A 4IIHA 5F4ZA 3S7TA 4F3YA 1IDOA 2GEBA 2WIAA 2BWJA 2CCGA 4NQRA 2XOXA 4MPRA 2HLNA 3DTVB 3L1HA 3G23A 3NNSA 4X8LA 1VG9B 3THXB 3QVUA 4WK6A 3G9UA 4G1UC 4DABA 2QU7A 4IIXA 1UXIA 3DHYA 1E79A 3N2ZB 2NYVA 3AVQA 3BMNA 1E5TA 3L8EA 2PX3A 3AEKA 3GOHA 5CVVA 2GM4A 1I6MA 1QMPA 3FMPB 3BBPA 4K9OA 4NY1A 3UXMA 4ENUA 1JIKA 5HRUA 1I32A 2NVWA 1C50A 3OTGA 2QPOA 1Z0FA 3EMBA 1L5LA 3RYFA 2Q4EA 3T3DA 5KHOC 3P9NA 3HCAA 3WMGA 2FUCA 2PCLA 3B12A 4CF3A 2ZKLA 5BMOA 5FXMA 5D85A 1YS2X 1WZCA 4L8YA 4CLRA 2BY4A 4B3BA 1KO8A 4JXXA 2NTEA 5D7BA 1QX4A 3OZTA 3VR5A 4CG2A 1WUIS 1CF4A 4GS5A 3T1VA 3K0SA 5SZJA 2QDKA 2VDNB 4GL4A 1ZUHA 3VMFA 1RKBA 1JJAA 4RVOA 2NV6A 2VDVE 4K0KB 3EY4A 3K0AB 4LY6A 1N5OX 1VLLA 3H9BA 2O7QA 5DIFA 2P9JA 1BNCA 3DFMA 5JE8A 3CCCA 1O94D 2IIVA 5JZSA 3OSUA 3FJ1A 4KC0A 5EUBA 2BZGA 1K6MA 3EA4A 1CUAA 1XDBA 3HLYA 4M0MA 4BTVA 4TWBA 4KIGA 1BH2A 3EB9A 4PVCA 5KX5F 1JIVA 2YOFA 4XFJA 1VBNA 4LHWA 1I4DD 1D7OA 2X77A 2HLHA 2GBPA 4L07A 4KV7A 4ND4A 4RNCA 2QTVA 1H2FA 2W43A 1BE1A 3IXLA 2F1KA 4WZAA 4ZOLB 3AVUA 1EVKA 2QSUA 2DUUA 1VGQA 1T2DA 2H65A 2CLCX 3IGFA 3QXJA 4G1VA 1IOZA 4WY8A 4UEWA 1CW2B 1XKQA 4Q24A 3JQBA 1KJIA 4RSHA 3GAAA 5TLSA 1CKEA 3SR0A 3GFBA 1ORIA 4YV2A 1TIBA 3QXXA 2NUTA 2IBSA 4GPAA 5H4HA 5H4GA 3FCXA 4PHTA 3EISA 4AIRA 1UP7A 3EY9A 4D9IA 4GBED 4S1NA 1H2HA 1KI4A 2DPYA 1I2MA 4E07A 1Z36A 2V7BA 3K1ZA 4H1HA 5ERGB 4KOEC 3RUPA 5A6VA 1NW3A 4MKXA 1B7GO 2QNBA 2C03A 3RU2A 4C05A 4DPKA 4Q7MB 5EMJA 4P6VF 4BB0A 4D5GA 1AQ6A 5BYAA 1JE1A 5M34A 3O9VA 4LIPD 3BGWA 3JATA 2ZYTX 4RPGA 3SLGA 4F6RA 3B1WA 4FGUA 2C2ZA 2ZDHA 1CHNA 4I50F 4I14A 3HSKA 3LYLA 4FN5A 2F43A 1MO5A 2W2NA 3HA2A 1UJNA 1WDWB 4S1PA 5HIIA 1Z38A 2PGDA 3H9EO 1ZJZA 2I65A 1O95D 3HXKA 4GX5A 1P8AA 2I4TA 4BAZA 5C8ZA 6ADHA 2X6QA 2AD5A 4UPDA 3CF4G 5CA1A 3IR5A 3PEVA 4FFOA 3SIWA 5L4LA 5CYPA 4D8WA 4YCDA 5DOZA 2QRVA 4ER7A 4FW8A 5JAHA 1GQRA 3AR3A 1UDXA 3FSEA 5F5LA 2XYRA 4G0YA 4TVSA 4NYJR 1EFVA 3KQOA 4ZO7A 3SZUA 3WBBA 2EDAA 2RE8A 4Q4JA 1ZEMA 1YDWA 4DM7A 3HXTA 4PFKA 3EZ6A 3WDMA 3OUTA 4J7UA 4IMPA 1NUPA 3PVCA 5CXXA 1MIOB 1YCFA 3NC0C 1JFRA 4KQIA 1T9KA 2V1UA 3L7KA 3LC7O 4S12A 3MCTA 4H4EA 3E5HA 3DWGA 4F86A 1S3IA 2FWPA 3PXAA 4IGIA 2G36A 3LLMA 2QLMA 2OMKA 4ZHQB 2J3EA 2P5UA 2GHRA 2IYPA 2WJIA 4NCIA 2IS6A 2W8ZA 4XR4A 2XKBA 2WV7A 2UYOA 3HCDA 2EZ8A 4UTRA 3GJQA 2R86A 4KLRA 1C9JA 3CX8A 4FLFA 3O8NA 1OFGA 3QBVA 1J1IA 1ADCA 2FSVC 3NH9A 1YKGA 3OT5A 3O90A 4Q6BA 1KDVA 1HFWA 3H6GA 1HSZA 4X64B 1O6BA 4TL7A 4FWBA 4ZVUA 5A9SB 2VAWA 1XMQB 4KGDA 1YCDA 5TF0A 1NBEA 3R3JA 4IDQA 1R2QA 1PWZA 2QTCA 2B92A 2WJVA 2F9FA 4WNYA 5K4AA 4ARUA 4PN7A 2QE6A 3K53A 1XEWX 3UJCA 7REQB 3PNKA 1E2DA 2AQIA 4HH4A 4OHOA 3RRJA 2C2OA 2JLQA 2O2CA 1CUJA 3OLYA 4JYAB 2X9QA 1YTUA 2VDOB 3U80A 4AXBA 5DT2A 1GKYA 2JI8A 3ODGA 5IJZA 7YASA 5IAJA 1P60A 1PEYA 3PDJA 3QYAA 2PANA 4W5NA 2XWJI 1MEOA 4H08A 2FPXA 1JLMA 1NBIA 2DJ5A 2VK8A 3O6VA 4K26A 5JS8A 3S8YA 4E11A 1BS1A 2WHYA 4IF4A 4YJGA 4YRCA 5HVNA 3K4PA 2IXFA 4EUFA 821PA 1VKJA 3PGXA 4W8OA 5EJAA 5IXYA 2REQB 1ECJA 3F90A 3O03A 4TSKA 1C1DB 4YMVA 1DE0A 2XUPA 5E3JA 4AF7A 1HZZA 1VPEA 2QNIA 1R8SA 2BEVB 3KOMA 4PGAA 5D3MA 4PRZA 1U3CA 3IDQA 3K1AB 3MWKA 4L8WB 4ZO6A 1RE0A 4F4JA 2JEZA 1TUEA 4V0KA 4YAFA 4UZFA 4A5SA 4C06A 4UNQA 2HMSA 3JYNA 3AU9A 1Q2XA 3GD5A 1Z47A 2KX7A 2V74B 5JARA 2FV8A 4XGKA 5COQA 3FPCA 4BX8A 3BQ9A 1X92A 3OF2A 2B35A 4IKPA 4RANA 4KO4S 3U1VA 3UJ9A 3WRVA 5KNDA 1DVRA 3THWB 3CKKA 1DPGA 3G8CA 4F2HA 4POOA 4O4JA 4RTLA 3IO3A 2QXUA 4CN8A 2VAXA 2IODA 1RXWA 3GV0A 2Q6KA 1UZUA 1WG8A 4FHZA 1U9IC 3RTDA 3KPYA 1SHTX 3DYBA 4LGVA 4BKQA 1AQNA 1SG9A 5HZKA 1VHJA 1O57A 4BQPA 1K8ZB 2LIPA 3H5WA 4KGZA 1SCUB 2J4FA 1LJ8A 2O3SA 1ES9A 2A35A 3CV3A 1W85A 4ADSG 2C7QA 2VXBA 4HEA6 1QNLA 2DFDA 3WV5A 1T5OA 5IKMA 4KXQA 2RSLA 3BXXA 3R20A 5K3SA 5CFMA 3A3PA 2WHXA 4WASA 5L9AA 3U0VA 3MUEA 4ALKA 4EIWA 5CFOA 2GK4A 1I5EA 5CT9A 4ZTBA 2ZJ6A 1SUSA 4NAUA 1Y5LA 3TRKA 4AJHA 2BV3A 3TXXA 1K3TA 3D2CA 3U48A 1JHYA 1WDTA 3LKZA 2HK6A 1RRFA 1NF8A 1UMCB 1PZFA 3LF2A 5DGTA 2E6KA 3M82A 3PYLA 2E6UX 3LYUA 4RH3A 4BVLA 1MX1A 3G0CA 3IESA 3KPVA 3OWHA 4RPLA 5SZKB 4QBKA 1R37A 1ZJYA 2FP4B 3SYNA 3GLHA 4DARA 2OEPA 1WXHA 1LBQA 3HXLA 4P80A 2GFIA 2J5KA 3L6EA 1QKIA 3PRHA 1BYIA 3GEHA 1LFAA 4URHA 3QHAA 5I5GA 3TBHA 3ZDXB 4N3BA 4EVRA 2G1PA 3FPSA 1NMEA 2QW8A 1P91A 4H7IA 5EIBC 3NEPX 1FYWA 1FOEB 1KVUA 3W9YA 3U56A 2WSIA 4QBHA 4MDEA 3NXSA 1CEEA 1W29A 3P26A 1XTSA 2QRPA 3AUJB 1OE0A 4NZMA 1P4RA 2XE4A 5EWJA 2R751 5AUQA 2QRQA 3I52A 3GW8A 3OLQA 4I5EA 1L4YA 3V3TA 2XIJA 4HEHA 3MSCA 1RZVA 2VP9A 4KWHA 5TMEA 1PJ2A 4PU0A 3KDSE 5LDGA 1U0FA 2A9FA 3HCNA 4H0NA 3N74A 1U9CA 4O1IA 4JLVA 2I1WA 1GTMA 4YRAA 1QSGA 4WXPA 1M8PA 3SSMA 3EW7A 3FIUA 1RWQA 1DCKA 3OX3A 1P7PA 1SBCA 2FHSA 1YDHA 2H1HA 3JD0A 3MGGA 3O8OB 2I99A 2NTYC 3PCXA 4PX2A 3DE7X 4CMBA 3KZKA 3RBVA 4TYQA 2PQ2A 2IUSA 3IAS6 3NIFB 5L6MB 1UBSB 1H1DA 2YV1A 4LMRA 1IRIA 2FUG1 4AS1A 3S2EA 4PYLA 2LXNA 1R18A 4BVAA 1SBYA 1CY6A 2C9YA 3QPDA 1DKMA 5LP6C 5KYXA 1OB5A 3BFVA 3IUYA 3NO4A 4X1OA 2X0NA 2F00A 3OLVA 2YWCA 4B43A 1C0LA 2PUJA 1RDFA 4MYRA 1CJBA 3QE0A 5COAA 3B8EA 2ID7A 3HL0A 4NNOA 2AJDA 1IEQA 4J0JA 1H1TA 4W9NC 3V4LA 2P4QA 1AGRA 2ODAA 2ILTA 2JAHA 3T61A 1RQXA 4EVSA 2YWGA 2EKQA 2IHYA 4RD4A 1SIWA 5HDQA 1V6CA 5JW6A 1Z4PX 4NU6A 2EZTA 4FKZA 1J33A 4FBLA 2XVAA 3WADA 4GUAA 5IBRA 5CB0A 1KERA 1Z06A 3MRTA 4WN9A 2WE7A 3KK0A 3U7FB 1FU8A 1EXDA 4IG9A 1N33B 4ZQHA 1C1XB 1IULA 1H6BA 4N6OA 3UYLA 2Z4TA 1NVUQ 3BS4A 4WI1A 4O6VA 1DKOA 4Q01A 1XGKA 4IUDS 2ZK7A 1TGYA 2FFQA 4BMOB 1CIPA 1IN7A 4RA6A 3SN6A 5GWXA 3C4VA 2PX8A 3NBUA 4WNIA 2BFBA 3OE4A 3B6KA 2QJRA 3EEFA 1NVFA 3UQYS 2UVPB 3OIUA 2VCEA 2P2GA 4IGAA 2W2VA 3KO8A 1VIMA 4UHJA 4A8JC 1WM1A 2I7VA 3UMVA 1KMMA 1KO1A 3PQ8A 3EEIA 4PO9A 4FYKA 3LT2A 3KZVA 4MI3A 4HYQA 5MDHA 1VRWA 4Y6RA 2MSWA 4IGEA 3AK4A 3COZA 1CEXA 2UAGA 2W90A 5EJFA 2FKAA 1XZMA 2WTMA 1R7RA 5LOVA 3P5BA 3S27A 2JFBA 1FBTA 2NU6B 2CFTA 3AR4A 1RXSA 2VSYA 1XTJA 5LA6A 5JQGB 1WRBA 2K6GA 1U04A 1NY5A 3IP9A 1YDGA 1RADA 2COEA 5JY6A 1J0CA 1IM5A 1Y4SA 5DP1A 2XTZA 4MS1A 3U3ZA 2A2ZA 3MG9A 3NATA 4V1CI 3SYKA 3L4KA 3GA0A 1AKEA 1Q3HA 4LY9A 1CB0A 4M55A 4PC3A 6GPBA 1P9OA 1Z7EA 2BUCA 4CN9A 5JAMA 1W4RA 3QWAA 4UMEA 3ET4A 3D4OA 1L4GA 4D3XA 2R1TB 3AF1A 2DB3A 5L3QB 4ITUA 3TF5A 3JD4A 2L18A 3E9QA 3K72B 1OA0A 1NZDA 1YVUA 4DMKA 3O75A 1P5ZB 4JJEA 5LP6B 4JBNA 1AVTA 5LQCA 1HO3A 3RRNA 1BSVA 1GP2A 3C5HA 1AF7A 4B7XA 4J1QA 5FQNA 5KWEA 4OFWA 5AUPB 5I8WA 5K05A 1N1EA 3DZIA 1LDYA 4MVXA 2JLUA 4D0GA 3Q0TA 3Q7TA 3P94A 4R9VA 5HJ2A 3JQAA 4PXYA 2VOJA 4X1YB 3S55A 2B4QA 2GAIA 2P6PA 3WYBA 1ABEA 4F72A 4YV1A 5ENDA 3IDFA 4TMFA 2C42A 2QVCA 4R8RA 4W63A 4CFZA 2DBZA 3ZWXA 2V7PA 1LBIA 1SJ9A 4C22A 1Y3HA 2AXQA 3FSRA 1ZK4A 3SS9X 4F5EA 3RFVA 4DLAA 1JQLB 1G60A 3OE1A 4MHOA 4ZCIA 3ER9A 3MB5A 1ZXXA 1T9GR 2FW0A 3IJEB 3ZIDA 2RARA 1HDGO 2IE0A 2XECA 3A6FA 3CINA 1QHSA 4FKBA 4RUKA 1IN1A 4F6LA 2C61A 4M0FA 2DFVA 2GO7A 5E9JA 1RRPA 4QFDA 1ONSA 2CV2A 4QICA 2WYVA 4MW9A 3M6IA 4X91A 3SDSA 3K9GA 4A8JB 1TLFA 3AW9A 4TL8A 3R7FA 4I5IA 4AKTA 2ZCVA 5AVTA 3R9XB 1L7EA 5JZBA 5KZMB 1VC2A 4LISA 1ZVMA 1VGRA 2WICA 3ZR4B 1E66A 3H1PA 4ONEA 4YFVA 5L3ZA 5TSDA 3ZWNA 4V0NA 4DG9A 4ZI3A 5JAQA 5C35A 5T7BA 3JQBC 5B7GA 4B3XA 4KXFB 3B6ZA 1ZCJA 4TN5A 1FYFA 3HTXA 2GD6A 2IZ1A 3DD5A 2G8NA 2ZRGA 4DEXA 1MW9X 1QFJA 2QMEA 2VRWA 4AMUA 3EYAA 1S2MA 3G2HA 3MS7A 3OZDA 4WZBA 1GYQA 4H7EA 1VHLA 4JBLA 1Q5PA 3ESZA 4ND8A 4P5PA 1T10A 3SCZA 3CNEA 5DM4A 1GU1A 1N6IA 3JWEA 4HRYA 1SR8A 3E81A 1XO1A 4TTJA 1P17A 3DEJA 3BGOS 3I1JA 3QG5A 2V1XA 4PS0A 4ZT6A 3VPXA 4DN6A 5EJ6A 1DRKA 2P0YA 3FB4A 3R75A 4HEQA 4EY6A 5HHTA 2NACA 4OXRA 3BMNB 2DPGA 1A69A 3VPHA 4NCKA 2IQ5A 2JARA 1K68A 1Z45A 1YZTA 3AEKB 3OU2A 4P1ZA 4R2WA 3VR6H 2XMCA 4LJAA 1ZPDA 4EEZA 2OXIA 3U7RA 3QVGA 1QR6A 1ZH8A 2WZQA 3FHOA 2XGGA 4LFCB 5ICGA 2EF1A 2LW7A 2QLFA 3IODA 4M8IA 3W0LB 4C0XA 5HOQA 2AZDA 5E0KB 3BGDA 4BN5A 1IH8A 2GD1O 2HJ9A 3IP7A 1L5HB 3LPDA 2Q3LA 4PBTA 2G83A 3E2MA 4P34A 4ZARA 5KTSA 4BO7A 1XVAA 1PDVA 1FQWA 3IURA 4NJMA 4QGAA 1LTKA 3AKZA 2IU6A 1V47A 4EKNB 5JOQA 3GY0A 4L8VA 4LE2A 1GLGA 4RKRA 4K9KA 2DETA 3TUIC 4Y7CA 1ZHHA 1X7WA 2V45A 3F7OA 1ZM9A 4D0NA 4I4TB 4Y2JA 2P9HA 1KEEA 1EFDN 4KDEA 4R2JA 5K3CA 2X2OA 3L82B 2ZYGA 4L6AA 4EJMA 4AJPA 4HPJB 1YF3A 3E8SA 3WHLA 1OI3A 1A8PA 1VFNA 3H9JA 1DJQA 2ZR0A 3NTOA 3SSAA 3CISA 4ECEA 2C9MA 4A8HA 1E3TA 2VK2A 3OICA 1C3LA 4OB6A 4HUQA 1VL8A 3BC1A 3S5UA 5EMLA 4II3A 1MC4A 1N32B 2D0PB 3EXHA 1LK7A 4LHSA 4Q66C 3OQNA 2SCUB 3QP9A 4AKSA 3S68A 5H80A 1D8TA 1P73A 1N78A 3UT0A 4E2WA 2LCFA 3JQQA 2CCJA 2YYSA 4NL4H 3T5CA 1DIHA 1O6FA 2YXEA 2H3HA 5GMOA 4EG5A 1MW8X 5T8KC 3D8UA 4KDCA 1GRNA 4YJHB 3EEOA 3OSZA 5A4FS 4NBVA 1VDMA 4GPTA 1G63A 2D2XA 5TR9A 3ROQA 1PSZA 4XYGA 1E4VA 1PR2A 3AHFA 4OHFA 1SPXA 2I8CA 3UATA 1XVLA 2HHJA 3X2FA 3KKEA 4MKFA 4QRDA 4B81A 3DUWA 2ZCUA 4RHXA 1N9GA 1ISPA 3B3FA 5IDQA 1YBVA 1OXVA 3TLAA 5JS2A 3B5EA 4DLUA 4P38A 4YUAA 3A06A 1BGWA 4DWWA 2W2OA 1D1PA 2NPFA 3WGJA 1M2WA 2X4GA 2IV3A 3JYOA 3K0CA 5JI3E 3CEHA 4HMQA 1WKVA 2AOUB 2J5QA 3LQRA 4GW3A 3LXUX 1D2GA 4JUIA 4N39A 4EUNA 2I67A 2QWXA 1HZZC 5L7YA 2C9ZA 2MYPA 3PD0A 5DLQC 2QQ0A 5DNDA 3IL2A 4RY2A 2B2XA 3ICCA 1CP3A 1CB7A 4Z7QB 4LUCA 4PV7A 4J2TA 4BE4A 4QU8A 5CA1B 1BE8A 5INTA 3GCXA 4ZV9A 3RUDA 1QQAA 2J31A 4F91B 7MHTA 4D4KA 1E0SA 4X71A 1LZKA 5EOVA 5G4KA 1XTKA 5EE3A 3TKLA 4ARZB 4E30A 3OEHA 4Q4JB 4TZ0A 4LOJA 4YXFA 5CMLA 4M9RA 4BP8A 4KVGA 4DWJA 2RIPA 5GPBA 3ND5A 4ZA2A 5K3BA 4N3NA 5CG2A 3T12A 3CH5A 4QU9A 1U0RA 5BSGA 1YS9A 4PSAA 4YY3B 1VE5A 2HTFA 3W8DA 1XTTA 1LGYA 4L73A 3C7CB 4QKQA 1P7VA 2Q46A 1AT1A 1JKMA 1VSQA 4US0R 4ED9A 5IASA 1FPQA 3T06B 1P44A 3EGDA 2YWJA 5EXDA 5B7PA 2IOFK 1SQFA 4BV9A 2J45A 3MAGA 4DDHA 5EGNA 5KYKA 3JV7A 2PRKA 3G2LA 5AK3A 3IMGA 4ZVRA 3NDRA 1TZCA 3GG2A 4I1VA 2QE7A 2NM0A 4PR3A 3K94A 4P3OA 3UQZA 2AE2A 5BVHB 3LK6A 5KAPA 3RAEC 1E1YA 3IHWA 1B76A 4DV2B 5BV1A 4FFNA 1JU9A 3U7EB 3EWAA 2AX4A 2I3BA 5FNVF 3QLVC 3A0RB 5FI1B 4H7KA 3E9NA 2XCUA 3IO5A 1V6SA 4JASB 5D6OA 3ABZA 1FXUA 1ZHFA 3LLUA 2PL1A 4URWR 2VBFA 4M37A 4RDCA 2Z6AA 1TT7A 1L5ZA 2GCIA 2H2DA 1OTXA 3KQMA 4FJ0A 5LSAA 221PA 4IRMA 2Q5JA 1UZNA 3LUPA 4FPXA 1ABFA 1BCSA 2PMKA 1G21E 3AETA 1E2QA 4LDZA 3HVHA 3IEPA 1WUKS 2OZPA 4OLJA 3MRXA 2IUTA 3P9ZA 5E7QA 3QFCA 2IZ5A 1ZUNA 5B1SA 3S5JA 4YJGB 3WKEA 1N7IA 1TU3A 2IIQA 2CWDA 3L07A 3KWFA 3PX2A 3ODPA 4MVJG 5DDIP 3L0CA 2GPJA 5U1PA 5L8VA 3TVTA 3OTOB 3AQIA 4RCYA 4MB0A 3O94A 3RB8A 3SQDA 1OX4B 2OQIA 4BO0A 4O25A 4YRBA 1F60A 2Y1OA 1ETHA 2DAPA 5EZYF 1WY5A 3IHTA 1PGNA 4N5HX 4J7AA 5EE9A 3L84A 4RQTA 1DXHA 1QIMA 2YL2A 4AG3A 3ROPA 4IHJB 5DB4A 3MTEA 5I9NA 2PDAA 2G4VA 5DIZA 1N8KA 5G0UA 2ECPA 1KEUA 2J48A 4MV3A 1HDXA 3DGEC 2OZLA 2HIGA 2WU1A 3KOZA 4X00A 4G0NA 4LBVA 2BRUA 3FN4A 3N7TA 3GJSA 4RC9A 2BBSA 2A33A 4X0EA 2VTBA 3C14C 5IF9A 1Q17A 1W8IA 3GUZA 3PU6A 5EP4A 2P2CA 2Q9BA 3VOTA 5K0TA 1MQ9A 1H85A 1PYOA 1IXKA 1L5WA 4I36A 3SC3A 3GNSA 4ZYLA 2CWWA 3D6NB 1QCZA 1KZGB 1EU1A 3C3JA 3EMDA 3KEMA 4PNZA 3ANLA 5P8WA 1PK7A 5SY9A 2V6MA 3QVJA 1A2KC 3BAZA 2O3RA 1QJCA 2P4HX 1UH5A 4E22A 4OF4A 2XHZA 3BTUA 3R24A 5IXSA 2Q3CA 1ZH6A 5A3VA 5ITZA 2K87A 1FFYA 4LSZA 9LDBA 3FYUC 3GX1A 1FUEA 3VZCA 5KDLA 3RC2A 3UJHA 4GPBA 1YA6A 1NT2A 4YR7A 3VNVA 1MX9A 3B3GA 3NLLA 4GOJA 4QYMA 4LXUA 2ZRIA 3IUMA 4Y1GA 1JHDA 1GNTA 1X39A 2FSGA 1VSVA 4XJTA 4EUSA 4L4ZA 5LMZA 1OYWA 3DOFA 1NPDA 3CF2A 3W5DA 4R0NA 2ZXEA 5EKUA 1Z08A 3GLHB 1T1GA 2ZU0C 2H16A 5H7XA 2A9PA 1T5LA 1DC5A 3C8UA 1QYXA 3DNFA 3HYRA 3H9CA 1KKMA 2QZJA 1W5SA 3I9JA 1XP5A 3ICPA 3A2LA 2P27A 1AC5A 5DTIA 5CAEA 2WM2A 3UGTA 3L7BA 4GMGA 3GC6A 2XZOA 5F12A 4PC6A 2J0UA 3VM6A 1G64A 1GZ6A 1NX9A 1DKRA 3DEAA 3FPFA 5HYVA 1WETA 1HE5A 3GLVA 3Q2OA 3GJZA 1OT3A 3H7AA 4DA8A 1J42A 4NZOA 5HZGA 2C5BA 1Z6XA 3L7JA 5BN4A 2V6FA 1EFTA 4KXNA 2CE2X 3DVQX 4DLZA 3IVGA 4MJXA 1EK2A 4KN8A 5A0FA 1E0DA 1EWVA 3BIXA 3F49S 1TFUA 4BUJA 3FNIA 1L8QA 4PQFA 4FOTA 1QCYA 2YMPA 4YH1A 2RHJA 3FTCA 2YOGA 5B53A 3I3OA 3VOSA 1FUUA 1CZOA 4EMBA 2DHRA 4LOIA 4OQNA 2Z58A 3D3KA 4X6XA 2DPXA 5EA2A 3FCAA 2Q3EA 4GC9A 4O4LB 3UK6A 4NCAA 4BPRA 3PHIA 2RB4A 1EM6A 3E4CA 1I0LA 3DMFA 1UDCA 3WSWA 2WUVA 4B17A 2PKWA 3GFVA 1QO0A 2DH6A 4NESA 5TT0A 5JNTA 2D2VA 5IYZF 4J1SA 1J8DA 1KJNA 1MNAA 2XWBF 4DNFA 4AMGA 3LUAA 1N1MA 1XQWA 2XZTA 1RXIA 3LDGA 5CGQB 3IMKA 1BW9A 4DWVA 2CD7A 5J43A 3I62A 1L4MA 2Y0CA 1PZHA 2BCJQ 2FPIB 1JLSA 3PPIA 3L6BA 2AXPA 2QRMA 2FR1A 2Z4RA 1IXZA 3ZWYA 2VC2B 3FYUB 4MKHA 2VYVA 3ZCVA 1P2UA 4L6IA 2PXCA 3RNOA 3SOPA 4DVJA 2E37A 1CRLA 4WN9B 3ICWA 3RF6A 2R47A 3UC5A 4YR9A 1KRWA 3OZVA 4L4XA 3VTZA 3U44A 4KR7A 3KSMA 3Q5EA 3H7IA 4B74A 3SMQA 4ASUA 4JLNA 1OTYA 4BDSA 4B6FA 1TC2A 4DLXA 3LZ6A 4IBOA 4RYLA 4PYIA 1YB4A 2O8BA 1U9YA 4UUOA 4TKZA 1NQVA 1PD1A 1OLUA 1WXQA 5AI9A 1BKSB 2BFBB 4O2AB 2D5IA 2GYUA 2VOEA 4RFVA 1YK0A 4MXDA 3ZI7A 5JMTA 3N2LA 4ND3A 1PWYE 3ZWPA 1EVJA 4QELA 2WEKA 5ESWA 2WK1A 3PFIA 5A5DA 3ER8A 3HVUA 3KS9A 4BQFA 4BVEA 3LPCA 1Y6ZA 3C1OA 2DTDA 4RTSA 3QZUA 4I8XA 4ML3A 4PZEA 3GRKA 2FK7A 3T1NA 2IPLA 1SUDA 3TD2A 2I3AA 2QZPA 2QF7A 4E5UA 2QTLA 1F1BA 4QQKA 3NU1A 8ADHA 1U65A 4MDHA 1T8TA 1UBFA 2QY6A 3E53A 1EHYA 3ZHQA 1JDBC 5KX5A 4HEA1 3RLIA 4D9HA 3C3DA 4M87A 5AJWA 3OI7A 2L19A 4K8OA 4QYWA 4MB2A 4Q37A 2O6HA 2FUEA 3HRIA 3ZDEA 1WW8A 1OR8A 4AM8A 2WU4A 2B30A 3MLAA 2BFEA 1SXQA 1P1KA 5NULA 1HE3A 1KOJA 3EGCA 4MS1B 1ZGZA 4MVJE 4D4HA 1OW3B 4FINA 1LS1A 1CR4A 1TAGA 1NZFA 4A73A 4B0PA 4RHYA 5FWNA 3B38A 4A6PA 4CKBA 5JXHA 1OYOA 4AXXA 4BMCA 3K2EA 2PKYX 2R7LA 1ZMTA 4RCZA 3R09A 3G8AA 1CXZA 1SULA 2A0UA 3AV0B 2PMDA 4MV1A 2V4MA 4WW0A 1Y7TA 5TQ2A 4ZI5A 1Q11A 4PYQA 1UK8A 2Y92A 1E60A 3ZKAA 5KYUB 2QLNA 1C7FA 3IP1A 1BVYF 4X1IA 3DVAA 1K7FB 1MFPA 3DT9A 1JAHA 2VQDA 4KUGA 4OK5A 3ED5A 4PTYA 1C2TA 5EFOA 3VZBA 3CW2A 4XCXA 2Q21A 3EC2A 1GZVA 3VX3A 1FNSA 1SC6A 2Z3VA 1AM4D 4TLAA 1AO0A 1JPUA 1R0KA 2E3JA 3RSSA 4I50A 1A96A 2LBPA 2NUAA 2IZ7A 3MGKA 3NM6B 4TGLA 5K45A 4AI6A 1GNQA 1E5XA 3MTGA 1BA2A 4GSLA 3AILA 1LV8A 1N5IA 4QUHA 3H5NA 5A2QA 5ES4B 2CJWA 1NP7A 1N2HA 3TRIA 3VI4B 3ZCSA 1JSLA 3FWNA 1SO8A 4B9AA 1J8YF 1JR6A 1H3EA 4HRVA 4LFAB 5LJLA 1AXRA 1YZQA 3K1YA 3I01A 4JH0A 4X97A 2O7SA 2VN8A 4KQ2A 5BP7A 3IQZA 1OXSC 4BV3A 2EP7A 2P4UA 3ETGA 3G5LA 1JB9A 3HY6A 3ABSB 1UEJA 2NSJA 1Y89A 3V42A 1BH6A 3OQVA 1ZO8A 3IAS1 4B3FX 1RJWA 4AG6A 3CNHA 3D0KA 5JXJA 1I3NA 3LIPA 1JAIA 2EP5A 4C7BA 4LJ6A 5BV7A 5C32A 1IOWA 3ITNA 5FLYA 4GAEA 5FWYB 3HDJA 4ER6A 1EE9A 4Z54A 4GGPA 1YR1A 1WKBA 2C04A 2ZRJA 1JDUA 1LEHA 1VPLA 1ZVQA 3DNMA 1M9NA 3GA7A 3C6XA 4R1NA 1RXYA 1JDBB 2IXTA 2VP5A 4KJZA 3FOAA 4QTXA 4U6NA 1IY9A 3HCCA 4R6XA 4XM0A 1VJ0A 2WWVD 4DLSA 2R7MA 2FYTA 4JXKA 2VRNA 4WZBB 4HGQA 4N65A 3WK5A 4QSHA 1YQWA 2XUHA 3LKDA 3UJBA 1M2OA 2FEOA 3K8OE 2O52A 1Q0PA 3HCOA 1RJEA 2VAPA 3HB9A 4WH0A 4KIWA 2YWFA 4J0KA 5IEJA 5T4FA 3FTEA 1FP7A 3H04A 4QT0A 4CF6A 1GGMA 2OBLA 3EDYA 4X44A 2IXEA 5HUQA 1NPYA 5EMMA 1ZOPA 1R8YA 2ATCA 3Q2KA 4IRUB 3R9KA 3I05A 3K0CC 2ODTX 3KTFA 1F0KA 4ZCLA 1A9PA 4U7PB 3I53A 5EJ8A 1H9AA 1XK6A 2CLSA 3B9QA 3ZCXA 4MMZB 1KMHA 1EBUA 2LUOA 1Y5MA 3QVVA 1H22A 3RM3A 1L7QA 3PNPA 2UYCA 4I1OA 4FE7A 3FGNA 2RMKA 4E2ZA 1Z12A 4NULA 4WSOA 2ZI9A 2VYCA 2GZ3A 1Y0BA 2VVTA 4D80A 4CGYA 1MAAA 3H2YA 1R9MA 4UVEA 1MPTA 3TTYA 2XUFA 2QUHA 4GLJA 4GZ3A 2F8TA 4ZHSA 1SELA 2QV7A 1Y82A 2CFOA 2F2TA 3CUSA 3K6SA 3A6EA 4G81A 4AB1A 3D1LA 4FMDF 1U4SA 5CB4F 1X7WB 2IS2A 4KPGA 3MWDB 3ORSA 5KWVA 1HOXA 3HSSA 2HSJA 4WV3A 4MTLA 1GZDA 4ZAXA 1ZHOA 1I10A 4L9SA 4GX1A 1PVDA 2COKA 4BBJA 4KRXA 2H57A 4TVOA 3EWSA 3ANSA 2V59A 3LAWA 3CZ9A 3NDIA 5ALXA 1RC8A 2EV9A 3D6JA 3U4CA 4XH9B 4XDZA 1PT9A 1ZDMA 1MZPA 1TF7A 3UJ6A 4DKJA 4P4GA 4JB0A 4JX9A 4FZ3A 2OHHA 3IT1A 3TZHA 3ADBA 2J8ZA 4G41A 3E1KA 1DTEA 3GJ3A 1GKUB 3I0ZA 3DV9A 2QMYA 5KOIA 3NFYA 3LPLA 4E03A 3ZXIA 1N8SA 4RIHA 1YA8A 1FX0B 4IHAA 4FW9A 3QG1A 5JMOA 3NIBA 5AIBA 4RQBA 5B37A 2A7XA 2UUCB 2IX9A 1P45A 4Q9DA 3VPAA 4S05A 4B9EA 3GLUA 1YH3A 5A03A 1JX6A 2V3CC 1IY0A 3QEBZ 1U02A 3HACA 1FU4A 1ZZEA 4I8DA 1H2YA 1U81A 2R2GA 1Z4QA 4JQZA 1O0CA 1E9DA 1ETUA 3VKWA 4DDTA 1FZTA 2OR3A 2PEZA 2C77A 2RHGB 1Q7EA 1QUEA 2FPRA 4JVMA 4BS9A 4Q21A 4B3TB 1NFFA 2I3ZA 5KOJA 1YQDA 1Z62A 3VC2A 1NIJA 1A2OA 2A0YA 2FMFA 2YCBA 4KWCA 5EXPA 5AKXA 4ZCRA 3G8DA 5HCUA 1UBUS 2VIIA 2M6LA 3OPYA 1PNTA 4MIKA 1ZJ4A 1QYVA 2BFWA 4ALMA 4R1SA 3SP1A 1QO9A 3FSGA 2TMYA 2BSQA 4QDKA 3A4MA 1JFVA 1JXMA 1G20B 3WLMA 1SCBA 4HLUC 2BKUA 3L7NA 3KZCA 3WNDA 2UVDA 4RY0A 1VPVA 4KO3S 4UOQA 2PRJA 2HU7A 3ZH9B 2GA8A 3OF3A 4A6DA 1LBEA 2PH7A 3RIEA 1KKLA 3W9BA 3WGHA 5F3WB 1A5TA 2VT3A 5G4KB 4BQOA 1SXJE 3PJGA 3VKHA 1KSJA 2QJOA 3B7PA 2W58A 3OCVA 3AM1A 3BIOA 3QHPA 5MFPA 2A1TR 4X85A 2BRUC 4PRLA 1ZH2A 4RXTA 1IIRA 2NXJA 3SJCA 4X54A 4YJKA 3VR6D 3VHLB 4EWLA 5BQ3A 1T2UA 4BFYA 4FEYA 3EULA 3P0HA 3OIDA 3I8OA 4CQJA 1C7ZA 3OG9A 5JBIA 1NVEA 1HBJA 1UBEA 3I9FA 5FOUA 3AHCA 2XUOA 5AKJA 2WG0A 3OM0A 4ZKDA 2JF0A 1N25A 4RVNA 4MYSA 5J4YA 3FUUA 5HJ5A 1CFJA 3IP8A 2PU7A 5D01A 3NALA 5DTMA 4ZYXA 5AXDA 2CMGA 1LWNA 2J3DA 3PC8A 3ZY6A 1MENA 1Q6YA 1NM5A 3EZ7A 1N2BA 1GR0A 2DVMA 1L5SA 4W1PA 1JHOA 4ZVVA 3FCSB 1X9IA 3GNTA 1XBTA 2XDYA 5ER9A 4A26A 3PXUA 4IO0A 3U49A 4TXNA 5IKXA 2XSZD 2R7AA 4Q48A 1O96A 1KMQA 4FGWA 3QFTA 4OHBA 1JEYB 4P3YA 3AJ8A 2XB4A 1SOWA 5DK6A 3VAYA 3MBOA 3L0OA 3NQ41 1W93A 3QE2A 5KNBA 1SK9A 2OV6A 3IVCA 3MTDA 1DQPA 2A14A 4LJ4A 2OXRA 1BCSB 3AETB 2XEXA 3N3AC 4DNOA 4DR1B 4RJIA 4BLQA 2PX0A 2RHMA 1OIVA 1ZSNA 4Q3OA 3RFXA 2XYVA 4YQZA 1E2GA 2GEJA 1UP6A 4YS6A 3ZE2B 5B1YA 1LPSA 2Y4OA 3K9QO 2PUBA 4AJKA 4WIAA 2EDCA 1QP7A 3LQ4A 1ISHA 1SC1A 1Y48E 6AT1A 2QMHA 3I58A 1RVV1 5DI9A 5ESRA 4GVLA 1WSBA 2BSXA 2GN9A 1H1LA 3IP6A 3JAKA 4FJ2A 4MIYA 1WF6A 1H8HA 3WGQA 3EW9A 4DSNA 4AZTA 1QHFA 2IVZA 3PL1A 3RDPA 4BX3A 4ZMSA 2IRWA 1J8QA 2ZR7A 3NUZA 1XRJA 3OFVA 5BSKA 1UXGA 3E7FA 1H3NA 3SXUA 4DR4B 4MRAA 2JD2A 2OZLB 1OVMA 2X8LA 3IBTA 4TQAA 1J2RA 3HQ4O 4L74A 5SY4A 3TL3A 5JJBA 2BFPA 3MXOA 1T2NA 3Q9SA 3COJA 1WUYA 2VTBB 2VP2A 1IQUA 2A94A 3TB6A 5B3KA 1T2CA 3X43A 1I3KA 4QFBA 3CRRA 3H9UA 3DLTA 3K9HA 2ZSKA 1B2LA 3DAOA 2WIDA 4IH1A 4OGKA 5DXAA 4DRXB 2ZI6A 3F6SA 1Z4IA 4EHIA 2JD1A 1LLFA 3HVIA 1V3TA 1CJUC 1VRVA 3BK7A 3NTLA 4MPDA 1OZHA 3X1MA 4IJ5A 4KBYA 5L51A 2GCGA 3SJZA 4P2BA 1JKXA 1JHUA 3GEPA 1CRWG 1J7JA 4DMFA 2NU8A 3VO9A 3OKFA 1T0JB 1PVOA 4CHGA 3OOJA 3L0DA 1WAMA 2IIPA 4OX9B 4NZZA 1XD8A 5E7JA 2ZSDA 2FFRA 3IAEA 1YQTA 1CNEA 3L4EA 3CJTA 3L8MA 4LI3X 4R5HA 1SOAA 3V2GA 2XKJE 2L69A 1U90A 3VR3A 4D02A 3D31A 3OF5A 1PJSA 1SG6A 1UZMA 1ZUD1 2JH8A 3R4CA 4YI3A 5FNZA 4Q4CA 2JFZA 1EBFA 3N2KA 3ZQJA 4IZOA 2DFLA 4HH1A 3I6MA 2FR8C 1DX6A 2QY9A 3CLUC 2ORED 4QFMA 4D4LA 2F7SA 1SCNE 2AN3A 4DIMA 1M2FA 3KEQA 3CURA 4FCWA 5LNK1 1F2VA 2DWUA 2I87A 2FG5A 1MTZA 1TA4A 2RKOA 2Y1EA 5AHRA 2BBOA 5ALDA 3T54A 1SH7A 3ZK7A 3VSBA 5KQGA 3REGA 4RVGA 4AY2A 3G1TA 3TTTA 1JXOA 2EW1A 2JAXA 3G2QA 3ZHUA 1TFRA 2I7CA 4F04A 2QA5A 1OH8A 2WWXA 4J2OA 5JNUA 1ZVVA 2EKBA 1QDUA 1WLYA 2YMMA 3K09A 2DUMA 4L5CA 3BULA 3PBKA 3L9XA 4IILA 1E3IA 1N7GA 2ZRPA 1XPJA 5AXBA 4QHTA 1R4NA 1JMYA 1ZNZA 1I1NA 2R44A 2VJAA 5DX1A 4FZVA 2NT4A 4DEYA 2D2IA 1TJYA 5DXFA 1H66A 2I2DA 3ZWAA 1F2UA 1NSFA 2AFIA 1F4PA 5AW2A 3V2UA 2VJLA 3FWKA 4S2UA 3O95A 5EZ5A 3UC9A 4PHCA 4DCGA 3MWYW 2ZETA 2QAIA 4L9RA 3AF3A 3T9BA 3V1LA 1JU4A 1OBHA 1OX5A 4RK4A 2W11A 2OLJA 1KMIY 1Z83A 2H54A 2BM8A 4DE5A 1CR2A 4PCVA 3G0DA 3WV4A 5BSVA 1C9KA 2ODBA 3BD7A 5CA0F 1SUWA 1SIUA 1UDWA 1RLJA 3GJ5A 4BEJA 1V8BA 1BHJA 5HR5A 3CWCA 1XN4A 2HXSA 2HF9A 3DBLB 3A27A 3V7YA 2Z5LA 4UU0A 1GG8A 2FHPA 5IHXA 3NWOA 5D7NA 4EB3A 1YASA 3DWIA 2XOKD 3N2YA 3C87A 4BFSA 5A04A 3PA6A 1DC7A 2O48X 2IP2A 4BB5A 3HDVA 1Z3CA 3BRWD 4DNXA 1V2HE 4HAUA 4LJRA 4RL4A 2F62A 1HH4A 1ZCAA 1EGVB 1AKNA 3X2SA 4R2XA 4U7WA 3N0XA 2R84A 1W75A 2DUNA 1SZJG 3JQCA 5DGCA 1BW9B 5CP8A 5FR2A 3VHXA 1M6YA 1Q3TA 4WKPA 2RHHA 4ER3A 5TC4A 2JH9A 2V7UA 4AJOA 5DLDA 3TQOA 1AV6A 3DDWA 1I7QB 4G0WA 1Z6YA 3NWJA 3VNAA 1IN5A 4B84A 1KH2A 3L0IB 2PWZA 3DT8A 2I2CA 3DPUA 4K1XA 4LVUA 3DEKA 5E2IA 2PN1A 4RE6A 2WNSA 5B1IA 4M0KA 1IBMB 2PT7A 5KQMA 3WL6A 3V8QA 1VE3A 1KJJA 4CZ2A 1P29A 1EX6A 2VI5A 3OA0A 4PIMA