4X3PA

Sirt2 in complex with a myristoyl peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
297
Chain Sequence
b'GSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Sirt2 in complex with a myristoyl peptide
rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
total genus 98
structure length 297
sequence length 304
ec nomenclature ec 3.5.1.-:
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4x3pA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4x3pA01
1PO7A 1PT9A 3GLTA 4RMIA 2IHUA 3CF4G 1PNOA 2QQGA 5MF6A 2OORC 4RJIA 3HWWA 3EY9A 1OZFA 4BUZA 2H59A 4MPRA 5EJ6A 3U3DA 4I5IA 5EJAA 2FRDC 1U31A 4UTVA 4RJKA 2UZ1A 3EA4A 5EJ7A 1M2GA 1ICIA 2H2HA 2VK1A 1YC5A 5EJ9A 1EFPA 4L2IA 4Q9DA 1V5GA 4MZXA 5AHKA 2VBFA 4GP9A 3E9YA 1D4OA 1Y9DA 4JUCA 2IHVA 1POXA 4V1CI 1POWA 4BVFA 1OZHA 1YTLA 3PKJA 4HD8A 4FZ3A 1EFVA 2WVGA 1JSCA 5BWOA 4UUAA 4JT9A 4JUAA 3K35A 2VJYA 2EZ8A 2IHTA 3CLUD 4ZZIA 1UPAA 1BFDA 1O96B 4IG9A 5MFZA 1M2NA 1YBHA 4K9KA 1M2JA 5FYQA 1E3TA 4D5GA 4GG1A 2JLCA 3F6BX 2PGNA 2AG1A 4JT8A 1S7GA 4UTNA 2W93A 1Q17A 2X7JA 4GPEA 3JR3A 4J16C 5K6RA 1YI1A 1V5EA 1PI3A 2JLAA 5EJMA 4F4UA 2NXWA 1PVDA 2OD2A 5MFPA 5K3SA 4Y6LA 1UPBA 2JI8A 4K9PA 5DGTA 4R8MA 2Q5QA 4X3PA 3D4BA 4JUDX 2VBGA 4BVEA 2FWNA 2EZUA 2FN3A 3RIGA 4BVGA 4GM4A 2Q29A 3GLSA 4MPPA 1SZCA 4K9NA 4C78A 4TWIA 2EZ4A 3IAFA 1ZPDA 2OD9A 1HZZC 2H4HA 2B4YA 4QPZA 1PYDA 2Q5OA 3EYAA 5K2OA 4KXQA 4BVHA 2NYRA 3HWX1 3PDHA 4JD5A 3ZGVA 3ZGOA 2EZTA 2JI6A 2Q5JA 4UTXA 2WVAA 3LQ1A 4J1TC 4UTZA 4JUFA 2OO5C 5BWLA 1YC2A 2VBIA 4Y6QA 4RJJA 4FEEA 5EJ5A 4UTRA 3CLSD 4L3OA 2A1TR 1NM5C 4UUBA 2V3WA 4BN4A 4O8ZA 2JIBA 3FLMA 3GLUA 3D81A 1QPBA 1O97D 2JI9A 5DEIA 4JUBA 4UU8A 4RMJA 2VK8A 2AG0A 1T9BA 1YNOA 1MA3A 3CLRD 4ZP1A 2A1UA 1J8FA 4IF6A 4MPJA 2PANA 1PNQA 1T9CA 1UPCA 4QELA 4RMHA 4BV3A 2H4FA 4FEGA 1M2KA 1T9AA 4IAOA 5BWNA 5D7NA 5FEMA 1Q14A 4V1CB 1DJLA 2FR8C 2BRUC 2PGOA 1V5FA 2WVHA 4QQ8A 4HDAA 5K6TA 4G1CA 4JU9A 4BN5A 2Q5LA 1Q1AA 1N0HA 4BVBA 3GLRA 4D5EA 4FVTA 2H4JA 2FSVC 1T9DA 1YI0A 4GM0A 1Z8NA 2EZ9A 5EJ4A 1OZGA 5IMSA 1Q6ZA 2Q27A 5EJ8A 3FZNA 3CLTD 4MQ5A 1U2DC 3PKIA 1SZDA 3IAEA 2C31A 4K9QA 4Y6OA 4TWJA 5DGDA 4C7BA 4RMGA 2H2GA 1U28C 2H2DA 4V1CA 2VK4A 4KGDA 2JI7A 3U31A 4K9OA 3ZG6A 4UU7A 2UZ1B 1M2HA 2Q28A 3FSJX 4F56A 3RIYA 3F6EX 4COKA 1YHYA 1YHZA 1XLTC 1OVMA 4JSRA 2OD7A 4K9LA 3D7KA 2QQFA 1MCZA 2H2IA 1S5PA 4X3OA 1PTJC 3JWPA 4KPUA 2H2FA 4BV2A 1U2GC 5MGNA 3OE1A 4K9MA 2DJIA 2HJHA 4GM1A 4JU8A
chains in the Genus database with same CATH superfamily
2XD4A 5FBZA 2EL9A 2Y0CA 3HBNA 3VTZA 2VSOA 2PU7A 3JARB 1XMOB 3SM3A 3IO5A 1K8YB 5H5JA 3N2KB 4QDOA 2JLRA 1O89A 3IX7A 2VDJA 2W6NA 3RBXA 3N8IA 5BWCA 2C5HA 2BF4A 4N5NA 5DM70 4IH1A 1T8SA 1Z9BA 2IE0A 1ZJ5A 1NJ6A 1N92A 3GFBA 1I9GA 3AHJA 3U4DA 2AJDA 1FF9A 2BFOA 2FPGB 2M1XA 3LLSA 2B1GA 4GR9A 3T0IA 2YZGA 3THWA 2G1JA 4BS9A 3V4ZA 2OB2A 5CB4A 4FWBA 4OUDB 4QVGA 5T3YA 2GM9A 3HE3A 3LYUA 4MUAA 1X94A 1SXJB 1I3KA 4OHRA 3EEOA 2DERA 4Q3BA 2HHCA 2DQZA 4P8RA 4EI8A 3NIWA 2BGMA 4MKGA 4Q3CA 3GARA 2VUSA 2XWPA 4YDSA 4UE2A 3IAM1 1YSCA 3O4HA 4AK9A 1Q7CA 4D3SA 3V7NA 1JIKA 1MO5A 2I78A 3VOAA 4E7PA 4FOLA 1EK5A 4L5BA 5MN5A 1KA9H 1W47A 3EA4A 2RGNC 4S35A 4G8CA 4X45A 1TUBA 2C2OA 2COUA 1CJVC 5AYVA 4B3JA 5HM6A 3GT3A 3KB8A 5FLKA 4F1WA 3M4JA 4OM7A 3RK1A 5KREA 4YAOA 4TRRA 4CIYA 3GNSA 4X6XA 2E37A 3ICCA 3OPMA 5DTQA 3DGEC 3FAZA 3IIMA 1KFJB 3R76A 1QIFA 4RORA 2R751 2ILVA 1L8AA 2Z2XA 1S01A 1S2NA 3BZBA 4IINA 1WXDA 3LT5A 2JEOA 4C88A 2PWPA 1FQKA 5HIKA 3ZUGA 2OKCA 1ISJA 1NTRA 4IGEA 4L8FA 3G8BA 4Q9DA 4Q39A 4LX8A 4MB0A 4WCFB 4WACA 3H3JA 4QRDA 4Y0NA 3AUTA 2XJ4A 3BT7A 1DBWA 4BFYA 5EIHA 4DC1A 2CLMB 5KKAA 1BQEA 1N5OX 1QWOA 4GXNA 4QDJA 5JCJA 2GILA 3WWZA 1N5KA 3R3VA 2JGFA 3QNUA 5CT6A 3SN6A 1FOEB 4M89A 4YI5A 4CL3A 2IH5A 4RHCA 4P38A 1IXRC 4S0XA 1N34B 1EXNA 4JBYA 3SS9X 3IR5A 4ESOA 5AM1A 1A8HA 1XD2A 2PTGA 2X77A 3P8ZA 3JATA 3PWKA 3OIYA 4JK3A 3WGJA 4WY8A 2IYXA 1YBAA 5GONF 1N6NA 1SJ9A 1UP7A 4CFYA 3K73O 1B0UA 1QKKA 1SZPA 4YRRA 3JQFA 5TSDA 3T3IA 3SX4A 3OZGA 3SYRA 3ZI7A 5KNDH 3KLBA 4LOLA 1JDBC 1VKNA 5DRYA 2Z8ZA 2O2CA 3AEYA 3TW6A 2OXCA 3OJFA 1EFVA 2HXYA 1ZU4A 3T3NA 2Y0EA 3UK1A 2QLMA 1JXMA 4Q3OA 4AXXA 1Q5PA 3DDOA 1NWCA 2SICE 2H1SA 3LX6A 3D7SA 4A8JA 1RABA 4LMAA 2CD7A 4DCOA 1E0SA 1OYVA 2VUUA 5CCDA 3AG6A 1SA0B 3PEWA 3DZDA 2O5VA 3UK6A 4M9ZA 1IBMB 2Y6VA 4PX2A 5A4DA 2PZEA 1HTWA 4WXEA 4BE4A 2R6AA 1Y9ZA 6YASA 4A16A 2I22A 3EQ7A 4CNQA 4YMGA 1ZD9A 3TW8A 1T2AA 5A1TA 5CLFA 5BOSB 3GJSA 5TVKA 5I9LA 5G0UA 2BT4A 4ZCLA 2GJAA 1DO2A 1XELA 4CM1A 1RKVA 2XMRA 1JWAB 1Q1QA 1V8BA 2ZJ6A 4KE8A 4G1VA 2D1TA 2H3EA 3KVOA 1JKJA 4RH1A 2GAOA 1M2JA 1R6XA 1E3TA 4Q1CA 4G86A 4M60A 3ITNA 2PZLA 2ZE6A 2FSPA 1M5RA 2QXTA 3D6NB 3C6YA 3HKBB 4FFOA 5BQPA 4CEIA 1IPEA 2OV1A 4NH4A 4UVGA 5TPWB 3ZH9B 4CLDA 4OQLA 1G21E 5JPIA 1T9ZA 2A9JA 2ZT8A 3VH3A 2R8ZA 3EG5A 3I4CA 3KQHA 1SXGA 1CIPA 1MNQA 5DH9A 1FXWF 1N8KA 3KQWA 2GDJA 3MK31 2PX4A 1NHWA 3GFFA 1HDRA 3HWSA 2Z5VA 3PRHA 1QDEA 1FPMA 4N03A 2YICA 1ZL2A 1E6LA 1G2OA 2OK7A 1HTTA 3ANSA 3GFOA 3GLHE 4K26A 4V3CA 1DQZA 3EC2A 3KL2A 3RS4A 4BBZA 4L28A 3KKNA 2AJCA 5BRJA 3Q3EA 2WWGA 2Q21A 1GLNA 4U39A 4R4JA 4I66A 1K7CA 4QARA 5J5VA 2FPPA 2QBYB 2PEZA 4ITVA 4G23A 2Y1FA 4QBTA 3ACDA 1E7SA 4C21A 5AIBA 2WWTA 1MEOA 3FFAA 2JBWA 3L5OA 1P9RA 1NJ2A 1QIIA 4DNQA 3DW1X 4QJ4A 3WB9A 3NC0C 4ACAA 2ZUUA 3KLOA 3WB0A 4WKBA 2UKDA 3QI2A 4KQXA 5LYJB 2Q9AA 3CXRA 3OE7A 2YV3A 3TL6A 3CNNA 4NXMB 4WLNA 2YMQA 2NTEA 3TKAA 1WY5A 5JQGB 1UMDB 2X3FA 5CVUA 5BSFA 5BV0A 4GAEA 1LQ2A 2Q6OA 1OI7A 4CLRB 4TKLA 1IQRA 3PEUA 4U7JA 3SICE 4MWCA 4NAHA 4GI5A 3I9FA 2O50A 3I2HA 3OEHA 1DAFA 2FSIA 2ZATA 4URUR 1VL6A 4WNIA 2X14A 4W5QA 3ASVA 2EGUA 3AFMA 1FYWA 4JC5A 3VU1A 4QJIA 3RIGA 4POAA 3S70A 4URWR 1ZISA 1O6GA 1MABA 2CMFA 3NTLA 2FB9A 5B6IA 4B46A 3EQ2A 3RQSA 1W5BA 4GM4A 4LTDA 1E79D 2HPVA 1F48A 2Q29A 3Q0IA 1S2MA 1FFXB 5MN6A 1CDOA 3OBBA 1H2EA 2JJ1D 1N75A 3ULKA 3HCAA 2HBYA 1UBRS 4JJGA 2HREA 3M9WA 2KPOA 4G84A 5AH0A 4R31A 5KSYA 1ZUD1 4M1OA 5AO9A 3NATA 2I0FA 1DRKA 3HBMA 2H63A 2MINB 4FDLA 4HB3A 2WTEA 2ZI5A 3BD7A 4IDDA 4RSHA 4DYHA 5JRDS 2BF7A 3UJ8A 4DJDC 1UBOS 3OM1A 5IM4F 1S3SA 1LFAA 4AF7A 4TS1A 5BSGA 3LO8A 2VDKB 5CFZA 1QNLA 4JHLA 2QT0A 3KLMX 4F71A 2OXIA 1TEHA 2GBLC 1WL8A 4YRMA 1TJ5A 1Q0QA 4PZUA 3K9FC 3QBVA 2X8AA 2ZJYA 4IRXA 3PHJA 4FOSA 2O20A 4R05A 4TKUB 3PQ8A 3IOEA 2ZIXA 3CB4A 2GWHA 3FOEC 2BBTA 3UA3A 1SCJA 4ROSA 3H05A 2QLBA 1GIAA 4DLBA 2VNAA 4OHOA 3BH0A 4DRXB 1M6VA 5JFGA 2XKJE 4QKQA 2HJ9A 3SD7A 1A0OA 4LZLA 1A1VA 1M72A 1CXZA 2OHHA 4UNNA 3F1LA 1B43A 4R69A 5JMTA 1NBOA 3P0JA 1SHLA 3E53A 5ESRA 2O8EB 1G0NA 2R7MA 3Q9UA 1GHTA 4JYCA 1H1DA 3PHLA 3JD3A 4HDSB 4P4SB 4AJKA 5DI3B 3JAMA 2C03A 3RB8A 3WNCA 3NKFA 4KLRA 4NABA 5U9CA 2OO5C 4LQDA 4IV5A 2NZ8A 4PAQA 1LGYA 4U2DA 5I01A 4PQYA 3G9XA 1CUJA 4FMBB 5CIWA 4CCYA 1G3IA 1MJ5A 2HBQA 4GLFA 2B8TA 3ABZA 4QTUB 4J0HA 4I3FA 4QYIA 3HVKA 2AHOA 3T06B 2RHJA 1HNWB 1FYFA 1U7XA 4ZQIA 3GDWA 4AKTA 3CLSD 1BWQA 3ESCA 5LMUB 4CQMD 2BCEA 4R8VA 4X63A 4FR0A 3FKQA 2F3PA 3DB2A 3GMTA 1IXZA 4RFSB 1F0YA 4ETWA 2ONZA 4H9GA 6Q21A 5JJ5A 4YP6A 4YK7A 2CXPA 1PQUA 1ESEA 5A4MS 4C9BA 3G59A 1EDDA 4ESEA 5EIOA 3H1EA 3KT0A 1KNXA 1JKFA 1LSSA 1OU4A 3ILYA 4K28A 1QIJA 4U2EA 5LQNA 1QTQA 1WBJB 3ZZ0A 3LF1A 3ENWA 1Q0UA 2Y1KA 4RBNA 4M6WA 5DK6A 4RZIA 3VPBA 1BC5A 1CRQA 3U3XA 4HVAA 1HKUA 3PC4A 2ZUDA 3R9XA 1MX1A 3QYAA 2A9FA 4KZKA 3CX4A 1C7EA 4UW9A 4CTNA 1DO0A 3QVVA 2RH5A 2Q49A 3GLHB 3NYRA 3HRKA 5HFJA 2PLFA 4A82A 5BQ3A 3W3ZB 9LDTA 4YLYA 4RCZA 9GPBA 4R2XA 4ANFA 2WT9A 2PL5A 3LMKA 3VO1A 2HMWA 1ESNA 1L4KA 3LOPA 1JYFA 5EVCA 5G02A 3H2ZA 3ROPA 2XYGA 1YB5A 3VNBA 3QSGA 4U6QA 4EGAA 3I3OA 2WIFA 4XB2A 1GQSA 1DWPA 3GAAA 3OOJA 2JFHA 3FVTA 3BX1A 3MELA 4JCCA 2ONJA 1GCGA 3HXLA 4QNNA 2ZG6A 1NKSA 3RS2A 1PZGA 3FA2A 1B23P 3ZWOA 1Q14A 2YY6A 4A26A 4Q7KA 2W5UA 4L5YA 2QE7A 1EE1A 4F12A 4GX5A 2FR8C 1GL6A 1N5IA 1CF2O 1ISFA 1O94C 1P73A 2Z1MA 4PTYA 1E6WA 4QQ8A 2WWRA 2J9YB 1YASA 5FH9A 1D2GA 2B98A 2OESA 2VTKA 5JMOA 2HI0A 4YJ2A 5HTOA 2J6IA 2JK1A 3TMYA 3IHTA 2PKQO 3SE7A 5C31A 4I7EA 3IPCA 3WRYA 4NTZA 2PZAA 1YR6A 3FG9A 3HEAA 1UZMA 3D3EA 5REQB 2P9EA 4TKZA 3TKLA 1MGOA 4D5EA 1C3XA 1C8KA 1KZ9A 2IYAA 1DC8A 4G4IA 4QX6A 5KPJA 1I6LA 4Z4EA 3KKQA 2Q3HA 4KXFB 5C9ZA 2WU8A 3AJRA 3U0BA 4FYMA 2QYSA 3OX1A 2BUCA 4NICA 1IULA 4YAUA 1EXVA 2J87A 2FXIA 4ZTZB 1NPTO 1ZHOA 2MR6A 3E9CA 4EB6A 2OK8A 3PFFA 1P1BA 1CS4C 3I8OA 1JR3A 1OYYA 5A0VA 1T2FA 2WAAA 1GQRA 3DV2A 3OEED 3PLNA 4KPUB 4MS1B 3PX2A 1RRMA 1O1YA 2XCUA 4MW0A 3O8OB 4QU8A 1NY5A 1G8JA 3BDVA 4JEHA 4L8WB 4EPTA 4B3SB 3PR3A 5CIQA 2PVPA 1T2CA 1UKBA 1NW4A 4H4CA 3UB3A 5DF1A 1FTYA 2WJ6A 4LZPA 4N65A 1MD9A 3SEQA 4JJIA 4BUJA 2LTAA 2GAAA 2YXEA 1LRJA 1CWUA 3OQIB 1HZZA 2JBHA 3EC7A 2Y1LA 5DHAA 2MDTA 5J47A 1JGTA 5LU8A 4R8LA 1KMHA 4YNBA 1THTA 2P9GA 1O8BA 2GT1A 2K2WA 2IYVA 4JS0A 4NENA 4N3GA 5BSHA 2O3RA 1W2GA 3AB7A 1PL0A 4J0CA 1XPUA 3UJ3X 2PX0A 1YDFA 2F3RA 2OBNA 1GL9B 2QOEA 4G4JA 3I5XA 4W5TA 1RXEA 1CLUA 3BXXA 2WJAA 2NZVG 2FJUA 3R3SA 2E89A 1NUTA 3C97A 3MJTA 2BFFA 5AI0A 5B64A 5HHTA 3VA7A 1HPLA 4QU5A 5C3UA 3USES 4DPKA 5CURA 1LDMA 4BQQA 1N6OA 2EQAA 3ML1A 3R5XA 4JNCA 5J4LA 2PQ0A 3THWB 1U3CA 1GT6A 2O8NA 3ENVA 1T2EA 2X5KO 3UV3A 1KXJA 4Q02A 4GU5A 1K4KA 5CB4B 1SGWA 3FFTA 3OFKA 2YFKA 4G0UA 3NPMA 2ALJA 4XWAA 3VFDA 4TTIA 3H6GA 2D5BA 1MENA 3VJMA 5KTMA 5DWQA 1OFUA 3TOZA 2AA3A 2VP5A 4RABA 1G5IA 4MAFA 5C35A 3GZNB 3ONVA 3M2PA 4F6LA 3BTOA 2W6OA 3NIGB 3WJ2A 4EVQA 2MYUA 2JIZD 5H80A 5LP6C 3PQCA 2V58A 4IFBA 2CCKA 1XZFA 3ZGYA 1TK3A 1VMKA 4AJNA 1TUBB 1E6UA 2WWHA 4ESHA 3NT2A 4RKFA 4BV9A 3KKKA 4L6CA 3BDIA 1DJOA 4MRRA 5FOUA 3RM3A 4DPMA 3WLRA 5DSZA 4EPVA 3ILHA 1FVFA 1QV9A 2JH8A 3ICWA 3QLJA 1YR1A 2DF8A 2IHZA 2PKXA 1FMLA 1I2BA 1KH2A 1RMQA 2R60A 2ZE5A 3JX9A 4AMUA 1QFXA 2WLSA 1JJVA 4AYWA 2XRZA 3LHIA 3LQKA 1HDYA 1N5DA 3WSTA 1E3WA 2XGJA 1BKYA 4O4HA 3REQA 5A3JA 4HYEA 3WB1A 1G7TA 4OBXA 3Q7SA 4IX9A 1ATZA 5K0NA 1URPA 3KYBA 4IR7A 2F1RA 2G4VA 3MJSA 4AW9A 1WPGA 4URVR 1O97C 1OR8A 2O7QA 3H7IA 1K63A 2VOJA 2GRUA 4OK6A 4Y1GA 1Y1KE 2GD2A 3PCXA 4GX0A 3E9NA 1MC5A 2KI5A 4TROA 3IOBA 4NWIA 5J4YA 4MQMA 2OBMA 2XSZA 3P9ZA 2IXAA 5CH5A 1K92A 4Z4FA 2IYQA 3HTXA 2JFWA 5KTRA 1XD2B 3OE1A 1F2TA 1ZN2A 5CM8B 3JATB 4J0QA 2QM3A 4MS3A 1NXTA 2JJ8A 2NZXA 4UHDA 4PN7A 2XT0A 2OFWA 1QV7A 3E2MA 3NBMA 5KWVA 1A98A 1XEXA 1ZBQA 3PHIA 3NWEA 4JSYA 3F8WA 2A14A 3BGIA 3GGOA 1FSSA 2BH9A 5EHQA 5JYBA 4FFSA 2GEBA 3VKFA 3L82B 4ZAYA 3M70A 4C6TA 1NU8A 3FX2A 4BOYA 5CFMA 1EFVB 1JR6A 2HTEA 2CF5A 2IP1A 3TOVA 1J0DA 1UWVA 2GCOA 2MSEB 1JFTA 5B5SA 4YP1A 2Z8YA 4A8JB 2OORC 1U0GA 1FP4A 3F9CA 2N9UA 3F6YA 3D2LA 1E2MA 2FK7A 3OPVA 3RT1A 4EH1A 2PT6A 2EWWA 5C1PA 1H8ED 4LUCA 4PPYA 1GKUB 1QRUA 1BD4A 2VOEA 2WFAA 4MV9A 1YUMA 3TW8B 3WMGA 4OHCA 4DDTA 1TK9A 1CE8A 4HATA 1WQ1R 3QUCA 1LTHR 2DHRA 1LBQA 3GBSA 2BBOA 1EB8A 1KDOA 4CIVA 2O8BA 3K8YA 1N5MA 1R3DA 4IOMA 1JKJB 2CE7A 2E4XA 3D3KA 3I1YA 4B82A 4ZICA 3SJCA 3G8CA 1P9OA 1R18A 5GGXA 5A3RA 2BGJA 5LDHA 1MH9A 1LV7A 4WXMA 1I8TA 3NHJA 2UVPA 3MWDA 3CO0S 3E58A 2FZVA 2LZ0A 4H7FA 2XQIA 5M5BA 5TIIA 2D7JA 4YRBA 4CEIB 3IQDB 5DGXA 4DCTA 1KY2A 4EA7A 5ITZA 2C9OA 1LWOA 4P6VF 3HJUA 4JC8A 4P3PA 1W5SA 1GP2A 2V9PA 3HYCA 2UV8A 2R8EA 3BGDA 1EK0A 1UT5A 1YAJA 4OJMX 4F3KA 1NTOA 3TOSA 1GDHA 3E70C 4MARA 1CP3A 2WW8A 5F3RA 1MIOA 4FZ5A 1PT5A 1T3TA 2B4AA 4WDRA 4AP6A 4PHTA 3UCEA 4P4LA 4H16A 4EHKA 1SUBA 5JADA 4NG5A 2DFNA 1UWLA 4O4JA 3UGKA 3V55A 2FETA 3PI7A 3ZOZA 3ODGA 2V55B 2W90A 3VTAA 4PICA 1IK6A 4MI9A 3OCZA 2VA9A 1A8IA 3B7GA 2QRLA 4YAKA 4OJQA 3RNOA 4YRKA 3ESYA 4EW6A 2R87A 2QL7A 5DBFA 4H77A 4BO8A 4DQLA 1ULBA 2FPPB 1E96A 1TZKA 1Z6TA 3D8SA 3HFGA 5CT5A 1UC8A 4K88A 3F6SA 3IHKA 1O03A 4FFLA 5ALVA 2WMOB 1JTVA 1U2DA 4LJ9A 1R6TA 3QTBA 4ZQCB 5B1EA 1EUQA 2QMEA 3GN2A 3O4IA 1R4NA 1SN7A 2FPLA 1QH0A 2VT7A 3FYHA 4NCXA 2PKCA 4YMIA 1WR8A 3WB2A 3AUFA 4E4TA 3PGKA 3TNYA 2O3JA 2EU8A 1B6GA 4L72A 4LZJA 2JRCA 4XGQA 1W85A 2XR1A 1YJAA 2PH3A 2XUOA 3AVPA 2IQ5A 4R40A 5DNWA 3K8ZA 3I39X 2AWNA 2HK6A 3I2YX 4MI1A 1V11A 3DE0X 2HO5A 2M1ZA 3GGJA 3V6LA 1RRKA 4DB2A 2E4ZA 2EZ8A 3V5NA 1ND6A 3QXXA 4KBGA 3L02A 3OTGA 2CMKA 1C9JA 2CBZA 2WAYA 4EG1A 4TRMA 5FTJA 4DIFA 1U04A 5C81A 1RE1A 1TTPB 2EERA 4CKXA 1GAXA 4OI0A 2R97A 2W43A 3AHHA 1P2DA 1MABB 3N39C 4KUEA 3SSMA 4NEQA 2FMHA 5AUOB 4JLWA 4IIJA 2VPQA 4QXPA 4EX7A 2I7VA 3O38A 3U61B 1GUDA 2XCTB 1JR3E 3PD7A 3MMSA 1RYNA 3NCTA 1RYZA 4I4TA 4GG1A 3F6BX 1U1FA 4QBIA 3QMWA 4ENPA 4Z5XA 2ZM6B 4R1OA 3T4PA 2XRYA 3GU3A 4Z7NB 3IIIA 3Q3IA 1MVOA 1PX0A 1PLKA 4KFSA 1D7AA 2BDEA 4HTFA 1MJGM 5FUMA 4MHTA 3DP7A 4PNPA 1P19A 3WBBA 4TS4A 4E5UA 2FPSA 3JS5A 1STOA 3RU2A 2G07A 4RKQA 1B8VA 1JHMA 1ZJ4A 1WM1A 2QJTA 3R9WA 4LJ5A 1XA3A 4A27A 4R41A 4CR6A 3GGDA 4EECA 1O0BA 4G8DA 1BDIA 2MR5A 3ECSA 5K3FA 2XBUA 4JQOA 2DKOA 4UBKA 4M2LA 1I24A 2YXPX 4OI4A 4L85A 1O57A 1PFVA 3L8GA 3B3QA 3ITDA 2R6R1 2NU8A 2FA9A 3H19A 2ZIXB 4IUBS 3HPRA 4Q9HA 3DV9A 2OAQ1 1CY0A 1XJCA 4MP3A 2EARA 2Y4NA 2IDJA 1YI1A 1T8TA 2KBFA 4P35A 1HL7A 4HZIA 1M6VB 1T5HX 2FPWA 5CLLA 1AQJA 1EX1A 2HU8A 3BXHA 3HV0A 3IKLA 4MGZR 4KJZA 1N0IA 1A95A 5F2NA 2HDHA 1FTGA 4WXHA 1YTUA 4MLPA 1O95C 4II2A 1T91A 1K6IA 2VC2B 1E77A 2MSCB 4GDMA 3BWDD 1YWGO 1NRIA 1XTTA 2RDMA 4FDVA 2L18A 4KN6A 8LDHA 1EBUA 2CXOA 2JCVA 2R5NA 1OVGA 2GETA 3CN7A 4MUHA 5KU7A 4PQEA 2X0DA 4GQBA 1DMRA 1L5LA 2DTEA 3HSKA 4U7WA 5CFQA 4RA9A 1E2LA 4CCYB 1KI4A 4NEGA 4DWJA 3ZV5A 3HK2A 3DZKA 4HQ0A 5COAA 2L0XA 4IWXA 4C5CA 4QYIB 2QDXA 3B6KA 4H7IA 3HJCA 2IHBA 4CUZA 3WFZA 3NHLA 4XGIA 3G2NA 1HT3A 2B2NA 2RHGB 1WD7A 2UDPA 4OK3A 2CJPA 2NAPA 1HQDA 2MSDB 2EC5A 2QNIA 4NMWA 3NORA 3L93A 5K0TA 4C0WA 4BLTA 1VA5A 3QFCA 1QS0A 3IV9A 4R0MA 5F4BA 1PEAA 4BU0A 5BV2P 3QEAZ 4MRVA 1SFRA 3AIOA 1Y9JA 3GWGA 1FC0A 1L5QA 4QG7A 4ZEMA 2Q6LA 3IR7A 4WFQA 1M10A 1WTAA 4NBVA 1XFDA 3TRJA 4UOZA 4PSCA 1RBMA 4ZJUA 4M6WB 2ZPUA 3IDSA 3GMSA 5AXBA 2JJ1A 4IHJF 2CLKB 3B20A 1E3QA 2ZUTA 3R9XB 3MWKA 4CIBA 1ZOPA 3I09A 1SEPA 4ZOAA 1UBLS 1RP7A 2VSFA 1OI4A 3B1FA 2NWQA 1O6BA 2C4KA 3DMDA 1V48A 2WD8A 3IXQA 3W6ZA 4S1WA 4YCMA 5K2OA 8AT1A 2R6FA 4KQEA 1M66A 4GQAA 2H0RA 2IW3A 1UKYA 3A2LA 4OI2A 1X9HA 1OBHA 4KVZA 4L5IA 4L9AA 4RVHA 4UEKA 1ZITA 2F9FA 3RJ5A 4EY8A 4MWSA 3ZIDA 4EAQA 3A9UA 4GYYA 1Y3HA 1D4ZA 1IJEA 4IDGA 4EW3A 5AJHA 3QE0A 5AM0A 1I32A 3HL4A 4CV3A 2Z1DA 2JASA 3BJRA 4QREA 3RADC 3K9GA 4L50A 4KXWA 4FDAA 4YPOA 4P3OA 2CJWA 5LP1A 2TS1A 2ZPAA 1S02A 7YASA 5HF6A 5KVSA 2EZTA 3WL6A 3DJFA 2D54A 3W2EA 3A1FA 1KYZA 2WMDA 1H93A 1XRRA 4MWGA 1Q1ZA 3Q2OA 4HGQA 5B4TA 1G8YA 1L5HB 1Z0JA 3PXCX 4ZDJA 3L8EA 4QRIA 1KZGB 1SKUA 3GIDA 3ZWKA 2CHFA 3KKLA 1U94A 4YJ2B 2WBLC 3WIDA 1QXSA 4Q00A 4AUKA 4BKPA 3DHEA 2GF0A 3G79A 4KWIA 2TECE 3H5VA 3Q6MA 1N2ZA 3COSA 1CRPA 5G3ZA 4RVOA 4M7PA 3RC9A 3L7OA 4PWYA 3RREA 1HXHA 1JQKA 1NE2A 2BL4A 3L18A 5CLJA 1JB9A 4Y2SA 1NVWQ 1SG9A 4LBVA 4E12A 5DM0A 4PYOA 2EDCA 5AW1A 1KSJA 3HBAA 1RXCA 1H5QA 5TT1A 1M1NA 1XHLA 2DY1A 3EC1A 2MHCA 3M3DA 3O8QA 1I7QB 5JZ9A 3ZCUA 1K97A 3N87A 3U17A 3ECCA 2I9PA 5B3KA 2A1TR 2D2VA 4OMFG 3OFND 3QWAA 2JDIA 3NOXA 4EB6B 1XCLA 4R16A 2A4MA 3RBAA 4BFTA 4HAVA 2ACWA 4F2GA 3HDTA 4BNGA 2EKDA 2QQ0A 1C80A 1GVHA 2OFOA 4LJLA 1NSYA 4MO2A 4CQMA 3K0SA 4PQGA 3HDQA 2YWHA 4YUAA 1WEKA 1XCPA 3KKEA 2J07A 2QYHA 1YR7A 3L8YA 4JHXA 2PMCA 4MVJG 3KJZA 4CDMA 5EP1A 1UKZA 4UC0A 3EXHA 1E5XA 1I6WA 1PF7E 1K0UA 1UBUS 3DSRA 2GZHA 2ID7A 2J67A 3EZ2A 4HWSA 1CY1A 3PSAA 4QQKA 3AQ4A 4Y9SA 1G66A 5ICSA 1J8MF 1KMHB 3F7OA 4I55A 4PGAA 3GEPA 4NENB 4RS4A 2ZI7A 4KIUA 4CIWA 2VQEB 4EMUA 3UNXA 3DR5A 3QWIA 5FTNA 3B48A 3LYLA 1Z4LA 3KAJA 5FFNA 2QY9A 4F5DA 3H4MA 1NXQA 1T2NA 2DPLA 2ZOSA 3DNMA 2FLWA 1H2RS 4NOKA 2WWFA 5LMNB 3O6VA 1FRNA 1QKJA 1T1SA 2AE1A 1R16A 2BFFB 2JK0A 2DJ5A 5CDFA 2PKQP 4HN4B 2HADA 5ADVA 3EDCA 5FEUA 1PNQA 3C3AA 4P08A 3ZGNA 3ZTTA 4PYKA 1JDJA 4IFTA 3GGPA 4V38A 3HXOA 3NV7A 2GH1A 1ADBA 2R8YA 3RC1A 1SU8A 1GG2A 4HJXA 5IJWA 5JNVA 4D25A 1Q22A 1U0NA 2G1AA 1E5QA 4QO7A 1NR1A 4F9FA 4BGUA 3KKOA 3M83A 5A6VA 721PA 5B3JA 1PHPA 3PHHA 3TDKA 1YZQA 2NTVA 3IEVA 4ZO7A 1KO7A 1PV1A 4BUCA 1IWPB 2OT3B 1SUWA 3BK1A 1DT3A 2IYYA 4MV7A 2QR2A 2GHTA 2VATA 2XLBA 1KO5A 3EISA 4HAOA 4J0IA 4E11A 4N5DA 2W4IA 2XMDA 1KSGA 2Q5LA 3TMAA 2SCUA 3QHPA 2C2KA 1F8XA 1N5JA 2PUVA 3DM5A 3LNCA 1WNTA 4P2BA 3UT0A 4HGOA 4YMLA 2Q6TA 3DBIA 5FWYA 1SULA 1PDOA 4MKHA 2YXBA 4OXQA 4RV4A 1U0TA 4M86A 3KWFA 1E3WB 4Z0NA 4CI0B 5D84A 4O4HB 4TXLA 4OHZA 1RI1A 1XYGA 2IV7A 3REQB 1HEYA 3WOVA 1I3CA 5KNLA 3DE7X 4E15A 3R3WA 4R2LA 1TYBE 1SQGA 3FOBA 2AOWA 1XQ6A 2R6HA 4GM0A 4KLZA 3DFKA 1VXRA 1ZWKA 3GEHA 4YMTA 1JLKA 1FNNA 1ZEMA 4PTZA 2YV5A 5L45A 2H7CA 4A6XA 2Y1XA 5EI5A 4E4YA 1AKUA 4WVFA 1EP1B 3LT2A 1XCJA 4HEA6 2LIPA 3F9IA 1DOHA 4CJXA 1DDOA 1ISSA 2ZUFA 2YV4A 2DSTA 1XGKA 3IRVA 1JYSA 4WRRA 4NR0A 4JC4A 1NBME 4ZYTA 3U19A 1RWBA 2JGRA 1AZWA 3FYCA 1F2TB 1SBQA 1Z7EA 2B8EA 2E4WA 1JQ5A 4MS3B 3UM9A 1SCKA 4AY4A 4GMGA 2F3QA 4TS9A 3INYA 1QP0A 2Q5CA 4AG5A 4A0FA 3EQ9A 3HKEA 1XEXB 3AEKA 4UKDA 1B42A 3ENZA 5I5GA 2FOIA 1I4TD 4DR5B 4PXYA 4IDQA 4OP2A 4C6SA 1OD6A 4B3FX 4QM6A 1EWVA 1PR4A 2PYDA 4DEXA 4DMGA 4Q21A 4C6TB 3N0WA 5DHUA 1J2RA 4CMGA 2H4WA 2JD2A 3AFHA 1WB6A 3FH0A 2IH4A 3Q41A 4ER3A 2P9ZA 3WA6A 1GNLA 1A8QA 2GCOB 1RM3A 3GDFA 4LG1A 5AW6A 2ZXUA 3F2IA 2IYUA 1A8UA 4CT0A 1YK0A 4PLGA 4KZPA 1NQOA 1BHO1 1FP4B 3O4VA 4BVLA 3L4SO 3E0XA 4HX5A 1P7WA 3OF3A 4YMHA 1NUSA 1P0CA 4D3YA 3QPUA 4HMOA 4F2PA 1ID8A 1VL8A 3EBLA 4F5EA 1J2TA 2EEZA 4S0ZA 4MUJA 4IO1A 1L5OA 5AI8A 4Z3DA 3W77A 3AIIA 5ICEA 1OH7A 2QPLA 1CE8B 2XA9A 3U4IA 3QI7A 4K2AA 3ZE1B 4E5YA 1KFCB 4ZALA 1BXRA 2W6ID 4TMTA 5CVJA 4BCBA 2O8BB 1EVEA 4BATA 1I4DD 4IIYA 4GOND 2E6UX 2I6XA 1M2HA 3L0CA 4WLFA 3BHMA 3GOHA 3BTSA 3TGWA 1IEVA 5CTAA 5AXDA 3V1YA 4DABA 4H4EA 1KC3A 2JIZA 1WMAA 2QTAA 2UVPB 3PGJA 1HEIA 3MWDB 4CU5A 4E6PA 3NM4A 4NATA 1I0ZA 2RJOA 3S0JA 3VYRB 2EQBA 3AUAA 4YP5A 3RS9A 1P9NA 4NZNA 4ZO9A 3M6UA 5ITZB 2XB2A 1X39A 2CEAA 4DDKA 5D3QA 3HM2A 1QQ6A 1U2PA 1FMTA 1XLTC 4K9LA 2CDRA 3C3XA 2NU7A 4U0KA 4WLUA 4C3UA 2C5FA 5JARA 5KYXA 3DAOA 4NFYA 4WX2B 2H2IA 5DLEA 2ASEA 1L4NA 2RJ3A 1MIOB 2I6UA 3NTXA 4UMEA 4BMDA 2DG2A 1TEZA 3QLVC 3T7SA 3INRA 4IMRA 2TMGA 2WZDA 1RCTE 1IG0A 4FFNA 4XQ9A 1ZM4A 2CK3D 2OCYC 4N01A 4IHQA 1IBRA 4O4JB 3ZXXA 4KO3S 1PD1A 2VDQB 5AICA 3CNHA 2FSSA 1YRAA 5AW9A 4OI1A 4EPWA 2NQ8A 3DDNA 3R8XA 2Q8NA 4QG3A 2PR7A 2IFTA 2J3LA 2QN1A 1ZH2A 3DDUA 1DQNA 3DXYA 3IAS6 3MAAC 4H6VA 3UC5A 4B45A 1GFWA 5JBQA 1ZIOA 1NMXA 4MVJD 1U3GA 4CCAA 5MGNA 5AK0A 1UDAA 2LE0A 4CFZA 3MQ2A 2YV1A 2SHKA 3L07A 4W5WA 1QF6A 4P4GA 4MUBA 1C41A 5K8CA 4IDEA 2C8LA 2FV8A 4F3CA 4EHAA 1R4NB 2XQKA 2SECE 1NVGA 1K2WA 3UGQA 1PK9A 1UQTA 3OECA 2D5IA 2WHEA 4EYOA 4N5IX 1AQLA 4N76A 1W85B 5J4KA 3D5QA 4MGHA 4IF4A 4DFDA 3FGZA 5JNUA 2YJ6A 4ND5A 2UU9B 2UYCA 3H2KA 3UKOA 1V11B 3C7AA 2QMUA 4NU0A 2XMZA 4XOUA 3SYKA 3LW7A 3OX3A 2WKSA 3FMGA 1O94D 4OFXA 1W5EA 1KRHA 2PUWA 4P7BA 5IK2D 4ZDWA 2HJWA 1MORA 4HUJA 2GQ0A 2JAWA 1ACLA 1JIXA 4RU1A 1Z6ZA 4DREA 4RTLA 4C4ZA 5EJAA 1YRHA 3V80A 3LWBA 3WDMA 2IS6A 4GPD1 4DBLE 2P9QA 1LEHA 4UTVA 2ZYRA 3LHDA 4HRXA 4N0QA 2J08A 1CHDA 2VNSA 4IIJB 5D2CA 3T0FA 4GR5A 2LWIA 2B8JA 4N6GA 1MA0A 2MTBA 3BFXA 3UMRA 1HYQA 1H42A 1U9YA 3GRRA 4I4TB 1ICIA 5DTIA 5AWFC 3UBTA 3W5VA 1E8NA 4ZT5A 2CFRA 5CJ2A 1ZEJA 3H5IA 1ZW6A 2EWVA 2FEWB 3SJBA 3I76A 1Y4SA 4HTFB 5DN6D 2IPXA 1AKWA 1DTWA 1QAQA 3V9AA 3L7MA 1PP4A 2B20A 2OHOA 4HRVA 3N53A 4FFPA 5BRNA 3ISVA 1KE1A 3WHKA 2W6CX 4FP9A 3EGXA 5ILOA 4MHSA 1YQUA 4MOWA 4ZD6A 2ZSEA 3O8BA 1EK2A 2GUGA 1AG9A 2OXFA 2V7TA 2ZDGA 4U8HA 5K3FB 3BGOS 1U6JA 3MIZA 3CVWA 4ZOBA 5JISA 1SZJG 1WVMA 3QOFA 4KMRA 1II8A 3DEKA 1UR5A 4MQLA 2SKEA 4LC9A 2NU8B 3WJ1A 5CDFE 1LBEA 1CJCA 2EYQA 3R24A 4M0KA 2O3QA 1Z6YA 4ZMRA 1IVSA 3CZAA 3ET4A 1COZA 5LA6F 3DEZA 4MUFA 4US2R 3FVRA 3QBTA 1RTTA 1XQWA 4DXHA 2QVGA 4M88A 2RKOA 1R6DA 3WOHA 3ZU6A 1PZXA 5M7EA 2RH9B 1UAAA 2QLLA 1ZP6A 3QU4A 2P1RA 3EVDA 3K20A 3HCWA 1DL5A 2J3JA 1AZTA 3CTPA 2AZ4A 1X8JA 1VBFA 2QN2A 2HO4A 2WAOA 3CUUA 1DTSA 3PKJA 1GSIA 1KP2A 1N6PA 3IOMA 2OPBA 1OPXA 3LL7A 3PNBA 4FIZA 4RF5A 2IU4A 2ZYWX 3DG9A 3E7DA 3PQ2A 4R68A 4RA9B 5HUQA 4TTQA 1RRVA 2L42A 1ZXBA 2OWEA 2QENA 3C74A 3QOXA 4IVRA 4LA4A 1EVLA 5KWJA 3MWFA 3WYCA 2FZ5A 1HMPA 1S8NA 3DEIA 3K35A 4OHPA 4U02A 4RA6A 3PB3A 4LDPA 4FYXA 3TLCA 4OJTA 4OQPA 4GDFA 1BJTA 2VHZA 1BA2A 3BERA 4PBTA 5AI9A 5HA5A 1OX6A 1YMVA 4QGHA 1RBQA 3ZLBA 4DQXA 5MN4A 1W75A 2P27A 5BV7A 2HJGA 2YC2C 1QS0B 1N2OA 1UXIA 2GPWA 4C3VA 3K8OE 4Q4CA 2I2FA 4YRFA 4ENQA 1G16A 1CK4A 5FYQA 3TQRA 1Z88A 1M0SA 5FXMA 4PXAA 4RTKA 2YUTA 3S2IA 5GIOE 1H2WA 1HZJA 3RNLA 1KKLA 4B83A 1OXBB 3W6UA 4TTSA 4EHDA 3OPYI 3M9LA 4U0JA 2FWBA 3L0BA 1S7GA 3V2GA 4AI6A 1QUFA 3SYNA 2GPBA 3RIEA 4Y2QA 5CFPA 4G0OA 3R2JA 2G0NA 2IS1A 1G3UA 3A31A 1DUVG 4BFCA 3F3SA 3MJEA 1BH6A 1QHSA 4LISA 1ODTC 5T4FA 4DA7A 3SS7X 3NLLA 3PF8A 4CI9A 1KY5A 3W7VA 3PFWO 2AE2A 1FBNA 2GXSA 4UM8B 4E33A 4ZVMA 5AW8A 1EK1A 4L95C 5D7BA 1XZIA 3TN7A 2Z58A 3E35A 3NM6B 1GNPA 3OZFA 4NCNA 1WA5A 4KL8S 3E4CA 3M6XA 3ZEIA 5JZSA 2IHNA 3GLGA 3RVMA 1UJBA 2H52A 3AZQA 4UXIA 3F6RA 2AW3A 2P5TB 2CJWB 3QVSA 4DC9A 3ZDAA 2VF4X 1N8TA 3LDFA 4F7DA 4L15A 4MKXA 5DHTA 1NW6A 1V5EA 3H75A 2DFKB 1Z4OA 5JDCA 5HJ7A 1RCFA 3K9QO 1K6XA 1AQYA 1UINA 3G9UA 4NYIQ 4OB7A 1ZM9A 2HU5A 3ZWXA 2C97A 2HRBA 4Q1AA 3G89A 4B3XA 5DXFA 4A0SA 1IBSA 3RJ9A 4PZAA 3IE2A 3RSHA 3N2ZB 1AUXA 2CUNA 3CX8A 5ALTA 4PZDA 3R7WA 1UXJA 5ED4A 3B1VA 1XA4A 1TLLA 2AYZA 2EX1A 4JT4A 1AMUA 3HVUA 1NUPA 1M1NB 1HDXA 1PG5A 3CSUA 2HF8A 4CM8A 3LXRA 3RS7A 3O8QB 2BGTA 3A1EA 4JI0B 1CDDA 2B35A 3ADBA 4BAZA 3L1IA 5IN4A 3DOCA 3IIEA 3KWLA 3WKEA 1ZCFA 4ZEVA 1YMQA 2BLLA 2G08A 3P0EA 3VNVA 3QVOA 2X3YA 3BULA 4CQMB 2X5OA 4CR8A 2B1RA 4B6JA 4OOFA 1P9WA 3G0BA 2ECOA 4RW0A 3E22A 3WO1A 1JXAA 2YMPA 2RGNA 3GLSA 3VO8A 1D3AA 2I6FA 2HRQA 5U1PA 1SNYA 1F3LA 3LRXA 5JYDA 1JEJA 3EXHB 5BNTA 1UFRA 3B8HA 4GMFA 5M2QA 2WWYA 1Y3DE 3OA0A 3OOWA 4Y2HA 2FQQA 3OF5A 3SZUA 5DLDA 2V74B 5BN1A 1AV6A 2G9NA 6LDHA 4I55B 5HXAA 2XH8A 5E4JA 3DMGA 3RFVA 4KFCA 2VH5R 3T1QA 4ECAA 5JCXA 3PJEA 4C20A 1M1YE 1DIHA 2WIAA 5GVSA 2II6A 2LDXA 4S12A 2HDWA 1D09A 1PJ3A 1EWRA 1TQ8A 2PS9A 3KYDA 1UMCA 3DHNA 3I30X 2CHUA 3M33A 2CXUA 1R0KA 3BZWA 3QEKA 3WLAA 4Y8VA 5ECYA 5IAGA 3K5PA 4OK5A 1Q0TA 4FJ1A 1S4MA 3G9QA 1AQNA 2XKKA 2QRQA 4Q16A 3K05A 2H11A 1TGYA 2FOLA 1QORA 1XKQA 2D00A 3KXIA 3EVBA 3D6VA 3OZTA 1ZY2A 5BN4A 2Q3JA 4OM8A 5EGSA 3BWXA 1DQYA 1SIOA 1IUOA 2BMJA 2OCIA 1KARA 2R7LA 1CDZA 4ZAXA 3EPLA 3T5AA 2GAIA 4TLAA 1DBRA 3P4XA 3DTYA 5JASA 1FNCA 4G5GA 1IK4A 1T1RA 2PX8A 1F3OA 2QR3A 1K27A 3AXSA 5H3CA 1HSOA 1V7CA 3MW8A 2WK1A 3IEKA 5HW0A 4KXMA 4QRHA 3TGLA 1JECA 4B3TB 1I3OA 1EGVB 3KJNA 4G0YA 3LQ4A 2VYFA 4AN0A 4D99A 1GNQA 1ESMA 1Y0BA 2ADOA 2PQMA 1R00A 2MSLA 2FEPA 2P4SA 4BKOA 2SCUB 2W00A 6PFKA 5HUJA 1CY6A 2JJQA 2COKA 1P5ZB 3LUCA 4CIAA 1QP4A 5BWLA 3PFIA 1CD5A 1XMSA 4JROA 1JJ7A 3ANXA 3L7KA 5FWYB 4YUWA 1RKXA 7AT1A 2GMWA 1NVEA 2ZUCA 4HEA1 2BDUA 2J0EA 4F4IA 1WDTA 1Q0SA 3WG9A 4MUIA 3TINA 1SOMA 3G5AA 2CL5A 3WQQA 2P9YA 3GVIA 2XWSA 1W5FA 1IEQA 1TTHA 4ND8A 4P5PA 5AR1A 4CM4A 4DARA 1EZ1A 1Z0UA 3B6MA 3OMLA 5AMXA 2XZTA 2XCIA 3AKCA 4QGGA 3TQFA 2CLSA 4O8ZA 2WAXA 1NW9B 1OQAA 1L3BA 1U8XX 2CNKA 1YULA 3OFNA 3STHA 5I4BA 5KOJA 1D2MA 2GUWA 2P1DA 3CC8A 3VVCA 1OPRA 1PAUA 2YIDA 1JQJC 4RMJA 5C5CA 4B87A 2P62A 5JDIC 3NH9A 1LX6A 2C2MA 3SDZA 3OZCA 1I7LA 1PZMA 1SG6A 1TZ2A 2FQ1A 2VSXA 5DSXA 2DCMA 3HKEB 1ZICA 4X93A 3RROA 1ZVJA 3AEKB 5JVDF 3DT8A 2BUBA 2WSIA 5G41A 1QHEA 4MLZA 1EJ0A 1O6ZA 1VRCA 3A32A 3E18A 3ORSA 3TLYA 1IY9A 1P44A 4GQIA 4I1PA 3HRIA 2HMYB 3EW7A 2VHYA 4R9UC 3FUWA 4J3JA 1MH1A 5AHXA 2QUBA 1OOEA 3JPWA 4PLHA 1DAIA 4ZVVA 3QVTA 3SC2A 3I2JA 2DPMA 3GCWA 4U2BA 2CVFA 4BV3A 1EFKA 3KEQA 4LC1A 2I3GA 1W4ZA 1M2KA 4LDZA 4TXMA 1X7HA 2REQA 3BFKA 1G9TA 2GR9A 2XPCA 4UBIA 1P81A 3QY9A 3T1TA 4PNEA 1O95D 4I3GA 5I9SA 4CXMA 2PJRA 3GF4A 1KO1A 3D2BA 3FMOB 4W6QA 2QP4A 4TMVA 1BXRB 3RG2A 1JFFA 2ID9A 1ZQ9A 1MR3F 1DKNA 2R84A 4MVXA 2GVNA 3P1JA 3H9GA 2J4DA 4BO4A 1VI2A 4DNPA 5J2TF 3KQVA 4N4AA 2HK8A 1MF7A 4YCSA 5CFRA 1PJZA 3B6EA 4LY6A 4F4JA 4UHJA 5INTA 2MU1A 1UDXA 1LBTA 1XXHE 4YT4A 1L7EA 3IPYA 3OCVA 4MVJP 3GGCA 3QU2A 1MW9X 1FUIA 2BWJA 1PJQA 2F1HA 1LY1A 2X76A 1XP8A 3BICA 2L69A 3MSCA 3ZWDA 3ZLTA 3KWMA 4PC3A 3ZN2A 4ER5A 3IAS1 2NU7B 5E2AA 5KYXB 2VNJA 4JJ7A 4TLMB 1USWA 2ORWA 1ZA1A 2WLTA 4PC7A 1RAAA 2R9VA 3LIPA 4GOJA 4ILKA 5K3DA 3ADDA 3TAXA 2CFSA 2QJFA 1VLQA 4Q3EA 3Q8MA 3WWCA 5AOCA 2REOA 3S2GA 2EZ9A 1JHDA 3GPCA 4RVFA 2W48A 1FBTA 4PQRA 3UMSA 1ZQ1A 1E1CA 1OT5A 1MAVA 4U3JA 3ZY2A 5DFAA 4KR6A 1IB0A 1BYIA 3KXPA 2V65A 3LW8A 3OJEA 4KRXA 3E9RA 4L5JA 2V7VA 1IUNA 1HG1A 1EJ6A 4XVCA 1MUUA 4YV2A 3IB3A 2F17A 2WWVD 3U4AA 3S7TA 2ZW9A 1P60A 1A2OA 2G6TA 4I9NA 1QP7A 4Z9BA 1ADGA 2FPXA 1G20E 4KRYA 3U81A 4I6EA 1M33A 1GYPA 3OZSA 4FW8A 3IGFA 1ECLA 3SHVA 3TRKA 3DDHA 3PC3A 3EDYA 1C0IA 4PPNA 2XNHA 4Q24A 4C4XA 1K8RA 3VYTB 1X42A 5BRAA 1XMVA 2R8PA 2GBLA 1S9HA 5AI5A 4UXHA 5F12A 2W98A 2E49A 2WEKA 2ZYTX 1U5BA 3TZCA 4Y6OA 3OLZA 4O33A 3WKBA 5J2UA 1KYVA 1N2EA 3D3WA 4ZYXA 1R8QA 4PG5A 5LN1A 4D8VA 1AN9A 5FA8A 4Q9AA 3NDIA 3M9XA 3QP9A 4MUGA 1AM4D 3IEXA 3KTDA 1RI3A 5U4XA 1ML4A 1VGRA 2I62A 3DBOB 1DRVA 2IY7A 3D4LA 4R1TA 3CMCO 3EDMA 4PSUA 3SU8A 5K0BA 1P5RA 3K9LA 5IWAB 1Y48E 2O52A 3LV8A 1MAUA 5IF9A 3NTUA 3E7FA 4ID3A 3OZXA 4F04A 3VYSB 1YVPA 4H7EA 4UNQA 4MW1A 2W6IA 3HSYA 2PRSA 4HBZA 3EGIA 1ZNWA 5BSMA 3Q88A 3H83A 4IJVA 4J4BA 4LZOA 1KI1A 1QWSA 4X91A 5E38A 5B2FA 2MJLA 2FMTA 3BA1A 1OHHD 2AZXA 3QXCA 1PR6A 4DV2B 1VBNA 1DTWB 2B36A 3ET5A 3E3OA 2YYSA 3B82A 1J99A 3UWMA 2F8SA 3OLXA 4S04A 5KNCH 4NNPA 5EA2A 1PHRA 3EGXB 1GFZA 1PFWA 1Z26A 4DIEA 3AMVA 1JHYA 3RFCA 2HV9A 2DZDA 4QIHA 5JY1A 4M54A 4OKSA 3BREA 2HNBA 3RLIA 4L4RA 3FOWA 1F6WA 3EFHA 1IPFA 2XKAA 1II8B 4B6SA 2ZRHA 3GIWA 5HDBB 2RHOA 4KUHA 4DIMA 4A8HA 1W44A 4NZ9A 1UDBA 2GZMA 3JQBC 3GEEA 3FCSB 4M3NA 3RIMA 5DM60 3OQMA 2CK3A 1N2GA 4A2WA 2A0WA 4YECA 1E1NA 5CIYA 3A1SA 3V2IA 3N6VA 4K9MA 2GASA 2WUGA 1BVHA 1I14A 4ZODA 3AW9A 4RZ3A 4P93A 4CF3A 2UYYA 1EX9A 1L1RA 2PZKA 1HT1E 4MVJA 1VSTA 2BELA 3S40A 3OAAA 4MYDA 1PT9A 2X2OA 4HNRA 4EKIA 1G7CA 3QVWA 1M7BA 2ZU6A 1A9OA 4X97A 4A2PA 1PK7A 1Y9EA 3EIEA 3FETA 1KZ6A 4IIHA 3AV3A 5ADWA 2DETA 4EMBA 1OLUA 5DN9A 3UC9A 2FQXA 4LXXA 1WZCA 2JFXA 5KDOA 1KPHA 4LDRA 1K3FA 3TQOA 1DB3A 4DLKA 4CLXA 5BSKA 4KI7A 2OSBA 1D1SA 4DQDA 3L7IA 2WSSD 4RA6B 3P2JA 4K87A 5G0TA 3HA3A 3K9CA 2E21A 4RK1A 3JZIA 3KSUA 4G5XA 4D46A 3SJAA 5FWNA 5ULLA 5SZHB 4DMHA 2FR8A 1X3LA 2KYRA 1O94A 3NHFA 3O91A 5IK2A 3W78A 4DDMA 5IAEA 2ZBQA 4LDJA 4ZREA 3TSZA 2IBSA 1EI9A 3BCSA 4BNKA 2O2GA 4IMJB 1A9YA 3O75A 2QN7A 2GLUA 5FA5A 1FU8A 4YRIA 2ZROA 2C2XA 3K9HA 3RTDA 2VXCA 2FDXA 2V6MA 1WEHA 1WKCA 4N0MA 3K0EA 3RSSA 1WG8A 1JFRA 2XECA 3BXPA 3ONFA 1IY8A 1SVUA 3QMPA 2I76A 1JAIA 1E1QD 4JJ6A 3F7NA 1DBIA 3NEJA 3JQ6A 3STTA 3V00A 4HMQA 4W1RA 1YB1A 5DN6A 4JMLA 2CYBA 3WIOA 1VCMA 4LDNA 3I9OA 3CRW1 3O8NA 5I9NA 1QGYA 3HABA 4GE0A 3SOPA 4FHDA 3KHSA 4F3RA 1HURA 2CNNA 2P2NA 5ARDA 3GDOA 2Z6AA 3TL3A 4OHKA 3PXUA 3T15A 5JNSA 4I1SA 3PUXA 3GYBA 5BSEA 2BY4A 2DQYA 2FLKA 1IQ0A 1D4OA 2DT8A 2QVBA 4RPCA 4LGVA 5FKJA 3SMQA 3H1TA 2GGSA 1KQGA 3GLGB 3UMBA 3OOYA 3JAKA 3IUYA 3M4YA 1QO9A 1KOFA 4KGZA 2GXUA 3MBKA 2GD0A 2W6ZA 3UAVA 2JIDA 4AWBA 1V1JA 3A10A 3F5SA 1UKCA 4DG9A 3U6BA 4EITA 4EBFA 3C3PA 4YWHA 3B9BA 2NUPA 2GZDA 2WTAA 2PGJA 3BRWD 4R54A 3FE2A 4WT7A 4E09A 2I03A 5K8IA 3ZCSA 2GKGA 4O1IA 5AVRA 4KWTA 2DR3A 2N1MA 3M6FA 1XDSA 4DN6A 3A9WA 1Z56C 3U2QA 4IG4A 4URZR 5EZ5A 2HQRA 3R7WB 2XZDA 4J1TA 3BMCA 1F6DA 4G67A 1A1SA 1YS2X 5IX8A 2HSWA 1N2XA 1GGMA 5HK9A 3QV2A 2DBVO 4QSMA 4CM8B 4MGEA 5EUCA 3WRWA 3A6DA 4RSMA 3VJKA 5I48A 3J81k 4JBHA 3BIOA 2OCPA 1SXIA 4OH1A 2VJCA 1YJBA 5IBRA 5IZCA 3MYRA 3IQFA 2POCA 1ONOA 3E7WA 1WKVA 3CNLA 1UBJS 2DBQA 3ETGA 4HTAA 2J9GA 4IWNA 4ND4A 1RZRD 4KIGA 2LRHA 3DZFA 3MJRA 1OROA 3E5NA 1ORRA 5B2EA 4C0HA 3CBGA 3GJRA 4L3WA 5LP6A 3E22B 1QSGA 2RGDA 3KFXA 1QDUA 3VSAA 2P79A 2QX9A 3EHDA 2BIFA 3UMVA 1WSDA 1VGVA 2ICAA 2O1WA 4YRNA 3B12A 2NPIA 4B6RA 5GZ3A 3RAFC 3C7DB 2FFAA 1PR2A 3IUPA 5AD1A 1JVBA 1JG3A 1QVZA 1YZFA 2ERCA 2PXHA 4MIYA 4BCCA 3P4UA 3G13A 4TXJA 3NPAA 2A35A 2DH6A 2Z6VA 4N7MA 2JGDA 3P9QA 1HFJA 4FBMA 4JC0A 4IEFB 4L08A 3KYDB 4PM4A 3G0CA 3JVUA 5G4KB 1UMCB 1SBTA 3G82C 2XY4A 5F1YA 1U3UA 2JJYA 3GROA 3T1VA 5CDTA 1Y5NA 3HM9A 3MTQA 4MCAA 3OIGA 4FZRA 4LKRA 3W5UA 1P4JA 4L57A 2QLFA 3K16A 2WJHA 1VJ1A 1KI6A 2XB8A 2D1RA 1JA0A 5BN4B 1M8KA 1P6XA 4FOOA 4TWBA 2RHRA 4J16C 3ZGLA 4J2HA 1VZ3A 4C03A 2PZFA 1V95A 2C9DA 2WSLA 2E4AA 3M6IA 1PG2A 2PZMA 2HY7A 3HCPA 2R96A 1QIMA 1ECCA 3ZDXB 2Q45A 4XVQA 4WZAA 4RHXA 2IPOA 2FG7C 5FUWA 1XTBA 3A4IA 1XQYA 3N5KA 4PYMA 5CCXA 2QN9A 1NSTA 4J76A 1JPUA 5CJJA 4CQLA 4ZAZA 3KZCA 3IC5A 1BGWA 1IIBA 2IP4A 2ZYVX 4KQ6A 3RWBA 3SQNA 5FOXA 1KZ1A 4KAFA 4AJLA 1QAMA 4ZJPA 1JQLB 3IVCA 5HNKA 1JEDA 1RLTA 2CBGA 2O07A 3EVNA 1GU0A 4HAIA 4MAAA 2B30A 5HS6A 3S2UA 3SQDA 3IAUA 3KYJB 2QSJA 1QMGA 2ZRAA 4UM7A 2PBLA 3JZFA 3TNFA 3WGHA 2DWUA 2I2BA 2OORA 4F5WA 4ZT4A 4S3MA 1Q19A 1EFUA 4ND8B 4B2PA 1IVYA 2PE5A 1SQ5A 2JLZA 1UBTS 3QG1A 4FCVA 4HVCA 3B85A 5BR7A 5LXTF 2ZIAA 3Q7PA 5BSRA 3RUIA 4LBZA 2DBRA 1Y3BE 5EE9A 5BQFA 2GHRA 3BJMA 1AGYA 4E30A 3TBKA 1RXUA 3EULA 3H7AA 1X14A 3AJAA 3VBCA 1GILA 2NSHA 1J5PA 3I1IA 1N2JA 3IQXA 1NRXA 2DPYA 3GVXA 1BN7A 4D92A 5KVVA 5EP4A 5EHXA 2ZVDA 5MDHA 3WLKX 1WXXA 4NP6A 3HNOA 3HGMA 3QLTA 5TQVA 5KJ1A 1G18A 2I7DA 4YJGA 2QD3A 2QT9A 4KB5A 1T3GA 5ITVA 1AZSC 4FYPA 1JHZA 2O6HA 5AUNB 3CRQA 3H5RA 3NRCA 4MRAA 1YFKA 2OV2A 1WUKS 1H0RA 1O6CA 5F73A 1U9ZA 4EFLA 5J2UB 4ES6A 1WZ2A 1H1TA 1SVNA 1UBFA 2AR0A 2QAGC 3GMIA 4RIEA 1QB8A 4WHMA 4X41A 5ESWA 1HFKA 5FF9A 1DIOB 1GA1A 2XADA 4MVJE 4C4PA 3P9YA 2Q3LA 3WISA 1R4ZA 1MXHA 3ETLA 2A86A 2QTNA 2Y4OA 1XRNA 4JNKA 1NG1A 3GUCA 1AKMA 2Z2ZA 1IZ9A 3BGSA 3SC2B 3T5TA 5ALJA 3HJGA 1XTPA 4LY9A 1H4QA 3G2PA 1VJGA 4FUQA 3P5BA 4ARUA 2REQB 3A11A 3ZGVA 1EEXB 1V8ZA 1CVLA 2PL9A 3C0KA 4DIDA 1ZU5A 1Y1TA 5HJ5A 1E66A 3FIUA 4E4RA 1SXQA 3CH6A 3JZMA 3NAZA 3H1PA 3COVA 2H0QA 3TCKA 4E07A 1E2GA 3LQ1A 4HS4A 3W5JA 3WIVA 2VSNA 3G2MA 1JFFB 1FVHA 2IYTA 4WKCA 4F8JA 1VG1A 4NMMA 4U5XA 1Y7IA 3PEEA 4Q1VA 4OA8A 1H6BA 4ZARA 1ZH4A 2ODAA 2HWKA 1GU7A 4BFXA 1SXJC 5JH7A 1JIQA 1XTIA 2QF7A 4S1VA 4MV6A 3AKZA 4FWTA 4BV8A 3I83A 4EY7A 3SYLA 3R75A 2ZZKA 4KGXA 2C4UA 2F3TA 5F78A 4Y6QA 3PLAE 4HXEB 2DXIA 1IHYA 1XJ5A 4CTKA 3IQWA 1JL3A 2C42A 3FNIA 3PSHA 1QYVA 1E3MA 3NKLA 4JI2B 1NVKA 1K68A 1IZ0A 3ZD7A 1QQ5A 4DWVA 1GZ5A 2WM9B 3RHSA 4D3DA 1YJ5A 1SUDA 3KPVA 4W9NC 1YRWA 2P4QA 2XIQA 5E6RA 1I80A 2FGKA 2ZP1A 4P7GA 2Q9BA 4ENTA 2W2LD 1WZIA 4X8MA 3K0AA 2C78A 2C99A 2OC4A 2X1HA 3HKDA 1E1CB 4U3JB 5LQCA 5DEIA 1NPYA 1WB5A 5KOIA 4R98A 1J22A 1UIRA 1YD7A 4L6AA 3BHNA 5JS6A 1ELOA 5LJIA 3DWIA 3DLCA 4DKJA 3HS3A 1OFTA 1N2IA 4ZPJA 4B1FA 4ALJA 3ZY6A 4DV3B 1T9BA 4URFA 1YNOA 3RHTA 4HCJA 1GYRA 3WLNA 5CFNA 1I4WA 2VQDA 3NV9A 4ZYLA 5KYWA 4BVKA 5GAJA 1QQAA 3AU9A 3ZHCA 2HCRA 4WKGA 4K7JA 3BL8A 4BB5A 3OZBA 4O63O 1NU6A 4G0XA 4RAQA 3WRXA 3ZCXA 2O0MA 2BHSA 2PS0A 3PD1A 1SC1A 3BMXA 2APJA 4JBIA 4J3NA 1KJ9A 2IYPA 1EH5A 1QPGA 3GVHA 2FTKE 3CONA 5A05A 3ZDQA 1R6VA 3FPEA 1KFEB 1T9CA 1HDGO 1U5BB 1WMBA 1FRZA 4Y9RA 2JARA 1M76A 3FDJA 3D3WB 2VUTA 3FNBA 2VF5X 4L8YA 4FQ5A 3UMGA 2OKGA 3PGMA 1FFSA 3JYHA 1ZJJA 2HSZA 3UKDA 1VFNA 5IT4A 1MEJA 3K4QA 4X3CA 3TRFA 3AILA 4BBPA 5DVZA 3PT9A 3INTA 5KNBH 2X8JA 5GJBA 2XAUA 1R5NA 4OHBA 4ZTBA 3RODA 4EGJA 1JQBA 1O95A 3GRVA 4EG4A 1IQPA 3B5JA 2GN8A 5T8KC 3ZE6A 1KGDA 5FTKA 1KPGA 1KVUA 1XK7A 5AW4A 2CB9A 5CNKA 1ZRNA 3R8FA 2O8FA 4PBSA 1O9GA 1RPAA 4P5DA 2XQFA 4UUOA 1LQTA 2FUNB 3QFFA 5FIUA 4UU0A 4AWAA 1BXZA 2WP0A 4FK8A 3RU3A 3HKCA 4LXIA 1I1QB 3RRBA 3LUHA 1OXMA 5D85A 1XV5A 5NLLA 4NYMR 4D2IA 2DPXA 2ILTA 2ZITA 3DZHA 2A94A 2X5NA 3FTDA 3R8CA 2BJVA 5LOVF 1XPOA 5JAZA 1C9DB 1J06A 3Q0EA 1D6JA 3T9FA 3R4CA 2ZDHA 3PTLA 4DLAA 3K1AA 5JSHA 2WIBA 2P5SA 4EJ6A 2HXSA 3TIFA 4FSHA 1GPWB 2WTNA 5B58T 1ADYA 5DLPA 3S4YA 4BNNA 2H31A 1OTYA 3CZMA 1Z47A 3LZCA 4PGGA 3UMYA 4OLHA 1Q6YA 2C3MA 3PQ5A 4KU4A 4TLEA 2G82A 2PQ6A 3GPDG 2XITA 5CX4A 1JAXA 1IN1A 3SR4A 1JHAA 4IPTA 3LLVA 1C81A 3FOAA 4OJKA 4G0ZA 2HPZA 3HBJA 4LRSB 1Z0KA 4PBRA 5WRFA 4BWFB 2PLRA 2O5RA 1SVKA 4H1WA 4QUHA 3ZHQA 5JI2E 5SYAA 2C7OA 2F55A 4GP7A 5B53A 2IUYA 1G41A 1X1DA 3W5IA 3I92A 1XF9A 1SUEA 3ZGXA 1R0RE 2VDUE 2ZKIA 2AHRA 4PW0A 4BU1A 3ZDDA 4MRPA 1MP0A 3LRPA 1FDWA 5GPBA 4B9EA 1E32A 3WGYA 1J56A 2CNBA 4PCUA 4WZAE 1OBCA 3QFHA 3F73A 1MZVA 1IRXA 3PKIA 3EFBA 3K6RA 2EFDB 4INOA 5J3JA 4XCVA 1OY1A 1QE0A 1JALA 1NVTA 3CPJB 4EAAA 2ZWIA 1OLUB 1YZGA 1XZJA 4X1YA 1CEYA 4BGVA 4ENWA 1T0IA 2YVKA 3N7TA 4WAUA 2RONA 5JNTA 1VHQA 3PL5A 1NIPA 1U28C 2MSNA 1BTOA 3AGQA 1CUAA 2VZ8A 3RVSA 4ZK2A 2VYNA 1RPJA 2IYZA 2Z8YM 1WUJS 2P3LA 3AP2A 3Q85A 2RGAA 1N57A 5FOQA 3L41A 3IJPA 2WTBA 1GRRA 3QWBA 1JPNA 2BFCA 1R88A 4DDHA 2R65A 5FYDA 3H65A 3CWCA 4RETA 5I7SA 5KQRA 5T4BA 1T8PA 4J1NA 1ICEA 1V8PA 4ER7A 4A15A 2XTNA 3LT4A 3HEMA 3GGGA 2RI0A 5ALOA 3NRJA 3IT2A 1FNDA 1NBAA 2YDYA 2DFTA 1W1UA 4FPXA 3GV0A 1C2YA 2RK4A 1SPXA 3N1UA 4FLFA 1OHHA 4H2DA 1QOQB 2NV6A 1VHTA 5FL7D 1E7MA 4G5YA 5TEWA 2NO5A 5K0GA 1AGXA 1ZG3A 3FCOA 1P2GA 4AIRA 2OXEA 3EPHA 3H5AA 3NJRA 1T6XA 1E8MA 3GJ4A 4H3HB 3CNEA 1GGJA 3E1KA 5J1SB 1AS0A 4I8DA 2Q2OA 2BMDA 3DDSA 4MAMA 3VPAA 6AT1A 4EW2A 2FQYA 2F3UA 1N25A 1JHVA 5ITWA 1GZ6A 4BAGA 2OFXA 3OC6A 4X7BA 3ZHOA 3JAKB 2WI8A 1GRCA 4XDGA 5ADHA 2IYFA 2VCYA 3VPDA 4QOHA 4LAFA 1HBJA 16PKA 3EWNA 4QPJC 1W9MA 4RQAA 1QGUA 4GM1A 2PT9A 3KJGA 3LRTA 4B3MB 4P33A 2NUPB 2WUWE 1ZD4A 2CUZA 3AM3A 1GSOA 3C5EA 3MMZA 2AJTA 3KOZA 2CY0A 4OL9A 5CLIA 3S2EA 1PO7A 5C51B 3MT0A 2ZTHA 3QWFA 1DV1A 3RBVA 6CHYA 4H3KB 2P5YA 4URYR 4W1SA 4EFMA 3IOYA 2CJYA 2AMFA 2PSJA 4DEVA 1QJ4A 4MTCA 4QOJA 3WXBA 3BMCB 1J33A 4DCPA 1ISGA 1T5TA 2R79A 3A37A 3HEBA 4BLOA 5JY6A 1MNAA 2CF6A 3D3JA 4L02A 5FQOA 1BX3A 4QTTB 4DMUB 3ORHA 4TM8A 2RD2A 2EQ5A 2OP0A 3CUVA 3RRZA 1Z7YA 4XA8A 1NXVA 3V1MA 3JY6A 2ODTX 2V9CA 2HMTA 4CUJA 3ZBUA 3DDZX 2WSSA 5ELMA 1IMJA 4LY0A 4BB9A 1W76A 1I3MA 4IJ5A 4DGSA 4CNBA 3D4PA 3LKDA 3VHQA 3LE8A 1XVAA 3VTKA 2IYRA 4Z1MD 2GFQA 3VDQA 5LP6B 4QBFA 1XZGA 4MYTA 3LLCA 5IBQA 4J1QA 1FXWA 3PT5A 3ZWQA 3BIJA 5IT0A 1AF4A 3DW3X 1Z7BA 2E4YA 2GCGA 3DGFC 1D5CA 3PXEA 3NOQA 2GXQA 3F98A 2CXSA 1R0CA 4UFOA 3UEOA 3I73A 3DAHA 3VR4D 3ESXA 3UHOA 3W06A 4JH0A 2JGDB 1LDGA 1E1QA 3G17A 3ZXYA 3UTDA 3TUJC 5AVXA 1HDCA 1RFLA 2Z6QA 3G8YA 3NTVA 2VAXA 4U7HA 4FUTA 3BXGA 1THGA 3ZQUA 1ST3A 3V4VB 8ABPA 4RK4A 3VM6A 4K6OA 1KI6B 3LOQA 5AW7A 2LR0A 3AINA 3E82A 5H68A 2WC1A 3JVVA 1PSZA 1M2FA 1A71A 1MB0A 1LC0A 4GRDA 5C2JB 4AS1A 3CRRA 4LC0A 8MHTA 4DCNA 5H83A 1TUIA 1JDNA 4WZAB 5AJVB 4LXHA 4TL6A 3IUBA 4W6ZA 3WK5A 3EDOA 2ZRPA 1MGPA 3HCEA 1JEYA 1V5IA 5EWLA 2ZBDA 4CQLB 4MUNA 2IV3A 3QGMA 4NECA 1THZA 1XC7A 2EHJA 3BRWA 4MV3A 2GZ2A 3O3NB 5ALFA 5JUWA 4NYJR 3EIOA 2GKSA 1OLSA 2ZRQA 4LVUA 4FZ3A 4ONEA 4KMOA 1V1MA 1TLFA 4EL0A 4TYWA 2BHTA 3ILVA 1GPMA 2IUFA 1A9TA 3KUKA 3SZRA 1YB4A 4JT9A 3EWIA 3KVYA 3L0YA 2CXRA 4M0LA 3GRAA 5JANA 1FZTA 3RUPA 3H2SA 1VKOA 3H9QA 1BA3A 4KMMA 4LHWA 2V9ZA 1XZDA 2NVBA 1S7CA 3I23A 5AHOA 4R2JA 2NG1A 3LX5A 4MGIR 1J97A 5BVHA 4ZVQA 4HZUA 4LI0A 4Y9UA 2WY2D 3MA0A 4BWGA 4D56A 4A0HA 3EZYA 2P6NA 1OFUX 2HEGA 4U7FA 4RSGA 4DIKA 1RZRA 4EO4A 5IM4A 3S68A 4K6MA 2WA1A 2ZJAA 1P77A 4BRUA 4MEAA 1C30A 3EXFA 5FCDA 3PK0A 3TZHA 5AVTA 3VH1A 4EJMA 4MUEA 3LUAA 2PR2A 3U1VA 3C70A 2F4NA 4YJGB 2N42A 1NATA 1WXEA 3REFA 3IP1A 5KINB 5G2OA 1WXFA 1X1TA 1XLTA 2ZR0A 1EAYA 3W5HA 1X1RA 3HU5A 1LSJA 2FZWA 1KQOA 3FYUC 4RKWA 3ZCVA 4F9TA 3IHLA 1YZYA 3NYWA 5JFTA 4E2XA 1PZEA 1ZRHA 1R9GA 1Q7BA 3EBPA 3H1AA 4G0WA 4RO0A 3QLVA 1WE2A 3FPSA 2O2YA 1NXSA 1GJRA 3JR3A 2D62A 5E2IA 3O8DA 1N7GA 2CCJA 2VKTA 5IARA 2NNWB 2G06A 3FRHA 1K75A 2PSHA 2NGRA 3QUAA 1XTSA 1Z0AA 3QFRA 2I4NA 2Y3IA 1B73A 3K4PA 5EKXA 3X2EA 4X61A 3NGMA 1XTQA 2VF7A 4PPQA 2H16A 4LRXA 3BXZA 3ED5A 2JGLA 3HA2A 7ADHA 2Q99A 3M2TA 4LYEA 5TV2A 1EHCA 2YRXA 4BO0A 2Y0DA 4I5DA 4R9RA 4B76A 1NVBA 2JLBA 1B8OA 1DC3A 1OAOC 3NWOA 5JV5A 3I28A 3T54A 3ROXA 3RUFA 2AFIA 2HTFA 5DB4A 3GBVA 2QMQA 1DG3A 2F90A 1M5TA 4MX8A 5JH7B 3SHQA 2Z09A 2WJWA 4NHOA 4KW7A 4H0NA 4REQA 3EBOA 1K6MA 1P29A 2XWJI 4AJ4A 3WYBA 4X3PA 1AZLA 2R85A 4DM3A 2CUKA 2YCLA 4BWVA 5L3ZA 4NMLA 3SSAA 3GN1A 4BJ1A 4LNHA 3HJNA 3FNFA 3P9CA 4HC4A 1YFZA 3OU6A 4NMXB 4OHMA 1YBVA 3JSXA 3WK4A 4D44A 1X9IA 1J42A 3CF2A 2VL7A 4R3NA 3SJUA 1DKQA 2FZGA 3E48A 4F9EA 3BG5A 5E6RB 1RI5A 2JCGA 2WIJA 4Q9NA 4K1LA 2IRWA 2BKXA 3K0AB 1QRSA 1Y1RA 2WYUA 3HKDB 1P0IA 1H5UA 2C00A 2IX3A 1GTVA 1U98A 1XCMA 4R8RA 5AKLA 4PAGA 1XDUA 3CUKA 2I99A 4YCBA 4K9NA 1JXOA 1E1MA 3KKZA 3H4VA 1N3BA 2BFBA 2H17A 2HFJA 2VS1A 4JYBA 3ZJYA 4RM2A 1TM1E 1NQAO 2OD9A 1UC5B 2IX9A 2JIPA 1O3YA 3DCJA 3KD3A 3H8VA 1Z5GA 3KKMA 4RWEA 4W9MC 4Q3AA 4Q4AA 1MV8A 2IU3A 2WE8A 1SD2A 2VYCA 3KOXA 3MCZA 1MO3A 3OKFA 2AF3C 4K9SA 5FI5A 5J9FA 4XYBA 4CT5A 1PZFA 5KYWB 1N5RA 2VI5A 3FWPA 2D59A 5D6NA 2FN4A 1E61A 3O92A 2H48A 4XEUA 3OFJA 2JATA 1W4LA 3TX2A 2HLDA 3EE6A 4H1UA 5KPDA 4Q5IA 1YQTA 1L1QA 1UPFA 1K7FB 2C0QA 2V8BA 5A5DA 4B3GA 2QQ5A 4TSFD 3WYNA 3CSSA 3STVA 4AQDA 1PWXA 4AZ0A 4PY2A 1HYGA 5B1YA 1ZSNA 2JHGA 4NF2A 4RDXA 5F4ZA 3DHWC 2XGSA 2P6UA 1WLSA 1QTIA 4AP5A 2P5UA 4AZWA 3AFOA 4E5VA 3A70A 2J33A 5B57C 3TK1A 1PU2A 3Q3CA 3IUQA 2Q4OA 1CUEA 4JFRA 1OXTA 2XNJA 2YOHA 2DCUA 1MJFA 1SRQA 1DX6A 2MSKA 3FCUB 3F9RA 3HB9A 5K99A 1WETA 4TL9A 4ARVA 3Q3VA 2X8JB 4KR9A 1JU4A 2DAPA 4ISBA 5CK4A 2K87A 4UFNA 2AXQA 1GPYA 4J4TA 2GRAA 1G4HA 2JFUA 3ZX5A 3I9NA 3ASUA 5A5FA 2FNAA 3VC2A 3QF7A 1LH0A 5DHQA 3ZK7A 3ROZA 2D3WA 1WQ3A 4PLYA 2Z5GA 3L04A 4K3VA 2O8FB 4AKGA 1WULS 2NN3C 1VBMA 1YT5A 4YX9A 3GFQA 3IEPA 1ECFA 3O03A 3PDUA 4C07A 4MMYB 4A8TA 1D2EA 3HKCB 2O1XA 3BSSA 3HMQA 2ZJOA 2JHCA 3BBLA 2XRFA 4XCQA 1VPTA 5K3OA 3VKUA 5FI3A 2JAPA 2I80A 2JVJA 3EZ7A 1XUOA 3KM0A 3N2EA 5EMHA 3AV0B 3ZJUA 3H5LA 3PPXA 1SKMA 3QHQA 2B4KA 1XTZA 2CNLA 3F74A 3K1AB 3QE3A 1CJKC 4YO8A 3WLTA 3DV0A 1RWXA 1UEIA 1P1FA 3Q8WA 2JA1A 2V3WA 3HY6A 2EOAA 4IJ6A 3R6WA 3R09A 3UENA 4B7CA 4ARCA 1ODFA 3PNMA 4C30A 3MD9A 4NCHA 1ZW1A 4M99A 1GPH1 5BUSA 3GFTA 1Q44A 1EG7A 1EE2A 4CL0A 4EYKA 1ZNQO 4IZIA 4Y9DA 2I71A 3DMTA 5I9MA 2DFVA 1FJXA 1UC9A 2Z3WA 1OX5A 2Q9UA 5T6BA 1KAOA 1GZUA 4YJKA 2WHQA 4LY3A 2VNHA 1ZO8A 1RLMA 4XUEA 2HOQA 2OHVA 4MICA 4GLBA 3EQ6A 5CBPA 3FRIA 1QVRA 5GY7A 3MJCA 5F35A 1LI4A 4EPYA 5CDYA 3U16A 1XB2A 3LVRE 2AS0A 4RULA 2R47A 4O02B 1KEEA 1R1DA 3RC7A 2WHPA 2B61A 1J7KA 2QI9C 1EEHA 1X1AA 3GEMA 3W5BA 3FYTA 2H06A 1FDTA 3CRZA 4JP3A 5DSTA 3M8KA 2Q7DA 4X1YB 4EQZA 2ZXFA 4MQUA 2YZNA 3HJTA 3R6TA 5H9WA 2JLQA 3D6HA 2WM3A 1L2TA 3C6XA 3B70A 4MLCA 4ZVKA 3V6MA 4D8WA 2IHKA 5FAXA 4HGNA 3PQ4A 4GYWA 1QIEA 1Z5ZA 2P35A 5ECGC 1ZUHA 2C59A 2CL7X 4JB8A 5EE5B 2BRUC 5LB2A 3RU9A 3FYSA 1AKEA 4HDAA 1XVUA 2P67A 2OQ2A 2V0CA 2JBAA 1IY0A 2BFCB 1YOVA 4WPGA 1AMNA 2O2ZA 1UKEA 3AVUA 2VR1A 2Z95A 2D2FA 3LFTA 4RDIA 2CFCA 5HOQA 2VF2A 1JEOA 2DKFA 2VSQA 3OZRA 5ED0A 4H3VA 4UDNA 1YB7A 2ADFA 4HEJA 3GJ6A 3GA5A 3A06A 5CK5A 1GQ2A 1KMMA 4JLMA 1LTKA 4DCJA 2OZKA 1REQA 4O4IF 5CYFA 2PQ2A 4MUKA 1BS1A 2RMKA 1BQ3A 2XQJA 4Q7EA 1PQPA 3RDPA 2BGWA 2C29D 3HCOA 5KNCA 3AOEA 2GBCA 3E9MA 3TDNA 4UDOA 3W8RA 5IH7A 1KORA 1ZK4A 4CE6A 2XDQA 2GK7A 4WXPA 1MX3A 3SX2A 1W73A 2FUCA 2W83A 3WDLA 1KIFA 2OBYA 4WNYA 3LUDA 3ZWYA 1TE2A 2PL1A 2GSDA 2V7XA 3UJPA 1RLIA 4YFVA 3ZWNA 3QA3E 3ONDA 3RVOA 2XNCA 3L6RA 1XU4A 1Z5OA 1EK6A 5AOAA 1Y8RA 5ICMA 1JNXX 3IQZA 2OHXA 3N8KA 2GOYA 1EP9A 1QGUB 2OE2A 4Q66C 2I55A 4YUXA 3JZDA 2SNIE 3B3AA 4HLQB 4ZU3A 1NC3A 4Z2YA 4A4DA 3ANLA 2CVQA 3FZQA 2ZCVA 1BZYA 4MVCA 5B6PA 4G3XA 1NNI1 4Q3DA 4XIGS 4GHWA 5HRCA 3H16A 3UAZA 1IOZA 1E5VA 1DWQA 1UJ5A 4JLSA 2QUIA 4WZBA 3V1UA 1PR1A 2P4UA 1Q7TA 3DOIA 3D8RA 4GSYA 4B43A 3WWYA 3ZVLA 4HWOA 1G4UR 2R25B 2WJZB 2PUAA 5DU2A 5I7WA 3D7LA 4F46A 3KB6A 1SVOA 3MAJA 1KHHA 2B9VA 3M6AA 3PF9A 5KB3A 4DG5A 1MAAA 2AB0A 6ADHA 3DOOA 4OVKA 2YN0A 4EKYA 1PNVA 4HDRA 3P7MA 1ZESA 4TWRA 4LHVA 1UQUA 2IOYA 1CFZA 4DV0B 3S8EA 1XPRA 4XIJA 5CUQA 4PLTA 3HCBA 1GGFA 1IZYA 1UKVY 4V0MA 4RPLA 3BHJA 3V7YA 4Y7DA 2ZJ1A 3SXUA 4P32A 3D4IA 3R0JA 3SF8A 4QUKA 4BFZA 3F46A 1R0SA 4AO7A 4ZCPA 3SKVA 2QJRA 1MV5A 1S8OA 3KT8A 1G63A 1X1QA 3O83A 2FAXA 1UBMS 5IKEA 1FNMA 3GLIA 2FY8A 3LBNA 4BLPA 3D7KA 5EQFA 3QW4B 3KE8A 4OJNA 3RAGA 3UJ9A 4NG4A 1R8JA 3GL9A 1ZUWA 2VQ6A 3CVJA 5FL7A 5LMZA 2QMYA 1USVA 1JPJA 4S1OA 2PBFA 3AI7A 5HKKD 1J07A 1N1EA 3BD8A 1XF1A 2CNOA 1L8OA 2DWQA 2G63A 3RJZA 2V4MA 3EAGA 2ZYIA 5FORA 3IULA 3UJHA 2P3SA 4C3OB 2F8MA 1EE9A 1M5UA 1QBGA 2M32A 1TKBA 2V45A 3TLJA 4HN2A 1XO1A 4A10A 1NI4A 4HAYA 5JXHA 4CU2A 3RSLA 5JDIA 4Z9AA 1MXFA 1R8XA 1YIDA 1PJBA 4TKMA 4AN1A 3SFTA 3CEJA 4NAVA 5SZKB 4YY3B 5LPNA 1JEYB 5EWLB 1ATIA 3BTVA 4RD6A 2HA7A 2LBPA 3PUVA 5SZIA 1ECPA 2PUDA 3ND8A 3DE2X 3FM9A 4YN3A 1EVQA 4JR2A 5LQSA 3IUNA 1OLSB 3I61A 2P30A 4RTNA 1V1MB 2A84A 3HC7A 3WTCA 4L73A 4IUYA 2VUIB 1RKBA 1DGQA 1M73E 4DLNA 1HH4A 1E94E 5F9FA 2E0IA 3QPCA 2FX2A 4OYHA 2VRBA 5HRUA 3EY9A 1PTKA 3U9TA 1G6HA 3EJWA 5CPBA 5BVHB 3UXEA 3NGLA 4DZTA 2VQSA 3FFBA 4HZUB 2DTXA 5EJ6A 4RXTA 2Y93A 3N9IA 2HWUA 3QKIA 3CH4B 3X3HA 4G9BA 4D9IA 5EHZA 3GNLA 3QPDA 2JGMA 3KUDA 1K06A 4HRYA 3L6DA 4OMDA 3CT4A 3L2OB 1I6KA 3PCRB 1Z28A 1EGMB 1C30B 3EXFB 4PTLA 4L6IA 5I7RA 3SVZA 4OXKA 2HF2A 5CVCA 3TBFA 3RYTC 1YB2A 3U3JA 1ZM7A 1IY1A