4X3PA

Sirt2 in complex with a myristoyl peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
297
Chain Sequence
GSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sirt2 in complex with a myristoyl peptide
rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
molecule keywords NAD-dependent protein deacetylase sirtuin-2
total genus 98
structure length 297
sequence length 304
ec nomenclature ec 3.5.1.-:
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4x3pA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4x3pA01
2QQGA 1DJLA 1PI3A 4HDAA 1YHZA 3CLSD 5EJ9A 1Y9DA 4K9PA 2NYRA 2JI8A 1Q1AA 2WVAA 4RMJA 4UU8A 4K9NA 4K9QA 2H4HA 2FN3A 3CLUD 4JSRA 4RJKA 2NXWA 4BVHA 4MPJA 4GM1A 1T9DA 2H4JA 4JUCA 1U2DC 4TWJA 4K9MA 4IAOA 1J8FA 1OZFA 4Y6OA 3GLTA 4UUBA 1HZZC 5MFZA 4JUBA 5EJMA 3ZGVA 4C7BA 2H2HA 4V1CI 2JI9A 4BV2A 4K9OA 5FYQA 4BVBA 1POXA 4COKA 5MGNA 1M2JA 2Q5QA 4GM0A 4BVEA 4UTRA 2VK1A 4IG9A 2UZ1B 4JU9A 5MFPA 3PDHA 3E9YA 2PANA 1U2GC 1YHYA 4BVGA 2FSVC 2UZ1A 4ZP1A 2OD9A 1YBHA 2Q5JA 4KXQA 1V5EA 4UTNA 2PGNA 1N0HA 2Q5LA 1M2HA 5DGTA 1UPBA 4D5GA 2H59A 2JI7A 3CF4G 4FEGA 2A1TR 1V5FA 2BRUC 4J1TC 5EJ8A 4BV3A 4L3OA 4Y6QA 2X7JA 5K6RA 2AG0A 4Y6LA 4JUDX 4FVTA 3RIGA 4RMHA 1BFDA 3D81A 3EYAA 4F56A 4GP9A 2OD7A 5DEIA 4O8ZA 4RJIA 2B4YA 2OORC 2FRDC 4V1CA 3HWWA 3K35A 4D5EA 4JU8A 2H2IA 4TWIA 2IHTA 3FLMA 1Q17A 4L2IA 2H2GA 2A1UA 1EFPA 4K9LA 2JIBA 2JLAA 1MCZA 1M2KA 4BN5A 1EFVA 3EA4A 5AHKA 2DJIA 2JI6A 2PGOA 1U28C 2H4FA 2WVGA 1XLTC 4UUAA 4RMIA 3JWPA 1S7GA 2OD2A 1ICIA 1PO7A 3IAEA 4J16C 5DGDA 4HD8A 3ZGOA 1QPBA 2EZ4A 2VK8A 1M2NA 1PYDA 1T9BA 4V1CB 2OO5C 2Q5OA 1T9CA 2H2DA 1T9AA 4JT9A 2Q29A 2QQFA 3EY9A 4JUAA 1MA3A 3U3DA 2Q27A 3PKJA 3GLSA 4MZXA 4MPRA 5EJ4A 1YNOA 4FEEA 2WVHA 4I5IA 2C31A 1OVMA 1OZGA 4G1CA 4GM4A 1YC2A 5EJ7A 1Q6ZA 2VK4A 5K2OA 1O96B 1PNQA 4FZ3A 1SZDA 1Z8NA 3IAFA 4IF6A 4UTXA 3RIYA 2VBFA 4C78A 1Q14A 4RJJA 5EJ6A 3CLTD 2IHVA 2Q28A 4UTVA 1O97D 4KPUA 4MPPA 5EJ5A 1ZPDA 2VBIA 1SZCA 1E3TA 5MF6A 4JT8A 2H2FA 1YC5A 4X3OA 1PVDA 1PNOA 1UPAA 4R8MA 1S5PA 4BVFA 3CLRD 4Q9DA 3GLUA 2EZ9A 2FR8C 5BWNA 2FWNA 4KGDA 4QPZA 1U31A 3OE1A 5BWLA 5FEMA 1PT9A 2JLCA 2EZUA 4GG1A 4GPEA 3HWX1 2HJHA 1D4OA 4BN4A 4JD5A 1YTLA 4MQ5A 4QQ8A 5BWOA 1NM5C 2V3WA 3F6BX 2AG1A 2VBGA 5K6TA 1JSCA 3FSJX 1OZHA 1YI0A 1POWA 2W93A 5IMSA 4UU7A 1M2GA 3GLRA 4BUZA 2VJYA 4K9KA 1UPCA 4UTZA 1YI1A 5K3SA 3D7KA 4QELA 4RMGA 1PTJC 4JUFA 3JR3A 4X3PA 3D4BA 2EZTA 3FZNA 2IHUA 2EZ8A 1V5GA 3F6EX 5EJAA 3LQ1A 3U31A 3PKIA 4ZZIA 5D7NA 3ZG6A 4F4UA
chains in the Genus database with same CATH superfamily
2PH5A 1XZAA 2OK7A 3KR1A 3VVCA 4ZK6A 2CL7X 5C5IA 4Z0HO 5JFOA 1J23A 2FKAA 2NXWA 3PC8C 4CEIA 2DULA 1E9RA 1C1HA 3NASA 2ZRPA 4MMXB 2ZCUA 4CL2A 5ICCA 4ESVA 4LXYA 3JPWA 1SU7A 4UHKA 1A7AA 3DBLA 4D9IA 3K0SA 2GEJA 3W7VA 3NRCA 3D6FA 3IEVA 3GFGA 1C3JA 1HZZC 4GX2A 1UM8A 4QIHA 1ZMOA 2CXQA 4DKJA 2IP2A 3GLGA 3SQMA 4NZ9A 4TMFA 4WKPA 1S2GA 3NHYA 2G6TA 3CE9A 1NQ5A 3OKFA 1QPGA 4N01A 5FRDA 2IYTA 1JEYB 3BG5A 4BTLA 2Y1EA 3SI7A 1X7HA 1U1IA 2X6RA 3AEKA 4DLRA 5LA6A 5KINB 2JRLA 5HJ2A 2AOVA 2W7TA 3PJRA 1PBTA 1WSDA 4JJFA 4KDRA 2ZSUA 2VS1A 3RS8A 3GFPA 3T6KA 4X95A 1LUAA 4BO1A 5KCZA 3KX2A 3H5RA 1ENZA 1FJHA 1O89A 1BS9A 1KSJA 3IQDB 2WR8A 3L7DA 1XRNA 3AJEA 1JP7A 1WV1A 4LQCA 4NECA 4MRAA 3TRJA 2W2QA 1EDDA 5E6SB 1JVSA 2VSFA 2XDQB 1KERA 3CUTA 5T4EA 4WD3A 1FTWA 2BDEA 3T1VA 2IY9A 4ENWA 3VR4D 3UKOA 1MO3A 4WZBE 4DIUA 5DE3A 1JSZA 3GLFA 1BWSA 2X5OA 3RUHA 3J7AC 5JY1A 3ZLJA 1JMVA 1UXGA 4P5DA 2EG9A 2G1UA 3DP7A 3E9MA 2I3BA 4ND4A 3RYCA 3RVNA 1UBGA 4TYMA 1H1DA 1EBFA 4IYJA 1OPXA 2PK3A 3ET4A 3NV7A 5DGHA 5LB2A 3TVDA 2FETA 2FN9A 1G6HA 4ZOLA 2F6RA 1TZBA 4NU0A 3KQTA 4E7OA 1UFQA 5CFMA 3JD2A 5C1IA 3C5VA 1NKTA 2VQFB 1I7PA 5FHRA 4G37A 4GE0A 4DFDA 3ZV5A 2JFUA 3HKDA 2JDID 4G8BA 2B92A 1W1UA 3RTEA 1Y3FE 1X9GA 3VZQA 4CT5A 2WU3A 2W2VA 2RGNA 3KO8A 1GSHA 1UKCA 2Q3BA 3E7FA 4UBLA 2PIDA 2I6FA 2PLFA 3IXLA 4E94A 1GNSA 5L53A 1I7SB 3WR5A 3OPXA 2X41A 4D9MA 4QJ3A 1C1YA 2UUAB 1E77A 3ZN2A 2V1UA 4L4ZA 3ND9A 4YN3A 5CYOA 4AJ4A 2V59A 4R9RA 4EW2A 5JSFA 2NV0A 4M1ZA 1FXWF 4DN6A 3H2YA 4PNHA 1DBSA 2DKNA 1SUFA 5J5VA 1VZ2A 3MQFA 4A6XA 2RHJA 3HDHA 2AWOA 4GG1A 4G09A 1FJXA 2LCFA 1LTKA 1J8MF 1RWBA 3DLPX 4JIGA 4QYSA 4GPAA 4AS3A 4NEQA 4IYRA 4MHSA 3QF4B 5HJEA 1PX0A 1RHMA 1H42A 4G8DA 4NF2A 3F7MA 1OBVA 2CXOA 4YWJA 1FYFA 3THSA 1K8XB 1XAJA 4D3YA 4G0XA 2VTBB 2JH3A 5DHQA 3BRSA 1K66A 3GP5A 1U99A 3JWEA 3C85A 1SCAA 1TF2A 1KDVA 4C0AC 5B2EA 1ZO8A 1I5RA 3T7KA 4C0LA 2GEVA 2NU6B 2ZTLA 4WXYB 4DSOA 5ELXA 2VDLB 4IKOA 2ANCA 3F6EX 3MTEA 3OUUA 4JDPA 2FZ4A 1ZIXA 1VSTA 3NVDA 3CF2A 3UWSA 4V0MA 4MW9A 3DC7A 1E4EA 4RWZA 1GQYA 3SSAA 2HA2A 4RTNA 4UXHA 3QKIA 4BLPA 1OLXB 2P77A 3OIDA 3RKUA 3SDBA 2O0LA 4IOMA 2QQ0A 1Z6PA 4UNRA 3AI3A 5FFNA 2PU7A 5KOIA 4ZI5A 3JV7A 3T7TA 2IIVA 5I7SA 3TTXA 3DF9A 2PWZA 2JI9A 2QX8A 4A5OA 4ZT5A 3E2PA 2GOYA 2A58A 4TMZA 3LX6A 3RC2A 1A82A 2BF4A 4DPKA 2M9MA 2ZYSA 2QN1A 3HEAA 2BBOA 3FI0A 4OH1A 4YCNA 2C4WA 3WL5A 3TH5A 3OT1A 4G07A 4O2AB 6AT1A 1Z16A 3EIQA 2RARA 2BSQA 3WGMA 1UF9A 3C87A 4UTNA 1TZ2A 2CGEA 4C5AA 4N39A 1HYGA 2QGZA 3IHWA 3PFHA 5KIAA 3GLKA 3PQ5A 3AYZB 5AI6A 1YA8A 5TVGA 3GDOA 3W78A 4JEUA 3I30X 2ZBDA 4K6FA 4ZYUA 3HFJA 1BDJA 3QITA 5B2FA 3G8CA 4IOLA 2VF4X 3RYCB 3IH5A 1VCNA 1UPTA 2BDUA 3WLIA 3ZZUA 2GWRA 4RH0A 2O3JA 3WNZA 2XE7A 4AF8A 4D9BA 5TGTA 2GYUA 5B5SA 1G18A 2CXPA 3KSZO 2YHSA 3P32A 4GKAA 4RC9A 1IOVA 1HE5A 4N5MA 2CV2A 3PEEA 5K05A 1RMTA 2VXOA 3MT9A 1FYWA 3OPMA 3H11B 3ROXA 3FXAA 2AQHA 1YS1X 2ZSAA 4OFWA 3NC4A 3T5BA 1YA6A 3W5UA 4J16C 1EK6A 1JG3A 3GEHA 2PL9A 3FOWA 3N2LA 4YRMA 2QMZA 5C8ZA 4XCQA 4HX2A 3AINA 2J0UA 3K3PA 2WJYA 4PICA 4BBZA 3ESRA 3PXUA 2CL6X 3M33A 3R7BA 5JJIA 4DADA 3GB9A 4N7BA 4MVJG 5G40A 4ZV9A 3WK8A 4DR4B 4R40A 5FL7D 2QN3A 2HNKA 4I3HA 3AEKB 3JYHA 1UEJA 1JHVA 3QMWA 2PBZA 1QNLA 2OG2A 3L0ZA 4QQKA 3HJHA 3X1DA 3QVXA 5CIWA 4P81A 3ANLA 2XA1A 3I9LA 4Y6RA 1UZNA 3FHOA 1FLVA 1XU9A 2A35A 2P11A 4ZVQA 3TQFA 1DJMA 2VBIA 1CQXA 4XJXA 1JYEA 2JD1A 2H0AA 2PRJA 1UBJS 4NK5A 5DNDA 3G7NA 5C53B 1OAOA 4YXWA 2UXCB 4B7XA 4Q3EA 2HCRA 3I6BA 4WA7A 2ZPAA 1OX6A 3A4NA 3GGJA 3TZCA 1LX7A 3FR7A 1KFJB 4RQBA 1I0IA 4BNLA 4BN4A 2OSVA 2Q6TA 5E7QA 3NJ8A 2IK8A 3I1JA 3N5CA 4O2BA 1MXFA 3NTVA 4XDHA 1XZHA 3MUOA 1HE2A 1RBZA 5DCLA 4TVBA 2QY9A 1LD3A 3SSMA 2YXDA 3MS2A 3E0XA 1G9TA 2IOFA 2CXNA 2YBEA 5FWYA 3AB8A 1RKBA 4UTZA 1I7LA 3CG4A 3ETGA 2ZE6A 3Q6NA 5K3SA 1SK8A 1ZL0A 3GFBA 3U3JA 3AM5A 1YXMA 2MR5A 4Y1GA 4EY3A 4C2BA 2ETXA 2FUKA 2IHUA 5EMNA 2ZAMA 2VJPA 4FS3A 1GKIA 1JRLA 1VMAA 2MWMA 3ZYCA 1Z0ZA 2CFTA 1OB2A 3AYXB 2RCYA 3PNKA 4RKEA 3OX4A 2XZPA 2H4JA 3T15A 1XUOA 5THQA 5CYGA 1SG0A 1YB2A 2YJ5A 3IR5A 2W71A 4TPKA 4K1XA 5FBWB 1I32A 2A0UA 4FR5A 1L5HA 4IINA 3QKTA 5A0TA 2Q9BA 4TV8A 1OGJA 5AW0A 2JJQA 1UKAA 1BH6A 1IBMB 1I1HA 1RHJA 3FIUA 3HKEA 3KOMA 1ATIA 1CEXA 1WEHA 3S4YA 1OLUB 5MFPA 3HVHA 2DR2A 3ROQA 3IBTA 3ZC3A 3DE3X 5LR6A 3PGKA 3CG0A 4H9GA 5CVVA 4I08A 4TMWA 3TQHA 1USGA 5FLXA 4TWRA 3NVMB 4LJYA 1D07A 4ENVA 1WBBA 8GPBA 2Z6UA 1MRSA 1CFJA 1X80A 1JHAA 1UQTA 2UYOA 3ANMA 3AWDA 2VL7A 3AJDA 1EA7A 3K2BA 4HGZA 4IW3B 1WA5A 4N1AA 4RK7A 1PFYA 3PLAE 1YB7A 3CKYA 1JHYA 3TR6A 4MB6A 1M2OA 1DJQA 1UJNA 2V4ZA 2YIJA 3MRSA 3O9ZA 4FQ7A 3HDQA 4H6XA 4JLOA 3QUCA 4AG6A 1YULA 1QQ5A 2AFRA 4N3NA 3KZVA 4HMPA 2V58A 2IEZA 2GX6A 3LPNA 3FCCA 4JLJA 2A1UA 3WWDA 1H5UA 1ZK1A 2ET6A 4HRAA 4R98A 1KORA 2HPVA 3EA4A 2JI6A 4TSKA 5E9WA 2GN9A 1DUIA 2IS1A 4CTKA 4IQ4A 1M8KA 2IGBA 4ZHQF 2R6DA 1XX6A 2ZI6A 1PKEA 2OHFA 3EDRA 4XWWA 1XP5A 4F9EA 1R6AA 2QRQA 4MZXA 1M2FA 3JQFC 5BWMA 1E89A 1THGA 3NS7A 5AW4A 3GQVA 1S8NA 3NTLA 4LJ4A 5GONA 4OQMA 2CXXA 4KYUA 3E9QA 3OCWA 4EM6A 3O2NA 2BP7A 3VSCA 3GJRA 1SIWA 1EVYA 1K6EA 1YVEI 2D7CA 4IBOA 2D0IA 4IY1A 4ZMRA 1FS5A 4RJJA 1BXZA 5AUOB 1GL7A 1XL1A 4MMYB 4URZR 5JDCC 3LF1A 1P4HA 1ZGHA 1SG9A 1TU4A 1L4KA 2GVNA 3L3BA 3NKVA 4MW7A 3T06B 1TRKA 1SWVA 2B37A 4BVFA 2NPIA 5CLHA 3DE6X 1YFJA 2GEUA 3FMPB 4AO7A 5F78A 1PQ4A 3K0FA 3NWBA 3OT5A 1X19A 3P2OA 4KXYA 2WWYA 4ETNA 1ZR4A 4ROTA 1C81A 2AG1A 3KYDB 3OY2A 2O14A 2P9BA 3NVAA 1SEPA 1TVMA 5DX0A 4AJ2A 1P7WA 1DEHA 2X22A 4EKDA 2ZAYA 3CF6R 3QVTA 4WX2B 1UBUS 1XQVA 1MQ9A 3HBMA 5EKUA 4YMTA 3MRVA 2HIHA 1ULHA 3BORA 3PIRA 4G9EA 4HEA1 4MS1A 3T99A 1M6VA 1D6MA 3L7LA 4NZOA 4P93A 4D44A 1QGDA 1B2RA 1ZS9A 2PMFA 2VKQA 4J16A 2C7PA 3D3KA 3T7JA 1FP1D 3W2IA 4MA4A 2G1KA 1YCHA 2G06A 3ABIA 5IT5A 2ZSEA 4GOMD 1VGQA 3CEPB 3FD8A 1L5NA 4PSAA 3DWGA 1YHZA 3EDQA 3MTAA 4IIXA 4I55A 3WMWA 1GUYA 4EBBA 3F9IA 2QZ4A 2FWJA 3KJIA 2AA3A 3Q9LA 4MVJP 2NP7A 1KDPA 1E1LA 2ZUSA 3THWA 1ZM2A 3GHHA 2BLNA 2X3FA 3RT9A 4AC9A 4C03A 5K0SA 1AUXA 1BXGA 1H2FA 1C0KA 1L5MA 5IXSA 7AT1A 3U19A 2BGTA 2VHJA 2AKAB 4Y1RB 2F43A 4DVGA 3KWMA 2FEPA 3DL2A 3Q85A 5FWDA 3BL8A 1IY2A 4AG5A 3ER6A 1O08A 4UFOA 3KUUA 3D2CA 3UWPA 1W85A 3QYAA 3E9YA 4I4IA 2ZYIA 4NATA 2SICE 1ZKMA 1IUOA 3B6JA 1ZW1A 3E5RA 4FUQA 4YMWA 3DOHA 1YBHA 3GCWA 4NJEA 1O97C 3NB0A 1FS4A 1CFZA 3KEMA 3GUYA 1GLVA 5CFOA 2JFWA 3D9QX 3WS7A 2NSYA 1VLMA 1A8PA 4OKSA 4O4JF 5IBQA 2WV7A 5TQVA 2GFIA 1H66A 1IZZA 1MHPA 1EGAA 1Q0LA 3BTUA 3GZNA 2EP8A 4QPCA 1ND6A 1B3RA 1DBVO 2CZQA 4PG6A 4Y2GA 3TGWA 3UWKA 5IDQA 3WK9A 4UU1A 4PNZA 1C0IA 5DP2A 2HHHB 4WESA 2WIJA 1B6RA 4GQBA 4MUIA 3RYFB 1H2EA 1PNRA 4EA8A 3PTLA 2JL1A 2J5XA 3KKNA 4O1IA 3M3DA 3EVDA 3VM6A 3IJ5A 4HZGA 4MUAA 4C89A 2PPVA 2XTAA 1D2NA 2ZU6A 2Q0XA 3ETDA 2JA1A 3NRBA 4K9SA 5HQ3A 2VPZA 1EBBA 3RTDA 2QD2A 2FN8A 2PGOA 3CH6A 3TL6A 4G9GA 3CX3A 3JWPA 5EVCA 1GFSA 1QK4A 4X8MA 3UWMA 3HN7A 3TTWA 2NU9A 2XMBA 2BGMA 3MINB 4UDOA 2ZIXA 3QMVA 1T8UA 3BVPA 1WWKA 1KAHA 1VL6A 4NU6A 4WACA 4CWAA 5H4GA 2W4IA 3N2GA 3D4OA 4KO3S 4OGKA 3T9BA 4UMDA 1KR2A 1OFGA 2ZBQA 3BGVA 5COBA 1VZ3A 5BQOA 4F5YA 1Z5PA 2YWRA 5JSYA 4C4RA 5HRAA 1IQRA 1NSFA 3O84A 4J1NA 1ANKA 5ALLA 4YUAA 2VPQA 4Z3DA 5FWNA 1GDTA 1XLUA 2YZKA 1D0IA 1B0PA 2BD0A 4GPIB 1NYRA 3HRKA 3U9LA 1EWTA 3NTRA 5GMOA 4OLBA 1TEXA 1W47A 5I8ZA 4B34A 4YMUA 3I2JA 1YDFA 1Q74A 4OP2A 4FHDA 1I6MA 3OZGA 1U6IA 4YDQA 5D5QA 2D62A 3GO4A 3HN6A 1U94A 1QE3A 4JFAA 4BFVA 3HR8A 1EMDA 2OO7A 5GAJA 1KYVA 1QHYA 1GPLA 3N6VA 4B4VA 3G0OA 3VOBA 4CLEA 2C8LA 2VYND 4LZJA 3UJCA 3T35A 1REQA 2XT9A 1TM1E 4PC6A 5BT9A 4RF4A 5K0FA 3ZGZA 1R0CA 2COKA 4HVCA 4ND3A 2PVCA 2OAQ1 4NR0A 4OHPA 4W7HA 1IWBB 1R4ZA 4KGXA 3RSLA 4B47A 5LQKA 4OI0A 2PNJA 1U9CA 4EF4A 3AHEA 1DTSA 3WX0A 3T0IA 1Z28A 3FRJA 4AZ0A 3HJGA 3I4LA 4ZVMA 1NJGA 1DE0A 1NRWA 1RFLA 1VKNA 2FPSA 2GYWA 2FUNB 2R48A 1ENOA 1JIXA 3A4MA 3A6GA 4PFSA 2WE8A 3TCNA 1OR8A 2WNHA 4AWAA 2R7NA 4DY4A 3GNSA 3IOEA 1M6HA 2C0PA 2VXBA 3DOJA 3OZCA 3TQSA 1C3OA 2CVQA 1AMNA 2RGWA 4LRSB 1NV8A 3LWNA 4YO8A 3BFPA 3V8BA 1A9ZA 2B2XA 4OLFA 1WP9A 1O54A 5IX8A 5K7SA 1A9TA 4MGKR 1WCXA 4DAEA 3LM8A 3T9CA 3T5CA 4F71A 4GBMA 1FNDA 2H17A 3VPGA 1CD5A 2D5BA 5CDUA 1SNYA 2HU8A 4P4SB 5DM70 2XYVA 4KWTA 1JG4A 5HIKA 1HFJA 4KRXA 3KKLA 5MGNA 1Z35A 2VDWB 1ISMA 3U16A 5B1DA 3DDNA 4MLDA 4GPBA 1Q6YA 2FFJA 4Z9AA 3VU9B 5JADA 4RK5A 2ZUEA 3FZQA 3IQWA 5GQSA 1MT3A 2FGKA 1T5HX 2ORYA 3VDRA 1P17A 2I2WA 1LC3A 1RXEA 2O2CA 4OP1A 4AXXA 3RRYA 2YYZA 2RGGA 2O3RA 4AUEA 2GXAA 1MB0A 3MSCA 4FKZA 1GRCA 2VHEA 3F4BA 3NBAA 2BRUC 3IUPA 1TYEB 4ISBA 1XJ0A 3QK7A 1J22A 3W6UA 3WK6A 4QRDA 3PNQA 4KK4A 5ALWA 2PKXA 2B82A 3Q6IA 3WGNA 1TM2A 4OXNA 4L8GA 1WOMA 4R1TA 3V1MA 5EHQA 4D0RA 3M6MD 3RT1A 3FPEA 4R9VA 3MTIA 3AEQB 3ZLVA 4OO3A 5E9QA 4C7JA 1WXQA 4ZT3A 3NJRA 3RC8A 3MCWA 5H02A 1NW3A 5JUWA 4M1OA 1XMSA 4OVKA 2BR4A 2ENUA 3T7RA 1HURA 1G3RA 2E4UA 3R40A 3UEOA 2OC4A 4XWYA 4UVIA 3RFUA 1PVVA 4AIRA 1Y3BE 2XLBA 1ISJA 2FQWA 5EIWA 4PLZA 3WGQA 5BVGB 2H63A 3EXHA 3L4JA 2YWBA 1MEJA 2BZ0A 4KH1A 2WK1A 1R00A 1MB2A 2CMKA 3LG2A 2QR3A 3HCCA 3RVJA 4GZLA 1LSJA 1NF8A 3OM8A 1JU3A 5AH0A 5DBGA 1RI2A 1M6EX 2DG2A 2ZM5A 3F8TA 5AFSA 1GWNA 2VDVE 5BOSA 4LC0A 1T2AA 5T41A 5SICE 3GT4A 1V25A 2JB9A 3GLUA 4YIKA 4GWKA 4WK6A 2P1RA 1M1NB 1U8UA 2JEOA 4QOFA 5HGJA 4CQNA 1GA1A 1HY3A 1I1NA 4FNMA 4NU5A 2Z6VA 5LJIA 3TNJA 1ILWA 3HKBA 4JNCA 2GJ9A 5BYJA 5KPDA 4BB5A 2BGNA 3I52A 3MAGA 3R3JA 5F1PA 5CFZA 2K5UA 5G3ZA 4BO2A 4FSHA 1S1MA 3NT5A 4K7JA 5CRIA 4KE7A 3FGNA 5I8PA 4B3RB 2A3NA 1ORRA 1MC1A 2J3MA 5CT9A 4P4TA 4UOZA 2BTEA 4WE3A 5E1DA 4J6EA 3M1AA 2DEUA 2A9RA 4A91A 4B4DA 1FVFA 4BNNA 4MRMB 1LFDB 1E1RA 3OQVA 3BDAA 1FX0A 4BKMA 2IDZA 4XLZA 1XDZA 4BX9A 5JNUA 5IF3A 4UQOA 4OI4A 1T1IA 4IZ6A 3EVEA 1M0TA 1JIVA 1AQJA 1RJWA 1HH4A 1YZNA 4BGEA 3EIOA 1JQ3A 2OGWA 2H8KA 4TTAA 1U0TA 4FQ5A 4MVXA 1JQ5A 5K3AA 1N1EA 3AY6A 3G7SA 3OBBA 3VHXA 3WGUA 4WLFA 2QRVB 1AS0A 1SUAA 2M6SA 3GCDA 3NOVA 4O29A 2ZG6A 4J0HA 1PFVA 1K5HA 3G2PA 5EGNA 4E5NA 5JD4A 1FYXA 1DUSA 1TCVA 1U9YA 3BXPA 1G41A 2WMDA 3OC0A 4HATA 4KFRA 2Z4SA 4PWZA 3IIEA 4S1NA 2IZ0A 1NXTA 5LYYA 1SBCA 1EX9A 4GM0A 1DXHA 3A3PA 1YVRA 3VYWA 4D4HA 4DA8A 1MAUA 2JEYA 4MQ6A 1CERA 4R81A 3ZLTA 3ZUPA 2I4IA 3GPCA 3VZBA 1D2GA 1SC9A 2HMUA 4LPKA 4PGFA 1Z0AA 3GRRA 2EDAA 2OBFA 2VHYA 1VHJA 1GTMA 4BFUA 3T7CA 4F4DA 5HQTA 3AVWA 2J4CA 1SCQA 2I6GA 5B1IA 4HUQB 4JKYA 1DU4A 4F6RB 2WNIA 4IXWA 5HBGA 1FUUA 1THTA 4DHEA 3B7WA 1IK6A 4AYXA 2RHHA 1SCIA 4F56A 2AYXA 2GNPA 2L69A 3DZFA 3E1SA 4RJIA 4ZVOA 3RAGA 3V9AA 3KYCA 4PPNA 3GJ6A 3ZJTA 1R6XA 2G9RA 2YJNA 4EMSA 4DDMA 4Y9RA 4BATA 2H5JA 3FMGA 4JOQA 1O0CA 4K9LA 3G0HA 3MILA 2JLRA 1C9MA 3F67A 1FA9A 5D1HA 4LECA 2H52A 3A1EA 2BHLA 1KI9A 3EXEA 3TZQA 4IIJA 4GZ5A 1P75A 3SJCA 4DLSA 3A4LA 4LV8B 1IONA 2ZS8A 4D0GA 1W5EA 1VIDA 1A71A 1T4CB 1Z0DA 3BGWA 3IR7A 4LTDA 2NO1A 2JZCA 2H2DA 4FDUA 3B2QA 4JT9A 2HZBA 1C0EA 2I7XA 4PQEA 3L8FA 4YFVA 5LZ7A 1U3FA 3UTCA 4F93B 1XJWA 2XB9A 3OTGA 2C1XA 5L6LB 1SBHA 1SVUA 4PR3A 5H9VA 2AZXA 4QFCA 2E3JA 4P7KA 1ZK4A 4L8LA 3N7TA 3L18A 4ILEA 2GPBA 1BHO1 4IDQA 4COOA 4YLYA 4FYYA 3U0VA 2GM4A 1SXJC 3WHKA 2QPTA 3AFHA 3BAZA 4AZWA 4MA0A 1Z3CA 4U9HS 1Z45A 2R44A 4GKVA 4LY9A 4TUYB 5DLQC 3EVTA 5KYWB 2C61A 4N5LA 3CZMA 4KXNA 3JALB 3KSBC 4ZEMA 1FTYA 3EGWA 2OGZA 1WB5A 1Z33A 2R5FA 3DHNA 1RBMA 5FNVB 5DYWA 1UKZA 1OFUX 1UFOA 2FWMX 2LP4Y 2NU7A 4J7XA 2ZBPA 2RGAA 4QC2A 4TUYF 4TN1A 2EZUA 3PWSA 4Y18A 3STWA 2PA3A 3I6MA 3OZWA 1T0HB 3MLBA 4X7RA 5HKKD 1N2GA 3I04M 1YZFA 4XEUA 1E9VA 2C2YA 1RXIA 1W49A 3B2NA 2J9ZB 3HBAA 3DNPA 3I8OA 1N92A 4JVSB 2P90A 4LDNA 3VBCA 4CR7A 4F8JA 1IY1A 4YPOA 2P69A 3RGWS 5LWHA 2GB4A 4ML3A 2ZT8A 2IKQA 1M3SA 3KUCA 4G36A 1X1AA 1EFAA 4L28A 3UHPA 4TXNA 2RHDA 5B53A 1N5DA 5K5EA 4YAEA 3EOAI 1ZOOA 4KACA 4FSDA 4XKJA 1TYAE 2PA0A 4MUEA 4UAUA 2VBCA 4N3AA 1YGYA 1Y9DA 1ZM9A 4I99A 3ZWCA 3AILA 4KZKA 2XOEA 4G65A 3NXKA 3UYKA 4DA6A 4TTJA 4GSLA 5BQ3A 4DCGA 3RWOA 3MB5A 2V9PA 4UUNA 2HU5A 5B1YA 5ALVA 4ZAYA 3SCZA 3EARA 1KEZA 2QLTA 4E5KA 4JI4B 1J0XO 1T4GA 4X41A 2ZROA 1U4SA 2W11A 3QKRA 3E9DA 4PAOA 2X42A 4Q01A 4TM7A 1JX6A 3LV8A 1IULA 1II8B 2OWDA 3ABSB 4HNRA 4YCBA 2H4ZA 1MXHA 1WF6A 3R1IA 1DFHA 1AJEA 3LY9A 4MIEA 3LOQA 3GFFA 3WIDA 2XUDA 1CVLA 1Z06A 5HBRA 3U7IA 1U4NA 5EQJB 2NUPB 5CEEA 3KYCB 2C9MA 3GRYA 4PPQA 1OBCA 3U13A 4CG2A 4IGIA 4DWVA 2ZRBA 1FQKA 3X2EA 1N9KA 1YUMA 4R2MA 3DAOA 3RBAA 8OHMA 3RASA 2HADA 1J0EA 4RMHA 5FJIA 1LPAB 1ZICA 2J9XB 2E21A 2PL3A 1NBMA 3KXLA 1YOVA 4TV9B 2XNSA 4P7BA 4DTIA 5JYDA 2WU4A 1TZCA 1GTZA 1TVKB 4QXMA 4DR1B 3H5VA 4GOOD 4B85A 4AZ3B 1IZ9A 2XCUA 3R0IA 3PGA1 3NTOA 2WTAA 4G41A 1GQ2A 1C1XA 1UXOA 1Y89A 4N18A 2B1IA 1S9HA 4UE6A 3ZEIA 5KTRA 3WXBA 2ATEA 2QMQA 1Z8FA 2JFXA 4ZIRB 3LDGA 4TXJA 5AXCA 4XIYA 1Q11A 1H9CA 2O3SA 4WY2A 1VPLA 2WF9A 3KHSA 4LJ6A 1TT5A 2F8SA 2QM0A 1KFCB 3QLEA 1EFRD 1HYEA 4NENA 1R9MA 2QRVA 3C3DA 2PGLA 1EP1B 3DDZX 3U6KA 2Q1SA 3VPAA 5FBVB 4YV2A 4Y2JA 1M7GA 4M49A 4U7PB 2JG3A 4B9AA 2J67A 4G4JA 3ZZNA 2C5GA 2E4XA 4NOLA 5JWHA 1BMDA 5A6SA 1A69A 1RRGA 3BMXA 3CLTD 3SYRA 1O97D 1T5IA 4K8OA 1DAIA 2DHEA 5HIMA 2GS9A 1S4MA 4X8OA 2OORA 4A92A 1ZH4A 5AP9A 3ZNNA 3V34A 4CNBA 1C8LA 1T25A 4MNTA 3TQCA 1V16A 4WASA 1RWXA 4MUXA 4FNOA 2HHAA 1EX7A 1II0A 2W9XA 3D3WA 3NGMA 2D0OB 3KJEA 4HQLA 2NACA 1GG5A 4CM4A 1KE2A 5LJLA 1Z4LA 2C98A 5T3UA 1BYIA 5CX1A 4EB6A 2IXGA 5A9TA 2PVPA 5E38A 5FD8A 1TZMA 3PJFA 1I0LA 1UEIA 3G13A 5BOSB 3T1TA 1KSHA 3MHTA 4ZGWA 4QWMA 1ZLYA 1E2IA 4YGYA 3TGLA 4ESOA 5AJZA 4V0QA 2MCFA 3MRTA 3PENA 5M3BA 3VR4H 3AJRA 3I61A 4Z9BA 4MV5A 3QOXA 1CK4A 4N7RA 2Z04A 4F6CA 4AMUA 4C3ZA 2QUIA 5F9MA 4TT3D 1G8MA 2O8DB 1E9EA 1GGMA 2AE1A 1ZI9A 4KH0A 4U7TB 4DZRA 2WOOA 3L9WA 1O0BA 1YZTA 1DKOA 4JJ8A 3T7IA 3VXKA 3WSVA 2GHQA 3N5KA 3E9NA 3AR6A 4EJ0A 1XEAA 1KBOA 3Q3HA 5BSMA 2PT5A 3O3CA 4O1HA 3GDFA 5K1ZA 3L92A 4C08A 4E6EA 5L9AA 4RAOA 3FBWA 1A1SA 3IDQA 4JJKA 4L76A 2X5KO 2FP4A 4GGPA 5BSUA 6ADHA 1CDDA 1YT5A 5C1OA 1N2CE 1K92A 5CH3A 4BOYA 3H4MA 3TLMA 3I58A 2P2NA 1CJKC 1DFGA 3C3CA 4BO3A 4XWKA 4L3WA 2FCAA 2A9FA 1R5NA 3R0XA 1I7QB 5FULA 2ZYWX 1JFSA 1COZA 3PHGA 4H4EA 3VKVA 1UBMS 2VSNA 5GVRA 2G9NA 4CV2A 2NAFA 2OP0A 2HEGA 4EYSA 1SPXA 4Y6LA 3AZPA 3LIPA 5LOVB 2WM8A 4P98A 5C4GB 4XJTA 2PX8A 4YCMA 2WHRA 4TLEA 3U60B 3PDJA 2QNBA 1XCBA 2B8EA 2W0SA 3WIUA 1HOTA 4FM9A 4PLGA 2G7ZA 3C24A 3VU9A 5G4KB 1OC2A 1QYDA 2GM9A 3RHSA 3A36A 3DZCA 2FF7A 3A1VA 5D3MB 1DG3A 3G0GA 1BKDR 2X8AA 3YASA 4D79A 1UIMA 4RVGA 1UMKA 3MA0A 4UHDA 4N8EA 5DLDA 4P4SA 3TLEA 1K6JA 2ZQYA 1GZHB 4N8SA 3GRFA 2HJGA 3AIOA 3M2TA 3C1AA 1SQ6A 4PNEA 2AMLA 4EFLA 2O8DA 3O31A 4CMGA 3R8FA 4OD0A 3V4SA 2YRXA 2PUDA 2B35A 4M8KA 2FLKA 2O2YA 5ENZA 1HT2E 1T4MA 2M1ZA 4RQUA 3CM0A 4AMGA 4E30A 4U7DA 3ULKA 3PC4A 1EVLA 4BV8A 1NSTA 3RSQA 5AKIA 4BQQA 3BN3A 2ILTA 2DE0X 2HQOA 3KU4A 2M6KA 4NX2A 1OV6A 1JYSA 3A9RA 3IUNA 1DV1A 1XZJA 1H6BA 1R6VA 1ORIA 1W0CA 3BZBA 1SVLA 3KSRA 3NP7A 1ZG3A 3OQPA 4BFZA 1VJCA 2OWEA 1VE9A 2I1QA 4QU9A 4CM6A 4DMKA 5JXHA 1MAHA 4M1WA 2QLMA 1XDDA 3DC2A 3GT3A 3M4ZA 1E2BA 4BNWA 5K45A 1X1QA 4KB5A 3OPVA 4NBNA 2KLBA 3D3WB 3H8VA 4DV7B 2B30A 2MSWA 4MGYR 3UANA 4ZTUB 4LQDA 4FMCB 1QAMA 4M3NA 3FPCA 4F2PA 2F3UA 1OZHA 3DHWC 1XA0A 4YNBA 2D5AA 3LO5A 2Q5FA 4ZJYA 2Z43A 3WISA 4WK2B 1HUQA 4CM1A 3KT3A 4DA0A 1NBEA 3P0EA 3KQQA 1K98A 3AERA 3MWKA 4QE3A 3DLTA 1NJ6A 1OBOA 4QELA 3PWTA 2NO4A 2XUAA 2ZR8A 2XIJA 2IZ6A 4RA9B 1LVGA 1NUPA 1NFRA 3BIWA 1EQAA 1CNMA 3VR6A 5BR8B 2V4UA 5BNIA 2E5FA 2IA5A 4RWEA 3ZNOA 3I04A 3K73O 1QO0A 2AFVA 4NHOA 1A72A 4E5PA 1XTJA 1HDOA 2OV8A 1TT5B 4LYDA 2Q0HA 1JPNA 2GEDA 3B38A 1C30A 4WLVA 3VBEA 2AOXA 1KR5A 5F4ZA 4XZ3A 3EPRA 3HVKA 2NN3C 4Z1MD 3DSRA 4LNAA 2E55A 1SELA 2X15A 5DCUA 2O7NA 5BV1A 3SBXA 2CMFA 4L4XA 3UFXA 2NQ8A 1G9XA 2UZ0A 5D5PA 2J8ZA 4PZPA 2CVHA 3S68A 2HCBA 1M74A 3K09C 4O4HA 3ROKA 3UGQA 1NV9A 5GVSA 3MUEA 2WB4A 1IDOA 4R16A 4R1QA 3Q40A 3OZTA 3MT8A 3R5XA 3OCVA 1BOFA 3N59A 4Y9UA 1I3NA 1MABB 3V1YA 3LTNC 3SLRA 1XJ5A 3FVTA 4J0QA 4GUAA 1B26A 5DBEX 1YUBA 1SUWA 3WZMA 4KR6A 3A6DA 4U7GA 5ED4A 3KUXA 3U4QA 3TKAA 4W5HA 4RELA 1RZVA 4DEVA 4OJNA 1XEXB 3ICEA 1F48A 1C9DB 2CNNA 3QMPA 4EW3A 3H87A 3V1TC 2GD1O 2YBDA 1VJGA 5T4FA 4CMHA 4LHEA 1USIA 1H0HA 1E5QA 1O9BA 1RRFA 2JLAA 1G1MA 1VI5A 2ACEA 2YJ6A 1K7EB 1RRPA 4MH0R 2LDXA 3D64A 3RRNA 2I4TA 3GMIA 5FTLA 3KT0A 1J06A 2YMQA 4FHGA 5FTKA 4ZYXA 1Z88A 5K4HA 2VWPA 3FRHA 2OT3B 2WM9B 2XTNA 1V3VA 3PKZA 5FJJA 3HB1A 5PNTA 1JKIA 4RE5A 1THMA 1TCAA 2P1ZA 2Q1XA 3E48A 5DW0A 2A78A 1MG5A 1MAWA 5IKOA 4DLLA 5SY4A 5KTYA 1L8LA 1SKUA 3M4JA 3VQTA 1OFHA 1AZLA 4MUGA 3CVWA 4O4LA 4UDNA 1J24A 4HI0E 5AVJA 3P2JA 1O96B 4OIMA 4I55B 2IH2A 3LBNA 2NM0A 1IXZA 2ZI4A 5E4FA 5TMBA 3I5YA 2QBYB 3ZHXA 5KYGA 4DILA 3M8KA 4E5YA 3QXJA 2AN5A 1U04A 3FUUA 5IW8A 3V80A 2Q21A 5I4IA 1S3IA 1UQRA 4RW0A 1QV7A 1GT91 2H7VA 2IY8A 3GZJA 1RWVA 3I32A 4FWBA 1QH9A 2AXNA 2RGEA 3CJQA 3GNQA 4HDCA 1KK0A 1E6WA 4NYMQ 4ESEA 1KPIA 5A7FA 1DI0A 4WK0B 2EHDA 3WC4A 1G16A 1CDEA 3BUSA 4EO9A 2F9FA 3QEBZ 2VPXA 3JAWB 3QTBA 5HR5A 3C7KA 3EXFB 4QXPA 4MEAA 2Q8PA 2FPRA 3V7WA 1WUHS 4V0LA 5HTOA 1IUPA 3BHMA 3SZOA 1UT5A 4Q3AA 2F1HA 5ARDA 3MS7A 4EL0A 3RUCA 1ZHOA 3RNOA 1DQRA 1T6BY 2RE8A 2J5QA 1X7GA 4TUYA 1ZKDA 5FTJA 1Z4MA 3UAXA 4XTCS 3MFYA 1M6YA 3PX7A 3CVVA 2OY0A 4ID9A 5MHTA 1EHCA 1M2WA 4QBFA 5KJ6A 1RDFA 1DIAA 3C8UA 4LOJA 4AJ9A 2D2VA 5EIAA 5J4VA 4JKIA 4AT1A 1VHTA 1PQUA 1YTUA 1ESDA 1B23P 1A77A 4KAJA 4NE2A 3OPYB 3DULA 3AESA 3PLRA 2WIAA 3T3IA 2RHRA 3MCZA 3JYOA 4G25A 4AW9A 4LI3X 5K99A 1JF8A 1PJ4A 1JMYA 4GHWA 3BMOB 1DC6A 2HFKA 2VSOA 3QOFA 4KMMA 1TJYA 2K2QB 1N5KA 1U0EA 3H65A 4K87A 4LE2A 4QUBA 1RJ9A 1WZNA 1KH3A 1C80A 1R10A 1EVZA 1NJSA 2IPOA 2VYVD 4KR2A 2WIDA 4MKRA 5AVSA 2ZE5A 3FIJA 2HF7A 4BO7A 5IC4A 5KNDD 4A0RA 5EI5A 2I03A 1P6UA 1P4SA 2PMKA 2F8MA 1Z18A 2AFHB 1J00A 1VKJA 1KKUA 3W0LB 1WDWB 1G8JA 3CNHA 3E7XA 4LYFA 1YDEA 3LUCA 3LFTA 4LBYA 5CT4A 3TXYA 5ADHA 3U7HB 3RRJA 4PLYA 1XFAA 3W7AA 3VOAA 1UMDB 4X91A 2VH1A 3KIPA 3LDAA 5IRCD 3LH5A 3A3YA 4BO8A 5EERA 1ZP6A 2GPAA 1CXZA 3ZS8A 4HGRA 2C2MA 3WGIA 3ET5A 3JQRA 1AIPA 2EFEB 2G6BA 2G5CA 2WWWA 4GUDA 3G1TA 1RPNA 4GP9A 1IRXA 4OHVA 3MWLA 3EG5A 3TR0A 4B2PA 3PI6A 4PAWA 1P3DA 4CQJA 1P80A 2R6ZA 4L5AA 1P7VA 1XHFA 3ECCA 3STHA 4AECA 4QLBA 4FMPA 3FZEA 1JN0A 3I9MA 5E0OA 4UTOA 2PXXA 3PDUA 5IP5A 2REQA 5F12A 1FDTA 1KEEA 2VZ8A 3UHOA 1SKYE 2D3TA 4KLCA 1JSXA 1KVSA 3NAQA 4KUEA 1P5ZB 2G7MC 2H1HA 1AN0A 2VK8A 2W2NA 1C9EA 4FCVA 1FW6A 1TVEA 3TOXA 4KVGA 4HC4A 4WKGA 3HCNA 5IJ0B 3ZD6A 1UUFA 4U2EA 4AS1A 5B4TA 1GPWB 4W5RA 2C4KA 3UF0A 4FGZA 1QOZA 2RGYA 4I14A 3EA5A 1Z5WA 3ZV7A 1V4BA 3R4VA 1YZYA 2KS6A 3DXFA 2WQZA 2F64A 3HI4A 4UBKA 3NYIA 2CJPA 4BQNA 1T0JB 2FF5A 1JR6A 2J33A 5KBYA 3FJOA 1G4HA 3SYLA 4N6OA 1GITA 4HDRB 2G4CA 4M9UA 1E7WA 2WF5A 1ORDA 1YQXA 2JF0A 5JS2A 1J1ZA 3TRDA 4QGHA 3L7BA 4JLWA 4XQCA 1FVXA 3K9BA 4KXUA 3SR4A 4HT3B 1QZZA 2QNIA 5F7XA 4IR7A 4P0PB 1NULA 3TIIA 5DHAA 1M1YE 5COQA 1WQ3A 3KSMA 1Y1SA 2I3GA 4IDHA 3WRYC 4BQPA 4CL0A 2Z5LA 3SD7A 2L19A 4WSOA 5A5VA 1A1VA 2VHVA 4E1VA 2UKDA 1FZQA 2EU8A 1WDLA 1WZIA 1JSCA 1V71A 1X74A 3HNOA 1WDKA 2FI1A 2I7VA 4KQEA 2I22A 4L8WB 4IG4A 3NNDA 3AETB 4JWTA 4OSEA 3REFA 4KQ2A 2EXXA 3BWVA 2BHTA 3GI1A 2PSFA 2TMKA 2WJGA 1JDSA 3BF7A 4X1YB 5FBLB 5BUZA 2VJMA 2DPLA 1SIBE 2VF7A 1V0JA 1W29A 1W96A 2PAAA 4WOJA 1AKTA 3CONA 1HDRA 3LQ1A 3NKLA 5IU6A 1TLLA 1WUKS 2HMTA 3W8DA 1L8QA 4NSNA 1PZHA 3WRWA 4OHWA 1BE1A 1K88A 2F4NA 1WHTA 3R7NA 1AUOA 2QRLA 4P53A 1OUMA 2TSYB 3OFJA 1OOEA 5DNAA 3D0RA 2WAOA 4QHYA 4WRRA 3KBBA 2BR3A 1SMKA 1L9XA 3H8JA 4WNYA 1FNMA 4DIFA 3ZV3A 3ESXA 1Y3IA 3ZDRA 5MDHA 1BX0A 3I05A 1R0YA 3BH7A 1RBQA 3E5NA 1A95A 4ACBA 5LZ5A 2PX2A 3OOHA 4KI7A 5ULLA 3ZD9A 1G64A 3MJFA 2BUAA 5GZ1A 1ZR2A 1X6VA 5CYFA 4COKA 4ENQA 4AP9A 1V1MB 3A2MA 4TX1A 5BQFA 2CZGA 2FW1A 2PX5A 4UHFA 2IF0A 3D2LA 1N3BA 4L8FA 4XR4A 2MYNA 2LBPA 3FWYA 3C6XA 4G0YA 2QTVB 3KOXA 5FADA 3VPSA 1VHWA 4X65B 5LQSA 3L8DA 3RE1A 4D5GA 3CC8A 4AKGA 1GL6A 2PGNA 1BS1A 2XQFA 1MVLA 4TZ0A 3B70A 1TC1A 2ANBA 5D5HA 3WL4A 5JW6A 1RJGA 1WZCA 2N46A 3A8TA 2P78A 3KQUA 1XYGA 1SJ9A 3GUUA 4O63O 4QGSA 1L4FA 4ZYZA 5A06A 5FDFA 2QMEA 6GPBA 4NKRA 5LMNB 3MTQA 1BWRA 2AMFA 4FKMA 3D1VA 2WY2D 4PTYA 1CWUA 3AXSA 3EPPA 3LRXA 5F98A 2YVLA 1OIWA 2ZUBA 2WT9A 3B1KA 3HYNA 3K35A 3MCTA 3JQ8A 2CL0X 4BEWA 2Z8YA 4QTTB 5IJ9B 4C76A 2NUBA 4LGVA 1RYEA 3HUUA 2DOKA 5AW7A 1Q21A 2RSLA 3OCZA 1PIWA 3ACCA 1GHTA 1NFQA 3ZE7A 4QDTA 1FOEB 4YRQA 1CEQA 1V7ZA 1DIGA 4IH9A 1LSSA 1HTBA 1QX4A 3EGXA 3KQPA 3QH4A 3IVAA 1RWMA 1G291 2R96A 4AWBA 1Y98A 4IICA 1C7IA 1YZLA 2I2CA 4G5QA 1HTTA 4RHYA 1M83A 4HADA 2VH2A 3KZ1E 4UUQA 1CUJA 1P3Y1 4KO8A 1CJVC 1DIRA 2J6IA 1E4EB 3PD7A 3WAGA 4HH1A 3UA3A 4LJ9A 4P1ZA 4YRKA 1S2MA 3PP8A 1Q0UA 3QPVA 5ED0A 4NPHA 5JAUA 4RCYA 4MR7A 1IIBA 5HF5A 3C7TA 2XODA 5EZ5A 2V8BA 1BOOA 3KOYA 1QDEA 1EVQA 4RTOA 3LLCA 1C8BA 2VDNB 4OAPA 2YFYA 3BMNA 3WL8A 5JH7B 1MIOB 4LWQA 2O5CA 3AG6A 5IDWA 5KB3A 4DCSA 2R1TA 2W00A 2WSYB 4M0DA 4M0FA 4OV6B 3TM4A 1FLAA 4DABA 1QFMA 2FTKE 3LO8A 4OHFA 1IQPA 3TRKA 3RS7A 4Y98A 3DXZA 1T2CA 3NH9A 4EG0A 3AVPA 1BFKA 3GLRA 4GR9A 4XH9B 3LX4A 1UKEA 1EDZA 1EUDB 3L0IB 3OF3A 4MLCA 4UVGA 3STTA 3SZUA 2EQ5A 2O1SA 3IQEA 1P4AA 3O4IA 4YK7A 3B1YA 1WD5A 1WU7A 2YJGA 1CHNA 1T3HA 2IF2A 3AUTA 3FKQA 2QN7A 3A2KA 2NO6A 3IP1A 4E2ZA 3JRWA 1XAIA 3I53A 5IJXA 4C01A 1OFUA 2GN2A 4PU0A 4KQKA 5TJ9A 5ERYA 5H8WA 1QCCA 4LG1A 4JJ6A 1HR0B 1U63A 1QP8A 2F1OA 5CHEA 3IRVA 3ZHBA 5HF6A 5C7IO 1EXNA 2YYAA 1TMYA 3NYQA 4H4CA 3RFCA 4AICA 4QUEA 1E92A 2NTEA 3SK0A 5AM4A 5AK6A 3FAZA 2FR0A 1E1CA 2QUKA 1XD9A 4DQVA 3THOA 3D31A 5F76A 3G1WA 4OH7A 1QXSA 2AHOA 2W0MA 5T6BA 4LWOA 4AJKA 3ZIAA 1D2EA 3RB8A 5LL6P 3SHFA 3UFBA 1NBOA 3P27A 5HOQA 2FQYA 3LCRA 3CCBA 3JALA 2OCGA 4YVFA 3TMKA 4F9TA 1PVOA 1CE8A 2Q6KA 1NI5A 4PAGA 4MJ7A 5KYWA 3BJZA 2DWUA 1ESNA 3ZE1B 3S27A 4DSTA 2K6GA 2WUDA 3SMVA 4AN4A 1L8XA 3AVQA 1T1SA 1NOIA 2BHRA 4DG9A 4XQEA 1VG8A 3EQ8A 2WSSA 5T8KA 5B3LA 3VMFA 3EEIA 3D6HA 1ZJZA 3OIGA 1XZQA 3L6BA 4JOCA 4OK6A 4PV7A 5JLAA 3W1WA 5LLTA 1Q7CA 3NHFA 4Q4HB 1QHSA 1G3MA 1YRBA 2OQIA 4O4JA 2IQIA 5IH3A 1P19A 1CPYA 3B9RA 4QOSA 4QULA 5EMLA 1WU8A 3JSXA 2Q99A 4L2IA 3UJ6A 4YRFA 5LA6B 2GBGA 1EESA 2DAPA 3IJEB 1N2OA 2JIRA 1EJBA 3ONNA 2AT1A 3GLGB 5JBIA 1Q95A 3DB2A 3M6LA 4A23A 1KOGA 5JS1A 2ZCJA 1ZA2A 2ERCA 2ZRDA 3THWB 3WMRA 1W36B 3RWMB 1NDUA 5CMLA 1TZKA 3EE6A 3MC1A 4M7RA 1FLDA 4HK4A 4MPRA 3BA6A 2K7FA 5KKNB 4B7UA 4M1MA 3WKCA 5FOWA 4IX9A 3OA0A 4JY7A 1NQWA 2PV7A 3IP7A 4UE3S 4Y2SA 2W8ZA 3E6AA 2XWJI 4BMXA 1GRVA 1PJQA 2J85A 2ZYVX 2VDQB 4J75A 4EY5A 3EPKA 1QRTA 4N3CA 3Q8WA 3OM0A 3LC0A 1M6VB 4KGVA 2DSNA 4M98A 4FZ5A 5ICFA 2X0NA 3UBTA 2NTNA 3EOZA 4B73A 2HN9A 3OSUA 4BC1A 1GCAA 4Q6WA 1TTHA 5BN4A 2OZEA 2R8BA 1M5UA 2B3DA 1KZGB 1Y6JA 1YAHA 3QEMA 2GARA 4OMFG 4UQLA 4FXPA 3OJLA 4MW4A 4DLWA 3EFBA 3HWX1 2WTEA 1M33A 2FMHA 3KQMA 1L6RA 4LDZA 4WCDA 2PDAA 4D96A 4HPWA 5MN5A 2IIBA 2VBGA 4XEHA 4A7PA 4CQMD 3MK31 2I80A 2CDRA 3TUZC 4EELA 1POWA 2R6CA 3QY0A 3O90A 3EHEA 2HPAA 3DVAA 3ZWQA 1XZIA 3KXDA 1JHQA 3FTPA 4JGGA 4Z7NB 3AF5A 1ISSA 1Y8QA 2XCLA 3D7KA 3G0BA 1G7TA 1PK7A 4EKGA 3LBHA 3D4BA 1ZJ6A 2YJTD 4FZRA 4BE7B 1IK4A 2X0JA 2X6TA 4A26A 2BFBB 2MMGA 2C7BA 3JR7A 1FTSA 3I2GA 4WN3A 3WLSA 4F92B 4HZUA 1J56A 3PUKA 4TLLB 5CT8A 2I1WA 1IAVA 3P19A 3ZD7A 4REQB 3K5IA 4HRVA 3SJBA 3P8ZA 1KRHA 1V8BA 4PBRA 1I10A 3BIFA 1IQ0A 1I3LA 3B8EA 4N9QA 5DYTA 1E2UA 1M34E 2H1FA 2W2PA 1OJLA 1DXQA 3LE8A 3ESCA 4B45A 1GNPA 3ZHSA 5IKEA 2OYRA 4ZHQA 5IC5A 3GEGA 1M1NA 2ATCA 3DO6A 4WLUA 4PONA 3MTJA 3FHCB 4DC9A 1MRNA 1O03A 1OHHA 3FKSA 4KU4A 4N0EA 5EUBA 1U2RA 1OI2A 2XYQA 4AX4A 2H9AA 4AAYA 5C3MA 1DCTA 1PF7E 3E03A 1JPJA 5JISA 3CN7A 4DCJA 5CDFA 1ST2A 2OHXA 2F62A 4OL9A 3VR3A 4LF7B 1E2HA 2XMRA 4FR0A 1U7PA 1SA0B 1E1YA 2Y4NA 1SVIA 3EIEA 4TLCA 3WWOA 4X54A 4FQ8A 2AFIB 1U3UA 2GESA 5CK5A 3LC7O 1Q0PA 4ZO8A 2QTWB 3E3MA 3JZIA 5KMGB 2PJZA 4B7CA 4BPRA 5KCMA 4DNOA 2GBPA 3K0AB 2SCUA 3OE7A 4UBOA 4K0RA 2ZIGA 4JL6A 3HYTA 3I9KA 3R7WB 4F04A 4NCNA 4TVKA 3OQNA 4TL9A 1BEEA 1EHIA 3BD7A 1D4AA 1A7JA 1FMLA 1LW6E 3ESQA 5HSGA 3TNFA 3BIJA 4ZWNA 3IOMA 3M7IA 3EUEA 4OQNA 4U7WA 5JC8A 4U39A 2IUSA 5BSVA 1DC7A 3MW8A 2FNAA 3L7JA 3QTLA 4C5CA 4ZVRA 3NHJA 1EJ6A 1QDLB 1PJLA 1Z2EA 2GUWA 2XJ9A 3H5NA 1TCCA 3LGSA 2NZXA 4X92A 3ZH2A 4GM4A 4ACAA 3B6ZA 4UATA 3IEKA 2FSUA 2RH5A 4MVJI 5C8DA 2O9JA 4HXGA 4CKXA 3ZVLA 4RSHA 9LDTA 4YJFB 1LVHA 4XIFA 1E6UA 5T57A 4BC0A 1X86B 3UK1A 5KWIA 3ONDA 1US8A 3CNEA 2HTFA 4UDXX 1EA5A 1EVKA 5MGBA 5GP1A 3KVNA 3TL2A 3DOUA 2OAEA 3K0KA 1QIFA 1E8DA 2BMJA 2VATA 1YRYE 2WJZB 2CWWA 4C30A 4E0BA 3HDGA 4RDXA 1NP6A 1LLFA 5FPKA 4GT1A 2JCBA 2VQEB 3L7IA 3ROTA 3SIRA 1K5PA 1YTLA 4QDXA 1ISPA 1JHZA 1HORA 4O2BF 2FZWA 4FFVA 3LZCA 3KXIA 1QFZA 1JZTA 2NSDA 4FFLA 2QZ9A 5K3BA 2E5WA 1HM5A 4FDVA 3TW0A 4HRYA 1SBNE 4EECA 5C32A 2OLKA 4E3ZA 4K5QA 1SXPA 3OETA 4YRBA 4D9NA 5FUBA 4X94A 2XDYA 1IHYA 4R1LA 2X6QA 3ZY6A 2WTUA 1C9JA 3DOOA 2HRRA 1V9SA 4UM5A 1TKAA 1ZNYA 3D4IA 4M55A 4OHBA 5T6MA 2DB3A 4CLRA 3R3ZA 2UVQA 3IE2A 4QJIA 4IQ8A 2G77B 2OECA 4DRXA 4LF9B 3MD9A 3G0DA 3T7SA 2AXEA 3FMOB 5TQ0B 2XYRA 1NIPA 2CFCA 1ZOPA 5AJTA 2HR1A 2D74A 4B7ZA 4PGMA 1Q83A 1DV2A 1AMOA 1EUYA 3D0QA 5D3ZA 2Y99A 1J33A 1KJYA 2NQTA 3CA8A 3DR3A 4TT8A 1BXRA 3U49A 3OHMA 4Y6PA 1N2ZA 3RRZA 2J3DA 4TKVA 5JFTA 3ZDEA 4ZU3A 2ETVA 5EG5A 3ZI7A 2I2AA 3M3HA 4PC3A 1G9SA 4RA6A 2YS7A 2WTXA 3IUMA 4H77A 5EHGA 3NBKA 1YJ5A 3QLJA 4LYJA 5LZ4A 4ZTZB 3L6EA 3SZMA 3ER8A 3UCXA 4P3YA 3ABRB 2KYRA 3HU1A 1PR4A 4Q7QA 1Q2UA 3JU3A 3NBMA 5DHUA 5L3RA 2XV1A 3NOOA 4CKZA 2NU8B 4MR8A 1E9AA 4E5UA 4LDRA 4MQLA 3EYAA 5I45A 1EWKA 2Q3DA 4U02A 1L4MA 3VR3D 4BUJA 2VH5R 5EIHA 2ZIXB 4TN5A 1VJ0A 4S04A 4PX2A 1XD2A 2DXIA 2PUBA 1JSLA 4TWIA 2O0HA 4TVSA 1D0VA 2RGUA 4LRXA 1QYCA 4GD3Q 1PSDA 1RC1A 4H16A 1KU6A 5EYPA 2O06A 1FFXB 3FPSA 4O6VA 1MOPA 2E37A 1ECBA 4R0VA 3LWZA 2V97A 3P9KA 3THYB 1Q3HA 4UHBA 4KNWA 1DAEA 1XKLA 4EHFA 3K2EA 4RD3A 1MX3A 3K9LA 4JYBA 4RYLA 4Z8XA 1J0CA 1UXHA 2WU1A 1VL2A 4IOKA 3CR8A 1GU7A 2ZB8A 2ESRA 2HFJA 3I12A 3NHUA 5G0WA 2QQFA 3NEYA 3GN1A 4DRXB 5BNWA 2JJ2A 2L17A 1O6ZA 2O7SA 2XUGA 2WUVA 5L45A 1MDFA 1GRNA 2NSHA 3I23A 5DISB 3AFMA 4E2FA 4WT7A 4BVJA 3U9TA 5M04A 1NVTA 1R1DA 2IY7A 1AO0A 1IHUA 3KB8A 4S12A 3KD2A 3Q10A 1E1RD 1CJSA 3AXTA 4E15A 1VA4A 1USUA 4QJBA 2R9VA 5ETJA 2UZ3A 4QOJA 5HKOA 2H8GA 4A2PA 4W5JA 2YKGA 1JAXA 3ORFA 1RHRA 3ZH9B 2VJAA 2EYUA 3ZQUA 3QF4A 2X9GA 4H7KA 4Q00A 3QW2A 3DFZA 4GLLA 3T1QA 3A4IA 3H0EA 2ISQA 2YV5A 3MB8A 3PVSA 2V6MA 1A96A 4IEIA 1MX9A 1XSEA 1BEUB 3V4LA 5IEJA 4JD5A 1XRQA 5I9TA 1O5TA 2CB0A 2J87A 1Z2CA 2Z2IA 3DLCA 1VA5A 3H42B 3E18A 5E6RB 4L16A 2O50A 2QYTA 3K20A 4V3CA 3A31A 1QIDA 3G5LA 1SVWA 4JLPA 4WNAB 3T1OA 3VZSA 2C7QA 4WDQA 3NATA 3TW8A 3TF5A 3ZVMA 3RF6A 3EJWA 4LYYA 5TS2A 3WLLA 1FXWA 1QIIA 2X4LA 5BV7A 1YJQA 2CK3A 4JJGA 3UJHA 1BSVA 1P31A 2FK7A 1YIOA 4ALLA 5B64A 5ESDA 1W4BA 3UMBA 3V7FA 4WZ6A 4M6WB 1DXOA 2FQXA 1PI3A 3AI7A 1IBLB 3OLQA 2O8VA 4DZTA 3FF1A 4DY6A 3IYLW 4MAAA 1KOJA 3GLQA 2CVZA 1PQPA 3HSSA 1XCPA 3L9XA 1QSGA 4ZRDA 3OIUA 1QO9A 3RVBA 1ZNXA 1B8PA 1NW5A 1XK6A 3QVMA 2M2IA 5LIRA 1WPRA 4JI8B 3M9WA 1XXHB 1YZGA 4GXNA 4ZOLF 4BV2A 3H5AA 3K05A 3LZDA 3R5JA 1N2JA 4NH0A 4LGYA 5CPFA 5DTQA 4ZJUA 1W5FA 2Y9MB 3VPDA 4YT4A 3TLCA 5JAMA 3MTGA 1BHSA 3C3JA 5BN3A 3HVUA 1ULZA 4RANA 2WU8A 3ZV6A 4JQCA 2P1DA 3TSCA 3OWOA 4DUZB 1LBIA 4N6NA 1Q0SA 2XUPA 4QPJC 4MYCA 4DZZA 1VPDA 2PUAA 1ONSA 4HXEB 2BP7B 1SA0A 2F1RA 1X8XA 2ZVPX 3D5QA 3OFVA 4IIGA 1VFNA 4LYAA 1ZGJA 5EWLA 5FNZA 5EEHA 1I6WA 4I2NA 1KC3A 4FVTA 1HEIA 1W6UA 2GSDA 4KIWA 4YJHA 4ZC1A 4JJ4A 4PC1A 3SOZA 3AJ8A 4FTWA 1QIEA 4B0PA 1W2HA 1U9IA 3C4VA 4OBBA 1VDMA 1IVYA 1RAIA 3TI7A 4XX0A 1RYFA 4BEBA 5KSYA 3FTEA 5T4HA 4IXDA 5LA6F 5FUXA 1IATA 2EATA 1K97A 1Y80A 1N8SA 2PGAA 1ICIA 1ITZA 1HSOA 3VTFA 1KOLA 3RVPA 3FZYA 3WYGA 5IM4A 3DLHA 3LYAA 1M2NA 3F3YA 3PNYA 4OA5A 3H9JA 3OKAA 5C0OE 3S99A 4E09A 1IN4A 3BAFA 2YFQA 1MLDA 3ZTYA 3WG9A 3U3DA 1L1RA 3AOGA 3N05A 5JS8A 4Q3NA 5JSKA 1H3EA 1UZMA 2NW6A 3ZW9A 4G0WA 1B16A 1BA2A 2BFBA 3BILA 4YO7A 2ZTVA 3T5GA 2GAAA 3NHRA 3CVUA 1CU1A 2CJWA 1P1IA 2QTMA 3W6OA 1BCSB 3E53A 1NAIA 1SCNE 3BWXA 1GQFA 1UK8A 2BW0A 2VHWA 4MB0A 5AXAA 3ZQ6A 3P9ZA 2D6FA 1I7NA 1XVAA 2JAUA 3BS4A 2ZIZA 3P5BA 3WKEA 3HHEA 4JHXA 4EPYA 1NNSA 5K20A 3F6YA 1X8JA 2HUNA 3ODPA 1A9SA 2ATXA 4O4IF 3TQRA 1WW3A 2VYCA 4MI3A 4UNIA 4YAOA 1I30A 4EATA 3HC7A 1PT9A 2V1XA 4KOEC 3Q8MA 1JV2B 1N34B 4NY1A 4JC0A 4A0FA 1T9HA 3ETHA 1Z6ZA 2HU7A 2Y0CA 2W48A 1Y8QB 4QVKA 5ARBA 1ID1A 2GK7A 2OMEA 4JC4A 1GUFA 4MVJF 3V1NA 3DTVD 3RTBA 4BCBA 2FMXA 1UK9A 2ZWAA 1QH8B 2XZDA 3S1SA 1YB6A 2LIPA 1FQWA 4R5MA 4E31A 4KE6A 2FMKA 3K94A 2XD9A 2ZFUA 1JDNA 2POCA 4RSGA 2GDJA 1GG9A 2WA2A 4R4JA 1AGYA 3G9TA 4BKOA 2WBLC 2VP0A 1YCDA 1LSOA 3P20A 2A1TS 3Q41A 1ZM3A 4JS0A 4ZVKA 2OQVA 1KQGA 5TC4A 1X1BA 4E07A 3I6QA 4PZAA 4TROA 3LDUA 4BMZA 3OLZA 3CINA 4FBGA 4LVNA 1PYOA 3FPKA 2CDBA 2NOAA 3P94A 4O2AA 5IN5A 4RY8A 1L4YA 3UJPA 1UJMA 3WGKA 1J2RA 2I2DA 4QYIB 4DUGA 4CF6A 1RYBA 4HR7A 4UD6A 3H1AA 2BIFA 2G8NA 1TQDA 1MPXA 1X94A 2ZE8A 4L4UA 2WF7A 4ID3A 1IG0A 4UULA 1V6AA 3BXHA 3RS3A 4QO7A 4EA6A 2OHGA 1N3IA 1EK5A 2CFIA 2M6LA 5IUJC 3E4DA 5F4BA 5BUSA 2FY8A 4EARA 1JAHA 1EGHA 1WKVA 3MGAA 3FUVA 3RAEC 2PM8A 4RKYA 3COYA 1I3CA 4Z4FA 3LBAA 1EE9A 3TTTA 3EPJA 3EEYA 3HJFA 1YRQA 4KAAA 4D98A 5DWDA 5LP6F 3N58A 3IKMB 1GKLA 2NMVA 4IWNA 2FOXA 2JJ1A 1D2RA 4I9NA 2VAPA 4YECA 3CGGA 4R54A 4EVSA 4YAIA 3T5AA 2CT8A 3JYQA 4Q82A 4ZO4A 4AX8A 2XUJA 2FX3A 5K6RA 1DLJA 3Q3VA 1MR3F 5JI2E 2C84A 3JASB 4WFQA 4XDYA 3QVOA 2ZAGA 5EE3A 1CE8B 1GLGA 2LKDA 3ELWA 5CEFA 1F1JA 4M86A 4A6PA 2ACWA 3AP1A 5KYYB 4X84A 3LS2A 4TRRA 5K0EA 3DUFA 3FLMA 1XJQA 5G0TA 3TB4A 3ZCQA 3AHGA 1X42A 3GQBA 1YFZA 3QV2A 3SX4A 2QP9X 3UK0A 5FP0A 1CZUA 4RPJA 1ZVMA 4G5RA 2EQAA 4BB0A 5JVDA 4M53A 1HDZA 3AR2A 3SQLA 3ZBUA 1VJ5A 1SHUX 2P2GA 1HKHA 5CB8A 1EB8A 1F3LA 2J3JA 2PLRA 1RYZA 3ASUA 4QO8A 2AJ8A 4E08A 3G2OA 4TYPA 4TS9A 2P9JA 1GDHA 1Z4OA 2CL5A 1DEOA 5ECWA 3RAJA 3ENNA 4IJ6A 3T9AA 4ARIA 2AEJA 3C74A 3R09A 4KXXA 1VLZA 3IO5A 4B40A 1Y9EA 4HAIA 4FWIB 2X2PA 2JIPA 2D1TA 2JGMA 4I5IA 1P2DA 3F6RA 4RSMA 3SHTA 3T9FA 3OKCA 3R5KA 2ASEA 2NPFA 3H3JA 2R62A 1JXMA 1E1CB 3LC1O 2WJ3A 4GNKA 3VDXA 3WLQA 4CQLA 5IVPA 1SB9A 2GA8A 3PJEA 3P45A 4IIBA 5JJLA 1C29B 4RMNA 3AOEA 5A3SA 4D3DA 1GEEA 3NAZA 4RM3A 3CYFA 4LBZA 4UHEA 4B5LA 3H5LA 5NLLA 5ADWA 1NUUA 2J0VA 1CHDA 2GSWA 4OQDA 5DM4A 3ZXXA 1RQ7A 3C6KA 1X14A 4OXIA 5KTOA 2EW2A 1KYIA 3M6AA 4N5NA 1AGRA 5JHGB 1AF7A 4MVJE 5HMLA 2QY6A 3DE4X 4KZPA 4LSWA 1DZIA 3SHWA 4K46A 5TQ0A 4CNQA 2N42A 5KJEA 5LU9A 1EUDA 2JHAA 3SVZA 3ZBQA 1B00A 3X1XA 4MVWA 3CHYA 1OLXA 2R68A 4GR5A 4JP1A 3W6PA 4NS4A 2XTMA 4CLRB 2PRSA 2YNMC 3ZDAA 4NZNA 4MA5A 1JH8A 4X1IB 2Q2NA 3ZIDA 3TLJA 3MUNA 4L57A 4I6GA 4DT1B 1B41A 2MYUA 5KQPA 1O6FA 3JWGA 5BYAA 4A1OA 4CKBA 5HDBB 2BZ1A 3EVFA 5JH7A 4HDNA 1ZH8A 2HA3A 2VCHA 3G8YA 1PR1A 4TOIA 4C87A 2IDJA 1DMSA 4L8YA 2I9PA 3DAFA 3HYRA 1B6SA 3IMEA 3FJYA 3M6UA 4OK5A 2ZJ8A 2MYPA 5DMHA 1MGPA 4ZZ1A 1F12A 2X5XA 3BB1A 2IZ7A 2RGBA 2O59A 2VRWA 1GR1A 2W90A 5KOJB 3HGQA 3ZJUA 4UCQA 2V45A 3SIXA 1YASA 2X8JB 1I4LD 1ZJYA 1D5WA 3DZJA 1DQSA 3O9MA 4ZQCB 1K8ZB 4RLSA 4BO9A 2DT8A 4KLNA 4YCAA 4NV3A 1U3DA 2E4VA 4QRHA 4Q1VA 4QA9A 5F33A 4LDJA 1HLPA 3MWDB 2YY6A 1PTJA 4BNUA 4BNFA 4HLQB 1H3NA 1E2QA 4BXOA 3G2NA 4JI0B 4J0DA 2HRZA 4GEKA 3NFRA 1OD6A 1HDEA 2VSXA 1HL7A 3DT9A 1I2ZA 3NEPX 3UAWA 2AN9A 1E96A 3O38A 1QKJA 3HLTA 2W6CX 4RCVA 3FWKA 2H59A 4WKBA 2DHQA 4ZVLA 1P73A 3WL7A 3D2BA 2QD5A 4M2LA 4D7AA 2OPBA 4URUR 1RPZA 1FFYA 3R8XA 4N40A 4IDBA 4KQCA 2DQYA 4LYEA 4EA9A 2AG0A 1F1BA 3GD5A 1BU8A 3KXKA 4LOLA 4ARUA 2ZRIA 3FYCA 4PQFA 3ZJYA 1X70A 3B1XA 2BM0A 4UCWA 3KG2A 3EXIA 3LYHA 4L9SA 1E20A 4XFJA 5LYJF 1XPOA 2UYQA 2FPKA 4PNPA 2QA5A 1KY3A 4YACA 2QORA 4J0FA 3KPUA 2X4GA 4IILA 4WZBA 5BR1A 3H9CA 3AMVA 3IAS1 3T52A 3GLFE 4GC5A 4DJJA 1TQ2A 3C6BA 3JQCA 4M83A 4G1FA 4D97A 4GQAA 5LXTA 3AERB 2LVBA 3I28A 1Y4SA 1LX6A 3GJ3A 1E6KA 2Q62A 3I4FA 3LUKA 3ZK7A 5JNTA 1Q1EA 2Q3JA 4JUAA 3VOTA 4ZKDA 2HK8A 1XGKA 2OZPA 5LQMA 3VA7A 2HRBA 1ZM4A 3TTUA 3FLEA 3G89A 2WAXA 1G3IA 4OU5A 3G59A 1JE0A 3JAMA 3IQGX 2PGXA 2DFPA 3VHQA 5FA5A 1Y9JA 4Q34A 5CLIA 5CLJA 2VJMB 4MHOA 1Y7TA 4V3BA 1V8FA 5AQEA 1YS9A 3RRBA 1E79A 1BN6A 1FPMA 1NX6A 4JLVA 1ZPDA 1N6IA 4UVHA 1Q57A 4A03A 4LK2A 1E3TA 5CITA 3BTOA 2BELA 4L75A 2QPAA 1YR3A 3NUZA 4E2XA 3LQFA 3PJDA 1YR9A 4N41A 1PJ8A 3D8RA 1G7SA 1PZMA 3K0CA 1O94C 3KR2A 2PMEA 1K5GA 4ICIA 2VA8A 2D7JA 1M66A 3L8GA 2HT1A 3QKUA 4IDDA 4WOBA 5E2AA 5BWOA 4Z1MA 1RFGE 4NIMA 4B3CA 5CCEA 4AUNA 2FH5B 2VF2A 1II9A 3ICWA 3U81A 2ODAA 2JARA 2A14A 2ZRHA 4AMYA 4EFKA 3ZWVA 4QKQA 4B79A 5CXXA 1EDEA 4E5MA 2Q6OA 4RM2A 3VAAA 5GJBA 1M8JA 3HU5A 4FE4A 3U1VA 1ZOLA 2NZYA 2XH8A 5LKRA 2ZUDA 3OT4A 4I4LA 4R2HA 1E3QA 3NP9A 1YDGA 1PT8A 1BE0A 1UBHS 3PDCA 3EZ2A 3WK5A 2XMPA 2I7DA 1XP8A 3GFRA 5G4KA 8ABPA 4C3OB 2XZLA 3D6UA 2QXYA 1NHWA 2LPMA 1I14A 4MUFA 1ZAKA 5KNDH 2D13A 4JBLA 4YP7A 3M1LA 4CBVA 4EABA 4ZEVA 4OF4A 1E1QD 3PCXA 4F3RA 1N5OX 1NPYA 3UMSA 5A4AA 3OZAA 1BROA 1R5BA 1NQVA 1H3FA 4R9NA 5F23A 3V32A 5F7OA 2OESA 4US0R 4E4TA 2GBFA 1P61B 1NVVR 5AI4A 5JCOA 3LYUA 4DAOA 1GEGA 2QN6A 4YLEA 4A8JB 1F06A 1PJRA 3OA2A 3OQIB 4WCFC 2SKCA 3UH1A 1FVOA 1K6MA 3NWEA 1T8SA 4MIYA 4P3KA 3MWYW 2FP4B 2AZMA 1ZL2A 3O91A 2QVCA 3W2GA 4F2GA 3B6IA 3WGJA 2FW7A 2WIBA 3MWJA 4QM7A 3DZKA 3INGA 2I29A 1CC1S 4HMQA 3CRZA 1GGEA 1HQCA 4J91A 5A5FA 1XA3A 1C2TA 2W37A 1E58A 2REQB 2I78A 3FSRA 3CBGA 4S0ZA 4H3VA 1DGQA 5C18A 4ALNA 2ODNA 1Q50A 4D9GA 1UJ4A 2AI1A 3ICQB 1G0OA 4L3OA 1XRPA 4FGLA 2CXTA 2O2DA 3PQ7A 4HBGA 4R6XA 3GH1A 5G53C 2NUAA 3EC7A 2EWVA 4CHGA 3U1BA 2X0KA 4B3GA 2X9QA 2P0YA 4BCDA 4XQ9A 3UXMA 4LHXA 1JR2A 2J6BA 4JN6B 4NMLA 5FFFA 4BNKA 3DEAA 5K0TA 2GPJA 4UMEA 2ADMA 3PEVA 1VI2A 1DKLA 4AO6A 5CB4F 3L7NA 1ESCA 1X13A 4BZQA 2CSXA 1XCMA 5ALXA 4CCSA 1FU8A 1XYYA 3CCFA 3F49S 4FIZA 4L2IB 4NDZA 4ONEA 5CX1B 5LBIA 1ULUA 3ZOKA 4CVNA 1DVRA 1JYFA 4ZCIA 5I7VA 1G0NA 4P3XA 2HDNB 3EF0A 4ZODA 4F8EA 1Y8ZA 3FNQA 4MYRA 3P0FA 1QAQA 1KH1A 4XWTA 1JXOA 2ZRLA 4EQ6A 4EZEA 3P9XA 3X3HA 1W88A 5TIIA 4ZQEA 4OQ4A 2O3TA 5D00A 1MZVA 4R7GA 1UP7A 4AUMA 4LBVA 1SZPA 1A5BB 4NCAA 1VL8A 3NKFA 4U3JA 5AUQA 3ST7A 1Q19A 2YHBA 4C2AA 5JJCA 1GCGA 3LJKA 3NDIA 2XW6A 2CE7A 2WSSD 3NJ4A 3D8SA 1S2DA 5IS2A 5CH5A 2IS2A 1RCTE 1S2LA 1C41A 4TKMA 2IXAA 2WUFA 3GELA 4JQSA 2J08A 3B6EA 4RV5A 1W87A 3VSDA 2QT0A 1M6NA 3EXFA 3OTOB 1UDAA 2FW0A 2HMAA 3V8RA 1ML4A 4G5FA 3HZZA 1G8FA 2FEMA 4KHPB 1LRJA 1QGAA 1R0KA 2EX4A 2XIQA 1PE0A 2Y0BA 5K3FB 4X63A 4RS4A 3VRHA 2IYQA 2Y1KA 4RY2A 1M75A 1N5JA 2BKLA 5KQGA 1MVNA 1A9YA 4B8ZA 1QS0A 2CUKA 4KREA 3ZZ1A 1FX1A 3OSZA 4JAVC 4YQFA 4F1WA 1KVRA 1J97A 2X3YA 3CB4A 5LSAA 4K6KA 5BP7A 4KC0A 3MJHA 3WJAA 2R8YA 1Z0FA 2ZRAA 3K9CA 4EITA 3EMVA 1LB1B 1WNTA 4UAGA 1A9XA 2EGUA 1Y1QA 1FY2A 4IS2A 3UVEA 4RVFA 1P7ZA 4MWSA 2FHPA 2W4QA 2H2WA 4FYVA 1FFEA 2IWRA 3RSFA 1ZK3A 3VZRA 3S8YA 3GOQA 5BYKA 3RAFC 2OGTA 1NMQA 1QGYA 3WJ1A 4B87A 1ADGA 1VMDA 1WVIA 4FYMA 4RHEA 5EC8A 1CX9B 13PKA 1F2VA 2G28A 3B20A 3HXLA 3CZCA 4XPZA 2OILA 1K4YA 5ENDA 1DBWA 5TE9A 3T34A 3BULA 1TAQA 4DMFA 1TLFA 1RYMA 4G01B 1RKVA 2QBYA 3WGVA 2VJLA 2FUG1 1O96A 3ENZA 2JDIA 2AVDA 4TZTA 4UZSA 4BFYA 4S1TA 3AONB 1JW9B 3BTSA 4YRTA 3PQ8A 1IEWA 1Q5PA 3B1JA 4EYOA 4X62B 1ILEA 3DDWA 2Q6IA 2Q5QA 2R60A 1NVMB 3BK1A 3QFHA 4LRQA 1TMOA 4XVHA 4I9GA 4ZVTA 5TQ2B 4EI9A 2DLDA 2VDOB 1SXJB 3AIIA 1JIIA 3HACA 4KE8A 2XI4A 4MS3A 4LKRA 4RDIA 1N36B 2C5BA 2C59A 4WFIA 2W6ID 3BL6A 3TGPA 5AI9A 2O2SA 5SZJA 4EF5A 2HQBA 4KO4S 1AQ6A 4LNUA 2HMSA 4PPFA 5IARA 2LWIA 3FHJA 3ZTTA 5BQXA 1HOXA 4P22A 3D3EA 3FY4A 5TF0A 5EWJB 3R74A 3PGMA 2YOFA 2Y2VA 1BTOA 1MABA 2AC7A 1QHXA 2WAAA 3RTAA 4AL4A 3HV2A 3KZCA 3FTQA 3EGDA 3QKSB 1YQ9A 3AUAA 1G8KA 1T35A 4D9JA 1GGNA 1ZSNA 1TJPB 2VIIA 3SF0A 1SCUB 2Q1YA 4BL5A 4E5SA 2QUAA 1E2EA 5ECYA 5A3VA 5J43A 4JLDA 3TG2A 4ZAFA 5E0KB 3AL0C 2RHMA 5D84A 3AUXA 4YREA 3DDSA 3JRNA 3QMMA 4PHHA 5A0VA 3A28A 5JTUA 5JAHA 2XHZA 3L4SO 4LE0A 4F21A 5IJ9A 1RAAA 1PRYA 3DMRA 4DM7A 1GZ5A 3E4CA 4IJMA 2DH5A 3FFXA 3M4XA 3E84A 2ZJYA 4KIJA 3WNDA 5I7UA 2ZUVA 4YDRA 1R0RE 2IVFA 5E7MA 2WKPA 3K31A 5K3FA 1YNOA 5F3DA 4C14A 4TXHA 4CW7A 1V7CA 4PN7A 1NOJA 1Y82A 1BD4A 3NH6A 2HT6A 3NHPA 1RACA 2GD0A 2BM1A 4J0KA 4J0GA 5K0JA 1ZCZA 3G2LA 5LYJB 2J48A 3AG5A 2I99A 1IHPA 1R12A 3KFLA 2M98A 4GKBA 2DBQA 1HKUA 4FFOA 1FMFA 3DA8A 2EJWA 2B8JA 2QTVA 2H3EA 4FE7A 4Q66C 4C1NA 3Q7RA 4Q9DA 1L4UA 2FRDA 2Q2VA 4CR6A 3VUFA 1T9ZA 3WBBA 2R6JA 3D6NB 1Z2DA 3FUXA 1LJLA 5TEVA 3KL2A 4G23A 4Y1EA 4Y2UA 4DARA 2AZDA 1AHHA 1XROA 2B4KA 3ZDCA 1OI3A 3QFTA 5JD3A 2D4AA 4BASA 5JEDA 5KOHA 4CM5A 1XTIA 1HZZA 1PR2A 2VSQA 1X8KA 2XB8A 4KHZA 4I4TB 3ZR4B 3D8HA 4PYNA 1G8SA 4RADA 5H7XA 3L7MA 4XD7D 4I5FA 2PZKA 5IJWA 4AWXA 4YT2A 4BLOA 2HAEA 2AEEA 3WJ2A 3OEHA 4UBMA 1S3GA 4R1OA 3DTTA 5C4IA 3UCFA 1XNHA 3N0TA 2X76A 3COZA 5CLFA 3GFQA 4M1TA 1MJFA 3QVGB 4ZD6A 3SM3A 3X0DA 2R1VB 5ITSA 1SY7A 1XA4A 2FZGA 2FPOA 3WL3A 4HLUC 4Q03A 2R6AA 3OJCA 1QG6A 3LPMA 1RZ3A 2NUAB 2BN4A 1NVXQ 2F55A 4QZVA 3HJUA 4KPFC 1SU8A 2YN4A 1KXZA 4BJ6A 3R7AA 1E1NA 2WJJA 3QG1A 2Y0PA 4YP0A 3JAKB 5A9SA 3ZWAA 5AVZA 4F4IA 1QM5A 3W5VA 3ZQJA 1IUNA 4PLFA 5HS6A 1B1CA 5JPIA 2EBFX 5HA5A 1KHTA 3WP0A 1I5EA 4C3VA 3SWWA 1CIJA 4X60A 2YRWA 4Z1OA 2PJRA 4LZLA 3FOFC 1Q44A 3HS3A 1N1GA 1KI8A 2HPZA 3L40A 2XRZA 1OSNA 4K6OA 1GP2A 1P1FA 3KLBA 2OFOA 2WI8A 2GZSA 3F0TA 4RF2A 4EW1A 4OGLA 1KQ3A 1H5NA 1I6KA 2G83A 3ZE2B 4KO2S 2W6JD 1DT3A 1U8FO 5GOTA 2J45A 3SEQA 3BXEA 1U0FA 3LKVA 1E2PA 3P0HA 2GXQA 4R71A 5IKXA 1LTHR 4KBYA 2CDAA 1W4ZA 4KWCA 1U2TA 4ZGGA 4QG3A 5HZKA 4ZT2A 3P9CA 4CM8A 2QM3A 2VHUA 1H6DA 3R3UA 3WMGA 1M0EA 4NOKA 2EQBA 3JQQA 4MCAA 2BMVA 2IPNA 2JJ2D 4BNTA 1KYWA 1UJ2A 2XQJA 3L1JA 4GYJA 3MBOA 1NSYA 5NULA 1VKHA 2CLSA 4G86A 1MO2A 3EXG1 3GRVA 1OGIA 2AG5A 2PXHA 1JJFA 4PYMA 1B1AA 3ROMA 2QGFA 3L6OO 4YIHA 5IULC 1HDXA 1FRVA 1KEEB 5KSWB 2R47A 1NBWB 4IOJA 1SXJE 1IWPB 3P0IA 4G67A 1W0KA 3OAAD 4XCVA 3UMJA 5IM5A 3DQQA 3DHEA 2QUHA 2F1IA 2FW9A 3CVXA 2PKQP 1Z2OX 1X2EA 1VHLA 5ALKA 2EZ4A 4MKGA 2YL2A 1W36D 2OSBA 4G85A 4IZOA 2JH9A 2ZYAA 1PZNA 1E4VA 1NC3A 2GKSA 1CUZA 4MCHA 4OK3A 4PSUA 4TYYA 4DQKA 1B7GO 1BEZA 1B8NA 2GPYA 1Z22A 3H9GA 4KN5A 3LKBA 1E5VA 3OESA 4LVUA 4NMXB 3OQOA 2EFDB 2FZVA 3S3TA 1GFZA 2R2GA 2WD9A 3MTDA 4R7TA 3K1AA 5DTIA 1E6LA 1G8PA 1Z8NA 2X8BA 3RIYA 3CO5A 5C8YF 5JBNA 2O2JA 5FOUA 1NOKA 3JAKA 5DYYA 4XRGA 1BA3A 5A9SB 1RYYA 3PTZA 1KE1A 2J7KA 2I4OA 3LPLA 3TOCA 4MDEA 1JQEA 4J6FA 3I2YX 1F5NA 4PG4A 3C6ZA 1U8EA 4I7EA 4UEKA 4XWAA 1CQIA 3VPFA 5A5DA 4FFMA 3RS9A 2C9OA 4F5DA 3MWEA 1J4AA 3F71A 721PA 3BH6A 2POQX 1LDBA 5EKXA 2QSJA 2QSUA 4AP6A 4PQYA 4B2YA 4CQMB 5C5DA 1F6BA 4R0NA 1MC5A 2OCYC 2FPWA 2R5WA 4EB6B 2ZJ5A 2Q3MA 2FSPA 4UXIA 1A4RA 1SC3A 4W9NA 4EHAA 3FLBA 2HOQA 5IVIA 4E4YA 3AESB