4X3PA

Sirt2 in complex with a myristoyl peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
304
structure length
297
Chain Sequence
GSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD-dependent protein deacetylase sirtuin-2
publication title Sirt2 in complex with a myristoyl peptide
rcsb
source organism Homo sapiens
molecule tags Hydrolase/peptide
total genus 98
structure length 297
sequence length 304
ec nomenclature ec 3.5.1.-:
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02146 SIR2 Sir2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1600.10 Alpha Beta 2-Layer Sandwich SIR2/SIRT2 'Small Domain' SIR2/SIRT2 'Small Domain' 4x3pA02
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4x3pA01
5EJMA 5EJ4A 1PNQA 4UUBA 4K9MA 5MFZA 4UU8A 2VBGA 2VBFA 4BVGA 3K35A 2B4YA 4GPEA 1M2GA 5AHKA 4UUAA 4K9NA 2VK1A 1J8FA 4HD8A 1O96B 4BN4A 3EY9A 5IMSA 1YI0A 4K9OA 3FSJX 3GLRA 2OO5C 1T9DA 4GG1A 4MPRA 4UTNA 1PO7A 4IF6A 1SZDA 1UPAA 2EZ9A 2Q5QA 1UPBA 3IAEA 4C7BA 5EJ7A 5FEMA 2NXWA 1V5FA 2IHTA 1M2NA 2JLCA 4BN5A 1EFPA 5BWOA 2VJYA 2FN3A 1YHZA 1PI3A 4RJKA 2QQFA 2FSVC 3CLSD 1HZZC 2W93A 1PT9A 1POXA 1Q6ZA 5BWLA 2FRDC 2X7JA 2Q5LA 1PVDA 4JUBA 4QQ8A 4D5EA 2JI9A 1T9BA 5DEIA 2BRUC 2IHUA 4RJIA 2WVHA 1JSCA 4ZP1A 2WVAA 4BVFA 1U28C 3CF4G 2OORC 4KPUA 4Q9DA 2OD9A 4KGDA 4GM1A 2H2IA 4R8MA 2OD2A 4MPJA 5MF6A 4G1CA 4JSRA 2H59A 2H2DA 3HWWA 5K6RA 1E3TA 3RIYA 1S7GA 1XLTC 4J1TC 2Q27A 2H4HA 1U2GC 3OE1A 4BVBA 4RMIA 5EJAA 1M2KA 1V5EA 4BUZA 3GLTA 2Q5JA 5D7NA 1PNOA 2JI8A 4RMGA 1ICIA 3D7KA 4FVTA 4JUAA 2EZ8A 1Z8NA 4IAOA 4O8ZA 4JT8A 4K9QA 1OZGA 1PTJC 4J16C 3GLSA 1MA3A 2V3WA 2Q5OA 4Y6OA 4KXQA 1POWA 2EZ4A 1QPBA 1T9CA 1OZHA 3FLMA 2WVGA 3LQ1A 4I5IA 4V1CB 4Y6LA 4UTZA 1OVMA 4F4UA 2H2FA 4BVEA 3FZNA 2UZ1B 3EYAA 4GM0A 4FEGA 2JI6A 2H4JA 4IG9A 4JD5A 5FYQA 2OD7A 1SZCA 3ZG6A 1Q17A 1EFVA 2VK8A 4RJJA 4FZ3A 3U31A 3D4BA 1YC5A 4UTVA 3PKJA 4Y6QA 1YHYA 5K3SA 4V1CA 5K2OA 3F6BX 1V5GA 4C78A 4ZZIA 2Q29A 2C31A 5EJ8A 3U3DA 3JR3A 2AG1A 1Q1AA 2UZ1A 2VK4A 2FR8C 1Q14A 4K9LA 1YI1A 5DGTA 3F6EX 4BVHA 4UTXA 1YNOA 3IAFA 1U2DC 4GP9A 4L3OA 1YTLA 4RMJA 1MCZA 4BV2A 3JWPA 3ZGOA 3E9YA 1BFDA 1D4OA 2JI7A 5BWNA 3ZGVA 2H4FA 2A1UA 4FEEA 1YBHA 1UPCA 3RIGA 3CLUD 4JUDX 1NM5C 4MPPA 4QELA 3GLUA 4X3PA 2H2HA 1OZFA 1S5PA 4UU7A 4V1CI 5K6TA 2QQGA 4BV3A 4D5GA 3CLTD 4F56A 4HDAA 4UTRA 2JLAA 2PANA 4K9KA 4K9PA 2A1TR 4JT9A 2FWNA 5EJ5A 2Q28A 4JUFA 1O97D 2AG0A 4JU8A 2EZTA 3PDHA 4MQ5A 2PGOA 2PGNA 1M2JA 2NYRA 1Y9DA 5EJ6A 3PKIA 4L2IA 1M2HA 2VBIA 4QPZA 4RMHA 2DJIA 1N0HA 2IHVA 1DJLA 4MZXA 1PYDA 4JUCA 3EA4A 5DGDA 2EZUA 4X3OA 1T9AA 3HWX1 5EJ9A 2HJHA 4JU9A 4TWIA 4COKA 3CLRD 4TWJA 4GM4A 2H2GA 1U31A 1YC2A 3D81A 5MFPA 1ZPDA 2JIBA 5MGNA
chains in the Genus database with same CATH superfamily
1MFZA 4W5OA 2PGXA 1B41A 2XNSA 1E9AA 1F9AA 2QYTA 2B36A 5CU7A 3OUUA 1H2AS 1LRKA 1XTZA 4WKGA 1SD2A 3WLEA 5FKJA 4KKXB 4DA7A 1LTKA 2Y1LA 1BJRE 3N87A 1L4YA 4OHFA 4JXXA 1DBWA 5EA2A 5F1OA 2FQWA 2NQTA 3EC7A 2OUKA 1KHHA 5DSZA 5L4NA 3LH5A 4CT5A 1BA2A 5FFFA 5H83A 4HMPA 2PY6A 1XXHA 3CRW1 2PQMA 2D5IA 5DHFA 4ER7A 1VL1A 4H6WA 6Q21A 1JMVA 1RRMA 2XHEA 1VMKA 4LTNA 3KCNA 3ZX4A 4NJEB 4G09A 1SBZA 3ZQUA 1JJBA 2KSQA 5DX1A 2C2BA 4KR9A 1FFEA 1RBQA 1ZD1A 2FEAA 5JOQA 3QFRA 1NZDA 3OOEA 2DQKA 4C08A 5B7PA 2VTVA 5IAAA 3BM5A 5AW2A 1QVWA 4HB3A 1V71A 4JA0A 5AI9A 3THRA 3GGDA 4ZYVA 1VLZA 3KTFA 1L5MA 2IYAA 3P19A 2MOKA 4MWSA 2AKYA 3VVMA 2O06A 4BLSA 3HBLA 1MQAA 4M9RA 5I7WA 5KWIA 4KX5A 1PAUA 4J0CA 4RK6A 4B2YA 4F4DA 2GPWA 4IHJB 4RE6A 3HO1A 2VJKA 3HVIA 4YRDA 5NULA 4FMBB 4BJ3A 4B3IA 1JE1A 4MYSA 1J2EA 1Y3FE 1T0HB 4OGLA 5F4BA 5FBZA 5HKAA 3ZE7A 7ABPA 4GXTA 2UUAB 3NTXA 1T43A 4IF6A 2BC9A 1XZMA 4ZXFA 4UE6A 1QR6A 1M6HA 2PH3A 1HETA 1OIVA 2ZRGA 1IZ7A 1XNGA 3A1UA 3AEXA 3WBFA 2ZUEA 2LKDA 4PHGA 3S99A 5L95A 5UKDA 4LDPA 3WRXA 3UCFA 2BGRA 2D06A 1A2OA 2W2LD 1BDIA 2WR8A 1TK9A 3GFSA 1DCTA 4DTCA 3EZ6A 4IG4A 3TLJA 4OJYA 4CMJA 4M1OA 3JAKB 3VZSA 4OSEA 1VIYA 3IE0A 4ISBA 3FOWA 4WEOA 3CH7A 3UAWA 4NJEA 3C5WP 2PJRA 5CEJA 3C3MA 1I6LA 5JWOA 4XVCA 1CP2A 1ZISA 5DSXA 4FDVA 3TBFA 3ZD9A 4EZIA 3DOHA 2QQFA 3LFTA 3L7LA 4GBMA 1OZ0A 5FULA 3FZGA 5K09A 1UUFA 2R3SA 3AQIA 2C0CA 4DJEC 4ECAA 5IU6A 4URHA 5K9ZA 4IP0A 5C5CA 3ORYA 2PZ8A 4KO3S 4KDRA 1BXZA 1S9DA 3HA5A 1P4GA 3PRJA 2D0OB 4DLXA 2C3UA 4B8YA 1ETHA 2AUMA 1POXA 1S8NA 3IOBA 5BUCA 2PPLA 5A06A 4TN5A 5T8KC 2ODNA 2X7JA 2RHMA 4DMGA 4EHIA 1XTSA 1KI4A 1RYZA 4JODA 1K6MA 3D6HA 4QOHA 1E2BA 3O9MA 3BMNB 4JMPA 5F5NA 1ECPA 5B5SA 4HPJB 1BS1A 4JB2A 2JGMA 5EWMB 4A0HA 3IAM6 4ENPA 3ELBA 5DDIP 5LB4A 4U2FA 4EPVA 2GARA 2GYUA 1FP2A 1RWMA 3MB5A 4UXIA 4DBVO 3E82A 4MKFA 2AD1A 1Y4SA 4R3NA 5FA6A 1U63A 1ZM9A 2GZRA 2DWUA 1XQ9A 2WMNB 3DO8A 5I8PA 3AESB 2I2AA 2WJHA 3JAKA 1QQTA 4JIGA 1TK2A 3IVGA 1OT3A 3Q1KA 3D1LA 4M1QA 2ZYRA 4LOAA 2P2YA 2Q3MA 4KODA 4M1YA 3OCUA 4WVFA 4YWJA 3K6JA 3SC2B 1VBMA 4D57A 2GEDA 3DB2A 1CY1A 3L82B 5AHKA 4D4IA 1CUIA 1TQ8A 1TCBA 2WPDA 1MAWA 3IA2A 1GITA 4J91A 2LNDA 2GXQA 4R2KA 4C29A 5H82A 3T5DA 3L7BA 1CJTC 1SQGA 2IU6A 1HEYA 1ORHA 2NTNA 5EMLA 1H66A 4CG0A 5ALUA 2Z58A 3SDBA 1DE0A 1WZCA 3PFFA 4RJLA 1N2OA 3N0WA 3RW9A 2Y1WA 2HQSA 2A84A 4WCFB 2NZ8A 4R8MA 2QN2A 2X5NA 1V25A 4JL8A 1Q0TA 2WB4A 1L6IA 2BHRA 1P2VA 1CXZA 1PSWA 3FSGA 2XCSB 1KJ8A 1VLQA 5AKGA 3BMNA 3IXLA 3U4HA 3TGPA 2OMEA 2CUTA 2PZEA 3QYPA 4OIMA 3G2PA 4X6XA 1N2XA 4RGQA 4CEHB 5EWMA 1J06A 4YLEA 5BNTA 1J0CA 1EHIA 1HWYA 4JJKA 4L4YA 2A88A 3ZXSA 2FHPA 5K0BA 1ZCJA 1OKKA 2N1BA 3B3JA 2HU2A 3DZBA 2QPOA 3O8BA 2PIAA 1X1RA 4UFOA 1WDTA 3HDJA 1L5ZA 5HFNA 4KXWA 4QBKA 5BURA 3DDCA 5FPYA 1VL6A 3G85A 3AESA 1YCDA 1Y6GA 2RBEA 4K86A 1KRXA 3L4BA 1KPGA 4J1TC 1BHJA 3QE2A 1WPRA 1JH9A 1AD2A 1G1MA 1U2GC 1C30B 3CT4A 3DONA 1VA4A 3PZRA 4FOLA 3UV7A 2J7PD 2A92A 4MQEB 3SC2A 3ZWAA 1PJ2A 3MB8A 3FPHA 3P9RA 4RMIA 1UQUA 1RKUA 1ATZA 1WS6A 4NU8X 1M2KA 3OEHA 4UUQA 3TW0A 2JEZA 2HHHB 1TMGE 2RK6A 5EIBD 4R1QA 5LXTB 4AKIA 1VPVA 4FB5A 2OGUA 1QS0A 4BQSA 1SIWA 3PXGA 5C7IO 1P72A 1PNOA 4WCFA 1JEYA 3W2TA 3MTQA 4ZAGA 1OLSB 4ER6A 1VGRA 1X7GA 2HBQA 1WOYA 3DDZX 1H6DA 2VUIB 3GPCA 2XMGA 3L7YA 3LECA 3OCVA 5F1YA 2OKGA 4I1VA 4UATA 1BN7A 3RJ5A 4CEHA 1C0EA 5GPBA 3WRYC 3OF2A 1ZGHA 1W9HA 3PIIA 4CMCA 3FHJA 2FMHA 4JJ4A 5HRUA 1TYBE 4J16C 3RVSA 4PZUA 3GLSA 1XC7A 1YS1X 3UJNA 3VPSA 3PC8C 3E5HA 4UNQA 3RBAA 1QFMA 5HIJA 4EFDA 2A35A 4AYWA 2HFJA 4DV3B 2IWHA 4JC4A 4AP9A 1YQQA 3WGYA 1YHNA 3D59A 4J6FA 4EJSC 3RVLA 2VNSA 4KW7A 2PL9A 4C0LA 1LWOA 1IN7A 2QG6A 3I3SR 3N0RA 3EEYA 4BVLA 5FI5A 5FL3A 3K8OE 1C30A 1WB6A 3N2NA 4TQGA 3OU7A 4ER3A 4YIHA 4MQEA 1RI5A 4A0SA 2HA3A 4OUKX 4M1EA 3TNFA 4B8WA 4Y0VA 4YMIA 2O2SA 4TTPA 4G4SP 3TTWA 1QAMA 2HBZA 3B6EA 3MF4A 2V5VA 3ESYA 4DA8A 3UTCA 4YCMA 5LQRA 5KYTA 1HMPA 1NUAA 3AJEA 3AZOA 2BBOA 1YR3A 3Q9SA 3D5QA 4MUEA 5NLLA 5IBCA 5LXTA 3INYA 2NUPB 4UREA 4XOIA 5C8YB 5FNVF 1VLLA 4XM2A 5FBLB 4DAEA 1AIPA 1LZKA 1OLSA 4GM0A 5JARA 4E5PA 2BKEA 2O05A 4Q3EA 3H99A 4PGFA 5DLDA 3VKGA 2R6CA 4C43A 3PWZA 1O3YA 2HBRA 1WPGA 5HXAA 1K7EB 4FHDA 1RYMA 3HRIA 2CF6A 1RCUA 2GFIA 3H4IA 3I6QA 2BH9A 1WZIA 5FYQA 1LSOA 3IEUA 3MMSA 2OD7A 1XAHA 3PQFA 5L4SA 1XRRA 4M98A 4NFSA 4WZAE 3ZG6A 1WD7A 1C0KA 3DZFA 3E2MA 2REXB 5A7FA 2PH7A 4M7OA 2VA9A 3FYHA 2V7EA 4HYEA 2DUMA 2VF2A 3VNAA 3ZQ6A 3G82C 4Z3KA 4RVFA 4BE7B 2HCFA 3NHYA 2JH8A 2WSIA 2NZWA 4IIEA 4RETA 3V46A 5K3EA 1QE3A 4DBLC 1SIOA 2VYQA 2Q5FA 2QLFA 1YC5A 4KKVA 3U16A 1F14A 5AVXA 3PPXA 2MR5A 3E0QA 1VJDA 3DSRA 2KX7A 2BZ0A 2NO6A 3HVUA 4KN9S 4BKMA 3L0PA 4OBXA 1RYBA 1WY7A 3FJYA 4DNQA 1OX4B 1NQWA 5I9IA 4QYWA 2FSFA 5DM0A 3TMKA 2VAVA 2IY9A 2NTYC 2QZ9A 5AJYA 2CFIA 3IDOA 4JZKA 4KX3A 5C8YA 1RI1A 4YS6A 2VK4A 1K6EA 4QFBA 2QQEA 3H5TA 1YAJA 2QQ0A 4KH1A 5E95A 4ABYA 2DHCA 5DNDA 5DN6A 3TBKA 1L4KA 1HYBA 1OXVA 2R4TA 1Z83A 2X4LA 1UBMS 4R69A 1ZEMA 3EX7C 3BBPA 3CVYA 4BWGA 1SBYA 2VC2B 3KYIB 4ONEA 2XF8A 3JQBC 5F23A 1DIAA 5BPFA 1SOAA 1IYZA 1RYHA 2VRWA 1V9LA 2Q6OA 2NU9B 2GSDA 3UK0A 4C0HA 4C4PA 3JAMA 4AI6A 4UBLA 5CT4A 3FYUB 2D7CA 1WXQA 4D1YA 1PNTA 3FKSD 2RGBA 2D00A 2Z2JA 2L42A 2FWBA 2YFYA 3KHUA 2OR3A 3M6VA 5EOVA 1TVEA 4HBZA 4DMUB 4Z86A 5J4VA 4U8GA 2JBAB 3H5NA 3PJRA 3L7MA 1SEVA 3TW8B 3KCQA 2JFFA 2P8SA 1LY1A 1UM9A 1G7TA 3H8WA 1GN8A 2H1SA 5TS3A 3NRBA 2X0JA 2F1OA 1ZUD1 2NZUG 3ZVNA 3KVYA 4GYJA 4C5BA 3K20A 4F4IA 1D4OA 4NCBA 3TAHA 3KLOA 1U8YA 1S8AA 2JW5A 4MQBA 4Y9TA 1QWSA 3EN0A 3EHDA 4QDJA 2H4FA 4TS1A 3FRIA 4RKFA 4H1TA 5KOJB 5F52A 3I12A 2NLOA 4YJ3B 2Y1OA 3R4VA 4QXRA 3GGGA 3OEYA 4RK7A 4L72A 3N07A 2TRSB 3KBOA 2IGTA 4HN2A 5JSKA 4CLHA 2X1HA 2LRHA 1PRYA 2EFDB 1FEZA 3IAAA 3M6IA 4TL9A 3S2GA 3EIHA 3KAKA 1Z5PA 1XYVA 1LTQA 2P4SA 4V1CI 1JHPA 4U63A 3U17A 2NU9A 2A7QA 3QRWA 1ZIOA 2C04A 5AUPB 2ONJA 7MHTA 2O20A 3FYUA 3GEEA 3JVUA 3UCXA 2OGZA 3MLAA 4LJKA 4DQXA 4CKZA 2OOKA 1J00A 1TUBB 2EAUA 1ZL0A 2M6LA 4Z2AA 1VMAA 1E9DA 2HSGA 3D3JA 3NV7A 1A9SA 1BEZA 1Z5VA 3JZFA 4KWCA 5DIZA 1ZJ6A 4B9AA 1KNXA 1P8AA 4BKOA 4PINA 4DLUA 2JBAA 5JAPA 1M7BA 4BKUA 1NVFA 5LMZA 4IDPA 4PONA 5FCDA 4ZDJA 3TW8A 3VM6A 2C4VA 1XJ0A 3BS4A 3GNQA 3NUZA 3ZU5A 1G16A 4QJ4A 2EOAA 4QFCA 1KERA 1YR6A 4H27A 4K9KA 3REQB 3TPZA 4CM9A 5TLSA 2GASA 3EOAI 1QLJA 2IYRA 4BQOA 3S8EA 1WSBA 1UC5B 5EIHA 4IUYA 4BNGA 3O3NB 3CVUA 4K6OA 4G4IA 3LY8A 4FCTA 4R3UC 3VR6D 3KXPA 5FHQA 1RFGE 3GT3A 4JHXA 1RRFA 4YJDA 2WM2A 4IKEA 1QIGA 5KOJA 1QVVA 1N75A 1VHWA 2FA9A 4YJ3A 4MQ5A 2VDWA 3A3KA 4LNHA 4EITA 1PV4A 3M6FA 3W7VA 1Y1TA 3M70A 1SC6A 1X6VA 4X6UA 1RXYA 1T4CB 1W35A 3I83A 4P98A 4A5OA 2XD9A 4LY9A 3ZDDA 2AYXA 4OBEA 5FO0A 4FYMA 3OPVA 1RI2A 1KDOA 3MGAA 4M9CA 4RMHA 1MEOA 3JW8A 3L6BA 1PWHA 4WSOA 5EG5A 2I65A 5HMMA 2CFOA 1QO0D 3NI2A 4FU0A 3HBJA 3FDIA 2IHVA 3DULA 1TUBA 2X86A 4DCJA 3BGWA 1Z2DA 3MSCA 4NBWA 3V97A 5CNJA 4PLFA 1Q12A 2Q6LA 2O48X 1JEJA 3EVDA 3ZU4A 3GLGE 1O54A 1UDXA 3FSRA 2IEBA 3BJRA 4BEWA 1N5MA 2PD4A 5ER6A 4FOSA 1N6NA 1NBOA 2AC4A 2J3MA 3A4VA 2WYUA 3F6YA 1DQPA 4UEOA 5ALZA 2P5YA 2NSJA 3OHMA 4YRJA 5MDHA 2O52A 4X3OA 1JZQA 4J0HA 4AMVA 5JAZA 3ZNQA 1ZI8A 1UEJA 4CM3A 1LX6A 4JU9A 2QP3A 3PKZA 5LA6B 5A5DA 1GUBA 2F3UA 4R1OA 2IS2A 3VR5D 4BC0A 1U8XX 5L53A 2RHDA 1Z6QA 1VDMA 2WTXA 2OYSA 4GM4A 4JQOA 5F1KA 4CM8A 5J43A 4OM7A 1B4DA 2AA3A 3LQKA 4AKEA 1JSLA 2IXFA 5FHRA 4LECA 3IXQA 3O6VA 1T4CA 4HHEA 3WKCA 4BKQA 1E63A 1TOAA 3JRNA 3R6WA 4NDAA 4PZCA 1L3CA 1DXOA 1IQ0A 4ZAVA 4Q12A 4BLPA 3IUBA 2HK8A 3VHLB 1MAAA 4Z4FA 5T41A 3HA7A 2PRSA 2XTAA 4I8DA 3P9QA 1OXTA 5GGYA 1ZN7A 4A8JB 2B2NA 1NMQA 3LKZA 2JPDA 2PSDA 3LP8A 5AW6A 1KKLA 2Z3VA 1E98A 3K0EA 4N5IX 4R2LA 4RULA 3CUUA 4M36A 1SKAA 2OV6A 1CUXA 1XHFA 2ZSDA 3HXKA 4M49A 4QAJA 4YPOA 4GICA 1O7JA 4M4SA 4HKTA 4RC9A 2BWJA 2EKQA 1MUUA 5CM8B 4BQEA 4KGZA 4LYEA 5DYGA 2QRHA 1VSTA 4NMMA 2X8BA 4K8RB 4RTNA 3K70B 2HC9A 1COZA 3W4IA 4B6OA 1I2ZA 1FUEA 2VP9A 3OPYI 3SNHA 4D0GA 5KO2A 3I04M 3N0XA 5LA6A 5IG2A 1JQKA 2E4XA 4FUQA 2R4QA 1Y5MA 1CZOA 2UVPB 4OL9A 2GYYA 2GT1A 3KYBA 4OXKA 1WKVA 2AMLA 2J8ZA 8AT1A 2G4VA 2XMDA 1NRXA 2XZOA 4DLAA 4TMWA 1JEOA 3FE2A 4LDNA 1YI0A 2BMEA 4UDNA 2ZWMA 5TS2A 4EQZA 4DMMA 4HDOB 2O57A 2CE2X 3FUXA 7REQA 3MCWA 5IARA 1S2MA 3KK0A 1JS1X 5HDBB 3FHLA 4HMQA 3IMKA 4ZCMA 1XA4A 1SOWA 2YZNA 1UP6A 4H4CA 1EX1A 4N5DA 4TXJA 1SG0A 4YMTA 4JLOA 3TIFA 4A8JA 2PQ0A 1JMYA 1RADA 2AXEA 1IVYA 2UZIR 4QGGA 1AMNA 3BE4A 1AUPA 4WEQA 4WK2B 1W85B 1A8SA 2M2IA 1PO7A 3QJGA 4LSWA 4DB4A 2WUEA 2JCVA 2ZRKA 5CDYA 5A1TA 2D1YA 2VYFA 5HIIA 2RGWA 1YR1A 1XQYA 2QJRA 4IFIA 1C3EA 1PU2A 3ESCA 4FYXA 4MGKR 4OMCA 4B46A 4MIKA 2H1RA 2AEMA 3CS3A 4RDCA 4UNNA 5HQTA 4JGBA 2V6BA 2WAOA 3KVRA 3I2JA 3VNSA 1EQUA 1CR6A 4BO9A 4EFMA 1SVOA 2WWXA 3LL4A 4RAQA 2ZU6A 3Q0TA 1E0DA 5AJWA 2CJYA 4EA7A 4Q3KA 2IXDA 4WPGA 4E2WA 4QNMA 2XMPA 4EG8A 1QP4A 2OBNA 2UVPA 3JRXA 3VDXA 3ZZ0A 2TSYB 5ICEA 1EFPA 1PJ3A 1QCYA 3DE7X 4YACA 2DOKA 2X8AA 3ISTA 1H9BA 1UWCA 2W2LA 3NP7A 4B6SA 4EPWA 4G0NA 3KZMA 4K2AA 4PFKA 4QECA 5ESWA 5K4GA 5FXMA 2GZMA 3MTDA 1PL7A 4P7FA 2FEKA 2IPLA 3WLAA 4KPUB 1XL0A 5GVSA 4I1IA 1CP3A 2YQ5A 1QQAA 2FCRA 5DSTA 4MCAA 1WKCA 4LTMA 1UKEA 4Y9RA 3QWHA 3GZ4A 1KAEA 2MINB 1XQ6A 4ITVA 5KJEA 3GJXC 1TW3A 3HSKA 3N28A 4C4YA 4LI3X 5EJ2A 4D02A 5FI3A 4R1SA 4QDZA 3FVQA 1GFIA 4YLYA 1XTQA 1Y42X 1Z4LA 5LLDA 1FUUA 4I1UA 1W85A 4O2BA 4XM0A 2C5AA 4XJXA 5LC1A 4KIGA 4CKBB 4I4IA 2GVNA 1VXOA 1BFUA 3P9ZA 1IQRA 1PS8A 4R1PA 5KVVA 1B2LA 1SUIA 4KRGA 2PR2A 1EWKA 2DBZA 4S0ZA 2DY0A 4MV9A 1KE1A 4AF7A 4B6RA 2G5CA 1P60A 1N77A 3IP1A 2RCNA 1T5SA 2LTAA 3IILA 4K87A 1NL3A 5T4BA 3RVJA 1IULA 3G0CA 2AV6A 1IL0A 4MR9B 3RYTC 2WYHA 4NE7A 4WLFA 1BTOA 4DABA 2QT9A 4U4AA 5CB0A 3CJRA 1E6MA 2NOAA 2WVAA 4BMCA 1XRLA 1F8GA 1QFYA 2BW0A 3MCAA 4PRLA 3S28A 3UC9A 5CFPA 1JAYA 1HQCA 1NXQA 2R7NA 4BFXA 4BQQA 3C74A 3ENKA 2B9VA 4L5BA 5IKEA 1G60A 1IXKA 2IPAB 2V7VA 2YZ2A 2Q3CA 3PNOA 4KPUA 1T0PA 5ALLA 2CHEA 4RVSA 3V1YA 1SVLA 2H9IA 2W71A 1XRMA 2GPAA 3OX1A 3RT1A 1GU0A 2O19A 2I3BA 2GM5A 3BTOA 1RLIA 1NM5A 1NLZA 1NONA 4EY3A 2LDBA 3BN3A 3HJUA 3BFJA 3ZZ1A 4TTTS 5A0FA 3U5TA 3KU4A 2BGIA 4HNUA 3GZJA 1Q15A 1ULUA 1KKMA 4BUJA 2Q0SA 1A9PA 1MR3F 2MSNA 4HFJA 1P9WA 1CLUA 5EMJA 3UJPA 4CKBA 5C52B 3MWYW 3PX7A 3MUNA 2H59A 1A8UA 2EBHX 2FOXA 1FQWA 3QVWA 3GLFB 1AV6A 1E2EA 3VR3A 1KJ9A 1U5AA 2W2KB 4FYHA 1AA9A 4R0VA 5DBOA 2HA6A 2G5PA 4QYIB 4RDIA 3RNOA 3WOVA 3WZ2A 2QRNA 1NI4B 4NECA 4RLHA 3H65A 4BNJA 3BXHA 2XCIA 1P2UA 2CVZA 4ZAXA 1PS0A 1QB8A 2VPZA 4CIDA 4PC7A 3PXDA 4MR9A 5KYKA 3W06A 1QIMA 5DP2A 1JJFA 2NO7A 1U65A 1Z5OA 1P7CA 2FJUA 2H4HA 3T8YA 4BVBA 2VJMA 2JLQA 5F5LA 2AEEA 5DWVA 1U8UA 3S29A 4AECA 4E7PA 1P6UA 2JGFA 2NZJA 1B1AA 3GDFA 4BTLA 3K9LA 2EFGA 4L57A 1DTEA 2GK3A 2C2OA 1L4HA 4UHBA 3WZLA 1EB9A 1NLYA 2FWPA 3LCUA 1HDEA 1LXCA 3H2HA 3MJCA 3O9VA 3T3PB 1KQPA 3RK4A 1DJPA 1SCNE 2IC5A 3GPBA 4E3ZA 3OPQA 5D7NA 2J7PA 4FR2A 4PR0A 4B4KA 3EG9B 3IEMA 4HRYA 4BLTA 4GKVA 2VSQA 2X0DA 2ZCUA 3MILA 2YWEA 4DNPA 1JAZA 1PUIA 3GZNB 5E1MA 3SP1A 2G08A 4G24A 2PUEA 2BEUB 2ZT5A 2R00A 4XFKA 4ALMA 1UPTA 5CK5A 5KX5B 4O8ZA 4RPLA 2JJ1D 1NUHA 4NS4A 2HF8A 2WE7A 1J56A 1EM6A 4RCVA 4N5HX 2IYSA 3IR6A 2W2KA 1VKZA 4OHZA 3MUEA 2Q4RA 5JDIA 1ZVVA 2IH5A 1QWOA 2XLBA 4L5AA 3QVLA 4QYIA 4IQ4A 1T0UA 2Q1YA 1FJHA 3VH4A 4EL0A 1OH7A 4TYYA 4H7DA 3RVOA 3LWDA 3A9RA 3M34A 3DL2A 2BDEA 1PZFA 2QE7D 5JJIA 4CPDA 1O6GA 3MC1A 1ICEA 4ZVLA 5HNKA 1GCIA 3A6EA 4DLVA 4CV1A 5A6VA 4KYUA 1M6WA 2ZR0A 1II0A 4KN8A 1P5HA 1IM8A 1O8BA 1C3OB 4Q7KA 5KQMA 2YXEA 4WQMA 3ICOA 1ZW6A 3UQYS 2JAQA 5JMTA 3JRWA 3A9SA 4UUNA 4YK7A 1SM4A 4FMPA 2ZIGA 1DINA 4KUGA 4I1OA 1FNBA 4CEIB 3EPJA 4KTTE 4PBTA 1XCMA 2YBDA 1F0PA 3H13A 2VJPA 3D8HA 4NV1A 3EG9A 3LG2A 2C78A 4E13A 2X40A 2IT1A 2UZ1B 3HR8A 5CBPB 4KIFA 1W47A 3GZNA 3HYNA 4EG0A 3KR1A 1YFLA 2BEUA 2CKDA 4G86A 1H23A 2FPRA 5AM4A 1FVXA 1IZ9A 3G8CA 5KNLA 3DL7A 2QY6A 4UU1A 2GSWA 3CLUC 1SXJD 1VE7A 5KX5A 5IC6A 2X7XA 3EUAA 3FRJA 4UCWA 4MMXB 5A04A 3TDNA 3E4DA 3EQ7A 3QVMA 1QBKC 5F7ZA 2Q21A 3BHIA 4QHSA 1H2RS 4WHMA 5LWHA 4MAAA 1ZHHA 1SZCA 3U40A 1U3WA 1ZOSA 1X1SA 5IYZB 4LYHA 2BPOA 3TQSA 4Z51A 2YW2A 2X19A 3DQZA 4CHTA 2FWIA 3DTVD 1LLFA 3U80A 5IM4A 2WTNA 2VH1A 3FLBA 3ZD6A 3OFKA 3U31A 4UZFA 3J81k 4P0PB 1OV4A 3AHFA 1H2XA 4Y6RA 1KK3A 3R44A 4WESB 4QG7A 3RODA 3BRWD 4X20B 4CDRA 3W5DA 2HI0A 3B5EA 3QX7A 5YASA 2RHWA 2QR5A 5U1PA 1SVUA 1DCMA 2OV1A 1YJ8A 3MK31 4HRVA 4Q1FA 1KAHA 1N2CE 2N0SA 4FGSA 4XWOA 1WMDA 2IA5A 1LNZA 2BGMA 3KLMX 5K2OA 1PJAA 2CXSA 3CZ5A 3K8ZA 3MWJA 3FMOB 4H1UA 5AVVA 4CEIA 5AOVA 5KNCA 1GGNA 3Q3HA 4CR8A 3B78A 3EIFA 5REQB 1TZBA 5LL6P 3BGVA 2DETA 4RADA 4KV7A 4B6JA 2UZ1A 1CE8B 5CBPA 1SC3A 3GIWA 4NCAA 3CC8A 3PQ5A 5JXHA 3IEKA 4YTEA 2ECPA 3ZWKA 3D5EA 4XLTA 5FUQA 2YDXA 2QVBA 4IR7A 1CK4A 4YJ2B 4YRIA 1JIIA 2WT8A 4EI7A 4ENTA 2FW0A 2ABWA 1IE3A 2BOVA 4EY7A 1OT5A 5J4HA 3FNQA 2XUIA 3II6X 3KOXA 3Q3VA 4RSHA 3WLNA 3F6EX 3PEYA 4J9VA 2X6RA 2C9ZA 5FPKA 1PL0A 2OC9A 2C7PA 2ATXA 5JNVA 3HNPA 4EGCB 3RHFA 1USWA 3GLGB 4DS3A 1UBFA 3NWBA 1NVWQ 1N2GA 2LKCA 2PVPA 1K3UB 3QVXA 5F9HA 5BT8A 5ECGC 2XUJA 3RS0A 1Z37A 4EYEA 5GONF 4DV7B 1GYQA 2PO7A 5DYTA 4L51A 1SXJE 1ECLA 3PEEA 4WESA 2P78A 4X20A 3RYIB 4QXQA 1Z22A 3B1KA 2IHNA 1FVFA 2B0CA 2WDZA 3M49A 4C6RA 1MORA 3EUFA 1KDTA 3JWPA 4JI1B 1BCRA 3B5IA 3FKSA 4NI5A 4CHGA 2B98A 1UJBA 3H9QA 5JZBA 2Y0PA 1IN8A 3P9SA 4PZDA 1R0ZA 1G4UR 1Q7EA 3E9YA 3GMDA 2YVUA 4FWIB 4JH0A 5J63A 1EE9A 3SZUA 3T1TA 1ST3A 5KOHB 2O7VA 1N92A 4WXRA 5REQA 3VVBA 2HO4A 2B7CA 2DXIA 2D1QA 4NH4A 1GV1A 1XU4A 1Y1LA 3OCWA 3UJ7A 3VSAA 4UM5A 1CE8A 1NDHA 1A69A 2R1ZA 4BB6A 3LK7A 4Q4AB 1VHDA 5JFGA 4YJ2A 1FS6A 2ANBA 4V0NA 3V1UA 5KQRA 2O8DB 4GWGA 4ESHA 4QDKA 4ZAWA 1S9HA 2Q2VA 2HU7A 3PWTA 4LE1A 2OXFA 1ZOPA 3ABSB 5BV7A 1XTUA 1UANA 4Q9HA 3KYCB 5GVRA 4C7JA 2QRPA 5C5IA 3HDYA 4NVRA 5K6TA 5TF4A 2IYTA 3LUKA 2Q8QA 4NOLA 1EX6A 4RELA 1Q44A 2VWPA 4X24A 2I8CA 4JLBA 3GLGA 4ZC8A 1NNEA 1ZWLA 2NWQA 3RC7A 3CLTD 4W9RA 4C7VA 3K70D 2HV8A 1Y81A 4JJ7A 1SHKA 4LZOA 4QRDA 3Q41A 4TOIA 5DLEA 4HEA1 1EJ0A 1VSUA 4XW2A 5T57A 5TXGA 5HCNA 3UC5A 1BE6A 3L7NA 3T7DA 2GQ0A 3RYIA 4J4HA 4PYQA 5KJ1A 1GRRA 1XQXA 3HB0A 1ZL2A 3WP1B 1P1CA 2BGJA 1QHGA 3DEIA 5DM1A 2X0EA 4FI3F 5D3MB 1C1HA 4H7EA 2OHIA 1H9AA 4YO8A 5HTKA 2HU8A 3PI7A 3DE5X 3G13A 2EHDA 2PUDA 1K7FB 2QD1A 1CQWA 4JC0A 2CVHA 1A95A 1JKXA 2HRQA 4OU5A 2EHJA 4G0ZA 5CTAA 5AKKA 3RBZA 5IT0A 4MVJF 1GKKA 1KSFX 1Y3BE 4W5WA 4DLBA 2VP6A 3SEAA 3H4TA 4Q4HB 4DLSA 2CXOA 1XQVA 1QFXA 5G4KB 2YTZA 1P77A 2QI9C 3EWAA 2WJGA 4PS1A 4Q4AA 2O8DA 2VP3A 1TVKB 5DBIA 2ZTMA 1ODIA 1V95A 2VSOA 4KJZA 3IVMA 1I4LD 1L1RA 4N9WA 4QGFA 1NF3A 3VR6A 2XVYA 3BFVA 1OU4A 1T0IA 3KYCA 1W34A 5FQNA 4D80A 4LTDA 5EJ6A 3FOEC 3MT0A 3U4AA 2VBIA 3A1SA 2WTUA 2VRNA 4OH7A 4E94A 3OE4A 1I13A 2WUGA 1W5AA 4YRGA 4EUNA 4REMA 1DV1A 4KREA 4NQZA 2G9UA 1U6JA 4GPAA 5EXDA 5AFSA 2QGNA 3IBFA 4PR3A 3GDWA 3HSYA 1R0XA 3E9QA 5AHOA 4YP0A 5FLYA 1L5GB 1MBZA 2CUNA 2W11A 1MAUA 2C20A 2E9SA 1W8IA 4ZEVA 5TMPA 4GI5A 1ODSA 4KAFA 3PVSA 3TEJA 5A4JA 2WBLC 2AEFA 1DIOB 4LJ9A 4QVIA 1QO0A 3KOOA 2C9MA 3V4LA 2OG2A 3BICA 3FWKA 4AY2A 1R00A 5JATA 2G6TA 2J0VA 2XRYA 3L41A 2C03A 5D3MA 2PS0A 1G2IA 2JFBA 1OLUB 2WV9A 3LPDA 1GP2A 3PRKE 3U9SA 3KG2A 2PWBA 2ZI6A 3N39C 4XARA 3QEKA 1FXUA 5E38A 2O7QA 3EXG1 3AUFA 1LFAA 2I7VA 3ES9A 5IABA 4Q4HA 2I54A 4DIUA 3DS8A 5G4KA 1GZHB 1PK8A 2YIMA 3CISA 3WO1A 4BGVA 4JJ6A 4XYLA 4HL6A 5CLJA 5MFPA 3ETJA 2X9NA 1TVKA 3NT4A 3EDYA 3VJRA 3W3ZB 4YBRA 3R3HA 1Q11A 1MG5A 3F96A 4GX0A 3TRFA 3VR5A 2VDVE 3KSUA 3PHJA 4H35A 2CXPA 4IWNA 4V24A 4N0QA 3PC4A 1SG6A 2QRVB 4TRJA 4DNXA 1KMHB 3BFKA 4L8VA 2HSZA 1KI2A 5G02A 2REBA 4BNVA 1A9ZA 1HF3A 2FRXA 4W1QA 1CR4A 5AKZA 4X93A 3HP1A 4D8YA 3J81A 3JS5A 5HE8A 3ROEA 2GHQA 3ISJA 3WWEA 3NPAA 4AJIA 1GCGA 1QHFA 1YZHA 2OYRA 3IL2A 4Q37A 1A9OA 2Y1XA 3D31A 1T3GA 3ORFA 3PEVA 4RORA 2PKQO 3E1KA 2H1IA 2BI7A 1E4OA 1U7TA 4GOOD 1WW8A 4FGJA 2YCLA 1LV7A 3VKWA 5JANA 2I2DA 3W77A 4C4SA 1P2SA 1OLUA 1E9RA 1XWFA 2XMQA 3HV2A 1R0BA 3N6VA 2I67A 1MO3A 1E58A 3MSXA 2WG2A 3KKNA 2QTFA 2G04A 5F7JA 2IOYA 5TEWA 4DC9A 4CL2A 1XZBA 2DPXA 3PXBA 5JSFA 4CKYA 1T2EA 1JE0A 2ZUSA 3VAAA 1E4EB 3H1EA 4UMEA 3RTAA 1DAKA 1Y6FA 5B37A 2VZ8A 1M34E 2NXNA 1EFCA 1NUTA 3N58A 1VCNA 2R8XA 4CN9A 1GL3A 3WYNA 3AP2A 4I46A 3CA8A 4UZSA 1U0NA 2PEYA 1U9ZA 5G3YA 3X1XA 5BYKA 2WYIA 2QRVA 5TY0A 1KMHA 1P91A 3PUKA 4KQ9A 3U4DA 3GNTA 4EA9A 3KL2A 3OQHA 1P1IA 3W2EA 1Z18A 4Z7JA 4ZYZA 5H9WA 2O8EB 2Z04A 4IVNA 1N4AA 1PGJA 1TMYA 1J8DA 4LX8A 1H2EA 1KL7A 3MMPA 4HZUA 4HS9A 3RC1A 4ZZ0A 4UTNA 5EZ5A 1W46A 3FBTA 1OBFO 1RP7A 5GM1A 2YX1A 3CO0S 3B1ZA 4LV5B 1SRRA 1UK9A 2OGSA 2XB9A 2FN4A 3BB1A 1JLMA 2QTHA 3DT8A 1R50A 3TFOA 4AC9A 2BJWA 1M2NA 1DIGA 3WYEA 2ATCA 2QQ5A 3LC0A 5JG7A 4HGQA 3UIEA 1Y89A 3ZPXA 2YKGA 1SIBE 3KDSE 3NGMA 1SHJA 1MRSA 4ZMRA 2WOOA 4OK6A 3J7AC 2QY9A 5J2UB 1O5IA 1D6NA 1DJOA 3QFFA 5SZJA 4NL4H 2XR1A 2BSXA 3DCIA 5A1JA 5SYAA 3DEKA 3EPLA 1ZHOA 1BQEA 4G65A 1P7PA 4R68A 3T34A 3C7CB 1E4EA 5BWOA 2QAIA 2X22A 3B13B 3R0QA 1Y63A 4JASB 3JR7A 3SE7A 1GFZA 3OUTA 3IC5A 3EC2A 1EFTA 1R6DA 4KYIB 2H9YA 2OP1A 2WJ3A 6ADHA 3O47A 2JFWA 3RHZA 5A2GA 1CNEA 1QRAA 1HE8B 1W49A 2XTZA 5EIBC 5DT9A 4JQYA 3AB8A 5A0TA 1GJRA 4F0JA 2O8EA 1X7ZA 4QGHA 5LUBA 3HEMA 1P1BA 2RAFA 1RHJA 5K0LA 1VE5A 4KB5A 4RXTA 4D46A 1QIKA 3OKAA 1L4LA 2XB2A 3KPYA 4JLNA 5DI3B 5GTDA 4G0PA 2XQKA 1QPZA 1G5RA 1M0WA 4Q00A 4CR6A 5E1BA 4Y9SA 5IS2A 4TGLA 5JD5A 4P58A 2PEZA 1VRWA 4BQIA 4Z6KA 4Y9UA 1RKVA 3C3XA 2V55B 1YL5A 4TM8A 5JTTA 3VDMA 3HB9A 5J2UA 5J47A 4AKGA 3LCMA 3GGCA 3DOEA 3GUUA 3I05A 2ZB4A 2V45A 3H5AA 3G7NA 3PC7A 4R5MA 2OE2A 4YAKA 1GDTA 4D9NA 1C4OA 1SR8A 2PQ6A 2ZS9A 1MFPA 1N2SA 2R8RA 2HWXA 1UJNA 2IOQA 3DGFC 1P5JA 4US0R 2XYRA 3A05A 1ZBQA 3C5EA 3PC6A 1U8CB 1FLVA 3KPJA 3ZQKA 4BO1A 1Z5NA 3NR2A 3SZRA 1GQSA 4XUDA 4DA6A 5TVKA 4NYIQ 1YOBA 3I42A 5P21A 1Y3HA 2AKAB 4US2R 1F4VA 2CF5A 1GO2A 4C05A 4CNQA 4E5YA 3CSUA 1DFHA 1OAKA 1E6WA 1S8OA 2OP0A 2R5WA 2XWPA 3FFBA 2OD9A 3RDPA 4B73A 3VYVA 4CMAA 2I1LA 2PMWB 3SGLA 1TMOA 2YIJA 4AMUA 3BBLA 1OFVA 3DOIA 1GD1O 4YMWA 2ST1A 4MWEA 3D2AA 3KEQA 5FFMA 1XEWY 5B12A 2MIIA 5DI3A 4RL4A 5KZMB 4TKMA 2YJNA 4NPAA 3RR2A 3TBHA 4LF7B 3HV0A 2B2CA 2QUJA 3AG6A 1RWBA 5KU7A 1KZYC 1QDUA 3HADA 2JIDA 2Z8XA 3NWOA 4PXAA 1T6NA 4GPD1 1NNI1 1MOSA 3RFTA 3I8SA 1RRVA 3QFTA 3LIPA 4M76B 1E1RD 3AF2A 2PYZA 3CWCA 1VSVA 2FPLA 3QKWA 4BMSA 4NZMA 3HDHA 1J2JA 3RABA 1NW7A 3JY6A 2GHIA 3ZIDA 1UFRA 2ZB8A 4JEHA 2FDRA 1T3SA 4JLKA 3WGZA 1QJCA 4ENWA 4WADA 4CKCB 1BD3A 2SICE 1D2HA 1AQYA 1O58A 2G9ZA 2IUTA 2BFDB 2Y0CA 1JALA 3OJFA 1OYVA 3P8ZA 3SYRA 4A2PA 2HV9A 3MWGA 5JXIA 3DLBA 4CIBA 2PH5A 1XZEA 3VNVA 1YRWA 3COSA 3L9XA 5IWAB 3IBYA 3WQSB 3DB1A 3PQ6A 2CVOA 1WUTA 4OU4A 1Z9BA 2ZI7A 2FWRA 4DNFA 5FDFA 1E79D 1E9EA 4KRYA 3PHIA 1E2LA 1JZSA 3JQEA 1FTNA 1X1BA 3K4QA 3AUTA 3T9FA 5COQA 3GFFA 3ZI0A 1A9YA 1F1BA 5T4EA 3ROZA 4N1AA 4ZHQF 2IOFK 2SBTA 3ADPA 4RA6B 4AFNA 5JTUA 1EDOA 2NUTA 3TS1A 5JCXA 1TLFA 3T5PA 1VI5A 2WZBA 4N0EA 2OBYA 2V4UA 3M3DA 4FNGA 1SUEA 1YZQA 4EHLA 3OFSA 3P0RA 1NVKA 5E9JA 5DCUA 3A4IA 4ZDKA 1Z0UA 2XMRA 1LW7A 3O8LA 4O6VA 5KREA 4YRCA 5AVRA 3NOVA 4QXAA 4PCLA 3G49A 1P1HA 1LSUA 3B36A 1SUBA 3O1IC 4JOQA 3FOZA 4PYRA 1IXRC 2FW8A 4PFQA 3BRSA 1HTTA 2JJ1A 4IMPA 3V8MA 4EPYA 1NVGA 1FOEB 2GN4A 2FQXA 4C88A 4FC7A 4CKCA 2BHTA 3A6FA 3JVVA 4PPYA 2BFDA 2PV0A 1A7UA 4QC2A 4NAHA 3RTEA 1GZ4A 1OSNA 1EG7A 3WC4A 2DBVO 2G1KA 3AVXA 2OV4A 3DTVB 1UIRA 3VSDA 4FDMA 3SN6A 4ACBA 2A0XA 1U0EA 3U7GA 2QE7A 3KVNA 2VL7A 1LV8A 1ST2A 1XZAA 1T8YA 4KXUA 4WOKA 5CIQA 2AHRA 2HW8A 2QNIA 4QVGA 4AJKA 1G3UA 5C1BA 4L8WB 4JK3A 5AICA 4LK2A 1JHYA 3DR3A 1HM5A 4LA4A 1IU9A 3GVPA 2ZB7A 3QOYA 2ZM5A 3UJHA 2Q1SA 5LD2C 3EXIB 5HJ7A 2AKEA 2VF4X 5AKHA 1AX9A 3ICQB 1ECCA 3H6GA 4XWYA 2XCUA 4RA6A 2CEAA 2VHXA 1DB3A 1F9EA 3LT4A 3QM1A 2VZLA 1JHDA 3A1FA 3WGIA 4ARUA 6NULA 4PSVA 1OYYA 5B1SA 4P53A 4A8PA 1Y9EA 2GETA 4DDHA 3BILA 3Q72A 1KOLA 4I50F 1HV8A 1RWOA 4FW9A 3HCFA 1EGHA 1WMEA 1SXJA 1NY5A 3OPXA 5DW0A 1X1EA 2J87A 4DDWA 1IOVA 3BB3A 3O1LA 4MMYB 1E0KA 3UJDA 4RJJA 4XCXA 5AVKA 4IIGA 5E6UB 2HRDA 1GL9B 2O7RA 2K4MA 4FCVA 4MV3A 3SJUA 4FLFA 3ROPA 1UDAA 2F1HA 3OD1A 3GC6A 3I62A 2ZBGA 1ZJWA 4GRAA 1C14A 4P5PA 1T5LA 2DLDA 4Q05A 3QE9Y 1QQBA 4WIAA 1CVIA 2BBWA 1UMKA 2Y1FA 4BBAA 4Y6QA 4RY0A 4U7WA 1A1VA 2H11A 5CFLA 3DTVA 3OOSA 2IXGA 3WKEA 3BFPA 2PWYA 2O4UX 3JQCA 3MQ4A 521PA 3WL8A 4UEKA 4RK0A 3BRWA 2OWDA 5EMKA 3BE5A 1L2TA 1LBEA 3C1AA 3DWEX 2WAYA 3L0IB 3HCPA 3K9QO 2EGGA 3L6DA 2EP5A 1HL3A 4HJRA 1YR8A 2A30A 1K6XA 3JVDA 3ZNOA 4F9FA 2I8LA 1L7OA 2YMPA 2JK1A 4FSHA 2FR8C 5KWSA 4LG1A 3MJEA 1AHHA 2ZRNA 3HDGA 4FZRA 2J4FA 5LQSA 3V2UA 1JAIA 1NKVA 1OIXA 3DAOA 1OY1A 2NU7B 5KC9A 4PRKA 2I03A 1MO2A 4W1RA 1RWWA 2CNBA 2QJOA 4FKBA 2RB5A 3V8RA 3WSTA 1A98A 1Z2EA 1ZZGA 3K53A 3N2YA 4HNAA 4AUMA 3L6EA 4ENSA 2ZULA 2ZJ6A 3DTYA 2W6CX 3PIDA 1H0RA 3NBXX 1YJCA 4WZ6A 4EHJA 2BGLA 3EH2A 1I8TA 4F3RA 1NSFA 5DGCA 3ZV3A 2X9QA 1G55A 3RSFA 1P3JA 1U2DC 4GP9A 1J0EA 3G17A 4G5OA 5ADUS 5AVQA 3SS8A 3K9HA 1M8PA 4KAAA 1P4AA 1U9CA 1VI6A 5E6UA 3U2QA 2O3SA 5AW3A 1ZI6A 1V47A 1L5SA 4RU1A 4L5IA 1K4KA 4IXMA 4QIHA 1J9EA 1TKCA 3DM5A 1HYQA 4DVGA 5CDHA 1QE5A 1VI2A 4OYRA 3U4GA 3SBDA 1F5SA 1HDXA 1O8CA 1V6SA 2VEDA 4IKPA 1A7JA 4C87A 4I4NA 4MYCA 3ITKA 3GEMA 4E88A 4LC0A 1U11A 2IU3A 4XIJA 5KQLA 9ABPA 1YJ5A 2Q3FA 4MDFA 4I9NA 2C9OA 3SQOA 1VBNA 2AZDA 1RPZA 1BFDA 2RBGA 4P3XA 2V5UA 3N74A 2QVCA 2FG5A 3ZWNA 1QYDA 2DHRA 2PD3A 3ZGVA 4QOIA 4I1PA 2O5VA 4DQ0A 3PS9A 1SU7A 4AROA 4KU4A 3LWZA 1MC4A 2JDID 4IOKA 2C4NA 5BOVA 1J0XO 3RIGA 1PCXA 2IP4A 3FLEA 2I7XA 2CT8A 4F1WA 2V6JA 2NU7A 1L5QA 1T35A 3QMPA 4OQMA 4M9XA 1OZFA 1E7RA 4MUMA 4TRNA 4RM2A 4V0KA 1MD9A 4P84A 2VT7A 4AXXA 5EE9A 1WXDA 5EL0A 3A27A 3HU1A 4LCJA 3DQQA 1G6HA 1QC5B 5C1OA 1DEXA 1MX5A 3HSSA 4AQYB 5J1SB 2WJIA 4FNMA 5CLQA 4E21A 4LC1A 1L6RA 3CBGA 4GMHA 4Q82A 1ZN9A 5KYGA 3DZKA 4TWZA 4BNTA 2CNLA 1JDVA 2R8BA 3ZHSA 1XVLA 4JQSA 4QT0A 1H0HA 2NT4A 3W8RA 4F5ZA 3ADKA 3LVQE 5EXTA 2QW8A 2RH5A 3KD2A 4RH0A 4ZVRA 3RUPA 3CCBA 2VHYA 2QDXA 3PQ3A 3K4PA 4WFKA 4UU0A 2YVLA 5KCMA 2JKZA 1LDYA 1SULA 3LOUA 1APBA 1E3WB 4LBZA 5GWXA 2FWNA 3IDFA 1RT9A 1XKQA 4AKSA 4LXGA 5FYDA 3UOWA 1HMYA 1NI5A 4B6EA 1MOPA 2CHUA 4WERA 1M34B 3V1NA 3QKIA 2TS1A 2J7KA 3Q8MA 3GLHE 4G67A 5K05A 4C04A 2O5EA 4YRZA 5CJ2A 5THQA 4DDUA 5CDUA 5BW4A 2PGNA 3ZVLA 3BB4A 1ADCA 3IKTA 1NX6A 3ABOB 4I5FA 1X42A 1CT9A 4S1VA 4OLFA 5D3QA 4RD4A 4QTZA 2GPYA 4PGGA 1DAGA 1G9TA 2B83A 2VNIA 4YVFA 4NK4A 4CF5A 1E89A 3VPBA 3E70C 4IQ0A 4YPVA 2EW1A 2H31A 4MQLA 1QC5A 1NTRA 2ZIVB 1EDDA 1LC0A 1DRUA 3OZRA 1PIWA 1E0SA 2GJSA 4S1TA 5TC4A 5LR6A 1ZLXA 2PJUA 1ZM4A 1YBVA 10MHA 2EXXA 2BFCB 4PZ0A 1NG1A 2A0FA 4QXPA 2FY8A 2IQ5A 1Y9ZA 4FYJA 2PX4A 5IEBA 4JUCA 2YHIB 1EHYA 3IVCA 4E0BA 1E6KA 5FNVB 3PDWA 3MIZA 3QVKA 5FWDA 2R1TB 4NYMQ 3EXEB 1ZK3A 5EIXA 1WU7A 5AMXA 3D0OA 3RRBA 4QO8A 1Z5ZA 1E3WA 3U1TA 3VJLA 2A9FA 4A8HA 1LBHA 4MITA 2XVXA 3S6JA 4LCEA 3IP6A 2C7RA 1C1YA 1M34A 1VJ5A 1VYHA 1XF1A 3B7GA 3K1TA 2J3LA 3PR1A 4K26A 5FTKA 4KXVA 1P75A 4YCDA 2PRZA 3ZS9A 2WHPA 3CNQS 3OQBA 1GNQA 2JVIA 3HJNA 5J2TF 4CQLB 3ONEA 1HRKA 4O8CA 3O4GA 5EIOA 3VZDA 3WQRA 3GWGA 4RZ2A 3HL4A 1E7WA 4URUR 1CSEE 3SQWA 1D9XA 2PL5A 1PR1A 5JPIA 4L9SA 3ZWBA 2MSCB 1GRNA 2AI2A 1LB1B 2X42A 4MO9A 1JR3D 3OJEA 2X0NA 1AO0A 1OB5A 4M55A 2UUOA 2ZRLA 5EJMA 4RFSA 1TF2A 2FMFA 2BFCA 1ZJ4A 2J4CA 3EPRA 4JL5A 3RSLA 3ZTWA 5JSZB 4CTMA 1TEXA 3EDMA 5CGZA 3S1AB 2YHIA 1A8PA 3P4UA 4IV8A 2CWDA 4YMGA 1IPHA 3WK7A 1ACJA 3IESA 3IUEA 5FNVA 4LF8B 1A4RA 1K5HA 2NVBA 3DVRX 1JQEA 5JAQA 3EXEA 3O4VA 5CDGA 3F1KA 3GAZA 2XY4A 2YL2A 4I55F 5AHRA 2UXDB 3MJVA 4RSRA 2BV3A 1JL3A 1JUDA 4FYWA 1YS7A 1TQ2A 2AL7A 3I1IA 2RB4A 3TKAA 2B99A 2GPSA 3L1UA 1O0BA 3EBLA 4FQ7A 1KYTA 4Y0NA 1J8FA 1HSOA 1P0CA 4XX0B 4JLMA 1YQTA 4XWAA 4KE9A 1TIBA 2Q6VA 3L05A 3L7OA 2G5GX 4X1IB 3AL2A 3BWVA 3IJRA 2SCUB 3AUXA 3NHKA 4YJGA 2ES4A 3I39X 3GGOA 1B76A 4AZSA 1ONNA 1KTIA 2QIOA 1XKTA 2C2WA 2DKFA 4R01A 4IEIA 4ZA2A 3D0RA 2F3QA 4B3SB 4D9BA 1D2RA 1RRGA 4OQQA 9GPBA 3GJ7A 5GONA 1C3LA 1I10A 4LWOA 3VTFA 4XR4A 2V5AA 4ARSA 1J33A 1PG0A 4F5EA 3CHYA 1CBUA 1G4HA 1UPAA 3SM9A 3S1AA 4MCHA 4X8LA 2C96A 3NT2A 4QRIA 1M6YA 4F84A 4ARVA 1L4MA 1QVRA 2P9QA 3WMEA 4KWHA 3A9UA 4S1WA 3M4NA 4WNCA 4EGJA 3SEFA 3ELWA 4Y1GA 1JBKA 2R6GA 3TSZA 4ZMBA 5FOQA 4XGQA 4F3CA 4OGFA 2Z1NA 2WM8A 5KNBH 2WWGA 3M1LA 3WYCA 2AZMA 3OCJA 1XVVA 3HNOA 2HIHA 4XSVA 3V6LA 4KR3A 1NBIA 4HB4A 3TI9A 4XX0A 3VR4H 5KPJA 1HDOA 4JVSB 3VZRA 4F97A 4RDXA 1N7JA 1T1RA 1PYGA 3DR5A 4X1IA 1PI3A 3WMXA 1SVIA 4ATNA 3K1YA 3PHCA 2SCUA 4LYAA 2ZS7A 4PPQA 5ALYA 4DJFC 1F2DA 2BH2A 1VE9A 4MI1A 3OJOA 5DRTA 2PRIA 3CLSD 4WGGA 1KVRA 3OOWA 3B52X 4G1UC 3UT0A 1WE2A 2AOVA 5F98A 2ZAMA 4YREA 3ZGXA 5DTIA 1E5DA 3RFFA 1EKXA 5D3ZA 1AKUA 4ZV4A 1KI7A 5IN5A 1BKYA 2EFEB 4E5KA 5A02A 4DM7A 4JT2A 4C01A 1RP1A 5B7QA 5BWLA 3RSZA 4B3RB 2H29A 2Q5LA 4KUEA 2VCEA 3IUQA 4XM1A 1GSIA 5B2EA 2CFCA 3HJTA 5KYXB 2JNWA 5JYBA 3DHNA 5F9MA 4KRFA 2HSEA 3HLKA 3F74A 5JV5A 4TLBA 4WK4B 2QAGB 3O74A 1KS9A 4QHTA 4JBWA 4TL8A 2IHUA 1JKIA 2ZWAA 3HACA 4XGRA 2CE7A 1SPXA 1CUFA 1X1TA 2FQ1A 4TKVB 5FQOA 4H1WA 3CU5A 3HGQA 4FJ2A 3TR6A 3UA4A 1P7VA 1ZRHA 2WP0A 4AJHA 1JEYB 1KJIA 5EAIA 2PS9A 2XVMA 3UMSA 3U7FB 3CUVA 4O5OA 3ETHA 1NNUA 2G9VA 3ICVA 3NHFA 3U39A 3VOAA 4C20A 5C1PA 3KSZO 1CS0B 2I66A 2PCLA 4FILA 2O0KA 3HY4A 4YP9A 3V9PA 3JWEA 3BIOA 2TMGA 2OSBA 3ZI7A 1HDRA 2OPHA 3EZLA 1YI8A 3EODA 4B4WA 3MBKA 2H4XA 4PLYA 5LYYA 3I9FA 4ZEWA 1OGIA 3LQRA 1QP7A 4BMPB 3K94A 1NV9A 2ORYA 2BMFA 3IIKA 4LOJA 5TMDA 3ROKA 4F45A 5G3ZA 2JF0A 3SC4A 1PEKE 3LZDA 5KNDH 4TMYA 4WNIA 4OOEA 4FD3A 3SEQA 3VVLA 4IZHA 3S1SA 1JQDA 1VP9A 5D5QA 5BSKA 1P5RA 1OGYA 3K1JA 2Y6UA 4GUAA 3VQTA 1G20B 1E7SA 1T2NA 4MVJD 2I2FA 3C16C 1SRQA 1ZG3A 4PQFA 5G53C 4RVGA 1WAMA 1F3LA 1YRLA 2AUTA 4BX3A 2VXYA 4B32A 4D9JA 1SBNE 4MDYA 1ZH0A 4E70A 1SXJC 4MTLA 3QELB 4JS0A 3WB0A 4AICA 3O75A 5AW5A 4JI3B 4C6SA 5F4ZA 2CLLB 3E9EA 4O59O 5CW1A 1WG8A 2QAGA 1YZLA 3F6CA 3IOEA 3VC3A 4BRWA 4CM7A 5B7GA 1P6XA 4JXJA 2P3OA 2Z95A 2O2IA 4FMDF 4NFLA 2LBPA 3Q5EA 4K1XA 4TKVA 1RQRA 1ZGAA 3ZWVA 2HCRA 3S7TA 3WGGA 2OFWA 3CZRA 2XBUA 4LSMA 5KQSA 4M0MA 4N8EA 3B53X 3WGHA 1W1UA 4DREA 4X84A 1W48A 2OQ2A 3I2FA 3PHGA 1DG3A 2CJXA 2D7DA 3DCNA 1I2BA 1E1RA 4NZOA 3TLYA 2XE7A 4LMRA 4D3XA 2ZM6B 1YB7A 1RD4A 1AS3A 2LVBA 3LDUA 4Q7JB 3ZHXA 2JZOA 1EJBA 1O9BA 2P79A 3WI7A 1GGJA 2N47A 1A5SB 1K08A 4KI0A 3CXUA 2GEUA 1G3QA 4XB6B 3V3TA 3BGDA 5F5XA 1J21A 3N0VA 2ECKA 2Q5JA 4Y8VA 3DFIA 4XD7D 3MUFA 3TX6A 4K1LA 5CVVA 5HM8A 2EWWA 1NPTO 2CCKA 1EBFA 2BFEB 1G20A 2P69A 4NJOA 4R8KA 4ZWNA 5JRDS 2FUEA 3REFA 3N2GB 4DIEA 1CJVC 2ZT6A 5F2KA 1YACA 1LS1A 1WXHA 3BERA 4WK0B 3A2MA 5KYVA 5LZ7A 2IF2A 4RZSA 5TT0A 3ZKAA 2IV2X 4D8XA 8LDHA 1CY6A 2C7BA 2WIJA 4RV9A 1T9GR 5F7OA 4JT8A 1IEWA 3QELA 3KWJA 1E79A 5CHYA 5J5VA 1TGVA 1YUMA 3GL9A 4KE6A 4Q24A 5ESXA 1MVOA 4NBKA 2QS9A 1ULTA 1IWOA 4IIUA 4XWWA 5SY6A 2Q99A 1Z63A 4TKUB 3TSYA 4N48A 2NADA 5JEEA 3LPNA 3HKCB 1PW5A 3VDQA 1ND5A 4MVJE 5FTNA 3ULKA 3OY7A 2RG7A 2PZJA 1FTSA 1JW9B 3AEUB 4BIMA 2P0YA 4N5MA 3CPJB 5TQVA 3OIFA 2VDUE 3GV0A 4FKZA 4DL9A 5DCWA 3GCWA 1KQNA 3AOGA 2FGJA 1JSXA 2BL4A 2J9FB 5FUBA 2XIJA 3R23A 1Z0SA 1IEQA 2HSJA 4BEVA 1XEFA 5G40A 2D13A 2F3SA 1LH0A 3OCCA 5GJWC 3LIIA 4INZA 4MEAA 4IBOA 3TYXA 3L8HA 4BVEA 5JU6A 4PNHA 1ZKDA 4PZAA 1UK6A 2BFEA 2CKMA 1Z7BA 2Y1KA 4YRRA 4XXHA 1DKQA 2DERA 3N2GA 1WB5A 4HTAA 4GI2A 1T5BA 5BRJA 7AT1A 1HEIA 4PEVA 3RV3A 2IBTA 2PMCA 3ETCA 1W6RA 2J5XA 2FQYA 3V2HA 1G17A 3F1LA 2I4OA 1HC7A 1PGOA 2Q9AA 3D4LA 3IQEA 2Q62A 2H5IA 4KQHA 1QIJA 4O33A 2IUYA 3H17A 1GVNB 4C1BA 4IDOA 4Y2HA 2PYDA 1ZNWA 3X1DA 4CIWA 5ITSA 4TKUA 1V7CA 3BREA 3ZY5A 1IQPA 1NFRA 1V5IA 1IHXA 2W2VA 3GBPA 3HKCA 3OTGA 3OWXA 3LE8A 3G5TA 4J1NA 4RZIA 3C7DB 3AIKA 3JTMA 4QOEA 1ZX1A 3CLTC 3TSWA 3AEUA 4R16A 1L7EA 5K0EA 3K70C 4TZ0A 1O89A 2BKLA 4W5JA 1IM5A 3IT1A 3I32A 1TYCA 4RKWA 5JR3A 6CHYA 1UJ6A 1KDYA 2JFXA 1T2VA 3BA1A 5F78A 5ARDA 3V2GA 2XDAA 1YCFA 3M5CA 2J9FA 3JQFA 1DO2A 4PYNA 3L4JA 1EFKA 1XEXB 2QTVB 4F9TA 1JXQA 2P9ZA 3F6BX 1V5GA 3MS7A 1GKUB 4DMFA 4YMLA 1ULAA 4IQFA 4GR5A 4N3NA 1PR3A 4CVNA 2JLZA 4M88A 3KUKA 1NATA 4FDLA 1XYYA 4YPFA 3RFVA 2BUBA 1AH2A 4A6EA 3DBHB 4RHEA 1P5ZB 2H0RA 1PR9A 2BCJQ 4IDBA 1ZA1A 4TS9A 1IMOA 2XDWA 3B8HA 2XGMA 3RWBA 4TZTA 1A4XA 2LGJA 3PYMA 1P3Y1 2VOEA 2FLKA 3AKYA 2OQIA 4UCFA 5DGTA 1B0UA 1KY3A 5TQ0B 4PYOA 5K3DA 1FMTA 3EXHC 4PO1A 5I4BA 4OQXA 1NBWB 4XYEA 3B70A 5HMLA 2NUAB 4DAOA 4WBNF 5F7XA 2IH2A 3WWCA 3AGPA 1FFXB 3DZIA 4CKEB 1L8OA 2I4TA 3URMA 1GPJA 1COWD 4U7JA 3I58A 5LKAA 2OO7A 3I9MA 3IAFA 3K16A 3SI7A 3ONDA 2RARA 4Q4CA 3ZOKA 1FLNA 2J0QA 2ZJ4A 3JD3A 3QLVC 1R8XA 2I6GA 3O0DA 4IMRA 2R66A 1E1QD 5LP6F 3Q3CA 5HW0A 3RADC 1GIAA 3KKEA 3D0QA 2XNDD 2ZJAA 5G0TA 4DOMA 4AMZA 4B7UA 3H42B 2ZJ3A 1ZVJA 4I8XA 1J0DA 1E5LA 2YV5A 1XEXA 2QTVA 4POAA 4TMFA 4YV2A 1K3FA 2DQYA 4AP5A 2C2HA 3V1KA 3CVJA 2A0YA 4C0BA 1UT5A 2TMYA 1J2TA 1X7WB 1H6CA 3GLHA 4MGEA 5B7NA 3LHSA 3EZ2A 3VSBA 4F1JA 3EQ2A 3WWOA 1ZD8A 3V2IA 2JI7A 3GAFA 4Z9FA 4YN3A 1MIOB 2XE6A 1KH2A 1GAEO 3DBHA 2WJ6A 2MTBA 4BB5A 1I3MA 2FK8A 1GQRA 4QYSA 1IHPA 3COWA 1K5DA 2JZCA 4TVOA 2IJGX 4PHFA 4E07A 3FNFA 3R6GA 3OM9A 2LCIA 4HWSA 4X3PA 4NZNA 1UBOS 3EFBA 4RKYA 2NUAA 3BWXA 2IDJA 4HXEB 4AJ4A 3HRHA 1XZNA 3ZXXA 1VKHA 4CKEA 2JDIA 1QHHB 4G5XA 3G8BA 1RDFA 3HZZA 2WF7A 5AI8A 2CMHA 4PNEA 2QL7A 4YP7A 1NFQA 1LS6A 2GN6A 3TMAA 5I9SA 3T7KA 3U5ZB 3ROGA 2XKAA 4RHTA 3PXCX 1QORA 5E1OA 3DMNA 3F2IA 5BMOA 1Z0JA 4P08A 4ABTA 5BUZA 3N2ZB 1DXHA 3R7WB 1IUKA 2VHEA 1UBCA 4H08A 2RAUA 3EZXA 3L8YA 3UK2A 2YQZA 1T91A 1V7ZA 2ZSHA 1VFPA 3OZWA 1GZ3A 1KMIY 1PDOA 1PEYA 1Y6JA 2VP4A 3H4VA 3K6KA 2B0JA 3VO1A 1X7WA 1SVKA 5EJ5A 5SYMA 1WEKA 2ANCA 4X41A 3A3OA 2IVFA 1C7ZA 2A1IA 1ADGA 1HDCA 1DQRA 1KO7A 1GA6A 1PQ4A 1Z6XA 4H4EA 3SLGA 4YCAA 1VE1A 4ITUA 3O2QB 4WAUA 1IZ8A 4GXNA 4YFVA 5LZ5A 5C35A 4B82A 1L5HA 3KQNA 1GTVA 3OF3A 2WKSA 1V3TA 4HLUC 4BRSA 4DLNA 5BQOA 3CF2A 3RBXA 4E08A 4YV7A 1RABA 5CH3A 3ETLA 3NV9A 2H4YA 4LRYA 4JI0B 1IEXA 1CR2A 4HQLA 4ZOEA 3PKIA 2YYAA 4KDCA 2HWUA 3RS7A 2WUFA 2J6IA 3DCYA 3W90A 2O14A 3KELA 5EWLB 2XGJA 1QHHA 3M3HA 4IH1A 1YVRA 4M87A 4O4JF 5DNCA 1EVYA 3KR2A 3G2KA 1P1KA 4NG5A 5JBNA 1SKYB 1DJLA 1Y9JA 2C59A 2VHTA 1BJKA 3R6LA 4E3WA 2G6BA 2OXEA 3FWPA 3ISVA 4LVOA 3EA4A 4X00A 2ORED 5EGSA 3SMVA 3ESBA 5HCIA 2XTJA 3R7WA 3GBVA 4GXQA 2IK8A 2R8YA 4EOGA 3I0NA 3V33A 4ARZB 2XZLA 2Y68A 3VPGA 4I81A 1T9AA 1EP2B 1G2QA 1RPJA 1RWPA 1X7XB 1XELA 3L7DA 3GLKA 4MLDA 3VGPA 5BR1A 2HJHA 3SHTA 5AW8A 5A5GA 3EFHA 4JMLA 4Q16A 3DYBA 3UMBA 4CLXA 1MABA 1QGDA 5AK0A 3UWOA 3FAKA 1LK0A 1I3OA 2HJRA 4HB0A 4NNOA 2PZMA 4ZT4A 4D99A 3U61B 1L7RA 2JBWA 1XNJA 1G7SA 3E1SA 4WDQA 5FRDA 4AJ2A 2DWQA 4EHBA 1N8SA 4QL3A 5JSYA 1A5TA 4WD3A 3OE7D 3TK1A 4YRTA 5B3KA 5B58C 3ZWQA 2G1JA 3K9FC 1M6VB 2ID4A 4F5YA 3F67A 4BNIA 3NBMA 3AR2A 3KFLA 2IHZA 2IOFA 1YT5A 1BEEA 1BGXT 2B4TO 3M1AA 1VKJA 1IBKB 2R6ZA 5EWLA 2JL1A 2ZTLA 2NTEA 3BTUA 4HGZA 4Z1MD 1RM3A 4MJXA 5BQFA 3OCYA 2AH5A 2O0LA 1IXZA 4BFLA 1QV6A 4MGYR 2PUJA 3I0MA 3GMIA 4H4DA 3W8FA 5BWBA 2BCGY 4UUBA 2DF8A 2VNAA 4X66B 3IOYA 1C9JA 4LK3A 4P3OA 1WJGA 1JR3A 2D59A 5E6SA 3PFNA 3UAGA 2CXXA 4XLLA 4YR7A 3QNWA 2PX5A 2VNJA 3EDOA 4ARZA 4LXYA 4EGSA 2IHJA 1Z56C 3RUAA 4ZODA 3NBKA 4J3JA 1MO6A 3UXMA 1V8ZA 2FZVA 3SX4A 4YCNA 2PWZA 4BO8A 4AS1A 1PTKA 2BUAA 2DQ4A 3DOCA 4IJKA 3SQDA 3QBTA 1RQLA 3JQGA 4OP2A 3ZK9A 2H65A 3L6CA 3ND8A 5ALOA 5MGBA 3S40A 5G1NA 4OD0A 4OREX 1RSZA 5IW8A 4YCLA 4FDTA 2X58A 1WUHS 4N18A 4EJFA 3HR4A 2F4VB 3RD5A 2QEQA 3BJZA 2CN1A 4BNYA 1ZU4A 4JVOA 5KINB 4IWXA 5DASA 3NAQA 3DHWC 4MKXA 3AI1A 4K9OA 1M6VA 2O6LA 3KQSA 1JU9A 2W0SA 5AJZA 3UGQA 1IK4A 1ONBA 1HYEA 2C2KA 2WG0A 4X1KB 4PCUA 5GONB 2QLTA 3OBBA 4PBSA 1NFFA 2LIPA 2R6HA 4Y2JA 3U9LA 4GOXA 4LMPA 3O94A 2FSHA 1DV2A 1HZJA 3OZSA 2PMBA 2VJOA 1PVVA 4R98A 1DC8A 3K1ZA 3M83A 3ZWCA 1P9NA 5JS1A 4X1KA 2QAGC 1EGMB 4WASA 4YV1A 4LVNA 3LUPA 1W5TA 4BMXA 1GSAA 1YRHA 4UXHA 3HJGA 4O4IB 1O4WA 1EUDB 3IDQA 1TLLA 2ADFA 2YHSA 3T5CA 4BNZA 2BY4A 1R6VA 4Z9YA 4JY7A 3RS8A 5FWNA 4A92A 5FOVA 4IICA 1GGVA 4Q9AA 4U7HA 2HM7A 1BCSA 2W6QA 1YBAA 4U2BA 3ROTA 3ELUA 4C4XA 3QWIA 4N3GA 4UHFA 1CDZA 1I4WA 3ZZUA 5JZVA 2WQ6A 4I1SA 1YZUA 4ZOLB 3O8NA 1U0TA 3CRNA 2UV8A 2NZYA 2FU5C 3MRXA 3FUWA 1H8ED 3QTTA 2CXRA 1H5UA 2P90A 3WGLA 2GEVA 5JAOA 3KSBC 5E2IA 1L4BA 1P31A 3V7UA 1KJYA 4ITRC 2MDTA 2P5TB 4KCGA 3SMQA 2AI3A 1JYFA 3ZD7A 2VIIA 2EKPA 2Z08A 3KJEA 3WNQA 3GP8A 5EZYF 4GVXA 4BIIA 2ZROA 4B1FA 3ANXA 3EVZA 2BUCA 4N12A 5TX7A 1QYVA 2K7ZA 2J3JA 4HEA6 3Q3IA 1U7ZA 2J5QA 2A4MA 2YV3A 2P9EA 3I0ZA 4GYKA 2A57A 1PDVA 1KYYA 4MARA 4YBZA 5HA5A 2QM8A 1EUCB 3CWQA 2PCJA 2Z09A 5DBFA 1SCAA 2C2YA 2PLRA 3TL3A 2POCA 1UINA 2WU0A 2W2OA 4B5LA 3RB8A 5C1DA 1WKBA 3MELA 4EMBA 2YOGA 1N5DA 2X2FA 2QROA 4CMHA 4D9HA 2C2XA 4TLAA 1NUQA 1BH2A 4O4IA 1EUDA 5CXXA 4RIGA 2G72A 3NCHA 2C8VA 3RGWS 4B09A 5AM2A 3L46A 4D5EA 2QTWB 4I6EA 3L6OO 2JCYA 2PUTA 4FQ8A 1JIJA 1V96A 4HAIA 4K6CA 5F3RA 4HWGA 4FONA 5FAKA 3UPUA 3IELA 4HDSB 4Y2QA 4FFWA 3WLOA 3GT0A 2XMCA 3NNNA 4ZOLA 1MA0A 2WVHA 5EJFA 4IYJA 1L5NA 2XT0A 4YRMA 2I6FA 2C4KA 5C7YA 1UQRA 2A33A 2EW8A 2GTHA 5I45A 5EP4A 5KIAA 2Z98A 2I6XA 4UMVA 1V2HE 1CNMA 1O6CA 3A1NA 4RWEA 3LRPA 5JW6A 1GQ2A 3LP6A 1SU4A 2ZRDA 3MWFA 5KDOA 1H3NA 2IRWA 2ACKA 2YYZA 2VKQA 4FQ5A 1ZONA 4PIVA 2JAUA 1QK3A 1NVUQ 4LXTA 3GLIB 4CEJA 3P94A 1TVMA 4EPRA 2NP6A 4EARA 3K0CC 4C5AA 3VV3A 3AKEA 3QHQA 3U3JA 5JBIA 1NOIA 4HVTA 1EUCA 1RMQA 1BROA 2ZJ5A 3OZGA 3OX4A 3BF7A 3FYTA 4GM1A 4AURA 1EEXB 3LT5A 3UHJA 2FE4A 4CTKA 2P2NA 3NVKI 1DXYA 1ODFA 3LC1O 5A7HA 1Q7TA 1ZMXA 2BGNA 1VB5A 1E6LA 3UMCA 3G88A 4EG7A 4QAQA 3VKFA 3QVGB 5G1PA 3M6XA 5CHEA 4CLEA 2HUNA 2YV1A 1UEXC 1CY8A 4C6HA 4PG7A 1OILA 2OFXA 1L8XA 4C4RA 3BQNB 3C70A 4JYCA 4A0GA 2BDTA 2Q7DA 3TIVA 3W5UA 2WKQA 4HDSA 2FOIA 2LCFA 3NRJA 3T1HB 2IEZA 1AZTA 3SSNA 3R5FA 1B6TA 5K8VA 3NT5A 2E6KA 4FYKA 4AG6A 5JWRA 3QFCA 1HE1C 2I33A 2C07A 3ECCA 1HPLA 1AVTA 1VECA 4IHJF 3UB2A 4UBKA 3Q3JB 1BOOA 5JNTA 5C5DA 4FFPA 1Z33A 2W6ZA 1L5OA 1LDGA 1VGQA 3B7PA 4S0XA 3MQFA 3TLBA 3W3AH 3GLIA 3KB8A 4MGHA 2OHFA 5H59A 3EIEA 1JDPA 1WPXA 1QUFA 4LJ7A 3K73O 4N8DA 2HF9A 4DA9A 3X1ZA 4RTRA 3NYRA 1AMUA 1RAFA 3STWA 3OLWA 3JALB 4KGVA 3OIGA 1EGAA 5L3ZA 1EFHA 4RH1A 2IELA 3SHOA 2I6UA 4Y98A 3DNPA 2HA5A 3QVGA 3TMYA 3QTBA 1XTJA 3OECA 4XD7A 3O0TA 4RNDB 4BP8A 2XEDA 1A97A 1RLMA 3AFHA 3QEMA 1QJ4A 5K1ZA 1N3IA 3WIDA 1RC0A 4IRMA 2KI5A 1FSFA 3OM1A 1PQUA 1UIMA 2X3UA 3IO5A 1OFHA 4J2TA 4TWBA 2OHVA 3UUWA 2FPMA 4ZN6A 1MOZA 1TVCA 3GP3A 5BR7A 5JUWA 2FGKA 4KXQA 3CNNA 3GRUA 3N59A 2GBFA 4GLLA 1POWA 1I2AA 2QBYB 4UD2A 4KK4A 4UHHA 1QPBA 1T9CA 1X70A 2IOHA 1OZHA 2GGSA 2PGIA 2QUAA 3EF1A 3GQVA 3KB6A 3NHSA 1CRWG 5H16A 4N47A 4YP5A 5FPTA 5A4AA 1BS2A 1QBGA 2W8ZA 1MJFA 1H1LB 1QYXA 2V8BA 4IVRA 4LPKA 4EEKA 1EUYA 2VHUA 5KSPA 4X62B 4C2UA 3E8SA 3HI4A 3WGNA 3S8YA 1M1ZA 3MJHA 2PJDA 3NNDA 3KC2A 4CRWB 4MH0R 2BKXA 3QEBZ 4XYMA 3VDRA 1BVUA 4U7PB 1NQOA 2GEBA 2AFHB 1VJGA 1QHNA 1WHTB 2BJHA 2W2NA 5PNTA 4D8TA 4E5NA 4MP8A 4PG8A 7MDHA 2AUNA 3NHBA 2B7BA 3MJ4A 1KEPA 1V1JA 1CUHA 3E23A 2OZPA 4I6GA 4RXUA 3AHJA 4R9NA 1HGXA 5TDHA 3QXXA 2B8NA 5HJ2A 1Z39A 3OIVA 2CZGA 1R6XA 4H60A 4Q47A 4ADSG 5EJGA 2Q2QA 2QD2A 4GBJA 4PC1A 1LLQA 3H11B 1E2NA 2AX4A 4HGYA 3ZTTA 1NP3A 1FK8A 4JBHA 5M29A 1XMOB 5BSGA 1C3JA 1OI4A 2RSLA 3ND9A 4P5EA 2QBYA 2AC7A 3C4JA 1PQWA 3M5DA 3Q8KA 4ER5A 1XLUA 1DPGA 3D4PA 1NDQA 4XIGS 4YRFA 4IWYA 5ALPA 5CG1A 3GWZA 1CQZA 4GECA 4Y9DA 1FLDA 1DX6A 3IBSA 1ECJA 2R62A 2WJAA 4KVFA 4YAEA 2IZ5A 5KYNA 2ZRBA 1DC5A 2Q5IA 4M8KA 4R51A 4DIDA 2SHKA 4OJKA 2ZPUA 4R8RA 3H5RA 4EWLA 5JFOA 5KVAA 1E5QA 3KT6A 2GJKA 3I6IA 2JI4A 2G5TA 4B2IA 3U3DA 2Y1CA 2AFHA 4G63A 5HEKA 2H08A 1T26A 1WHTA 2NTJA 3HS3A 1RC8A 4N7JA 3DDHA 3IAUA 3DEYX 2F00A 4OK5A 3R76A 4EW1A 4XRGA 2GLXA 1KZ7B 5JRJA 2AJDA 4WZZA 1LDMA 4MUNA 1JYEA 2OO5A 3FDXA 1TIKA 2VQDA 3HB7A 1KDPA 1KR2A 3CIOA 3QK7A 4LJ6A 1TTTA 1JRLA 2PLAA 4NICA 1WTCA 4A9AA 2QRJA 1QAOA 3FGNA 4G5FA 3ZU3A 1QF7A 3AJ8A 3H11A 3QNUA 1Z6PA 3UATA 1NF8A 3VKUA 3I61A 3ZGNA 4BPBA 1L5YA 3UJ3X 1JFVA 3ZWDA 4JSYA 2K2QB 3OA0A 3AFMA 4AJLA 4YRNA 2XCQA 5AJTA 1YTLA 1BU8A 2EP8A 5LXTF 1GTMA 4RMJA 1JBEA 3AR5A 4IIHA 5CFQA 1SELA 3PU6A 3CURA 5C0OE 1ZGCA 2WM9B 1COWA 2CL6X 2IYEA 4OYHA 2VPXA 4AB1A 2P41A 1QP0A 1JEDA 5M7EA 3V4VB 3CV3A 4GSKA 3G5MA 3UT6A 5LKRA 5DW3A 2OOSA 1P29A 2OWEA 2COKA 2L19A 2LDXA 4JFAA 1E1QA 1HH4A 3PUHA 1ZM2A 4PYMA 4ZO4A 1L1FA 2XNDA 4MB2A 4ZCSA 1NW3A 4Q7EA 3L7AA 3FZEA 3FA2A 2YWBA 4CG1A 1XB2A 2ICAA 3PENA 3MMXA 4B47A 4M0LA 1HZZA 4PSUA 5EXSA 1XMSA 2Z9BA 3ZI4A 3V1TC 2WJJA 4B9EA 4MPPA 5DOZA 1C8LA 1SUSA 4LDZA 4GEGA 3NVMB 5TEVA 1MX1A 1FYVA 3FIJA 2HIMA 1WOMA 4PSDA 2H2HA 4PSKA 5HF9A 4B2LA 1XJ5A 2W42A 1HDIA 4WOBA 5DRYA 2PIDA 5IT9A 3GUVA 2EV9A 3VPFA 3ID6C 1KZHA 3B85A 3RIMA 1BE0A 2AC2A 2D3TA 2WABA 3ABQB 3HABA 4LY3A 1QSGA 4P86A 3ABZA 5JY6A 4RCZA 1XTIA 5BSMA 4Y6PA 3DM9B 3LBFA 1DGQA 4HLQB 2BRUA 5FA5A 3EVGA 2IZ6A 2JFOA 4M1SA 2M98A 3HA2A 1JQBA 2ZKIA 3U62A 3ZHUA 5HRAA 2AZ4A 5C8YF 4MP3A 1D8AA 4EF5A 2MMGA 4HS4A 4MUBA 1K9SA 5IJAA 3TTSA 4A73A 3CIFA 2UAGA 2R60A 5B58T 3VISA 5KWJA 3ZJ4A 1M7GA 4UXJA 1TO2E 4LKOA 1CHNA 1GG5A 2WNHA 4JNKA 3ZY3A 1ZCBA 5EMMA 1O97D 1TJ5A 2HADA 3P5SA 5E4YA 4QBHA 5C4IA 1CW2B 5AQ1A 2ACEA 3GRFA 1PJZA 2B92A 3GROA 3ZDRA 2B7LA 1VKRA 2CXNA 2EW2A 2Q49A 1EBBA 2R11A 3DZCA 4HCJA 4NPCA 5CDFA 1ZMOA 3PDIA 3ZCQA 1G5IA 3RWOA 2A9VA 2DT5A 5IC4A 2JJQA 4DQLA 5L3SB 1OLOA 3NEJA 3UB4A 3DUWA 4FM9A 4L8GA 1KETA 1Z06A 3PITA 4KXLA 4P7KA 5THXA 3V4RA 3DGEC 2VDRB 1YDGA 5KYWB 2OL4A 1YQEA 2DVMA 2ZANA 1VCIA 4DNOA 2HMYB 4DPMA 2PGJA 2XODA 2G8NA 4JBYA 4ZOAA 4F2WA 2WHEA 5J5AA 1R1DA 3X0DA 2HQBA 4HYYA 4AQDA 4QKQA 1EHCA 3BSYA 1TQ4A 2KW5A 4L8YA 4M1MA 4B79A 2JJ2D 1WHSB 3OURA 4NQRA 2NPIA 3I45A 2ZXFA 2I3GA 4EB3A 2C5FA 3RRNA 2QVLA 4DLTA 4AULA 1G9XA 2G4LA 3W6OA 1EWVA 1QIIA 2D4HA 3HNRA 1L4EA 4MULA 3SFVA 4CT4B 4XH9B 1NT2A 3CGGA 3RYHA 1NUPA 4IF4A 3A3PA 3NW9A 2N1MA 4CWAA 4C1NA 4TWJA 1IATA 2FUG1 3ZDEA 4N76A 3FTFA 1RU3A 4JI6B 3FPCA 3UBMA 1EVLA 1DBSA 3U56A 1U31A 1EBUA 4QLAA 2G7ZA 2YJ5A 2YY7A 5L3SA 3E2PA 3TG2A 2HY7A 4P33A 4YQZA 2HQRA 3Q7SA 4U6SA 2Q5EA 3COJA 1VFNA 4M0UA 3SZMA 3PR2B 1H1DA 1JXMA 4M86A 5KYWA 1MAHA 1P4JA 2WWTA 3AY6A 2I7DA 3CLSC 6YASA 1TYAE 2PKQP 1XIVA 2QJFA 2WILA 3P0JA 2CHQA 3LM8A 3PGA1 2Q8NA 3FF4A 3LY9A 4X92A 1UZAA 1KRHA 5JCJD 3OE7A 4JJIA 2F8LA 2J59A 1XVAA 3QMWA 2FZGA 2HHJA 1T5TA 3K96A 3NORA 4MRVA 4WUTA 3N6RA 5DN9A 4CCWA 5M34A 1FU8A 4OQLA 4EYOA 2AJBA 1MH9A 4XFDA 1WHSA 2CNKA 4PIMA 4HNQA 4V0QA 4X54A 3HYLA 4DXAA 4MVJM 2QMEA 1USUA 4G9GA 4TTRA 4OQZA 2QTRA 4F2DA 1EX9A 1NURA 4QOFA 4Z1MA 1S0UA 3FR7A 4BYMA 4NBNA 4C6TB 2QN1A 4L85A 6REQB 4WOPA 4I2NA 4KN6A 5FBWB 2G28A 2FPUA 3G0IA 1TCUA 5HZGA 4UMFA 1EUQA 1JEAA