4X3TA

Crystal structure of chromobox homolog 7 (cbx7) chromodomain with ms37452
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
b'HMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 13
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4x3tA00
1NAPA 2FFKB 2L12A 2K05A 5JJZA 1ILQA 4NW2A 3H91A 2EOTA 5EQ0A 2B2TA 4X3SA 1J8IA 1QNKA 1U4LA 1U4RA 1HUMA 1Q3LA 2L9HA 3F2UA 4ZLTF 1PFMA 3FPUB 2MPMA 1RJTA 1NR4A 2DY7A 2RSOA 5D65A 1BNZA 2VXWA 5E4XA 1DOLA 2K1BA 4O42A 3I91A 1GUWA 5E4WC 3Q6SA 5CMDA 3I3CA 5EPKA 1IKMA 1EQTA 1HFGA 2L1BA 2BDNA 4HSVA 4X3TA 1ILPA 4HCSA 1BBXC 2B2UA 2L11A 1MI2A 4ZKCB 1EL0A 4HEDA 4ZK9B 1HUNA 5D14A 1M8AA 2IL8A 3I8ZA 1KNEA 2RVLA 2B2VA 2B2YA 2M2LA 1HFNA 1SDFA 1PFNA 4XT3B 2X6LA 1B4OA 1B50A 1HRJA 1XYIA 1MSHA 1U4MA 2KEDA 1O7YA 1JICA 1F9PA 2K03A 1RODA 2K01A 2NYZD 2NZ1D 1BF4A 4HAEA 2K04A 2H1EA 1MGSA 3G7LA 1WTRA 1O7ZA 1CA5A 1TVXA 4CJ0B 5EKIA 2DY8A 4IURA 4QUCA 1F2LA 3KUPA 2KEEA 1DZ1A 1NR2A 4RAUC 4XDXA 4U68A 4OIKA 4IUTA 1PLFA 3FDTA 4RWSC 2KOLA 1WTQA 1RTOA 4MHEA 5AFWA 5COYA 2K28A 2X6GA 4IUPA 3ONAB 3IL8A 4DN4M 1EOTA 2FJ2A 1J9OA 4IUQA 3DM1A 3DEOA 1WD1A 1B53A 2B2TC 1WVLA 2B2WA 1RHPA 1QE6A 1WTOA 3IFDA 3GV6A 1HA6A 2JYOA 2KECA 1C8CA 1PFBA 2HCIA 1WTXA 1ESRA 1S4ZA 3R93A 1X3QA 1LV9A 1XX8A 4ZAIA 1CA6A 1F9RA 1KNAA 4IUUA 2N55A 2N88A 1G2TA 2CVRA 2MP1A 1ZXTA 5EPJA 1U4PA 4ZKBB 4IUVA 5CBEE 2KUMA 3D6WA 2B2UC 4CJ1B 1A15A 1IKLA 4R9WA 1DOKA 3LWEA 1ICWA 2HDLA 1G91A 1VMCA 3DEPA 5DNFA 5EJWA 5EPLA 2HUGA 2RSNA 2B2VC 2B2YC 1WTPA 1B2TA 3TN2A 1G6ZA 4XT1B 1AZPA 1F9SA 1B3AA 2J7ZA 2SDFA 3GV3A 1ML0D 1WTWA 3I90A 1NCVA 2FMMA 1SSOA 1X3PA 2NWGA 4X3UA 1DOMA 1O80A 2FINB 4UAIA 2MGSA 5T1IA 4CJ2C 1PDQA 1EIHA 2FHTA 1AP0A 1HHVA 1EIGA 1MSGA 2D9UA 2R3ZA 4LMQD 3HP3A 5T1GA 3TZDA 3SVMA 3MTSA 2EE1A 2HDMA 2L4NA 2X69A 4OIJA 1JE4A 2HCCA 2Q8TA 2EPBA 1DONA 4RA8A 4X3KA 1WTVA 2MJ8A 1G2SA 2KVMA 3KBXA 3N52A 1F9QA 4MN3A 1WD0A 1BO0A 1IL8A 1SAPA 4QUFA 5CBAE 4R8IA 2JP1A 3QO2A 1RTNA 3P7JA 1VMPA 1CM9A 2RA4A 5CORA 3UI2A 2B2WC 2XIWA 1AZQA 3MWYW 1X32A 2Q8RE 1E0BA 1QG7A
chains in the Genus database with same CATH superfamily
1NJIC 2F4VL 3H91A 2EOTA 2NVXH 1QVCA 2JA6G 2IY5B 1S5BD 1EFID 5LMUQ 2E5LQ 1PFMA 1K9MC 2MPMA 5IP9G 3G71A 2DY7A 3J81j 3Q24A 3CCEA 4NXML 4JI0L 4FF1A 3URYA 5M3FB 2K1BA 3I91A 5E4WC 3G6JB 1TS4A 4DUYQ 4X3TA 5EKKA 3D4RA 4DV2Q 3W3AA 5K36G 5FJ8G 1YJWA 2FMCA 1PZJD 3HOUB 1L2FA 3KF8B 4A3BB 1PMRA 1Y1VH 4OXPA 3H3VH 1SDFA 4A3IG 2HHHL 3D6CA 2IX3A 4DAYB 3CCVA 4XYQA 1KDBA 1V1OA 2SNSA 5ELEA 4DNTB 1D5ZC 3I70A 1SYFA 2HT1A 1E1OA 1XWEA 3CPWA 1TWFB 4ZRZA 4YCUA 3S2HH 1QJOA 4DK1A 2OTLA 1WVLA 1RHPA 3RMHA 1YNJD 4X62Q 1N32L 4JI1Q 1ESRA 5M5WB 1XX8A 5IGDA 1H9KA 4UY8C 1BQQT 4KK7A 1FNWA 1LABA 4YWLA 2PO4A 2LKVA 2ZM6L 2HD3A 2KCNA 2KUMA 4HN7A 3P75A 3HOXB 2J4XA 2F4IA 3PIP3 1SFOB 3C1EA 4H7BA 3J81E 1Q8KA 3R2IA 1ESFA 5IGGA 3IRBA 4C3JG 5LL6X 1D8LA 3NHHA 2YTYA 1D1IA 2K7VA 3RLNA 5CV8A 1CQVA 3ZJYC 2NWGA 4G57A 1JMCA 1RL2A 3BS1A 4A3KH 3L9AX 3I4LA 5I2XA 2E2JH 1JC7A 2HCCA 1TWGB 5J22A 1S3OA 1PHJA 1WTVA 1G2SA 5C0XI 3G4SA 4G4KA 2HIXA 5HY6A 2EY5A 4HTHA 4RFBA 5KNDA 1X3FA 1S72A 4JI6Q 3NWSA 4DAVA 4KHVA 1QNUA 2A68D 2Z0SA 4DV0Q 4HIKA 2QEXA 3MWYW 1CFMA 1YBYA 2FFKB 4B3RL 4R8NA 3DXJC 1CTMA 1VQJA 4IFDJ 3PUXA 3E5SA 1XTDA 2EYJA 3UDGA 3V96A 3KLSA 5IE8A 2R92G 2E2IB 5EPKA 1Y1WH 1ILPA 2WB1B 4RCNA 2LXKA 4ZK9B 1EY8A 3NSWA 2UUAL 4UP7A 3HKZB 4QCLA 4DF7A 2F3WA 2K5NA 3JC66 4WJWA 4C3IH 4MZ9A 3IKJA 1KC8C 1LO5D 3U4ZA 3K80C 3S14B 2RDHA 4WFN3 3LNNA 4ALPA 3HOZG 2OTJA 3KYHC 5EBDA 5GAHC 2NTTA 4DAMA 3Q8DA 2GA4B 5LMUL 2EYOA 2E5LL 1TR5A 4BBSB 2CKZB 3OW7A 1T5EA 3IAYA 1WTXA 3PO2G 1CKMA 3BVMA 4DKAC 1VQEA 1TWAB 1NSNS 1HNXL 4DR5Q 1VQDA 1IYUA 5JOBA 3J7ZC 2E74C 2K75A 1N9WA 4QIWE 1B3QA 1JOOA 2K5HA 4JPBW 2AWOA 2M9VA 2JA7H 1EY9A 3QIAA 4UP9A 3Q22A 3SVMA 1BCPD 1PH5A 2ICIA 1BVSA 5CGKA 3K5OA 1PDQA 1Q1BA 2XN9C 1JORA 2Z6BA 4JV5Q 1K0RA 2MQHA 1LLRD 2DJFC 3TS2A 3C46A 2F3IA 3A74A 1MJEA 3SK8A 3ZYYX 3T1YQ 3LWUA 4Q5VA 2SOBA 5GQOA 1BO0A 1SE8A 1YNXA 1NTGA 2D0PA 4A3JB 4JI1L 5C6AA 1VDZA 1X32A 2PMZB 1E0BA 3SK4A 1J8IA 1FVIA 4TSSA 4OELB 4P72A 3C2PA 3ITPA 1U4RA 1GUSA 4A3FH 2ASBA 3F2UA 4GN4B 1SROA 3M3YH 3QWNA 4H13C 5D3DA 4LNQA 3U50C 4DK3C 4K5WA 1N36Q 1HFGA 4C2MB 3S15B 2HIVA 2QKIC 1KIXA 2TMPA 1I3QB 2KHSA 3AQQA 1EL0A 1BOSA 2A69C 2F3VA 2IX0A 2JEAI 2M00A 2B2YA 2M2LA 2OQ0A 1B50A 3KF6A 1K0SA 3CF5A 1SNDA 2RBMA 1B7YB 3PMFA 2BH2A 4IFDG 3RLFA 4NPSA 4LF4Q 4A3KG 1V9PA 2I5MX 4HJ5A 3OPOA 1PLFA 4JI6L 1WTQA 1ENFA 3SXHA 4OX9Q 3SE0A 4DV0L 4JCVE 3GTMH 2H5XA 3NBIA 3IL8A 4JI7Q 1SN8A 2RCFA 1HZ9A 2B2TC 3HOVH 1SNOA 3QG1A 1CZGA 4LJZC 1AFPA 3RR5A 4BA1I 5FKAC 1XTCD 4NMZA 3BU2A 5I6YA 1L1OB 2F1MA 3S2DH 3HOWH 3ULJA 3D6WA 1ZKOA 4UPAA 4BY7B 2LY7A 5L37A 4BWGB 2R7FA 1N8RC 4KV6A 2B2VC 1Y1WG 1GHJA 4A3GB 4LFCL 3TRZA 4KKUA 1SSOA 4JI4Q 5FLXE 4HJ8A 4MTKA 2P5ZX 1VQ5A 1SNCA 1K3BC 2EE1A 1UEAB 1I50H 3J81i 4FXGC 2K5QA 4RA8A 1AN8A 4C3IG 1TS3A 1OTCA 1ONLA 4BY1B 1HNWQ 1STEA 4LFAQ 1D1KA 3NQTA 1TS5A 2PQAA 5JJKA 2NB0A 1M4VA 3DHQA 4C1NK 5JJZA 2YU9H 5M3MB 1U4LA 1EY6A 2ZTCA 1RDPD 1TY2A 4DR5L 1HUMA 2L9HA 4ZLTF 3MC0B 4ME3A 5DM63 1GHKA 5J3BA 4TRDA 2EIFA 4R1JA 2IWHA 3MFYA 4XIGS 2F0OA 5M5YH 1EQTA 2YYZA 1FNUA 5CYUA 5FO8B 3KK7A 3BVZA 4A3LH 1S5FD 4J15A 1OO9B 2IT1A 4JV5L 4RG1A 2JA7G 3F8TA 3FRPB 2F0GA 3PUYA 1B4OA 3RD4A 3HKSA 4FF3A 1MSHA 1JICA 1W6KA 4C3HG 3A7AB 2VQEQ 3T1YL 3G7LA 2OQKA 4X6AH 3TZUA 1X65A 3OIPA 2EYFA 1Q46A 1PFSA 1SMYD 3S17H 1WTHA 3GO5A 3TMEA 3PIPA 2WINB 3EJIA 5KNCA 3VYTA 4Y7NB 3FKIB 4FXDA 2OEOA 3IFDA 1LT5D 3CU7A 1PFBA 2NVYB 5BN5A 1H9JA 3T53B 1SE3A 1BDOA 3MXPA 1N36L 1H9SA 4AYBB 1F2MA 1P8LA 2JXMB 5M5XB 4QL5A 3LWEA 2JA6B 1I5FA 4Q0FA 5C4XH 2D5DA 1B2TA 4Z9CB 2K52A 3HOYB 4FO2A 1B3AA 1KTKA 5CV4A 1WTWA 1NCVA 5T1IA 4LF4L 4YWMA 4PZ8A 1BR9A 5LMNQ 2CHBD 1IBLQ 1L0XB 5T1GA 2SEBD 1GVPA 4OIJA 4EQ5A 1IBMQ 3RLOA 4OX9L 4A3IB 2HQEA 2CWPA 3I4NG 2CW0C 1TWCB 2O5JC 4JI7L 1SAPA 1CI3M 3X3NA 4I7ZC 3E9IA 4CKCA 1PZKD 4POFA 1C4QA 1FR3A 3K57A 2PPBC 2QF7A 4OWTB 2B2WC 2XVSA 3SHLA 5C44H 1SE4A 1K28A 1QG7A 5EQ0A 2AQ3B 2L0CA 3HOVG 2QEJC 3U9OA 4ODGA 5JEAH 4K5XA 1LTAD 4PG3A 2HQLA 4L63B 1SYEA 3VR2A 4HIMA 3DWAA 3KFUA 4DXGA 3QB3A 3I3CA 3HOWG 4QQBX 1OXUA 4CHTB 2F52A 2L11A 2F0KA 5G3LF 1VQNA 1BCPF 3NPPA 1VF5C 5IODA 1VF7A 2KCTA 3A55A 4BBRH 4C3JB 3ND9A 1HNWL 4LFAL 1IW7C 2A69D 1FNVA 2RDGA 1A3VA 2KOLA 5JPMC 5JEAJ 2NN6I 5AFWA 2XGTA 4DN4M 2JJQA 3CKIB 1TKWB 1J9OA 1PVOA 1WTOA 1YHQA 2JN4A 1LT4D 2MO0A 1PYWD 1EYCA 3T51B 4KJNA 1PYSB 1CK1A 1Y14B 1XMOQ 1A3UA 4EQNA 5CBEE 3K5LA 4MTNA 1IKLA 4R9WA 3G6EA 4X66Q 2F0HA 1I4GA 2DNCA 3DEPA 2QW7A 1F77A 2KA7A 2RSNA 4OWXB 1PH8A 2C9OA 3CQZB 5C5MA 5C3EH 1JE5A 3GTPB 1WFQA 2UU9Q 2R92B 4XQNA 2VQEL 1LTSD 4A3LG 4DR6Q 2NVTB 3TS0A 1EIGA 2D9UA 3HP3A 1YJNA 4AIMA 2A6EC 1B1ZA 1GD7A 2A5HA 5IYBH 3VA7A 2KJXA 1VQFA 2KVMA 4DUZQ 4DV7L 1X55A 2NZOA 3RNUA 2RKSA 1JWMD 3K7AH 5C3XA 2QGQA 2N8NA 3S1RB 5I6WA 4I7AA 4QJFA 3I55A 3UI2A 4DV4Q 2F0WA 1BBUA 2K5WA 1PTOC 3GTOB 5IYDH 2K6AA 4JBKA 3QR8A 3KLSX 3I4OA 2Q2HA 4L6TB 3X3MA 5ELFA 2B2TA 4IO9A 3H3VC 3S1NB 1WYDA 5IY0A 1JR0D 2RSOA 4TQUS 1I4QA 4RH6A 3EN2A 1A8VA 1VQMA 4LUVA 1BUVT 1STHA 1BCPB 2GVAA 1M1KC 2NVXB 3P20A 3TDQA 1TIID 1WCMH 4P2CB 2B2VA 2C5CA 3B6YA 5KIXA 2KEDA 1IBML 2R6GA 2JA8H 1TWHH 1I4HA 4X65Q 3T1HL 3KF6B 3E9HA 2A6HC 1UEBA 4XDXA 2UXBQ 1G291 1GOZA 4L5TA 4B08A 1PTOH 4B3MQ 1DCZA 1ET9A 4IUPA 4OONA 3T16A 1UE5A 3MXGA 3CCJA 2CQOA 2A8VA 3DM1A 3I56A 3CC4A 3OWEB 3I4MH 4FF2A 4IOAA 1A62A 1OXXK 1IZ6A 2AHOB 1E7ZA 3OWFA 5IWAQ 5C44G 1C8CA 3GTGB 1N34Q 3T4AC 3OIQA 2VY3A 1JJCB 1KNAA 5JEAG 1YHAA 4GKKQ 1A15A 4A75A 2WV6D 4O1NA 3BYTB 3SGIA 5C4JH 4GLAC 5M3FH 1N33Q 4F87A 4OO1H 4JK1C 4ZYSA 1ML0D 1X3PA 1PYBA 4CJ2C 2VUMB 1HTLD 1B70B 3CCQA 1SR3A 1XNQQ 3HOUH 2V4DA 5FLMH 1JE4A 1HZAA 3H0GG 4BBRG 1LT3D 5KYIA 1Q8IA 5DLQE 3J80E 3F1ZA 4A3MB 5IGEA 4M8AA 4RHSA 1PH3A 3O13A 5TSSA 2N3SA 1CUKA 2JP1A 1AE3A 3QO2A 1A3TA 2RA4A 2Z6KC 5KNBA 4ZCKA 1EY0A 1NMGA 4B9XA 4XTCS 1CHPD 4YHHQ 2YTVA 4JOIC 1TWFH 2D2CC 2PQAB 3HGBA 4NW2A 1XMOL 4KHPQ 2CW0D 3FPUB 1R9TB 4X66L 4RGOS 3AU7A 4R4IA 2Q2TA 5M5WH 4LF7Q 4HSVA 2TSSA 2UU9L 3F2BA 1PZID 1MI2A 4ZKCB 2ZJPA 4DR6L 2WAQE 1H9RA 4RMFA 5J1ZA 3HOXH 1X56A 4I65A 1SFOH 2PI2E 1YIJA 3CRLC 5C3EG 2X6LA 2Y0SB 4LK1C 2BE5D 2G5DA 2L5TA 4DR1L 4DUZL 3HRZC 4S3SA 1HQRD 1Y69U 1HCZA 1LUZA 2MNAA 4QUCA 4K2KA 1NR2A 5IYCH 1PRTC 4U68A 5LHY1 4ZUIA 3CCMA 2QDBA 1DYQA 4GLXA 4DV4L 5IYBG 4MHEA 5FO7B 4KY5A 2X6GA 1CKOA 1EFWA 1TWGH 4LF8Q 4APVA 4DR3Q 3WWVA 1WD1A 2B2WA 1XMQL 2EYMA 4IUNA 3GV6A 5IYDG 4A93B 1HA6A 3K0YA 1IYVA 1TU2B 1S4ZA 3UE1A 1X3QA 2ICEC 1LV9A 2PNHA 2EYLA 1AEXA 3D4WA 3VR6A 2B63B 1H9SB 2LSSA 2PZUA 4OGQC 2A73B 1CSPA 4L8JA 4JI8Q 3TN2A 5IT9E 1SNQA 3L7ZC 2E2IH 4DR7Q 5M9OA 1B9NA 3PUWA 3ER0A 4X65L 5ELNA 1O80A 2F0VA 2FINB 1WCMG 4JI3Q 1Q12A 2JA5G 2FHTA 1AP0A 5ELDA 1LT6D 4DV6Q 3CPFA 2UXBL 3J81L 4DUYL 4WJ4A 2E8GA 4G7HC 2JA7B 4B3ML 1DONA 4P75A 4DV2L 4AQYQ 5HGTA 2L15A 4A3EB 3GTLB 5K5PA 5CBAE 5C0XH 4C3HB 4EGVA 1YI2A 3P7JA 4DNRB 5IWAL 3J81c 2I46A 1N34L 5G3LD 1ICWA 4KLKA 2Q8RE 4KHZA 1HUNA 2A6ED 3I4MG 5CC4A 4X3SA 1X3GA 4GKKL 1Y1VG 4IALA 1ZYRD 5IGBA 3CMAA 2F0IA 4PMWA 3GP7A 4LWCA 4BBSH 1J6QA 4A3DB 4L5QA 1UE7A 3S16B 3N6RA 1N33L 4DV1Q 1CKNA 1TWAH 1GM5A 1KLUD 1SNMA 4HCSA 1BBXC 1KABA 4X62L 1XPOA 5LMNW 5D14A 3CC7A 4LF5Q 1CSQA 2IL8A 1KNEA 5IOCA 3D4DA 3NBHA 5M3FG 2ZXOA 5C0XJ 2UUBQ 4OO1G 3SK6A 2IX1A 3PGZA 3TREA 1RODA 2KBNA 1EIYB 1BF4A 2K04A 3VYSA 3CCSA 1CA5A 1QUQA 5IP7H 1XPUA 1STNA 5FLMG 4OHJA 2LS01 5A2QE 3NEMA 4BA2I 3BZCA 1VQ8A 4IPGA 5FO9B 4YHHL 1EYGA 5E7NA 3ERSX 3SDZA 4Y52H 5FOBB 4KHPL 3I4NB 2XSCA 3OYYA 2WIIB 2KECA 1PH1A 4A3JH 1Q82C 3PO3B 4JW0A 1VQAA 3GTMB 2EY6A 4R4TA 3L0OA 4ZAIA 4IN3A 4KTAA 1TT2A 4LF7L 4IUUA 2MP1A 1KDCA 1D2BA 3RN5A 1PV4A 1Z6HA 2EVBA 3K81C 3WDNA 2SNMA 1QVFA 4QGUA 2HUGA 1L1OC 2PW5A 2R7ZB 3MXUA 2J7ZA 3GV3A 4C2MH 2UXDQ 3S15H 2N49A 4UAIA 3HOXG 1I3QH 2B29A 1EU4A 1GJXA 1R4PB 4LMQD 3MTSA 2X69A 5KYLA 2EPBA 3A0JA 1HNZQ 2KHIA 5IYCG 2MO1A 4R8IA 1UAPA 1Q1EA 1VMPA 1CM9A 4ZQ3A 1JOQA 3S9WA 1E1TA 2XNAC 3J7YW 2GN5A 3A8JE 3U58A 5EAYA 4KY7A 1EQQA 3RZOB 5CR3A 1EEID 2R93B 3AYHB 3J80i 4C1NI 1B44D 2WB1E 2QDLA 3Q6SA 5CMDA 4YY3Q 2MUYA 2Z4HA 4DR7L 1W3SA 4J8QA 1F2YA 1T5XD 4JI3L 3A56A 3A5UA 1M8AA 3CCLA 4H44C 4DV6L 2RVLA 1HXYD 3ULLA 4BY7H 4KKTA 5GAGC 3HKZE 2I0QA 5JJLA 2O5IC 2K32A 2EYHA 1EUJA 5I4DA 1F9PA 2WB1G 4NKLA 3VA5A 4AQYL 3NXWA 4HAEA 4BXXH 1STGA 4A3GH 2RHSB 5AJ3Q 2XWJB 3RUZA 2AQ2B 3E0JA 1KQSA 1F2LA 3KUPA 2KEEA 4RAUC 3GTJB 1HZBA 3W2DA 3MEFA 1HA5A 1RTOA 2R61A 2G9HD 5E3FA 4B3SQ 1NNXA 3CD6A 3GTQB 2ENBA 4J1MA 5C0XG 3NQIA 1EY4A 3BVGA 2Z6KA 1VQPA 3U4VA 1HR0Q 1Z47A 3UDIA 4HJ7A 4JOIA 1IYJB 5IIFA 1EWCA 1GXDC 4FP5D 1Y8PB 4BS9A 4YIJA 4DV1L 1QILA 4DR4Q 1CA6A 1BXTA 3E6ZX 3FPPA 4X64Q 4ZKBB 1CT1D 1PH9A 5M3MH 4G7ZC 2B2UC 2KENA 1IHZA 1OXVA 3PIO3 4BBSG 3TP7A 4LF5L 4GN3B 1VMCA 2ATWA 2K5VA 2UUBL 4CDCC 2FXQA 1G6ZA 3GTKH 2SDFA 1VQ4A 1H95A 4X3UA 4DV5Q 4CDFC 2RF4A 2XTIA 3TZDA 4GOPC 1SJHD 3F2DA 4M1UB 4HJ9A 2JEBI 4B9WA 5HURA 2EDGA 4A3FG 2R7DA 1JB3A 3KBXA 1O78A 3EROA 5FLXL 4QY7A 1V8QA 1XJVA 1OXTA 2PMZE 1HH2P 4GN5A 1VQIA 3I8ZA 1W6JA 1PA6A 1VS0A 2YTXA 4A3CH 2E2HB 1ILQA 5FLXc 1I6HB 1I4PA 2EXZA 5I9OA 4Y7NH 2ZTDA 4PNYA 5FK9C 3FKIH 1KHIA 3KJOA 4ZUJA 1Q81C 3I2ZA 3KDFA 1K83B 2NVYH 3TP6A 2JA9A 2UXDL 2F0MA 3A8IE 3D3RA 4ME5A 1SXTA 5M5XH 3K59A 2F03A 2ZXPA 2LMCB 1U9RA 1HRJA 3KJPA 3S1QB 2DNEA 1G6PA 3UDFA 2KCCA 1O7YA 1YNNC 3S1MB 1K3RA 3HOYH 1HNZL 2F4VQ 1FGBD 4HIDA 1DD2A 5EKIA 1U0LA 3VR3A 5A35A 1E22A 3VDYA 1E2WA 4J6HA 4NXMQ 3I7FA 1D6EC 2MHVA 4A3IH 3H0GB 4JI4L 2B8FA 1FJGQ 4ID6A 1TWCH 3QOLA 3I72A 4JVZA 1LTTD 3JAMi 2JYOA 4XXEA 3HS0C 2E75C 3R3OA 3PF5A 4LF9Q 4KD4A 2HHHQ 3AFQA 4YY3L 3UDXA 3MVVA 3ULPA 1U4PA 1PTOF 1EYDA 3EQLC 3DWQA 4ULLA 3AFPA 4DK0A 5EJWA 3M7NA 1RD9D 1PH6A 4JYAQ 3M7GA 1CZWA 1SRUA 3I90A 3NELA 3OTOQ 3WOEA 5AJ3L 2BCOA 1EQRA 3ND8A 3W1BA 5EBCA 1OXSC 1YJ9A 4BY7G 1ICFB 1C9OA 2F0EA 4KN4C 4L5RC 2F0UA 4GS3A 3I73A 4WRDA 4BXXG 2EQSA 3H09A 2DGYA 5BN4A 5C4HA 1MBYA 4GNXC 2VB2X 4HIOA 4C3JH 3CMEA 1S40A 1WD0A 1IL8A 2PQEA 1XXGA 3D31A 5ELCA 1HR0L 3M4OB 1IBKQ 4P73A 1STYA 4DR4L 1QWYA 1S5ED 3IFTA 1SE2A 1QNKA 4HR7B 4X64L 3K8AA 2E2DC 3CCUA 2WKCA 1RJTA 2YV5A 2ES2A 2EJFC 1E24A 4PQXA 4DU9A 1BBWA 1EY5A 1QZGA 1FGUA 5DM73 3FVQA 5M3MG 1MD2D 4GZYC 2BA0A 3Q0AA 3NTKA 4HEDA 2QA4A 4DV5L 1DJRD 2OCEA 4FF4A 1CKNB 3DWPA 3F2CA 4XYOA 4YWKA 1L1OA 1C7YA 4XT3B 1VQLA 2JSOA 3UE0A 3RZDB 4CKBA 4CDDC 3HOZB 4C56C 4R4OA 3GTPH 1O7ZA 1DGSA 1GO3E 4CJ0B 3M85A 1EU3A 1YVCA 2IHEA 2NVQB 1ENAA 4K8JA 4FVMA 2NVTH 4OIKA 2EZVA 4IUTA 4RWSC 2JA5B 1II3A 1TXYA 2RQXA 2NN6H 5COYA 3PO2B 4TKOB 4RGTA 2D62A 1ENCA 1JT8A 2CH4W 1YEZA 5EGTA 5C4XG 5CV5A 5LMNL 1IBLL 4DFAA 1YITA 5EKLA 1E2VA 4FNFA 4DPGA 3S1RH 3KLRA 4A3CG 4AYBE 1X6OA 1U5KA 5DAUA 3SK5A 3GTOH 4OWWB 1PTOB 1UNSA 2NBFA 4P71A 3WOFA 1WI5A 1SYDA 3K7UC 2N55A 4PZ6A 1ZXTA 5JVG3 3FKIG 4E6IA 1Y1VB 2Z9HA 3V05A 1QCBD 2HDLA 1S5CD 2VQFQ 2IW3A 5KGUA 1ASZA 1WTPA 1STBA 2A1AA 2VL6A 2ZTEA 2I5HA 4IJLA 4L5SA 1A6XA 2I5LX 4QIWB 4IFDI 4R4QA 1HTPA 1TS2A 1V43A 3J7AV 1L0WA 2WKDA 4KD3A 1ET6A 5C4JB 2Z4IA 3M4PA 4N8FA 3HOYG 3S2HB 4N8X1 3C3LA 2MJ8A 4RGMA 4IJHA 2PZWA 4HJAA 1F9QA 1HNXQ 1FJGL 4P74A 1RTNA 3OHXC 4KN7C 3MHBA 1I4RA 4LF9L 1UE6A 5D3IB 3LGJA 2HDMA 1EWIA 1PRTF 1WOCA 3FEWX 4A3BH 3T13A 1V1PA 1SEBD 3GTGH 2MFIA 4JYAL 1L0YB 4GKJQ 3MXNA 2B2UA 2QCPX 4YCWA 3OTOL 2GVBA 5ISRA 4ILWA 1VQ7A 1JCKB 2F0TA 4A3KB 2ZJRA 5I2YA 1DXMA 3R8BA 2E2JB 4ABNA 3TEHB 3GD7A 1EQVA 3DM3A 1UWVA 1FL0A 4F88A 2BDOA 1KL9A 3MAQA 1EYAA 2DUDA 2Z8LA 5JVH3 1HJPA 2VS1A 3HG9A 4GOPA 2VUMH 2AKWB 1JWSD 5BR8Q 1IBKL 1EOVA 1SYGA 4JBWA 4PMCA 3GQBA 4JI2Q 3T56B 3PIOA 1SLJA 2KHJA 2NZHA 4AH6A 3PF4A 1YNND 3CW2C 3LX0A 4A3MH 3AMUA 4IFDH 2AUJD 1EZ6A 4DR2Q 5J39A 1M90C 3R93A 3CCRA 1Y1WB 3NP8A 3H6MA 1XNRQ 4LUZA 1LYLA 3M4YA 1T9HA 4PMBA 4CJ1B 5C5LA 2WAQG 3TBIB 4JBMA 3CP0A 1R9TH 1R4QB 3OSOA 2VZAA 1A2TA 2H4OA 1RIPA 4OL7A 2XRQD 3SR1A 2F0JA 4C3IB 1VQOA 1MSGA 3R2TA 3BDCA 1IW7D 3RN2A 3BZDB 5CV9A 2XRSD 3HEJA 3W5OA 2F0PA 4CBVA 5GROA 4KI0A 2VNUD 4KKSA 3BDOA 1EWHA 5KEEA 1HR0W 1BKBA 4K14A 2NN6G 1SMYC 1JB7A 5BN3A 1PRTB 2K50A 2DJGC 2F0SA 4GLVB 4RCOA 5F2DA 1GKHA 4NB3A 2L12A 2K05A 2WACA 1VQ9A 3J80L 1XPRA 2OWOA 4LFCQ 1QVGA 3FMCA 1F2ZA 1MKHA 1O7LA 4A93H 5E4XA 1DOLA 2VQFL 2JA8G 1D7QA 1LTBD 3BZKA 1MIUA 2ID0A 4KMUC 3J80c 3A8KE 1EY7A 2PCFB 3KDFB 3AB9A 3L3OC 2EJMA 1HPCA 2F0QA 2PI2A 2B63H 3S14H 2WFWA 5ELOA 1S5DD 4LF6Q 2NYZD 1GUTA 1WTRA 2H1EA 3FHWA 1AW7A 3VYRA 1C0AA 3OW2A 1RCVD 3GDEA 1KDAA 3FDTA 4HMJA 3TQYA 4G7OC 1PTOD 2K28A 3MEHA 4O0AA 4GNXA 3ONAB 1JJGA 1A2UA 4U673 1I94Q 4A3FB 1JWUD 4A3EH 4WORA 3DEOA 3GTLH 3M3YB 1XNQL 4JBJA 4C3HH 4EQPA 1A0IA 2C35B 1LTLA 4LUOA 3CXCA 2Q8IB 4PV1C 1D5XC 2QILA 2RCNA 4K0KQ 4GKJL 3M4QA 3JAME 4DGZA 2UXCQ 1KAWA 4A4IA 3HOUG 4FXKC 4UP8A 4A3BG 1X3EA 3D0FA 5JPNC 5EPLA 4A3DH 2V1CC 3VR5A 3S16H 2F0LA 1B9MA 2ZXRA 2MGSA 1EIHA 2R3ZA 3VYUA 1K8GA 2A6HD 5BR8L 4K6DA 1E2ZA 1Z7TA 5DEHA 5JJIA 2ZT9C 2DN8A 3PV0A 4EQOA 1GUNA 5IT9L 4JI5Q 4JI2L 3NTIA 4EVOA 1PH4A 1EZ8A 1CQFA 2VUMG 1RF2D 3HOVB 4N9TA 1H9MA 3J7AF 2AQ1B 2EYPA 4DR2L 3CRKC 1I4XA 4RHRA 5IT9c 1KRSA 1YHBA 2F0NA 4QB4A 3S2DB 3EVQA 4JC0A 3HOWB 4A3MG 1XNRL 4POGA 4DNIA 4A76A 3I4NH 3DMUA 2VXWA 4JG2A 4O42A 3BG3A 1GUWA 1Y8NB 4LF8L 3PO3H 1GUOA 2BDNA 2CWAA 4DR3L 4YCVA 1SBBB 3KF8A 4DK6C 3EIVA 4DAYA 2L55A 2Y0SE 3FP9A 4V190 1I50B 4WJ3M 3NK9A 1AE2A 3PQIA 1ASYA 1K8MA 3DLLA 1SMXA 1UUPA 2R7ZH 2NTSA 4RKBA 1TVXA 4B3TQ 4FYDA 3CHBD 3BDLA 2BA1A 2DY8A 4MIUA 3TP8A 4JI8L 4RGNA 5ELBA 2Y0SG 3D8GA 2EY1A 3PUZA 2YU9B 1LTID 2UUCQ 4IZ8A 1SJED 2JE6I 4QF4A 3JAML 4DXFA 2Q2IA 4H02A 1A63A 5A2QL 2G9DA 2HCIA 5GADC 1LACA 1KAAA 1NMFA 5M5YB 3NTHA 1B8AA 4MNOA 2CH4A 2OF1A 1F9RA 2N88A 2CVRA 3JAMc 3RZOH 2F0DA 3EA6A 4A93G 2R93H 1O7IA 1Q86C 1G91A 1MJCA 3HKZG 1P16A 4XT1B 3MA2B 1AZPA 4LF6L 1KLGD 3STBC 1Q7YC 1DOMA 2JK8A 3BYYB 2B63G 4OEMB 4UDUC 4BY1H 3A54A 3AEVA 3C1FA 1ZEQX 4O2DA 4DV3Q 4IQZA 3S17B 1PRTD 2Z1CA 1K73C 2PW7A 1VQCA 3GTKB 2Q8TA 2PYKA 3G48A 2KQ3A 3N52A 1I94L 2EY2A 1PH2A 4QUFA 1JOKA 4PZ7A 1LTRD 4NP5A 3GTJH 3SEBA 1C48A 3Q23A 3KBGA 1I6VC 2PZTA 2VW9A 2XWBB 3GTQH 1NAPA 4A3EG 2ZJQA 4CGYB 4K0KL 2O2LD 1Y8OB 2UXCL 1Q3LA 2KCMA 1G51A 2AMCB 4RKLA 5IGFA 5C4XB 1JQYD 5D65A 3S24A 1BNZA 2K33A 3DUZA 4K2LA 3PUVA 1DM0B 1Q90A 4F7XA 5IP7G 2L1BA 1J5EQ 3ERQA 5CV6A 1V1PB 3E0EA 4LFBQ 5E1FA 1VCIA 4DV7Q 1NBWA 1SNPA 3MXNB 3NWTA 3EBEA 4A3DG 1HFNA 2CQAA 3K0XA 4NXNQ 1FD7D 5H1SE 2EXDA 4IPHA 2K03A 4JI5L 2NZ1D 1YNJC 2EJGC 2J0TD 4A3JG 1JJ2A 3K58A 1EEFD 5C44B 1QB5D 4GOPB 3TP5A 1KXLA 1PH7A 3A5ZB 5HGQA 2IHFA 1B53A 3M9BA 2K14A 2JA6H 1QE6A 5NUCA 5I9PA 3E3XA 1IL2A 5IP9H 1X54A 3J7A5 1IXRA 1HZCA 1QOHA 2B3GA 3L2PA 1QZHA 1KRTA 4IPDA 2E2HH 3CC2A 2ALYB 1G2TA 1X9NA 2CFMA 4IUVA 3T1HQ 2LFNA 1SYCA 5K36H 1DOKA 1I6HH 3A7LA 5FJ8H 2E76C 4JI0Q 3PO3G 1VQGA 1CHQD 3U9SA 4BBRB 1K83H 3NENA 4NDXA 4TVAB 4B3TL 5CV7A 4V0BA 3H15A 1LM0A 2A68C 3P1HA 3PSIA 1NUCA 1TY0A 3OMGA 2K4KA 2IPKD 2R7ZG 2BE5C 3S1QH 4IPCA 1E3PA 4X3KA 2UUCL 3S1MH 4MN3A 2A19A 2A74C 1PXUA 1VQBA 3EFXD 5CORA 2O4XA 3QOJA 5C3WA 2XIWA 3TSSA 1G8ZD 4KJOA 3HZXA 1AH9A 3H0GH 4XQJA 2BH8A 3CAMA 4HCEA 1NR4A 1N32Q 4B3SL 2B39A 4K8IA 5C3EB 5C4ZA 4A3GG 3W1GA 1IKMA 1YZ6A 3BJUA 2CCZA 1GUGA 2F0FA 2RDFA 2I07B 2ZM6Q 1NY4A 2IJ0A 2R93G 5LL6S 3K6OA 4R4CA 2N78A 3K5NA 3KOJA 3K5MA 1VQ6A 4DV3L 2WAQB 1EIFA 1PFNA 4IOCA 4F8MA 1XYIA 1U4MA 2D0OA 3HFZB 2K01A 3H94A 4BY1G 1MGSA 2B8GA 1LTGD 3K7AB 3OMCA 4LW1A 3V2TA 1VQKA 2NUCA 4IURA 3NE5B 1DZ1A 2AUKA 1TQOA 1VQHA 2JQOA 4DAPA 1EOTA 2FJ2A 2Q2UA 4IUQA 4XQQA 4GNXB 2LXJA 3H3VI 1K8OA 1RKNA 4UHVA 1HQMC 1W2BA 3M4OH 1UE1A 5KRUA 3NBHB 3CQZH 4K6LA 1J5EL 1BCPC 4B3RQ 2R92H 3NUCA 4LAAA 3QJYA 3PCOB 1ZYRC 5EPJA 4DR1Q 4LFBL 2WP8J 4CDEC 1WJJA 1WCMB 4DA2A 1QUQB 1KD1C 1STAA 5DNFA 4FDBA 1MHWC 2B2YC 4NXNL 2BOSA 4OO1I 1F9SA 3ICEA 1TWHB 5GAEC 2JA8B 1Z9FA 2OT2A 2FMMA 1HHVA 4K5VA 4CKEA 1SYBA 1XMQQ 2UUAQ 3MFGA 2L4NA 3OOCA 4N9PA 1NE3A 4EX5A 2K5DA 3VR4A 3RZDH 3KLWA 1FYCA 2AWNA 2PNRC 5IGCA 3I4MB 4QMGA 2OXPA 4H0LC 3HOZH 3S1NH 3STBD 2NVQH 3MZ5A 4HMIA 1D5MC 4HSPA 1K8AC 1AZQA 1V1QA 2JA5H 4AYBG 2RHQB 5JAVA 4KY6A 3PO2H 2VB3X
chains in the Genus database with same CATH topology
3H91A 2EOTA 1S5BD 1EFID 1PFMA 2MPMA 2DY7A 3Q24A 4FF1A 3URYA 5M3FB 2K1BA 3I91A 5E4WC 3G6JB 1TS4A 4X3TA 5EKKA 3D4RA 3W3AA 5K36G 2FMCA 1PZJD 3HOUB 4A3BB 1PMRA 1SDFA 3D6CA 2IX3A 4XYQA 1KDBA 1V1OA 2SNSA 5ELEA 4DNTB 1D5ZC 3I70A 1SYFA 1XWEA 1TWFB 4ZRZA 1QJOA 4DK1A 1WVLA 1RHPA 3RMHA 1YNJD 1ESRA 5M5WB 1XX8A 5IGDA 1H9KA 1BQQT 4KK7A 1FNWA 1LABA 2PO4A 2LKVA 2KCNA 2KUMA 4HN7A 3P75A 3HOXB 2J4XA 2F4IA 3PIP3 1SFOB 3C1EA 4H7BA 3J81E 3R2IA 1ESFA 5IGGA 4C3JG 5LL6X 3NHHA 1D1IA 2K7VA 5CV8A 1CQVA 2NWGA 4G57A 3BS1A 3L9AX 3I4LA 5I2XA 1JC7A 2HCCA 1TWGB 5J22A 1WTVA 1G2SA 5C0XI 4G4KA 2EY5A 4HTHA 4RFBA 5KNDA 3NWSA 4DAVA 4KHVA 1QNUA 2A68D 3MWYW 1CFMA 2FFKB 4R8NA 3DXJC 1CTMA 4IFDJ 3PUXA 3E5SA 2EYJA 3V96A 3KLSA 2E2IB 5EPKA 1ILPA 2WB1B 4RCNA 4ZK9B 1EY8A 3NSWA 3HKZB 4QCLA 4DF7A 2F3WA 4WJWA 3IKJA 1LO5D 3S14B 2RDHA 4WFN3 3LNNA 5EBDA 2NTTA 2GA4B 2EYOA 1TR5A 4BBSB 3OW7A 1T5EA 3IAYA 1WTXA 3BVMA 1TWAB 1NSNS 1IYUA 5JOBA 2E74C 1JOOA 2AWOA 2M9VA 1EY9A 3QIAA 3Q22A 3SVMA 1BCPD 2ICIA 5CGKA 3K5OA 1PDQA 1Q1BA 2XN9C 1JORA 1LLRD 3C46A 3SK8A 3ZYYX 3LWUA 4Q5VA 2SOBA 1BO0A 4A3JB 5C6AA 1VDZA 1X32A 2PMZB 1E0BA 3SK4A 1J8IA 4TSSA 3C2PA 3ITPA 1U4RA 1GUSA 3F2UA 3QWNA 4H13C 5D3DA 4K5WA 1HFGA 4C2MB 3S15B 2QKIC 2TMPA 1I3QB 2KHSA 1EL0A 1BOSA 2A69C 2F3VA 2IX0A 2JEAI 2M00A 2B2YA 2M2LA 1B50A 1SNDA 2RBMA 3PMFA 4IFDG 3RLFA 3OPOA 1PLFA 1WTQA 1ENFA 3SXHA 3SE0A 3NBIA 3IL8A 2B2TC 1SNOA 3QG1A 1CZGA 4LJZC 1AFPA 4BA1I 5FKAC 1XTCD 4NMZA 5I6YA 2F1MA 3D6WA 1ZKOA 4BY7B 2LY7A 4BWGB 4KV6A 2B2VC 1GHJA 4A3GB 4KKUA 1SSOA 5FLXE 1SNCA 2EE1A 1UEAB 4FXGC 2K5QA 4RA8A 1AN8A 4C3IG 1TS3A 1ONLA 4BY1B 1STEA 1D1KA 3NQTA 1TS5A 2NB0A 1M4VA 3DHQA 4C1NK 5JJZA 5M3MB 1U4LA 1EY6A 1RDPD 1TY2A 1HUMA 2L9HA 4ZLTF 3MC0B 5DM63 1GHKA 4TRDA 2IWHA 3MFYA 4XIGS 2F0OA 1EQTA 2YYZA 1FNUA 5CYUA 5FO8B 3KK7A 3BVZA 1S5FD 1OO9B 2IT1A 3FRPB 2F0GA 3PUYA 1B4OA 3RD4A 4FF3A 1MSHA 1JICA 4C3HG 1W6KA 3A7AB 3G7LA 3TZUA 3OIPA 2EYFA 1SMYD 3GO5A 3TMEA 2WINB 3EJIA 5KNCA 3VYTA 4Y7NB 3FKIB 4FXDA 2OEOA 3IFDA 1LT5D 3CU7A 1PFBA 2NVYB 5BN5A 1H9JA 3T53B 1SE3A 1BDOA 3MXPA 1H9SA 4AYBB 1F2MA 2JXMB 5M5XB 2JA6B 3LWEA 4Q0FA 2D5DA 1B2TA 4Z9CB 3HOYB 4FO2A 1B3AA 1KTKA 5CV4A 1WTWA 1NCVA 5T1IA 1BR9A 2CHBD 1L0XB 5T1GA 2SEBD 4OIJA 4A3IB 2HQEA 2CW0C 1TWCB 2O5JC 1SAPA 1CI3M 3X3NA 4I7ZC 4CKCA 1PZKD 1C4QA 1FR3A 3K57A 2PPBC 2QF7A 2B2WC 2XVSA 3SHLA 1SE4A 1QG7A 5EQ0A 2AQ3B 2L0CA 2QEJC 3U9OA 4ODGA 5JEAH 4K5XA 1LTAD 4L63B 1SYEA 3VR2A 3DWAA 4DXGA 3QB3A 3I3CA 1OXUA 4CHTB 2L11A 2F0KA 5G3LF 1BCPF 3NPPA 1VF5C 5IODA 1VF7A 3A55A 4C3JB 3ND9A 1IW7C 2A69D 1FNVA 2RDGA 1A3VA 2KOLA 5JPMC 5JEAJ 2NN6I 5AFWA 4DN4M 3CKIB 1TKWB 1J9OA 1WTOA 1LT4D 1PYWD 1EYCA 3T51B 4KJNA 1CK1A 1A3UA 4EQNA 5CBEE 3K5LA 1IKLA 4R9WA 2F0HA 1I4GA 2DNCA 3DEPA 1F77A 2KA7A 2RSNA 2C9OA 3CQZB 5C5MA 3GTPB 2R92B 4XQNA 1LTSD 2NVTB 1EIGA 2D9UA 3HP3A 2A6EC 1B1ZA 2A5HA 3VA7A 2KJXA 2KVMA 2RKSA 1JWMD 5C3XA 3S1RB 5I6WA 3UI2A 2F0WA 2K5WA 3GTOB 1PTOC 2K6AA 3KLSX 4L6TB 3X3MA 5ELFA 2B2TA 3H3VC 3S1NB 1JR0D 2RSOA 4TQUS 1I4QA 4RH6A 1BUVT 1STHA 1BCPB 2NVXB 3P20A 3TDQA 1TIID 4P2CB 2B2VA 2C5CA 5KIXA 2KEDA 2R6GA 1I4HA 2A6HC 4XDXA 1G291 1GOZA 4B08A 1PTOH 1DCZA 1ET9A 4IUPA 3T16A 3MXGA 3DM1A 3OWEB 4FF2A 3OWFA 1OXXK 1C8CA 3GTGB 3T4AC 3OIQA 1KNAA 5JEAG 1A15A 2WV6D 4O1NA 3BYTB 4F87A 4OO1H 4JK1C 4ZYSA 1ML0D 1X3PA 4CJ2C 2VUMB 1HTLD 2V4DA 1JE4A 1LT3D 5KYIA 1Q8IA 3J80E 4A3MB 5IGEA 4M8AA 4RHSA 3O13A 5TSSA 2JP1A 3QO2A 1A3TA 2RA4A 5KNBA 1EY0A 4B9XA 4XTCS 1CHPD 2D2CC 4NW2A 3HGBA 2CW0D 3FPUB 1R9TB 4RGOS 3AU7A 4HSVA 2TSSA 1PZID 1MI2A 4ZKCB 5J1ZA 1H9RA 4I65A 3CRLC 2X6LA 2Y0SB 4LK1C 2BE5D 2L5TA 3HRZC 4S3SA 1HQRD 1Y69U 1HCZA 4QUCA 4K2KA 1NR2A 1PRTC 4U68A 5LHY1 4ZUIA 2QDBA 1DYQA 4MHEA 5FO7B 4KY5A 2X6GA 1WD1A 2B2WA 2EYMA 4IUNA 3GV6A 4A93B 1HA6A 3K0YA 1IYVA 1TU2B 1S4ZA 1X3QA 2ICEC 1LV9A 2EYLA 1AEXA 3D4WA 3VR6A 2B63B 1H9SB 2PZUA 4OGQC 2A73B 4L8JA 3TN2A 5IT9E 1SNQA 3L7ZC 5M9OA 1B9NA 3PUWA 1O80A 2F0VA 2FINB 1Q12A 2FHTA 1AP0A 5ELDA 1LT6D 3J81L 4G7HC 2JA7B 1DONA 5HGTA 4A3EB 3GTLB 5K5PA 5CBAE 5C0XH 4C3HB 4EGVA 3P7JA 4DNRB 2I46A 5G3LD 1ICWA 2Q8RE 4KHZA 1HUNA 2A6ED 5CC4A 4X3SA 4IALA 1ZYRD 5IGBA 2F0IA 4PMWA 3GP7A 4A3DB 3S16B 3N6RA 1KLUD 1SNMA 4HCSA 1BBXC 1KABA 5D14A 2IL8A 1KNEA 5IOCA 3D4DA 3NBHA 2ZXOA 5C0XJ 4OO1G 3SK6A 2IX1A 1RODA 1BF4A 3VYSA 2K04A 1CA5A 1STNA 4OHJA 2LS01 5A2QE 4BA2I 5FO9B 3SDZA 5FOBB 3I4NB 2XSCA 2WIIB 2KECA 3PO3B 3GTMB 4ZAIA 2EY6A 4IN3A 4KTAA 1TT2A 4IUUA 2MP1A 1KDCA 1D2BA 1Z6HA 2EVBA 3WDNA 2SNMA 2HUGA 2PW5A 2R7ZB 3MXUA 2J7ZA 3GV3A 4UAIA 1EU4A 1GJXA 1R4PB 4LMQD 3MTSA 2X69A 5KYLA 2EPBA 4R8IA 1UAPA 1Q1EA 1VMPA 1CM9A 4ZQ3A 1JOQA 3S9WA 2XNAC 3J7YW 3A8JE 4KY7A 3RZOB 5CR3A 1EEID 2R93B 4C1NI 1B44D 3Q6SA 5CMDA 2MUYA 2Z4HA 4J8QA 1F2YA 1T5XD 3A56A 1M8AA 4H44C 2RVLA 1HXYD 4KKTA 2O5IC 2K32A 2EYHA 5I4DA 1F9PA 4NKLA 3VA5A 3NXWA 4HAEA 1STGA 2XWJB 3RUZA 2AQ2B 3E0JA 1F2LA 3KUPA 2KEEA 4RAUC 3GTJB 3W2DA 1HA5A 1RTOA 2R61A 2G9HD 5E3FA 3GTQB 2ENBA 4J1MA 5C0XG 3NQIA 1EY4A 3BVGA 1Z47A 5IIFA 1EWCA 1GXDC 4FP5D 1Y8PB 4BS9A 4YIJA 1QILA 1CA6A 1BXTA 3E6ZX 3FPPA 4ZKBB 1CT1D 4G7ZC 2B2UC 1IHZA 1OXVA 3PIO3 3TP7A 1VMCA 1G6ZA 2SDFA 4X3UA 3TZDA 1SJHD 4M1UB 2JEBI 4B9WA 5HURA 2EDGA 1JB3A 3KBXA 1O78A 3EROA 5FLXL 1V8QA 1OXTA 3I8ZA 1W6JA 2E2HB 1ILQA 1I6HB 1I4PA 2EXZA 5I9OA 4PNYA 5FK9C 4ZUJA 3TP6A 1K83B 2F0MA 3A8IE 3D3RA 4ME5A 1SXTA 3K59A 2F03A 2ZXPA 2LMCB 1U9RA 1HRJA 3S1QB 2DNEA 2KCCA 1O7YA 1YNNC 3S1MB 1FGBD 1DD2A 5EKIA 3VR3A 5A35A 1E2WA 4J6HA 1D6EC 2MHVA 3H0GB 2B8FA 4ID6A 3QOLA 3I72A 1LTTD 2JYOA 4XXEA 3HS0C 2E75C 3R3OA 4KD4A 3MVVA 1U4PA 1PTOF 1EYDA 3EQLC 3DWQA 4ULLA 4DK0A 5EJWA 3M7NA 1RD9D 3M7GA 1CZWA 3I90A 3WOEA 2BCOA 3ND8A 5EBCA 1OXSC 2F0EA 4KN4C 2F0UA 3I73A 4WRDA 3H09A 5BN4A 5C4HA 1MBYA 2VB2X 1WD0A 1IL8A 2PQEA 1XXGA 3D31A 5ELCA 3M4OB 1STYA 1QWYA 1S5ED 3IFTA 1SE2A 1QNKA 4HR7B 2E2DC 2WKCA 1RJTA 2EJFC 4PQXA 4DU9A 1EY5A 5DM73 3FVQA 4GZYC 1MD2D 2BA0A 3Q0AA 3NTKA 4HEDA 1DJRD 4FF4A 3DWPA 4XYOA 4XT3B 2JSOA 3RZDB 4CKBA 3HOZB 4C56C 1O7ZA 4CJ0B 3M85A 1EU3A 2NVQB 1ENAA 4K8JA 4FVMA 4OIKA 2EZVA 4IUTA 4RWSC 2JA5B 1II3A 2RQXA 2NN6H 5COYA 3PO2B 4TKOB 4RGTA 2D62A 1ENCA 5EGTA 5CV5A 4DFAA 5EKLA 1E2VA 4FNFA 3KLRA 3SK5A 5DAUA 1PTOB 1UNSA 2NBFA 3WOFA 1SYDA 2N55A 1ZXTA 5JVG3 4E6IA 1Y1VB 3V05A 1QCBD 2HDLA 1S5CD 2IW3A 5KGUA 1WTPA 1STBA 1A6XA 4QIWB 4IFDI 1HTPA 1TS2A 1V43A 3J7AV 2WKDA 4KD3A 1ET6A 5C4JB 2Z4IA 3S2HB 3C3LA 2MJ8A 4RGMA 2PZWA 1F9QA 1RTNA 3OHXC 4KN7C 3MHBA 1I4RA 5D3IB 2HDMA 1PRTF 3FEWX 3T13A 1V1PA 1SEBD 1L0YB 3MXNA 2B2UA 2QCPX 5ISRA 4ILWA 1JCKB 2F0TA 4A3KB 5I2YA 1DXMA 3R8BA 2E2JB 4ABNA 3GD7A 1EQVA 4F88A 2BDOA 3MAQA 1EYAA 2Z8LA 5JVH3 3HG9A 1JWSD 1SYGA 4JBWA 4PMCA 3GQBA 3T56B 1YNND 3LX0A 3AMUA 4IFDH 2AUJD 1EZ6A 5J39A 3R93A 1Y1WB 3NP8A 3H6MA 3M4YA 4PMBA 4CJ1B 5C5LA 3TBIB 1R4QB 3OSOA 1A2TA 2H4OA 4OL7A 2XRQD 3SR1A 2F0JA 4C3IB 1MSGA 3R2TA 3BDCA 1IW7D 3BZDB 5CV9A 2XRSD 3HEJA 2F0PA 4CBVA 4KI0A 2VNUD 4KKSA 3BDOA 1EWHA 5KEEA 4K14A 2NN6G 1SMYC 5BN3A 1PRTB 2F0SA 5F2DA 4RCOA 2L12A 2K05A 2WACA 3J80L 3FMCA 1F2ZA 1O7LA 5E4XA 1DOLA 1LTBD 2ID0A 4KMUC 3A8KE 1EY7A 2PCFB 3AB9A 3L3OC 2EJMA 1HPCA 2F0QA 1S5DD 2NYZD 1GUTA 1WTRA 2H1EA 1AW7A 3VYRA 1RCVD 1KDAA 3FDTA 4HMJA 4G7OC 1PTOD 2K28A 3MEHA 3ONAB 1A2UA 4U673 4A3FB 1JWUD 4WORA 3DEOA 3M3YB 4EQPA 2Q8IB 4PV1C 1D5XC 2QILA 3JAME 4DGZA 4FXKC 5JPNC 5EPLA 3VR5A 2F0LA 1B9MA 2ZXRA 2MGSA 1EIHA 2R3ZA 3VYUA 2A6HD 4K6DA 1E2ZA 1Z7TA 5DEHA 2ZT9C 2DN8A 3PV0A 4EQOA 1GUNA 5IT9L 3NTIA 4EVOA 1EZ8A 1CQFA 1RF2D 3HOVB 4N9TA 1H9MA 3J7AF 2AQ1B 2EYPA 3CRKC 1I4XA 4RHRA 2F0NA 4QB4A 3S2DB 3EVQA 3HOWB 3DMUA 2VXWA 4O42A 3BG3A 1GUWA 1Y8NB 1GUOA 2BDNA 1SBBB 3KF8A 4DAYA 2L55A 4V190 1I50B 3NK9A 1K8MA 1UUPA 2NTSA 4RKBA 1TVXA 4FYDA 3CHBD 3BDLA 2BA1A 2DY8A 4MIUA 3TP8A 4RGNA 5ELBA 3D8GA 2EY1A 3PUZA 2YU9B 1LTID 4IZ8A 1SJED 2JE6I 4QF4A 3JAML 4DXFA 5A2QL 2G9DA 2HCIA 1LACA 1KAAA 5M5YB 3NTHA 2OF1A 1F9RA 2N88A 2CVRA 2F0DA 3EA6A 1G91A 4XT1B 3MA2B 1AZPA 1KLGD 1DOMA 3BYYB 4UDUC 3A54A 3C1FA 1ZEQX 4IQZA 3S17B 1PRTD 2Z1CA 2PW7A 3GTKB 2Q8TA 2PYKA 2KQ3A 3N52A 2EY2A 4QUFA 1JOKA 1LTRD 4NP5A 3SEBA 1C48A 3Q23A 3KBGA 1I6VC 2PZTA 2XWBB 1NAPA 4CGYB 2O2LD 1Y8OB 1Q3LA 4RKLA 5C4XB 5IGFA 1JQYD 5D65A 1BNZA 2K33A 3DUZA 4K2LA 3PUVA 1DM0B 1Q90A 4F7XA 2L1BA 3ERQA 5CV6A 1V1PB 5E1FA 1VCIA 1SNPA 3NWTA 1HFNA 2CQAA 1FD7D 2K03A 2NZ1D 1YNJC 2EJGC 2J0TD 3K58A 1EEFD 5C44B 1QB5D 3TP5A 1B53A 1QE6A 5NUCA 5I9PA 1QOHA 1G2TA 4IUVA 2LFNA 1SYCA 5K36H 1DOKA 3A7LA 2E76C 1CHQD 3U9SA 4BBRB 4NDXA 5CV7A 4V0BA 2A68C 3P1HA 1NUCA 1TY0A 3OMGA 2IPKD 2BE5C 4X3KA 4MN3A 2A74C 1PXUA 3EFXD 5CORA 2O4XA 3QOJA 5C3WA 2XIWA 3TSSA 1G8ZD 4KJOA 3HZXA 4XQJA 4HCEA 1NR4A 2B39A 4K8IA 5C3EB 5C4ZA 1IKMA 1GUGA 2F0FA 2RDFA 2I07B 2IJ0A 5LL6S 3K6OA 3K5NA 3K5MA 2WAQB 1PFNA 4F8MA 1XYIA 1U4MA 2K01A 3H94A 1MGSA 2B8GA 1LTGD 3K7AB 3OMCA 3V2TA 2NUCA 4IURA 3NE5B 1DZ1A 2AUKA 1TQOA 4DAPA 1EOTA 2FJ2A 4IUQA 4XQQA 1K8OA 1RKNA 1HQMC 5KRUA 4K6LA 1BCPC 3NUCA 4LAAA 3QJYA 5EPJA 1ZYRC 2WP8J 1WCMB 4DA2A 1STAA 5DNFA 2B2YC 2BOSA 4OO1I 1F9SA 2JA8B 1TWHB 2OT2A 2FMMA 1HHVA 4K5VA 4CKEA 1SYBA 3MFGA 2L4NA 3OOCA 4N9PA 2K5DA 3VR4A 1FYCA 2AWNA 2PNRC 5IGCA 3I4MB 4QMGA 2OXPA 4H0LC 3MZ5A 4HMIA 1D5MC 4HSPA 1AZQA 5JAVA 4KY6A 2VB3X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NAP A;  2FFK B;  2L12 A;  2K05 A;  5JJZ A;  1ILQ A;  4NW2 A;  3H91 A;  2EOT A;  5EQ0 A;  2B2T A;  4X3S A;  1J8I A;  1QNK A;  1U4L A;  1U4R A;  1HUM A;  1Q3L A;  2L9H A;  3F2U A;  4ZLT F;  1PFM A;  3FPU B;  2MPM A;  1RJT A;  1NR4 A;  2DY7 A;  2RSO A;  5D65 A;  1BNZ A;  2VXW A;  5E4X A;  1DOL A;  2K1B A;  4O42 A;  3I91 A;  1GUW A;  5E4W C;  3Q6S A;  5CMD A;  3I3C A;  5EPK A;  1IKM A;  1EQT A;  1HFG A;  2L1B A;  2BDN A;  4HSV A;  4X3T A;  1ILP A;  4HCS A;  1BBX C;  2B2U A;  2L11 A;  1MI2 A;  4ZKC B;  1EL0 A;  4HED A;  4ZK9 B;  1HUN A;  5D14 A;  1M8A A;  2IL8 A;  3I8Z A;  1KNE A;  2RVL A;  2B2V A;  2B2Y A;  2M2L A;  1HFN A;  1SDF A;  1PFN A;  4XT3 B;  2X6L A;  1B4O A;  1B50 A;  1HRJ A;  1XYI A;  1MSH A;  1U4M A;  2KED A;  1O7Y A;  1JIC A;  1F9P A;  2K03 A;  1ROD A;  2K01 A;  2NYZ D;  2NZ1 D;  1BF4 A;  4HAE A;  2K04 A;  2H1E A;  1MGS A;  3G7L A;  1WTR A;  1O7Z A;  1CA5 A;  1TVX A;  4CJ0 B;  5EKI A;  2DY8 A;  4IUR A;  4QUC A;  1F2L A;  3KUP A;  2KEE A;  1DZ1 A;  1NR2 A;  4RAU C;  4XDX A;  4U68 A;  4OIK A;  4IUT A;  1PLF A;  3FDT A;  4RWS C;  2KOL A;  1WTQ A;  1RTO A;  4MHE A;  5AFW A;  5COY A;  2K28 A;  2X6G A;  4IUP A;  3ONA B;  3IL8 A;  4DN4 M;  1EOT A;  2FJ2 A;  1J9O A;  4IUQ A;  3DM1 A;  3DEO A;  1WD1 A;  1B53 A;  2B2T C;  1WVL A;  2B2W A;  1RHP A;  1QE6 A;  1WTO A;  3IFD A;  3GV6 A;  1HA6 A;  2JYO A;  2KEC A;  1C8C A;  1PFB A;  2HCI A;  1WTX A;  1ESR A;  1S4Z A;  3R93 A;  1X3Q A;  1LV9 A;  1XX8 A;  4ZAI A;  1CA6 A;  1F9R A;  1KNA A;  4IUU A;  2N55 A;  2N88 A;  1G2T A;  2CVR A;  2MP1 A;  1ZXT A;  5EPJ A;  1U4P A;  4ZKB B;  4IUV A;  5CBE E;  2KUM A;  3D6W A;  2B2U C;  4CJ1 B;  1A15 A;  1IKL A;  4R9W A;  1DOK A;  3LWE A;  1ICW A;  2HDL A;  1G91 A;  1VMC A;  3DEP A;  5DNF A;  5EJW A;  5EPL A;  2HUG A;  2RSN A;  2B2V C;  2B2Y C;  1WTP A;  1B2T A;  3TN2 A;  1G6Z A;  4XT1 B;  1AZP A;  1F9S A;  1B3A A;  2J7Z A;  2SDF A;  3GV3 A;  1ML0 D;  1WTW A;  3I90 A;  1NCV A;  2FMM A;  1SSO A;  1X3P A;  2NWG A;  4X3U A;  1DOM A;  1O80 A;  2FIN B;  4UAI A;  2MGS A;  5T1I A;  4CJ2 C;  1PDQ A;  1EIH A;  2FHT A;  1AP0 A;  1HHV A;  1EIG A;  1MSG A;  2D9U A;  2R3Z A;  4LMQ D;  3HP3 A;  5T1G A;  3TZD A;  3SVM A;  3MTS A;  2EE1 A;  2HDM A;  2L4N A;  2X69 A;  4OIJ A;  1JE4 A;  2HCC A;  2Q8T A;  2EPB A;  1DON A;  4RA8 A;  4X3K A;  1WTV A;  2MJ8 A;  1G2S A;  2KVM A;  3KBX A;  3N52 A;  1F9Q A;  4MN3 A;  1WD0 A;  1BO0 A;  1IL8 A;  1SAP A;  4QUF A;  5CBA E;  4R8I A;  2JP1 A;  3QO2 A;  1RTN A;  3P7J A;  1VMP A;  1CM9 A;  2RA4 A;  5COR A;  3UI2 A;  2B2W C;  2XIW A;  1AZQ A;  3MWY W;  1X32 A;  2Q8R E;  1E0B A;  1QG7 A; 
#chains in the Genus database with same CATH topology
 1NJI C;  2F4V L;  3H91 A;  2EOT A;  2NVX H;  1QVC A;  2JA6 G;  2IY5 B;  1S5B D;  1EFI D;  5LMU Q;  2E5L Q;  1PFM A;  1K9M C;  2MPM A;  5IP9 G;  3G71 A;  2DY7 A;  3J81 j;  3Q24 A;  3CCE A;  4NXM L;  4JI0 L;  4FF1 A;  3URY A;  5M3F B;  2K1B A;  3I91 A;  5E4W C;  3G6J B;  1TS4 A;  4DUY Q;  4X3T A;  5EKK A;  3D4R A;  4DV2 Q;  3W3A A;  5K36 G;  5FJ8 G;  1YJW A;  2FMC A;  1PZJ D;  3HOU B;  1L2F A;  3KF8 B;  4A3B B;  1PMR A;  1Y1V H;  4OXP A;  3H3V H;  1SDF A;  4A3I G;  2HHH L;  3D6C A;  2IX3 A;  4DAY B;  3CCV A;  4XYQ A;  1KDB A;  1V1O A;  2SNS A;  5ELE A;  4DNT B;  1D5Z C;  3I70 A;  1SYF A;  2HT1 A;  1E1O A;  1XWE A;  3CPW A;  1TWF B;  4ZRZ A;  4YCU A;  3S2H H;  1QJO A;  4DK1 A;  2OTL A;  1WVL A;  1RHP A;  3RMH A;  1YNJ D;  4X62 Q;  1N32 L;  4JI1 Q;  1ESR A;  5M5W B;  1XX8 A;  5IGD A;  1H9K A;  4UY8 C;  1BQQ T;  4KK7 A;  1FNW A;  1LAB A;  4YWL A;  2PO4 A;  2LKV A;  2ZM6 L;  2HD3 A;  2KCN A;  2KUM A;  4HN7 A;  3P75 A;  3HOX B;  2J4X A;  2F4I A;  3PIP 3;  1SFO B;  3C1E A;  4H7B A;  3J81 E;  1Q8K A;  3R2I A;  1ESF A;  5IGG A;  3IRB A;  4C3J G;  5LL6 X;  1D8L A;  3NHH A;  2YTY A;  1D1I A;  2K7V A;  3RLN A;  5CV8 A;  1CQV A;  3ZJY C;  2NWG A;  4G57 A;  1JMC A;  1RL2 A;  3BS1 A;  4A3K H;  3L9A X;  3I4L A;  5I2X A;  2E2J H;  1JC7 A;  2HCC A;  1TWG B;  5J22 A;  1S3O A;  1PHJ A;  1WTV A;  1G2S A;  5C0X I;  3G4S A;  4G4K A;  2HIX A;  5HY6 A;  2EY5 A;  4HTH A;  4RFB A;  5KND A;  1X3F A;  1S72 A;  4JI6 Q;  3NWS A;  4DAV A;  4KHV A;  1QNU A;  2A68 D;  2Z0S A;  4DV0 Q;  4HIK A;  2QEX A;  3MWY W;  1CFM A;  1YBY A;  2FFK B;  4B3R L;  4R8N A;  3DXJ C;  1CTM A;  1VQJ A;  4IFD J;  3PUX A;  3E5S A;  1XTD A;  2EYJ A;  3UDG A;  3V96 A;  3KLS A;  5IE8 A;  2R92 G;  2E2I B;  5EPK A;  1Y1W H;  1ILP A;  2WB1 B;  4RCN A;  2LXK A;  4ZK9 B;  1EY8 A;  3NSW A;  2UUA L;  4UP7 A;  3HKZ B;  4QCL A;  4DF7 A;  2F3W A;  2K5N A;  3JC6 6;  4WJW A;  4C3I H;  4MZ9 A;  3IKJ A;  1KC8 C;  1LO5 D;  3U4Z A;  3K80 C;  3S14 B;  2RDH A;  4WFN 3;  3LNN A;  4ALP A;  3HOZ G;  2OTJ A;  3KYH C;  5EBD A;  5GAH C;  2NTT A;  4DAM A;  3Q8D A;  2GA4 B;  5LMU L;  2EYO A;  2E5L L;  1TR5 A;  4BBS B;  2CKZ B;  3OW7 A;  1T5E A;  3IAY A;  1WTX A;  3PO2 G;  1CKM A;  3BVM A;  4DKA C;  1VQE A;  1TWA B;  1NSN S;  1HNX L;  4DR5 Q;  1VQD A;  1IYU A;  5JOB A;  3J7Z C;  2E74 C;  2K75 A;  1N9W A;  4QIW E;  1B3Q A;  1JOO A;  2K5H A;  4JPB W;  2AWO A;  2M9V A;  2JA7 H;  1EY9 A;  3QIA A;  4UP9 A;  3Q22 A;  3SVM A;  1BCP D;  1PH5 A;  2ICI A;  1BVS A;  5CGK A;  3K5O A;  1PDQ A;  1Q1B A;  2XN9 C;  1JOR A;  2Z6B A;  4JV5 Q;  1K0R A;  2MQH A;  1LLR D;  2DJF C;  3TS2 A;  3C46 A;  2F3I A;  3A74 A;  1MJE A;  3SK8 A;  3ZYY X;  3T1Y Q;  3LWU A;  4Q5V A;  2SOB A;  5GQO A;  1BO0 A;  1SE8 A;  1YNX A;  1NTG A;  2D0P A;  4A3J B;  4JI1 L;  5C6A A;  1VDZ A;  1X32 A;  2PMZ B;  1E0B A;  3SK4 A;  1J8I A;  1FVI A;  4TSS A;  4OEL B;  4P72 A;  3C2P A;  3ITP A;  1U4R A;  1GUS A;  4A3F H;  2ASB A;  3F2U A;  4GN4 B;  1SRO A;  3M3Y H;  3QWN A;  4H13 C;  5D3D A;  4LNQ A;  3U50 C;  4DK3 C;  4K5W A;  1N36 Q;  1HFG A;  4C2M B;  3S15 B;  2HIV A;  2QKI C;  1KIX A;  2TMP A;  1I3Q B;  2KHS A;  3AQQ A;  1EL0 A;  1BOS A;  2A69 C;  2F3V A;  2IX0 A;  2JEA I;  2M00 A;  2B2Y A;  2M2L A;  2OQ0 A;  1B50 A;  3KF6 A;  1K0S A;  3CF5 A;  1SND A;  2RBM A;  1B7Y B;  3PMF A;  2BH2 A;  4IFD G;  3RLF A;  4NPS A;  4LF4 Q;  4A3K G;  1V9P A;  2I5M X;  4HJ5 A;  3OPO A;  1PLF A;  4JI6 L;  1WTQ A;  1ENF A;  3SXH A;  4OX9 Q;  3SE0 A;  4DV0 L;  4JCV E;  3GTM H;  2H5X A;  3NBI A;  3IL8 A;  4JI7 Q;  1SN8 A;  2RCF A;  1HZ9 A;  2B2T C;  3HOV H;  1SNO A;  3QG1 A;  1CZG A;  4LJZ C;  1AFP A;  3RR5 A;  4BA1 I;  5FKA C;  1XTC D;  4NMZ A;  3BU2 A;  5I6Y A;  1L1O B;  2F1M A;  3S2D H;  3HOW H;  3ULJ A;  3D6W A;  1ZKO A;  4UPA A;  4BY7 B;  2LY7 A;  5L37 A;  4BWG B;  2R7F A;  1N8R C;  4KV6 A;  2B2V C;  1Y1W G;  1GHJ A;  4A3G B;  4LFC L;  3TRZ A;  4KKU A;  1SSO A;  4JI4 Q;  5FLX E;  4HJ8 A;  4MTK A;  2P5Z X;  1VQ5 A;  1SNC A;  1K3B C;  2EE1 A;  1UEA B;  1I50 H;  3J81 i;  4FXG C;  2K5Q A;  4RA8 A;  1AN8 A;  4C3I G;  1TS3 A;  1OTC A;  1ONL A;  4BY1 B;  1HNW Q;  1STE A;  4LFA Q;  1D1K A;  3NQT A;  1TS5 A;  2PQA A;  5JJK A;  2NB0 A;  1M4V A;  3DHQ A;  4C1N K;  5JJZ A;  2YU9 H;  5M3M B;  1U4L A;  1EY6 A;  2ZTC A;  1RDP D;  1TY2 A;  4DR5 L;  1HUM A;  2L9H A;  4ZLT F;  3MC0 B;  4ME3 A;  5DM6 3;  1GHK A;  5J3B A;  4TRD A;  2EIF A;  4R1J A;  2IWH A;  3MFY A;  4XIG S;  2F0O A;  5M5Y H;  1EQT A;  2YYZ A;  1FNU A;  5CYU A;  5FO8 B;  3KK7 A;  3BVZ A;  4A3L H;  1S5F D;  4J15 A;  1OO9 B;  2IT1 A;  4JV5 L;  4RG1 A;  2JA7 G;  3F8T A;  3FRP B;  2F0G A;  3PUY A;  1B4O A;  3RD4 A;  3HKS A;  4FF3 A;  1MSH A;  1JIC A;  1W6K A;  4C3H G;  3A7A B;  2VQE Q;  3T1Y L;  3G7L A;  2OQK A;  4X6A H;  3TZU A;  1X65 A;  3OIP A;  2EYF A;  1Q46 A;  1PFS A;  1SMY D;  3S17 H;  1WTH A;  3GO5 A;  3TME A;  3PIP A;  2WIN B;  3EJI A;  5KNC A;  3VYT A;  4Y7N B;  3FKI B;  4FXD A;  2OEO A;  3IFD A;  1LT5 D;  3CU7 A;  1PFB A;  2NVY B;  5BN5 A;  1H9J A;  3T53 B;  1SE3 A;  1BDO A;  3MXP A;  1N36 L;  1H9S A;  4AYB B;  1F2M A;  1P8L A;  2JXM B;  5M5X B;  4QL5 A;  3LWE A;  2JA6 B;  1I5F A;  4Q0F A;  5C4X H;  2D5D A;  1B2T A;  4Z9C B;  2K52 A;  3HOY B;  4FO2 A;  1B3A A;  1KTK A;  5CV4 A;  1WTW A;  1NCV A;  5T1I A;  4LF4 L;  4YWM A;  4PZ8 A;  1BR9 A;  5LMN Q;  2CHB D;  1IBL Q;  1L0X B;  5T1G A;  2SEB D;  1GVP A;  4OIJ A;  4EQ5 A;  1IBM Q;  3RLO A;  4OX9 L;  4A3I B;  2HQE A;  2CWP A;  3I4N G;  2CW0 C;  1TWC B;  2O5J C;  4JI7 L;  1SAP A;  1CI3 M;  3X3N A;  4I7Z C;  3E9I A;  4CKC A;  1PZK D;  4POF A;  1C4Q A;  1FR3 A;  3K57 A;  2PPB C;  2QF7 A;  4OWT B;  2B2W C;  2XVS A;  3SHL A;  5C44 H;  1SE4 A;  1K28 A;  1QG7 A;  5EQ0 A;  2AQ3 B;  2L0C A;  3HOV G;  2QEJ C;  3U9O A;  4ODG A;  5JEA H;  4K5X A;  1LTA D;  4PG3 A;  2HQL A;  4L63 B;  1SYE A;  3VR2 A;  4HIM A;  3DWA A;  3KFU A;  4DXG A;  3QB3 A;  3I3C A;  3HOW G;  4QQB X;  1OXU A;  4CHT B;  2F52 A;  2L11 A;  2F0K A;  5G3L F;  1VQN A;  1BCP F;  3NPP A;  1VF5 C;  5IOD A;  1VF7 A;  2KCT A;  3A55 A;  4BBR H;  4C3J B;  3ND9 A;  1HNW L;  4LFA L;  1IW7 C;  2A69 D;  1FNV A;  2RDG A;  1A3V A;  2KOL A;  5JPM C;  5JEA J;  2NN6 I;  5AFW A;  2XGT A;  4DN4 M;  2JJQ A;  3CKI B;  1TKW B;  1J9O A;  1PVO A;  1WTO A;  1YHQ A;  2JN4 A;  1LT4 D;  2MO0 A;  1PYW D;  1EYC A;  3T51 B;  4KJN A;  1PYS B;  1CK1 A;  1Y14 B;  1XMO Q;  1A3U A;  4EQN A;  5CBE E;  3K5L A;  4MTN A;  1IKL A;  4R9W A;  3G6E A;  4X66 Q;  2F0H A;  1I4G A;  2DNC A;  3DEP A;  2QW7 A;  1F77 A;  2KA7 A;  2RSN A;  4OWX B;  1PH8 A;  2C9O A;  3CQZ B;  5C5M A;  5C3E H;  1JE5 A;  3GTP B;  1WFQ A;  2UU9 Q;  2R92 B;  4XQN A;  2VQE L;  1LTS D;  4A3L G;  4DR6 Q;  2NVT B;  3TS0 A;  1EIG A;  2D9U A;  3HP3 A;  1YJN A;  4AIM A;  2A6E C;  1B1Z A;  1GD7 A;  2A5H A;  5IYB H;  3VA7 A;  2KJX A;  1VQF A;  2KVM A;  4DUZ Q;  4DV7 L;  1X55 A;  2NZO A;  3RNU A;  2RKS A;  1JWM D;  3K7A H;  5C3X A;  2QGQ A;  2N8N A;  3S1R B;  5I6W A;  4I7A A;  4QJF A;  3I55 A;  3UI2 A;  4DV4 Q;  2F0W A;  1BBU A;  2K5W A;  1PTO C;  3GTO B;  5IYD H;  2K6A A;  4JBK A;  3QR8 A;  3KLS X;  3I4O A;  2Q2H A;  4L6T B;  3X3M A;  5ELF A;  2B2T A;  4IO9 A;  3H3V C;  3S1N B;  1WYD A;  5IY0 A;  1JR0 D;  2RSO A;  4TQU S;  1I4Q A;  4RH6 A;  3EN2 A;  1A8V A;  1VQM A;  4LUV A;  1BUV T;  1STH A;  1BCP B;  2GVA A;  1M1K C;  2NVX B;  3P20 A;  3TDQ A;  1TII D;  1WCM H;  4P2C B;  2B2V A;  2C5C A;  3B6Y A;  5KIX A;  2KED A;  1IBM L;  2R6G A;  2JA8 H;  1TWH H;  1I4H A;  4X65 Q;  3T1H L;  3KF6 B;  3E9H A;  2A6H C;  1UEB A;  4XDX A;  2UXB Q;  1G29 1;  1GOZ A;  4L5T A;  4B08 A;  1PTO H;  4B3M Q;  1DCZ A;  1ET9 A;  4IUP A;  4OON A;  3T16 A;  1UE5 A;  3MXG A;  3CCJ A;  2CQO A;  2A8V A;  3DM1 A;  3I56 A;  3CC4 A;  3OWE B;  3I4M H;  4FF2 A;  4IOA A;  1A62 A;  1OXX K;  1IZ6 A;  2AHO B;  1E7Z A;  3OWF A;  5IWA Q;  5C44 G;  1C8C A;  3GTG B;  1N34 Q;  3T4A C;  3OIQ A;  2VY3 A;  1JJC B;  1KNA A;  5JEA G;  1YHA A;  4GKK Q;  1A15 A;  4A75 A;  2WV6 D;  4O1N A;  3BYT B;  3SGI A;  5C4J H;  4GLA C;  5M3F H;  1N33 Q;  4F87 A;  4OO1 H;  4JK1 C;  4ZYS A;  1ML0 D;  1X3P A;  1PYB A;  4CJ2 C;  2VUM B;  1HTL D;  1B70 B;  3CCQ A;  1SR3 A;  1XNQ Q;  3HOU H;  2V4D A;  5FLM H;  1JE4 A;  1HZA A;  3H0G G;  4BBR G;  1LT3 D;  5KYI A;  1Q8I A;  5DLQ E;  3J80 E;  3F1Z A;  4A3M B;  5IGE A;  4M8A A;  4RHS A;  1PH3 A;  3O13 A;  5TSS A;  2N3S A;  1CUK A;  2JP1 A;  1AE3 A;  3QO2 A;  1A3T A;  2RA4 A;  2Z6K C;  5KNB A;  4ZCK A;  1EY0 A;  1NMG A;  4B9X A;  4XTC S;  1CHP D;  4YHH Q;  2YTV A;  4JOI C;  1TWF H;  2D2C C;  2PQA B;  3HGB A;  4NW2 A;  1XMO L;  4KHP Q;  2CW0 D;  3FPU B;  1R9T B;  4X66 L;  4RGO S;  3AU7 A;  4R4I A;  2Q2T A;  5M5W H;  4LF7 Q;  4HSV A;  2TSS A;  2UU9 L;  3F2B A;  1PZI D;  1MI2 A;  4ZKC B;  2ZJP A;  4DR6 L;  2WAQ E;  1H9R A;  4RMF A;  5J1Z A;  3HOX H;  1X56 A;  4I65 A;  1SFO H;  2PI2 E;  1YIJ A;  3CRL C;  5C3E G;  2X6L A;  2Y0S B;  4LK1 C;  2BE5 D;  2G5D A;  2L5T A;  4DR1 L;  4DUZ L;  3HRZ C;  4S3S A;  1HQR D;  1Y69 U;  1HCZ A;  1LUZ A;  2MNA A;  4QUC A;  4K2K A;  1NR2 A;  5IYC H;  1PRT C;  4U68 A;  5LHY 1;  4ZUI A;  3CCM A;  2QDB A;  1DYQ A;  4GLX A;  4DV4 L;  5IYB G;  4MHE A;  5FO7 B;  4KY5 A;  2X6G A;  1CKO A;  1EFW A;  1TWG H;  4LF8 Q;  4APV A;  4DR3 Q;  3WWV A;  1WD1 A;  2B2W A;  1XMQ L;  2EYM A;  4IUN A;  3GV6 A;  5IYD G;  4A93 B;  1HA6 A;  3K0Y A;  1IYV A;  1TU2 B;  1S4Z A;  3UE1 A;  1X3Q A;  2ICE C;  1LV9 A;  2PNH A;  2EYL A;  1AEX A;  3D4W A;  3VR6 A;  2B63 B;  1H9S B;  2LSS A;  2PZU A;  4OGQ C;  2A73 B;  1CSP A;  4L8J A;  4JI8 Q;  3TN2 A;  5IT9 E;  1SNQ A;  3L7Z C;  2E2I H;  4DR7 Q;  5M9O A;  1B9N A;  3PUW A;  3ER0 A;  4X65 L;  5ELN A;  1O80 A;  2F0V A;  2FIN B;  1WCM G;  4JI3 Q;  1Q12 A;  2JA5 G;  2FHT A;  1AP0 A;  5ELD A;  1LT6 D;  4DV6 Q;  3CPF A;  2UXB L;  3J81 L;  4DUY L;  4WJ4 A;  2E8G A;  4G7H C;  2JA7 B;  4B3M L;  1DON A;  4P75 A;  4DV2 L;  4AQY Q;  5HGT A;  2L15 A;  4A3E B;  3GTL B;  5K5P A;  5CBA E;  5C0X H;  4C3H B;  4EGV A;  1YI2 A;  3P7J A;  4DNR B;  5IWA L;  3J81 c;  2I46 A;  1N34 L;  5G3L D;  1ICW A;  4KLK A;  2Q8R E;  4KHZ A;  1HUN A;  2A6E D;  3I4M G;  5CC4 A;  4X3S A;  1X3G A;  4GKK L;  1Y1V G;  4IAL A;  1ZYR D;  5IGB A;  3CMA A;  2F0I A;  4PMW A;  3GP7 A;  4LWC A;  4BBS H;  1J6Q A;  4A3D B;  4L5Q A;  1UE7 A;  3S16 B;  3N6R A;  1N33 L;  4DV1 Q;  1CKN A;  1TWA H;  1GM5 A;  1KLU D;  1SNM A;  4HCS A;  1BBX C;  1KAB A;  4X62 L;  1XPO A;  5LMN W;  5D14 A;  3CC7 A;  4LF5 Q;  1CSQ A;  2IL8 A;  1KNE A;  5IOC A;  3D4D A;  3NBH A;  5M3F G;  2ZXO A;  5C0X J;  2UUB Q;  4OO1 G;  3SK6 A;  2IX1 A;  3PGZ A;  3TRE A;  1ROD A;  2KBN A;  1EIY B;  1BF4 A;  2K04 A;  3VYS A;  3CCS A;  1CA5 A;  1QUQ A;  5IP7 H;  1XPU A;  1STN A;  5FLM G;  4OHJ A;  2LS0 1;  5A2Q E;  3NEM A;  4BA2 I;  3BZC A;  1VQ8 A;  4IPG A;  5FO9 B;  4YHH L;  1EYG A;  5E7N A;  3ERS X;  3SDZ A;  4Y52 H;  5FOB B;  4KHP L;  3I4N B;  2XSC A;  3OYY A;  2WII B;  2KEC A;  1PH1 A;  4A3J H;  1Q82 C;  3PO3 B;  4JW0 A;  1VQA A;  3GTM B;  2EY6 A;  4R4T A;  3L0O A;  4ZAI A;  4IN3 A;  4KTA A;  1TT2 A;  4LF7 L;  4IUU A;  2MP1 A;  1KDC A;  1D2B A;  3RN5 A;  1PV4 A;  1Z6H A;  2EVB A;  3K81 C;  3WDN A;  2SNM A;  1QVF A;  4QGU A;  2HUG A;  1L1O C;  2PW5 A;  2R7Z B;  3MXU A;  2J7Z A;  3GV3 A;  4C2M H;  2UXD Q;  3S15 H;  2N49 A;  4UAI A;  3HOX G;  1I3Q H;  2B29 A;  1EU4 A;  1GJX A;  1R4P B;  4LMQ D;  3MTS A;  2X69 A;  5KYL A;  2EPB A;  3A0J A;  1HNZ Q;  2KHI A;  5IYC G;  2MO1 A;  4R8I A;  1UAP A;  1Q1E A;  1VMP A;  1CM9 A;  4ZQ3 A;  1JOQ A;  3S9W A;  1E1T A;  2XNA C;  3J7Y W;  2GN5 A;  3A8J E;  3U58 A;  5EAY A;  4KY7 A;  1EQQ A;  3RZO B;  5CR3 A;  1EEI D;  2R93 B;  3AYH B;  3J80 i;  4C1N I;  1B44 D;  2WB1 E;  2QDL A;  3Q6S A;  5CMD A;  4YY3 Q;  2MUY A;  2Z4H A;  4DR7 L;  1W3S A;  4J8Q A;  1F2Y A;  1T5X D;  4JI3 L;  3A56 A;  3A5U A;  1M8A A;  3CCL A;  4H44 C;  4DV6 L;  2RVL A;  1HXY D;  3ULL A;  4BY7 H;  4KKT A;  5GAG C;  3HKZ E;  2I0Q A;  5JJL A;  2O5I C;  2K32 A;  2EYH A;  1EUJ A;  5I4D A;  1F9P A;  2WB1 G;  4NKL A;  3VA5 A;  4AQY L;  3NXW A;  4HAE A;  4BXX H;  1STG A;  4A3G H;  2RHS B;  5AJ3 Q;  2XWJ B;  3RUZ A;  2AQ2 B;  3E0J A;  1KQS A;  1F2L A;  3KUP A;  2KEE A;  4RAU C;  3GTJ B;  1HZB A;  3W2D A;  3MEF A;  1HA5 A;  1RTO A;  2R61 A;  2G9H D;  5E3F A;  4B3S Q;  1NNX A;  3CD6 A;  3GTQ B;  2ENB A;  4J1M A;  5C0X G;  3NQI A;  1EY4 A;  3BVG A;  2Z6K A;  1VQP A;  3U4V A;  1HR0 Q;  1Z47 A;  3UDI A;  4HJ7 A;  4JOI A;  1IYJ B;  5IIF A;  1EWC A;  1GXD C;  4FP5 D;  1Y8P B;  4BS9 A;  4YIJ A;  4DV1 L;  1QIL A;  4DR4 Q;  1CA6 A;  1BXT A;  3E6Z X;  3FPP A;  4X64 Q;  4ZKB B;  1CT1 D;  1PH9 A;  5M3M H;  4G7Z C;  2B2U C;  2KEN A;  1IHZ A;  1OXV A;  3PIO 3;  4BBS G;  3TP7 A;  4LF5 L;  4GN3 B;  1VMC A;  2ATW A;  2K5V A;  2UUB L;  4CDC C;  2FXQ A;  1G6Z A;  3GTK H;  2SDF A;  1VQ4 A;  1H95 A;  4X3U A;  4DV5 Q;  4CDF C;  2RF4 A;  2XTI A;  3TZD A;  4GOP C;  1SJH D;  3F2D A;  4M1U B;  4HJ9 A;  2JEB I;  4B9W A;  5HUR A;  2EDG A;  4A3F G;  2R7D A;  1JB3 A;  3KBX A;  1O78 A;  3ERO A;  5FLX L;  4QY7 A;  1V8Q A;  1XJV A;  1OXT A;  2PMZ E;  1HH2 P;  4GN5 A;  1VQI A;  3I8Z A;  1W6J A;  1PA6 A;  1VS0 A;  2YTX A;  4A3C H;  2E2H B;  1ILQ A;  5FLX c;  1I6H B;  1I4P A;  2EXZ A;  5I9O A;  4Y7N H;  2ZTD A;  4PNY A;  5FK9 C;  3FKI H;  1KHI A;  3KJO A;  4ZUJ A;  1Q81 C;  3I2Z A;  3KDF A;  1K83 B;  2NVY H;  3TP6 A;  2JA9 A;  2UXD L;  2F0M A;  3A8I E;  3D3R A;  4ME5 A;  1SXT A;  5M5X H;  3K59 A;  2F03 A;  2ZXP A;  2LMC B;  1U9R A;  1HRJ A;  3KJP A;  3S1Q B;  2DNE A;  1G6P A;  3UDF A;  2KCC A;  1O7Y A;  1YNN C;  3S1M B;  1K3R A;  3HOY H;  1HNZ L;  2F4V Q;  1FGB D;  4HID A;  1DD2 A;  5EKI A;  1U0L A;  3VR3 A;  5A35 A;  1E22 A;  3VDY A;  1E2W A;  4J6H A;  4NXM Q;  3I7F A;  1D6E C;  2MHV A;  4A3I H;  3H0G B;  4JI4 L;  2B8F A;  1FJG Q;  4ID6 A;  1TWC H;  3QOL A;  3I72 A;  4JVZ A;  1LTT D;  3JAM i;  2JYO A;  4XXE A;  3HS0 C;  2E75 C;  3R3O A;  3PF5 A;  4LF9 Q;  4KD4 A;  2HHH Q;  3AFQ A;  4YY3 L;  3UDX A;  3MVV A;  3ULP A;  1U4P A;  1PTO F;  1EYD A;  3EQL C;  3DWQ A;  4ULL A;  3AFP A;  4DK0 A;  5EJW A;  3M7N A;  1RD9 D;  1PH6 A;  4JYA Q;  3M7G A;  1CZW A;  1SRU A;  3I90 A;  3NEL A;  3OTO Q;  3WOE A;  5AJ3 L;  2BCO A;  1EQR A;  3ND8 A;  3W1B A;  5EBC A;  1OXS C;  1YJ9 A;  4BY7 G;  1ICF B;  1C9O A;  2F0E A;  4KN4 C;  4L5R C;  2F0U A;  4GS3 A;  3I73 A;  4WRD A;  4BXX G;  2EQS A;  3H09 A;  2DGY A;  5BN4 A;  5C4H A;  1MBY A;  4GNX C;  2VB2 X;  4HIO A;  4C3J H;  3CME A;  1S40 A;  1WD0 A;  1IL8 A;  2PQE A;  1XXG A;  3D31 A;  5ELC A;  1HR0 L;  3M4O B;  1IBK Q;  4P73 A;  1STY A;  4DR4 L;  1QWY A;  1S5E D;  3IFT A;  1SE2 A;  1QNK A;  4HR7 B;  4X64 L;  3K8A A;  2E2D C;  3CCU A;  2WKC A;  1RJT A;  2YV5 A;  2ES2 A;  2EJF C;  1E24 A;  4PQX A;  4DU9 A;  1BBW A;  1EY5 A;  1QZG A;  1FGU A;  5DM7 3;  3FVQ A;  5M3M G;  1MD2 D;  4GZY C;  2BA0 A;  3Q0A A;  3NTK A;  4HED A;  2QA4 A;  4DV5 L;  1DJR D;  2OCE A;  4FF4 A;  1CKN B;  3DWP A;  3F2C A;  4XYO A;  4YWK A;  1L1O A;  1C7Y A;  4XT3 B;  1VQL A;  2JSO A;  3UE0 A;  3RZD B;  4CKB A;  4CDD C;  3HOZ B;  4C56 C;  4R4O A;  3GTP H;  1O7Z A;  1DGS A;  1GO3 E;  4CJ0 B;  3M85 A;  1EU3 A;  1YVC A;  2IHE A;  2NVQ B;  1ENA A;  4K8J A;  4FVM A;  2NVT H;  4OIK A;  2EZV A;  4IUT A;  4RWS C;  2JA5 B;  1II3 A;  1TXY A;  2RQX A;  2NN6 H;  5COY A;  3PO2 B;  4TKO B;  4RGT A;  2D62 A;  1ENC A;  1JT8 A;  2CH4 W;  1YEZ A;  5EGT A;  5C4X G;  5CV5 A;  5LMN L;  1IBL L;  4DFA A;  1YIT A;  5EKL A;  1E2V A;  4FNF A;  4DPG A;  3S1R H;  3KLR A;  4A3C G;  4AYB E;  1X6O A;  1U5K A;  5DAU A;  3SK5 A;  3GTO H;  4OWW B;  1PTO B;  1UNS A;  2NBF A;  4P71 A;  3WOF A;  1WI5 A;  1SYD A;  3K7U C;  2N55 A;  4PZ6 A;  1ZXT A;  5JVG 3;  3FKI G;  4E6I A;  1Y1V B;  2Z9H A;  3V05 A;  1QCB D;  2HDL A;  1S5C D;  2VQF Q;  2IW3 A;  5KGU A;  1ASZ A;  1WTP A;  1STB A;  2A1A A;  2VL6 A;  2ZTE A;  2I5H A;  4IJL A;  4L5S A;  1A6X A;  2I5L X;  4QIW B;  4IFD I;  4R4Q A;  1HTP A;  1TS2 A;  1V43 A;  3J7A V;  1L0W A;  2WKD A;  4KD3 A;  1ET6 A;  5C4J B;  2Z4I A;  3M4P A;  4N8F A;  3HOY G;  3S2H B;  4N8X 1;  3C3L A;  2MJ8 A;  4RGM A;  4IJH A;  2PZW A;  4HJA A;  1F9Q A;  1HNX Q;  1FJG L;  4P74 A;  1RTN A;  3OHX C;  4KN7 C;  3MHB A;  1I4R A;  4LF9 L;  1UE6 A;  5D3I B;  3LGJ A;  2HDM A;  1EWI A;  1PRT F;  1WOC A;  3FEW X;  4A3B H;  3T13 A;  1V1P A;  1SEB D;  3GTG H;  2MFI A;  4JYA L;  1L0Y B;  4GKJ Q;  3MXN A;  2B2U A;  2QCP X;  4YCW A;  3OTO L;  2GVB A;  5ISR A;  4ILW A;  1VQ7 A;  1JCK B;  2F0T A;  4A3K B;  2ZJR A;  5I2Y A;  1DXM A;  3R8B A;  2E2J B;  4ABN A;  3TEH B;  3GD7 A;  1EQV A;  3DM3 A;  1UWV A;  1FL0 A;  4F88 A;  2BDO A;  1KL9 A;  3MAQ A;  1EYA A;  2DUD A;  2Z8L A;  5JVH 3;  1HJP A;  2VS1 A;  3HG9 A;  4GOP A;  2VUM H;  2AKW B;  1JWS D;  5BR8 Q;  1IBK L;  1EOV A;  1SYG A;  4JBW A;  4PMC A;  3GQB A;  4JI2 Q;  3T56 B;  3PIO A;  1SLJ A;  2KHJ A;  2NZH A;  4AH6 A;  3PF4 A;  1YNN D;  3CW2 C;  3LX0 A;  4A3M H;  3AMU A;  4IFD H;  2AUJ D;  1EZ6 A;  4DR2 Q;  5J39 A;  1M90 C;  3R93 A;  3CCR A;  1Y1W B;  3NP8 A;  3H6M A;  1XNR Q;  4LUZ A;  1LYL A;  3M4Y A;  1T9H A;  4PMB A;  4CJ1 B;  5C5L A;  2WAQ G;  3TBI B;  4JBM A;  3CP0 A;  1R9T H;  1R4Q B;  3OSO A;  2VZA A;  1A2T A;  2H4O A;  1RIP A;  4OL7 A;  2XRQ D;  3SR1 A;  2F0J A;  4C3I B;  1VQO A;  1MSG A;  3R2T A;  3BDC A;  1IW7 D;  3RN2 A;  3BZD B;  5CV9 A;  2XRS D;  3HEJ A;  3W5O A;  2F0P A;  4CBV A;  5GRO A;  4KI0 A;  2VNU D;  4KKS A;  3BDO A;  1EWH A;  5KEE A;  1HR0 W;  1BKB A;  4K14 A;  2NN6 G;  1SMY C;  1JB7 A;  5BN3 A;  1PRT B;  2K50 A;  2DJG C;  2F0S A;  4GLV B;  4RCO A;  5F2D A;  1GKH A;  4NB3 A;  2L12 A;  2K05 A;  2WAC A;  1VQ9 A;  3J80 L;  1XPR A;  2OWO A;  4LFC Q;  1QVG A;  3FMC A;  1F2Z A;  1MKH A;  1O7L A;  4A93 H;  5E4X A;  1DOL A;  2VQF L;  2JA8 G;  1D7Q A;  1LTB D;  3BZK A;  1MIU A;  2ID0 A;  4KMU C;  3J80 c;  3A8K E;  1EY7 A;  2PCF B;  3KDF B;  3AB9 A;  3L3O C;  2EJM A;  1HPC A;  2F0Q A;  2PI2 A;  2B63 H;  3S14 H;  2WFW A;  5ELO A;  1S5D D;  4LF6 Q;  2NYZ D;  1GUT A;  1WTR A;  2H1E A;  3FHW A;  1AW7 A;  3VYR A;  1C0A A;  3OW2 A;  1RCV D;  3GDE A;  1KDA A;  3FDT A;  4HMJ A;  3TQY A;  4G7O C;  1PTO D;  2K28 A;  3MEH A;  4O0A A;  4GNX A;  3ONA B;  1JJG A;  1A2U A;  4U67 3;  1I94 Q;  4A3F B;  1JWU D;  4A3E H;  4WOR A;  3DEO A;  3GTL H;  3M3Y B;  1XNQ L;  4JBJ A;  4C3H H;  4EQP A;  1A0I A;  2C35 B;  1LTL A;  4LUO A;  3CXC A;  2Q8I B;  4PV1 C;  1D5X C;  2QIL A;  2RCN A;  4K0K Q;  4GKJ L;  3M4Q A;  3JAM E;  4DGZ A;  2UXC Q;  1KAW A;  4A4I A;  3HOU G;  4FXK C;  4UP8 A;  4A3B G;  1X3E A;  3D0F A;  5JPN C;  5EPL A;  4A3D H;  2V1C C;  3VR5 A;  3S16 H;  2F0L A;  1B9M A;  2ZXR A;  2MGS A;  1EIH A;  2R3Z A;  3VYU A;  1K8G A;  2A6H D;  5BR8 L;  4K6D A;  1E2Z A;  1Z7T A;  5DEH A;  5JJI A;  2ZT9 C;  2DN8 A;  3PV0 A;  4EQO A;  1GUN A;  5IT9 L;  4JI5 Q;  4JI2 L;  3NTI A;  4EVO A;  1PH4 A;  1EZ8 A;  1CQF A;  2VUM G;  1RF2 D;  3HOV B;  4N9T A;  1H9M A;  3J7A F;  2AQ1 B;  2EYP A;  4DR2 L;  3CRK C;  1I4X A;  4RHR A;  5IT9 c;  1KRS A;  1YHB A;  2F0N A;  4QB4 A;  3S2D B;  3EVQ A;  4JC0 A;  3HOW B;  4A3M G;  1XNR L;  4POG A;  4DNI A;  4A76 A;  3I4N H;  3DMU A;  2VXW A;  4JG2 A;  4O42 A;  3BG3 A;  1GUW A;  1Y8N B;  4LF8 L;  3PO3 H;  1GUO A;  2BDN A;  2CWA A;  4DR3 L;  4YCV A;  1SBB B;  3KF8 A;  4DK6 C;  3EIV A;  4DAY A;  2L55 A;  2Y0S E;  3FP9 A;  4V19 0;  1I50 B;  4WJ3 M;  3NK9 A;  1AE2 A;  3PQI A;  1ASY A;  1K8M A;  3DLL A;  1SMX A;  1UUP A;  2R7Z H;  2NTS A;  4RKB A;  1TVX A;  4B3T Q;  4FYD A;  3CHB D;  3BDL A;  2BA1 A;  2DY8 A;  4MIU A;  3TP8 A;  4JI8 L;  4RGN A;  5ELB A;  2Y0S G;  3D8G A;  2EY1 A;  3PUZ A;  2YU9 B;  1LTI D;  2UUC Q;  4IZ8 A;  1SJE D;  2JE6 I;  4QF4 A;  3JAM L;  4DXF A;  2Q2I A;  4H02 A;  1A63 A;  5A2Q L;  2G9D A;  2HCI A;  5GAD C;  1LAC A;  1KAA A;  1NMF A;  5M5Y B;  3NTH A;  1B8A A;  4MNO A;  2CH4 A;  2OF1 A;  1F9R A;  2N88 A;  2CVR A;  3JAM c;  3RZO H;  2F0D A;  3EA6 A;  4A93 G;  2R93 H;  1O7I A;  1Q86 C;  1G91 A;  1MJC A;  3HKZ G;  1P16 A;  4XT1 B;  3MA2 B;  1AZP A;  4LF6 L;  1KLG D;  3STB C;  1Q7Y C;  1DOM A;  2JK8 A;  3BYY B;  2B63 G;  4OEM B;  4UDU C;  4BY1 H;  3A54 A;  3AEV A;  3C1F A;  1ZEQ X;  4O2D A;  4DV3 Q;  4IQZ A;  3S17 B;  1PRT D;  2Z1C A;  1K73 C;  2PW7 A;  1VQC A;  3GTK B;  2Q8T A;  2PYK A;  3G48 A;  2KQ3 A;  3N52 A;  1I94 L;  2EY2 A;  1PH2 A;  4QUF A;  1JOK A;  4PZ7 A;  1LTR D;  4NP5 A;  3GTJ H;  3SEB A;  1C48 A;  3Q23 A;  3KBG A;  1I6V C;  2PZT A;  2VW9 A;  2XWB B;  3GTQ H;  1NAP A;  4A3E G;  2ZJQ A;  4CGY B;  4K0K L;  2O2L D;  1Y8O B;  2UXC L;  1Q3L A;  2KCM A;  1G51 A;  2AMC B;  4RKL A;  5IGF A;  5C4X B;  1JQY D;  5D65 A;  3S24 A;  1BNZ A;  2K33 A;  3DUZ A;  4K2L A;  3PUV A;  1DM0 B;  1Q90 A;  4F7X A;  5IP7 G;  2L1B A;  1J5E Q;  3ERQ A;  5CV6 A;  1V1P B;  3E0E A;  4LFB Q;  5E1F A;  1VCI A;  4DV7 Q;  1NBW A;  1SNP A;  3MXN B;  3NWT A;  3EBE A;  4A3D G;  1HFN A;  2CQA A;  3K0X A;  4NXN Q;  1FD7 D;  5H1S E;  2EXD A;  4IPH A;  2K03 A;  4JI5 L;  2NZ1 D;  1YNJ C;  2EJG C;  2J0T D;  4A3J G;  1JJ2 A;  3K58 A;  1EEF D;  5C44 B;  1QB5 D;  4GOP B;  3TP5 A;  1KXL A;  1PH7 A;  3A5Z B;  5HGQ A;  2IHF A;  1B53 A;  3M9B A;  2K14 A;  2JA6 H;  1QE6 A;  5NUC A;  5I9P A;  3E3X A;  1IL2 A;  5IP9 H;  1X54 A;  3J7A 5;  1IXR A;  1HZC A;  1QOH A;  2B3G A;  3L2P A;  1QZH A;  1KRT A;  4IPD A;  2E2H H;  3CC2 A;  2ALY B;  1G2T A;  1X9N A;  2CFM A;  4IUV A;  3T1H Q;  2LFN A;  1SYC A;  5K36 H;  1DOK A;  1I6H H;  3A7L A;  5FJ8 H;  2E76 C;  4JI0 Q;  3PO3 G;  1VQG A;  1CHQ D;  3U9S A;  4BBR B;  1K83 H;  3NEN A;  4NDX A;  4TVA B;  4B3T L;  5CV7 A;  4V0B A;  3H15 A;  1LM0 A;  2A68 C;  3P1H A;  3PSI A;  1NUC A;  1TY0 A;  3OMG A;  2K4K A;  2IPK D;  2R7Z G;  2BE5 C;  3S1Q H;  4IPC A;  1E3P A;  4X3K A;  2UUC L;  3S1M H;  4MN3 A;  2A19 A;  2A74 C;  1PXU A;  1VQB A;  3EFX D;  5COR A;  2O4X A;  3QOJ A;  5C3W A;  2XIW A;  3TSS A;  1G8Z D;  4KJO A;  3HZX A;  1AH9 A;  3H0G H;  4XQJ A;  2BH8 A;  3CAM A;  4HCE A;  1NR4 A;  1N32 Q;  4B3S L;  2B39 A;  4K8I A;  5C3E B;  5C4Z A;  4A3G G;  3W1G A;  1IKM A;  1YZ6 A;  3BJU A;  2CCZ A;  1GUG A;  2F0F A;  2RDF A;  2I07 B;  2ZM6 Q;  1NY4 A;  2IJ0 A;  2R93 G;  5LL6 S;  3K6O A;  4R4C A;  2N78 A;  3K5N A;  3KOJ A;  3K5M A;  1VQ6 A;  4DV3 L;  2WAQ B;  1EIF A;  1PFN A;  4IOC A;  4F8M A;  1XYI A;  1U4M A;  2D0O A;  3HFZ B;  2K01 A;  3H94 A;  4BY1 G;  1MGS A;  2B8G A;  1LTG D;  3K7A B;  3OMC A;  4LW1 A;  3V2T A;  1VQK A;  2NUC A;  4IUR A;  3NE5 B;  1DZ1 A;  2AUK A;  1TQO A;  1VQH A;  2JQO A;  4DAP A;  1EOT A;  2FJ2 A;  2Q2U A;  4IUQ A;  4XQQ A;  4GNX B;  2LXJ A;  3H3V I;  1K8O A;  1RKN A;  4UHV A;  1HQM C;  1W2B A;  3M4O H;  1UE1 A;  5KRU A;  3NBH B;  3CQZ H;  4K6L A;  1J5E L;  1BCP C;  4B3R Q;  2R92 H;  3NUC A;  4LAA A;  3QJY A;  3PCO B;  1ZYR C;  5EPJ A;  4DR1 Q;  4LFB L;  2WP8 J;  4CDE C;  1WJJ A;  1WCM B;  4DA2 A;  1QUQ B;  1KD1 C;  1STA A;  5DNF A;  4FDB A;  1MHW C;  2B2Y C;  4NXN L;  2BOS A;  4OO1 I;  1F9S A;  3ICE A;  1TWH B;  5GAE C;  2JA8 B;  1Z9F A;  2OT2 A;  2FMM A;  1HHV A;  4K5V A;  4CKE A;  1SYB A;  1XMQ Q;  2UUA Q;  3MFG A;  2L4N A;  3OOC A;  4N9P A;  1NE3 A;  4EX5 A;  2K5D A;  3VR4 A;  3RZD H;  3KLW A;  1FYC A;  2AWN A;  2PNR C;  5IGC A;  3I4M B;  4QMG A;  2OXP A;  4H0L C;  3HOZ H;  3S1N H;  3STB D;  2NVQ H;  3MZ5 A;  4HMI A;  1D5M C;  4HSP A;  1K8A C;  1AZQ A;  1V1Q A;  2JA5 H;  4AYB G;  2RHQ B;  5JAV A;  4KY6 A;  3PO2 H;  2VB3 X; 
#chains in the Genus database with same CATH homology
 3H91 A;  2EOT A;  1S5B D;  1EFI D;  1PFM A;  2MPM A;  2DY7 A;  3Q24 A;  4FF1 A;  3URY A;  5M3F B;  2K1B A;  3I91 A;  5E4W C;  3G6J B;  1TS4 A;  4X3T A;  5EKK A;  3D4R A;  3W3A A;  5K36 G;  2FMC A;  1PZJ D;  3HOU B;  4A3B B;  1PMR A;  1SDF A;  3D6C A;  2IX3 A;  4XYQ A;  1KDB A;  1V1O A;  2SNS A;  5ELE A;  4DNT B;  1D5Z C;  3I70 A;  1SYF A;  1XWE A;  1TWF B;  4ZRZ A;  1QJO A;  4DK1 A;  1WVL A;  1RHP A;  3RMH A;  1YNJ D;  1ESR A;  5M5W B;  1XX8 A;  5IGD A;  1H9K A;  1BQQ T;  4KK7 A;  1FNW A;  1LAB A;  2PO4 A;  2LKV A;  2KCN A;  2KUM A;  4HN7 A;  3P75 A;  3HOX B;  2J4X A;  2F4I A;  3PIP 3;  1SFO B;  3C1E A;  4H7B A;  3J81 E;  3R2I A;  1ESF A;  5IGG A;  4C3J G;  5LL6 X;  3NHH A;  1D1I A;  2K7V A;  5CV8 A;  1CQV A;  2NWG A;  4G57 A;  3BS1 A;  3L9A X;  3I4L A;  5I2X A;  1JC7 A;  2HCC A;  1TWG B;  5J22 A;  1WTV A;  1G2S A;  5C0X I;  4G4K A;  2EY5 A;  4HTH A;  4RFB A;  5KND A;  3NWS A;  4DAV A;  4KHV A;  1QNU A;  2A68 D;  3MWY W;  1CFM A;  2FFK B;  4R8N A;  3DXJ C;  1CTM A;  4IFD J;  3PUX A;  3E5S A;  2EYJ A;  3V96 A;  3KLS A;  2E2I B;  5EPK A;  1ILP A;  2WB1 B;  4RCN A;  4ZK9 B;  1EY8 A;  3NSW A;  3HKZ B;  4QCL A;  4DF7 A;  2F3W A;  4WJW A;  3IKJ A;  1LO5 D;  3S14 B;  2RDH A;  4WFN 3;  3LNN A;  5EBD A;  2NTT A;  2GA4 B;  2EYO A;  1TR5 A;  4BBS B;  3OW7 A;  1T5E A;  3IAY A;  1WTX A;  3BVM A;  1TWA B;  1NSN S;  1IYU A;  5JOB A;  2E74 C;  1JOO A;  2AWO A;  2M9V A;  1EY9 A;  3QIA A;  3Q22 A;  3SVM A;  1BCP D;  2ICI A;  5CGK A;  3K5O A;  1PDQ A;  1Q1B A;  2XN9 C;  1JOR A;  1LLR D;  3C46 A;  3SK8 A;  3ZYY X;  3LWU A;  4Q5V A;  2SOB A;  1BO0 A;  4A3J B;  5C6A A;  1VDZ A;  1X32 A;  2PMZ B;  1E0B A;  3SK4 A;  1J8I A;  4TSS A;  3C2P A;  3ITP A;  1U4R A;  1GUS A;  3F2U A;  3QWN A;  4H13 C;  5D3D A;  4K5W A;  1HFG A;  4C2M B;  3S15 B;  2QKI C;  2TMP A;  1I3Q B;  2KHS A;  1EL0 A;  1BOS A;  2A69 C;  2F3V A;  2IX0 A;  2JEA I;  2M00 A;  2B2Y A;  2M2L A;  1B50 A;  1SND A;  2RBM A;  3PMF A;  4IFD G;  3RLF A;  3OPO A;  1PLF A;  1WTQ A;  1ENF A;  3SXH A;  3SE0 A;  3NBI A;  3IL8 A;  2B2T C;  1SNO A;  3QG1 A;  1CZG A;  4LJZ C;  1AFP A;  4BA1 I;  5FKA C;  1XTC D;  4NMZ A;  5I6Y A;  2F1M A;  3D6W A;  1ZKO A;  4BY7 B;  2LY7 A;  4BWG B;  4KV6 A;  2B2V C;  1GHJ A;  4A3G B;  4KKU A;  1SSO A;  5FLX E;  1SNC A;  2EE1 A;  1UEA B;  4FXG C;  2K5Q A;  4RA8 A;  1AN8 A;  4C3I G;  1TS3 A;  1ONL A;  4BY1 B;  1STE A;  1D1K A;  3NQT A;  1TS5 A;  2NB0 A;  1M4V A;  3DHQ A;  4C1N K;  5JJZ A;  5M3M B;  1U4L A;  1EY6 A;  1RDP D;  1TY2 A;  1HUM A;  2L9H A;  4ZLT F;  3MC0 B;  5DM6 3;  1GHK A;  4TRD A;  2IWH A;  3MFY A;  4XIG S;  2F0O A;  1EQT A;  2YYZ A;  1FNU A;  5CYU A;  5FO8 B;  3KK7 A;  3BVZ A;  1S5F D;  1OO9 B;  2IT1 A;  3FRP B;  2F0G A;  3PUY A;  1B4O A;  3RD4 A;  4FF3 A;  1MSH A;  1JIC A;  4C3H G;  1W6K A;  3A7A B;  3G7L A;  3TZU A;  3OIP A;  2EYF A;  1SMY D;  3GO5 A;  3TME A;  2WIN B;  3EJI A;  5KNC A;  3VYT A;  4Y7N B;  3FKI B;  4FXD A;  2OEO A;  3IFD A;  1LT5 D;  3CU7 A;  1PFB A;  2NVY B;  5BN5 A;  1H9J A;  3T53 B;  1SE3 A;  1BDO A;  3MXP A;  1H9S A;  4AYB B;  1F2M A;  2JXM B;  5M5X B;  2JA6 B;  3LWE A;  4Q0F A;  2D5D A;  1B2T A;  4Z9C B;  3HOY B;  4FO2 A;  1B3A A;  1KTK A;  5CV4 A;  1WTW A;  1NCV A;  5T1I A;  1BR9 A;  2CHB D;  1L0X B;  5T1G A;  2SEB D;  4OIJ A;  4A3I B;  2HQE A;  2CW0 C;  1TWC B;  2O5J C;  1SAP A;  1CI3 M;  3X3N A;  4I7Z C;  4CKC A;  1PZK D;  1C4Q A;  1FR3 A;  3K57 A;  2PPB C;  2QF7 A;  2B2W C;  2XVS A;  3SHL A;  1SE4 A;  1QG7 A;  5EQ0 A;  2AQ3 B;  2L0C A;  2QEJ C;  3U9O A;  4ODG A;  5JEA H;  4K5X A;  1LTA D;  4L63 B;  1SYE A;  3VR2 A;  3DWA A;  4DXG A;  3QB3 A;  3I3C A;  1OXU A;  4CHT B;  2L11 A;  2F0K A;  5G3L F;  1BCP F;  3NPP A;  1VF5 C;  5IOD A;  1VF7 A;  3A55 A;  4C3J B;  3ND9 A;  1IW7 C;  2A69 D;  1FNV A;  2RDG A;  1A3V A;  2KOL A;  5JPM C;  5JEA J;  2NN6 I;  5AFW A;  4DN4 M;  3CKI B;  1TKW B;  1J9O A;  1WTO A;  1LT4 D;  1PYW D;  1EYC A;  3T51 B;  4KJN A;  1CK1 A;  1A3U A;  4EQN A;  5CBE E;  3K5L A;  1IKL A;  4R9W A;  2F0H A;  1I4G A;  2DNC A;  3DEP A;  1F77 A;  2KA7 A;  2RSN A;  2C9O A;  3CQZ B;  5C5M A;  3GTP B;  2R92 B;  4XQN A;  1LTS D;  2NVT B;  1EIG A;  2D9U A;  3HP3 A;  2A6E C;  1B1Z A;  2A5H A;  3VA7 A;  2KJX A;  2KVM A;  2RKS A;  1JWM D;  5C3X A;  3S1R B;  5I6W A;  3UI2 A;  2F0W A;  2K5W A;  3GTO B;  1PTO C;  2K6A A;  3KLS X;  4L6T B;  3X3M A;  5ELF A;  2B2T A;  3H3V C;  3S1N B;  1JR0 D;  2RSO A;  4TQU S;  1I4Q A;  4RH6 A;  1BUV T;  1STH A;  1BCP B;  2NVX B;  3P20 A;  3TDQ A;  1TII D;  4P2C B;  2B2V A;  2C5C A;  5KIX A;  2KED A;  2R6G A;  1I4H A;  2A6H C;  4XDX A;  1G29 1;  1GOZ A;  4B08 A;  1PTO H;  1DCZ A;  1ET9 A;  4IUP A;  3T16 A;  3MXG A;  3DM1 A;  3OWE B;  4FF2 A;  3OWF A;  1OXX K;  1C8C A;  3GTG B;  3T4A C;  3OIQ A;  1KNA A;  5JEA G;  1A15 A;  2WV6 D;  4O1N A;  3BYT B;  4F87 A;  4OO1 H;  4JK1 C;  4ZYS A;  1ML0 D;  1X3P A;  4CJ2 C;  2VUM B;  1HTL D;  2V4D A;  1JE4 A;  1LT3 D;  5KYI A;  1Q8I A;  3J80 E;  4A3M B;  5IGE A;  4M8A A;  4RHS A;  3O13 A;  5TSS A;  2JP1 A;  3QO2 A;  1A3T A;  2RA4 A;  5KNB A;  1EY0 A;  4B9X A;  4XTC S;  1CHP D;  2D2C C;  4NW2 A;  3HGB A;  2CW0 D;  3FPU B;  1R9T B;  4RGO S;  3AU7 A;  4HSV A;  2TSS A;  1PZI D;  1MI2 A;  4ZKC B;  5J1Z A;  1H9R A;  4I65 A;  3CRL C;  2X6L A;  2Y0S B;  4LK1 C;  2BE5 D;  2L5T A;  3HRZ C;  4S3S A;  1HQR D;  1Y69 U;  1HCZ A;  4QUC A;  4K2K A;  1NR2 A;  1PRT C;  4U68 A;  5LHY 1;  4ZUI A;  2QDB A;  1DYQ A;  4MHE A;  5FO7 B;  4KY5 A;  2X6G A;  1WD1 A;  2B2W A;  2EYM A;  4IUN A;  3GV6 A;  4A93 B;  1HA6 A;  3K0Y A;  1IYV A;  1TU2 B;  1S4Z A;  1X3Q A;  2ICE C;  1LV9 A;  2EYL A;  1AEX A;  3D4W A;  3VR6 A;  2B63 B;  1H9S B;  2PZU A;  4OGQ C;  2A73 B;  4L8J A;  3TN2 A;  5IT9 E;  1SNQ A;  3L7Z C;  5M9O A;  1B9N A;  3PUW A;  1O80 A;  2F0V A;  2FIN B;  1Q12 A;  2FHT A;  1AP0 A;  5ELD A;  1LT6 D;  3J81 L;  4G7H C;  2JA7 B;  1DON A;  5HGT A;  4A3E B;  3GTL B;  5K5P A;  5CBA E;  5C0X H;  4C3H B;  4EGV A;  3P7J A;  4DNR B;  2I46 A;  5G3L D;  1ICW A;  2Q8R E;  4KHZ A;  1HUN A;  2A6E D;  5CC4 A;  4X3S A;  4IAL A;  1ZYR D;  5IGB A;  2F0I A;  4PMW A;  3GP7 A;  4A3D B;  3S16 B;  3N6R A;  1KLU D;  1SNM A;  4HCS A;  1BBX C;  1KAB A;  5D14 A;  2IL8 A;  1KNE A;  5IOC A;  3D4D A;  3NBH A;  2ZXO A;  5C0X J;  4OO1 G;  3SK6 A;  2IX1 A;  1ROD A;  1BF4 A;  3VYS A;  2K04 A;  1CA5 A;  1STN A;  4OHJ A;  2LS0 1;  5A2Q E;  4BA2 I;  5FO9 B;  3SDZ A;  5FOB B;  3I4N B;  2XSC A;  2WII B;  2KEC A;  3PO3 B;  3GTM B;  4ZAI A;  2EY6 A;  4IN3 A;  4KTA A;  1TT2 A;  4IUU A;  2MP1 A;  1KDC A;  1D2B A;  1Z6H A;  2EVB A;  3WDN A;  2SNM A;  2HUG A;  2PW5 A;  2R7Z B;  3MXU A;  2J7Z A;  3GV3 A;  4UAI A;  1EU4 A;  1GJX A;  1R4P B;  4LMQ D;  3MTS A;  2X69 A;  5KYL A;  2EPB A;  4R8I A;  1UAP A;  1Q1E A;  1VMP A;  1CM9 A;  4ZQ3 A;  1JOQ A;  3S9W A;  2XNA C;  3J7Y W;  3A8J E;  4KY7 A;  3RZO B;  5CR3 A;  1EEI D;  2R93 B;  4C1N I;  1B44 D;  3Q6S A;  5CMD A;  2MUY A;  2Z4H A;  4J8Q A;  1F2Y A;  1T5X D;  3A56 A;  1M8A A;  4H44 C;  2RVL A;  1HXY D;  4KKT A;  2O5I C;  2K32 A;  2EYH A;  5I4D A;  1F9P A;  4NKL A;  3VA5 A;  3NXW A;  4HAE A;  1STG A;  2XWJ B;  3RUZ A;  2AQ2 B;  3E0J A;  1F2L A;  3KUP A;  2KEE A;  4RAU C;  3GTJ B;  3W2D A;  1HA5 A;  1RTO A;  2R61 A;  2G9H D;  5E3F A;  3GTQ B;  2ENB A;  4J1M A;  5C0X G;  3NQI A;  1EY4 A;  3BVG A;  1Z47 A;  5IIF A;  1EWC A;  1GXD C;  4FP5 D;  1Y8P B;  4BS9 A;  4YIJ A;  1QIL A;  1CA6 A;  1BXT A;  3E6Z X;  3FPP A;  4ZKB B;  1CT1 D;  4G7Z C;  2B2U C;  1IHZ A;  1OXV A;  3PIO 3;  3TP7 A;  1VMC A;  1G6Z A;  2SDF A;  4X3U A;  3TZD A;  1SJH D;  4M1U B;  2JEB I;  4B9W A;  5HUR A;  2EDG A;  1JB3 A;  3KBX A;  1O78 A;  3ERO A;  5FLX L;  1V8Q A;  1OXT A;  3I8Z A;  1W6J A;  2E2H B;  1ILQ A;  1I6H B;  1I4P A;  2EXZ A;  5I9O A;  4PNY A;  5FK9 C;  4ZUJ A;  3TP6 A;  1K83 B;  2F0M A;  3A8I E;  3D3R A;  4ME5 A;  1SXT A;  3K59 A;  2F03 A;  2ZXP A;  2LMC B;  1U9R A;  1HRJ A;  3S1Q B;  2DNE A;  2KCC A;  1O7Y A;  1YNN C;  3S1M B;  1FGB D;  1DD2 A;  5EKI A;  3VR3 A;  5A35 A;  1E2W A;  4J6H A;  1D6E C;  2MHV A;  3H0G B;  2B8F A;  4ID6 A;  3QOL A;  3I72 A;  1LTT D;  2JYO A;  4XXE A;  3HS0 C;  2E75 C;  3R3O A;  4KD4 A;  3MVV A;  1U4P A;  1PTO F;  1EYD A;  3EQL C;  3DWQ A;  4ULL A;  4DK0 A;  5EJW A;  3M7N A;  1RD9 D;  3M7G A;  1CZW A;  3I90 A;  3WOE A;  2BCO A;  3ND8 A;  5EBC A;  1OXS C;  2F0E A;  4KN4 C;  2F0U A;  3I73 A;  4WRD A;  3H09 A;  5BN4 A;  5C4H A;  1MBY A;  2VB2 X;  1WD0 A;  1IL8 A;  2PQE A;  1XXG A;  3D31 A;  5ELC A;  3M4O B;  1STY A;  1QWY A;  1S5E D;  3IFT A;  1SE2 A;  1QNK A;  4HR7 B;  2E2D C;  2WKC A;  1RJT A;  2EJF C;  4PQX A;  4DU9 A;  1EY5 A;  5DM7 3;  3FVQ A;  4GZY C;  1MD2 D;  2BA0 A;  3Q0A A;  3NTK A;  4HED A;  1DJR D;  4FF4 A;  3DWP A;  4XYO A;  4XT3 B;  2JSO A;  3RZD B;  4CKB A;  3HOZ B;  4C56 C;  1O7Z A;  4CJ0 B;  3M85 A;  1EU3 A;  2NVQ B;  1ENA A;  4K8J A;  4FVM A;  4OIK A;  2EZV A;  4IUT A;  4RWS C;  2JA5 B;  1II3 A;  2RQX A;  2NN6 H;  5COY A;  3PO2 B;  4TKO B;  4RGT A;  2D62 A;  1ENC A;  5EGT A;  5CV5 A;  4DFA A;  5EKL A;  1E2V A;  4FNF A;  3KLR A;  3SK5 A;  5DAU A;  1PTO B;  1UNS A;  2NBF A;  3WOF A;  1SYD A;  2N55 A;  1ZXT A;  5JVG 3;  4E6I A;  1Y1V B;  3V05 A;  1QCB D;  2HDL A;  1S5C D;  2IW3 A;  5KGU A;  1WTP A;  1STB A;  1A6X A;  4QIW B;  4IFD I;  1HTP A;  1TS2 A;  1V43 A;  3J7A V;  2WKD A;  4KD3 A;  1ET6 A;  5C4J B;  2Z4I A;  3S2H B;  3C3L A;  2MJ8 A;  4RGM A;  2PZW A;  1F9Q A;  1RTN A;  3OHX C;  4KN7 C;  3MHB A;  1I4R A;  5D3I B;  2HDM A;  1PRT F;  3FEW X;  3T13 A;  1V1P A;  1SEB D;  1L0Y B;  3MXN A;  2B2U A;  2QCP X;  5ISR A;  4ILW A;  1JCK B;  2F0T A;  4A3K B;  5I2Y A;  1DXM A;  3R8B A;  2E2J B;  4ABN A;  3GD7 A;  1EQV A;  4F88 A;  2BDO A;  3MAQ A;  1EYA A;  2Z8L A;  5JVH 3;  3HG9 A;  1JWS D;  1SYG A;  4JBW A;  4PMC A;  3GQB A;  3T56 B;  1YNN D;  3LX0 A;  3AMU A;  4IFD H;  2AUJ D;  1EZ6 A;  5J39 A;  3R93 A;  1Y1W B;  3NP8 A;  3H6M A;  3M4Y A;  4PMB A;  4CJ1 B;  5C5L A;  3TBI B;  1R4Q B;  3OSO A;  1A2T A;  2H4O A;  4OL7 A;  2XRQ D;  3SR1 A;  2F0J A;  4C3I B;  1MSG A;  3R2T A;  3BDC A;  1IW7 D;  3BZD B;  5CV9 A;  2XRS D;  3HEJ A;  2F0P A;  4CBV A;  4KI0 A;  2VNU D;  4KKS A;  3BDO A;  1EWH A;  5KEE A;  4K14 A;  2NN6 G;  1SMY C;  5BN3 A;  1PRT B;  2F0S A;  5F2D A;  4RCO A;  2L12 A;  2K05 A;  2WAC A;  3J80 L;  3FMC A;  1F2Z A;  1O7L A;  5E4X A;  1DOL A;  1LTB D;  2ID0 A;  4KMU C;  3A8K E;  1EY7 A;  2PCF B;  3AB9 A;  3L3O C;  2EJM A;  1HPC A;  2F0Q A;  1S5D D;  2NYZ D;  1GUT A;  1WTR A;  2H1E A;  1AW7 A;  3VYR A;  1RCV D;  1KDA A;  3FDT A;  4HMJ A;  4G7O C;  1PTO D;  2K28 A;  3MEH A;  3ONA B;  1A2U A;  4U67 3;  4A3F B;  1JWU D;  4WOR A;  3DEO A;  3M3Y B;  4EQP A;  2Q8I B;  4PV1 C;  1D5X C;  2QIL A;  3JAM E;  4DGZ A;  4FXK C;  5JPN C;  5EPL A;  3VR5 A;  2F0L A;  1B9M A;  2ZXR A;  2MGS A;  1EIH A;  2R3Z A;  3VYU A;  2A6H D;  4K6D A;  1E2Z A;  1Z7T A;  5DEH A;  2ZT9 C;  2DN8 A;  3PV0 A;  4EQO A;  1GUN A;  5IT9 L;  3NTI A;  4EVO A;  1EZ8 A;  1CQF A;  1RF2 D;  3HOV B;  4N9T A;  1H9M A;  3J7A F;  2AQ1 B;  2EYP A;  3CRK C;  1I4X A;  4RHR A;  2F0N A;  4QB4 A;  3S2D B;  3EVQ A;  3HOW B;  3DMU A;  2VXW A;  4O42 A;  3BG3 A;  1GUW A;  1Y8N B;  1GUO A;  2BDN A;  1SBB B;  3KF8 A;  4DAY A;  2L55 A;  4V19 0;  1I50 B;  3NK9 A;  1K8M A;  1UUP A;  2NTS A;  4RKB A;  1TVX A;  4FYD A;  3CHB D;  3BDL A;  2BA1 A;  2DY8 A;  4MIU A;  3TP8 A;  4RGN A;  5ELB A;  3D8G A;  2EY1 A;  3PUZ A;  2YU9 B;  1LTI D;  4IZ8 A;  1SJE D;  2JE6 I;  4QF4 A;  3JAM L;  4DXF A;  5A2Q L;  2G9D A;  2HCI A;  1LAC A;  1KAA A;  5M5Y B;  3NTH A;  2OF1 A;  1F9R A;  2N88 A;  2CVR A;  2F0D A;  3EA6 A;  1G91 A;  4XT1 B;  3MA2 B;  1AZP A;  1KLG D;  1DOM A;  3BYY B;  4UDU C;  3A54 A;  3C1F A;  1ZEQ X;  4IQZ A;  3S17 B;  1PRT D;  2Z1C A;  2PW7 A;  3GTK B;  2Q8T A;  2PYK A;  2KQ3 A;  3N52 A;  2EY2 A;  4QUF A;  1JOK A;  1LTR D;  4NP5 A;  3SEB A;  1C48 A;  3Q23 A;  3KBG A;  1I6V C;  2PZT A;  2XWB B;  1NAP A;  4CGY B;  2O2L D;  1Y8O B;  1Q3L A;  4RKL A;  5C4X B;  5IGF A;  1JQY D;  5D65 A;  1BNZ A;  2K33 A;  3DUZ A;  4K2L A;  3PUV A;  1DM0 B;  1Q90 A;  4F7X A;  2L1B A;  3ERQ A;  5CV6 A;  1V1P B;  5E1F A;  1VCI A;  1SNP A;  3NWT A;  1HFN A;  2CQA A;  1FD7 D;  2K03 A;  2NZ1 D;  1YNJ C;  2EJG C;  2J0T D;  3K58 A;  1EEF D;  5C44 B;  1QB5 D;  3TP5 A;  1B53 A;  1QE6 A;  5NUC A;  5I9P A;  1QOH A;  1G2T A;  4IUV A;  2LFN A;  1SYC A;  5K36 H;  1DOK A;  3A7L A;  2E76 C;  1CHQ D;  3U9S A;  4BBR B;  4NDX A;  5CV7 A;  4V0B A;  2A68 C;  3P1H A;  1NUC A;  1TY0 A;  3OMG A;  2IPK D;  2BE5 C;  4X3K A;  4MN3 A;  2A74 C;  1PXU A;  3EFX D;  5COR A;  2O4X A;  3QOJ A;  5C3W A;  2XIW A;  3TSS A;  1G8Z D;  4KJO A;  3HZX A;  4XQJ A;  4HCE A;  1NR4 A;  2B39 A;  4K8I A;  5C3E B;  5C4Z A;  1IKM A;  1GUG A;  2F0F A;  2RDF A;  2I07 B;  2IJ0 A;  5LL6 S;  3K6O A;  3K5N A;  3K5M A;  2WAQ B;  1PFN A;  4F8M A;  1XYI A;  1U4M A;  2K01 A;  3H94 A;  1MGS A;  2B8G A;  1LTG D;  3K7A B;  3OMC A;  3V2T A;  2NUC A;  4IUR A;  3NE5 B;  1DZ1 A;  2AUK A;  1TQO A;  4DAP A;  1EOT A;  2FJ2 A;  4IUQ A;  4XQQ A;  1K8O A;  1RKN A;  1HQM C;  5KRU A;  4K6L A;  1BCP C;  3NUC A;  4LAA A;  3QJY A;  5EPJ A;  1ZYR C;  2WP8 J;  1WCM B;  4DA2 A;  1STA A;  5DNF A;  2B2Y C;  2BOS A;  4OO1 I;  1F9S A;  2JA8 B;  1TWH B;  2OT2 A;  2FMM A;  1HHV A;  4K5V A;  4CKE A;  1SYB A;  3MFG A;  2L4N A;  3OOC A;  4N9P A;  2K5D A;  3VR4 A;  1FYC A;  2AWN A;  2PNR C;  5IGC A;  3I4M B;  4QMG A;  2OXP A;  4H0L C;  3MZ5 A;  4HMI A;  1D5M C;  4HSP A;  1AZQ A;  5JAV A;  4KY6 A;  2VB3 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...