4X3TA

Crystal structure of chromobox homolog 7 (cbx7) chromodomain with ms37452
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
HMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 13
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4x3tA00
3LWEA 3MTSA 3FPUB 4X3TA 2XIWA 4HCSA 5E4XA 1E0BA 1ESRA 1MSHA 2EE1A 2KEEA 4IUTA 4R9WA 3KBXA 5AFWA 1WD1A 1JE4A 1NCVA 2B2WC 2MJ8A 2Q8RE 5CMDA 1QG7A 2D9UA 2HUGA 1G6ZA 1EL0A 2FFKB 1C8CA 1ILPA 2H1EA 2FHTA 3I3CA 2FINB 5T1IA 5EKIA 1EQTA 1DZ1A 1DOLA 1U4LA 2B2YC 2RSNA 3G7LA 3N52A 1PFBA 2KVMA 2NZ1D 3DM1A 2NWGA 1PLFA 2DY8A 5CORA 4CJ1B 3SVMA 1B3AA 1X32A 5EPKA 5EQ0A 1RTNA 2BDNA 4IURA 3Q6SA 1DONA 1Q3LA 2MPMA 3FDTA 3GV6A 1BO0A 2L12A 2N55A 2R3ZA 2B2YA 4XDXA 5EJWA 1X3QA 2MGSA 1NR4A 1RTOA 4ZKBB 1CA5A 2KUMA 1WD0A 1BF4A 1SSOA 4RA8A 1B4OA 5EPJA 2K1BA 1F9RA 1RODA 2K01A 4IUPA 1B2TA 1U4MA 2M2LA 1O7YA 2NYZD 2RSOA 2EPBA 4IUVA 1F2LA 1J9OA 1SDFA 2HCCA 4LMQD 1G2TA 3MWYW 1HFGA 3QO2A 2IL8A 5D14A 1WTVA 1F9PA 4X3KA 3H91A 3HP3A 2X6GA 2B2WA 1IKLA 1NAPA 4OIJA 4XT1B 1ILQA 1U4RA 3F2UA 1XX8A 1GUWA 1QE6A 1BBXC 2RA4A 4X3UA 3KUPA 1B53A 4MN3A 2J7ZA 1AP0A 2L1BA 4IUUA 1NR2A 4OIKA 4QUCA 2K05A 1KNAA 4RAUC 4UAIA 1WVLA 1KNEA 1VMPA 4ZK9B 1XYIA 4R8IA 4U68A 1WTPA 1CM9A 1LV9A 5JJZA 2KECA 5D65A 1O7ZA 2JP1A 3P7JA 2L9HA 4DN4M 2FJ2A 2K04A 2X69A 2L4NA 1HUNA 1EOTA 1F9SA 3GV3A 3I8ZA 1CA6A 2B2VC 4NW2A 4ZKCB 5E4WC 4CJ0B 2DY7A 2HDLA 1J8IA 1HHVA 2Q8TA 1HA6A 2JYOA 2CVRA 1MSGA 3DEPA 1MI2A 4IUQA 2X6LA 3I91A 3IL8A 3UI2A 2HCIA 1WTQA 5CBEE 1WTXA 1JICA 4HAEA 1MGSA 2B2TC 2RVLA 3DEOA 1SAPA 4HEDA 4RWSC 1O80A 1IKMA 1G91A 1WTOA 5COYA 3R93A 2B2UC 5CBAE 1DOMA 1G2SA 1BNZA 1VMCA 1RJTA 1AZQA 1HUMA 1PFMA 4O42A 1M8AA 1IL8A 2KOLA 2N88A 1PFNA 1B50A 1ICWA 2SDFA 3D6WA 5T1GA 3TN2A 4QUFA 1U4PA 1AZPA 2B2TA 5DNFA 1WTRA 2VXWA 1WTWA 1ZXTA 2B2UA 1EIHA 5EPLA 4ZAIA 2EOTA 4MHEA 2MP1A 1TVXA 4CJ2C 1HFNA 2L11A 1HRJA 1DOKA 3IFDA 3I90A 2FMMA 2K28A 1A15A 2KEDA 1F9QA 4HSVA 3ONAB 1ML0D 2K03A 1EIGA 1PDQA 1RHPA 1S4ZA 1QNKA 4X3SA 2HDMA 4XT3B 2B2VA 3TZDA 4ZLTF 1X3PA
chains in the Genus database with same CATH superfamily
3MTSA 2XIWA 4B3RQ 3EA6A 1NCVA 1E2VA 3NUCA 3ITPA 5FLXc 2ES2A 3OIPA 4DV7Q 1SMYD 2K5DA 1AFPA 1LTID 1YNND 2Z6KC 5J1ZA 5LMUL 1KXLA 2D0OA 3G7LA 1RF2D 5IYDH 4C1NK 3T53B 3WOEA 5IYDG 1STEA 1KRTA 1Q46A 2VS1A 1RKNA 3M4QA 2B39A 1Y1VH 1XPUA 1SNQA 3HOVG 3FMCA 3BZKA 3S1RB 2JEBI 1CA5A 5KNCA 1CI3M 2EXZA 4FXKC 3BJUA 4AYBE 2VQFL 2EY6A 4APVA 1CT1D 1SEBD 1HZCA 4OX9L 2JA9A 4IPCA 3GP7A 3J7AF 1G2TA 1Y1WH 1II3A 4JI3L 4LFCQ 3RLOA 5BN3A 1IBKL 2V4DA 4I7ZC 2IHFA 2L1BA 2UUAL 2ID0A 5I2XA 2B3GA 4L8JA 1YI2A 3HOYG 5JJZA 5D65A 4KI0A 2WAQB 3PUWA 1OXTA 4R4CA 3RZDH 3GV3A 2E74C 1ENAA 2JYOA 1R9TH 4IUQA 1HR0Q 1XXGA 2JA5G 1JJGA 3E5SA 4KHZA 4RKLA 2WFWA 4X62Q 3TS2A 2E5LQ 1B70B 1IL8A 2OF1A 4F7XA 1YNXA 3E9IA 1XPOA 3WDNA 1JR0D 3CMAA 1B50A 5T1GA 2JSOA 5DNFA 3BYTB 4JI2Q 1MJEA 3BDCA 1LLRD 1VQ4A 4CDCC 4HJ5A 4LK1C 4DK6C 4JI5Q 1KAWA 1I6HB 1JCKB 1TS2A 5E3FA 3B6YA 3S1RH 2HDMA 4HCSA 1ESRA 3MC0B 3KBXA 2MJ8A 5CV6A 1L0XB 3G48A 5EKKA 3P75A 3ERSX 2F0VA 2P5ZX 1PRTB 3N52A 5ELOA 1JC7A 3J7YW 1F2YA 4HJ7A 1Z47A 1E1TA 1BCPB 1V43A 2KHSA 5JPMC 4BBSH 3K7AB 3SK4A 3TREA 1VQHA 2WV6D 1DM0B 2VB3X 4EQNA 2Q2HA 3AFPA 2IX1A 5K36H 3H0GG 2F0KA 1SFOB 2KHJA 4H0LC 1TY0A 3CCMA 5K36G 3RD4A 4KJOA 2XGTA 1SSOA 4EX5A 1UE1A 1B4OA 4IFDI 2QDLA 4A3JG 2UUCL 2BCOA 2EPBA 1HNZL 3KF8A 3Q24A 1WTVA 4JBWA 5JVH3 2OXPA 3A7AB 2LKVA 3MZ5A 2Z4HA 1ENCA 1NR2A 3PUZA 2A68C 3T1YL 1W3SA 1KTKA 1S5BD 3RUZA 1JOKA 3STBD 4J6HA 3DMUA 5KYIA 4DN4M 5FLMG 4TQUS 4RGMA 2EYMA 2JEAI 1HH2P 1ET9A 5C3WA 4LF8Q 5I6YA 1I6HH 3QOJA 1W6JA 1LTLA 4K2KA 5GROA 2F0FA 5EKLA 5IP9G 1CKOA 2RVLA 1IKMA 2K5QA 1XJVA 4NXNL 3V05A 1JB7A 1PFMA 4DV4L 2KOLA 2A6HC 5IP7G 1Y8PB 1XMQL 5EPLA 2F0EA 3K7AH 4OO1G 4O1NA 5KIXA 1A15A 4EQ5A 1F9QA 1SFOH 4MTNA 2F0QA 1EIGA 4CKBA 1N36L 1K83B 2DNEA 2K52A 4EVOA 3CPWA 4C3JB 4DR4Q 3EFXD 4IPDA 3UE1A 4M1UB 1A2TA 3MAQA 2DY8A 4CJ1B 1X32A 3F2BA 2VQEL 4N9TA 2Q2IA 3SHLA 1SYEA 1IXRA 5NUCA 2DUDA 2MGSA 3LWUA 4A3GB 3S2HB 3H3VI 1SLJA 3CRLC 4RA8A 1TIID 1Q8KA 3KF8B 1QZGA 5LMNW 1U4MA 3L9AX 1EY0A 3K59A 4A3FG 3RZOB 1PMRA 3A55A 4Q5VA 2GN5A 4IOCA 3J7AV 5HGTA 3HOZB 5ELFA 4OONA 4JI1L 1QVGA 2KQ3A 5IT9E 3RN2A 2EJFC 1B53A 2J7ZA 1U5KA 1N33L 1KNAA 2A8VA 2C9OA 3MXPA 4A3LH 2A19A 2QILA 4X64Q 5IY0A 4A3CG 1VQCA 2CW0D 2IWHA 2FMCA 3GTOB 4IUNA 1WYDA 2NN6H 1S3OA 1S72A 4LF9Q 1KDCA 1SYBA 4YY3L 3AYHB 4X6AH 4JC0A 2F0WA 4RFBA 4LF7L 1VQGA 1KD1C 3NXWA 2F03A 1JOQA 1YNJD 4LW1A 1MJCA 1STAA 1K83H 3GQBA 2ZXPA 1LT5D 4HAEA 4RWSC 3HOUH 1LACA 2E2JB 4C3JH 2K33A 3CCJA 4FF1A 4QCLA 1L2FA 3Q22A 4OELB 4O42A 3EROA 3PIPA 1H9SB 4G4KA 1FJGL 1U4PA 3NE5B 2B2TA 5IT9c 2PQAA 2L5TA 2UXBQ 1O7LA 4GZYC 1PVOA 2O5IC 5CC4A 3GTGB 5C4HA 4FXDA 1PFSA 3M4PA 2KEDA 3AQQA 4JK1C 2N8NA 3S2HH 2WAQE 5J3BA 3J81L 4A3GH 1RHPA 4YHHL 3GTLB 2B2VA 3G4SA 3TP7A 1X9NA 1NTGA 2G9DA 1K3RA 5G3LD 5CV5A 5ELDA 2UXCQ 1SROA 3CPFA 4GKKQ 1PYWD 4GN4B 1C8CA 2K5HA 4C3IG 1ILPA 3RZOH 3I3CA 2Q2UA 2K5NA 3HOZH 5JJLA 3AB9A 3AMUA 2F0JA 1AH9A 1GUNA 1ASZA 1VCIA 3DM1A 1PTOF 1QILA 5EPKA 3SK5A 1XTDA 4JYAL 2ZTEA 2RKSA 2KHIA 3HKZB 5FOBB 2R93B 3KF6A 4OXPA 4YIJA 5C3EB 1WD0A 4JI4Q 1KLGD 1TR5A 3GTQB 1EY5A 2O2LD 1F9RA 1VQDA 3OSOA 2ICIA 2IT1A 4DUZL 4DV5Q 1PA6A 1Z6HA 3E0JA 3NSWA 3PUXA 1VQEA 3U4ZA 3H91A 3HP3A 1PZID 4CDFC 3RNUA 3Q23A 2NVQB 2E2DC 1B8AA 4RGNA 3PO2B 1O7IA 4X66L 5M3FB 3KK7A 5IGDA 2A5HA 4R8IA 3RLNA 5I2YA 4ID6A 1BDOA 1HR0W 1PTOB 1X56A 1YJNA 5IWAL 4JPBW 1D5XC 1TWCB 4NW2A 2NZOA 3GTGH 1Q7YC 1SJHD 4X65L 2QA4A 4PMBA 1Q86C 3UDIA 4OL7A 3GTLH 1J5EL 1CSPA 2B2TC 1EY7A 4KKUA 5FK9C 1YHBA 2QGQA 1KDAA 3M4OB 2GA4B 4DV3L 1N8RC 2FXQA 3TP5A 2IX3A 1WFQA 3L3OC 2PI2E 1XMOQ 3BVGA 3GDEA 4A3BG 4QIWB 3OTOL 4B3SL 3IKJA 4ZUIA 5ELCA 4CJ2C 4AIMA 1KLUD 1SRUA 4AYBG 5C4XB 2ZXRA 2RDHA 2R93H 3ONAB 4GNXA 5I6WA 3V2TA 3HKZG 2K5VA 4B9XA 2UU9L 5C3EH 1UAPA 1K8OA 1FNVA 3ND8A 4BA1I 4DV0L 5C3EG 4R4QA 2HHHQ 2I5MX 3I4LA 1QG7A 1K8MA 3CCLA 1EL0A 3BDLA 1XPRA 3J80i 2F0IA 1JQYD 1KABA 3CHBD 3F1ZA 4S3SA 1X3FA 2NVQH 3OOCA 3PO2H 1STNA 3KF6B 4EQOA 4IURA 4A3MB 3S1MB 4Y52H 5M3FG 4LUZA 4OO1I 4KHVA 3DUZA 2N55A 2M00A 1X3QA 4TRDA 4BWGB 5EBDA 3HOXB 3UDGA 1HZ9A 1QNUA 2D0PA 2DJFC 4FYDA 3H09A 1JJCB 2F52A 5BN5A 4IOAA 1TWCH 4LWCA 5JEAH 2K01A 4DXFA 1B2TA 1YHAA 2MUYA 4JV5Q 2LMCB 3Q8DA 4JG2A 2AQ2B 5JEAG 3CF5A 1J9OA 1YIJA 3K5OA 1F9PA 3T16A 1B44D 2A69C 1XX8A 3UDXA 1S5CD 1LT6D 2Z0SA 4GN3B 5M5XH 3M4OH 4RAUC 1HQRD 1KIXA 2EY2A 2YU9B 1EWHA 4H7BA 1YJ9A 1XWEA 5KRUA 4LF4L 3PUYA 2UUBQ 1PH5A 4CDDC 4DV6L 3KDFB 1YITA 2PPBC 2X69A 4J8QA 5JJIA 1PH1A 2EQSA 3I8ZA 2VL6A 2TSSA 1C9OA 1ICFB 2DY7A 3SEBA 1S40A 3EJIA 5C4XH 3SK6A 4JOIA 4FF3A 4DR7Q 2X6LA 3I4MB 5C4XG 3J80L 4FO2A 1WTQA 3TRZA 5LMNQ 1GOZA 1PH4A 4DR5L 4QMGA 1EFWA 1DJRD 4HIMA 1SNOA 4IALA 2OCEA 4JI6Q 4RMFA 4GNXC 4LFAQ 3IAYA 1AE2A 1STBA 2EOTA 2B8GA 3QOLA 1IYUA 1HFNA 3NTKA 2L11A 2NB0A 4A3MH 1OXXK 5D3DA 3GD7A 1E24A 3S1MH 1UEBA 2HIVA 4G7ZC 5FLXE 2R7ZG 2JA6G 3VR2A 2K03A 2LXJA 3HOXH 1NE3A 1YBYA 4NKLA 1X3PA 4X3TA 4LF6L 4JBJA 4EQPA 2B2WC 2EDGA 2HUGA 3H6MA 5GQOA 2FHTA 2C35B 4KN4C 1KC8C 1X3GA 2KCTA 5EKIA 5IE8A 4EGVA 5FO7B 3NEMA 1FVIA 4WRDA 4B08A 5L37A 2EXDA 3A8JE 2MHVA 1OTCA 3M9BA 2YU9H 5EJWA 1C48A 1Z7TA 3A54A 4DAVA 1RTOA 2YTVA 1VQFA 2VY3A 4RKBA 3NBHA 1I4GA 1F2LA 3DWQA 4OHJA 2HIXA 3PSIA 3I4MH 2XWJB 1PRTD 1MBYA 1IKLA 4O0AA 4DR3L 1EIFA 2OWOA 4G57A 4NDXA 4HN7A 2MNAA 1YHQA 1BQQT 2I46A 1XYIA 1Y1VG 3PMFA 1CM9A 3MXUA 4JOIC 3UE0A 4UP8A 2KECA 3U58A 2EVBA 5C3XA 2L9HA 1JOOA 3R2IA 2J4XA 3I56A 1I4HA 2E76C 3HKZE 1QUQB 3VR5A 1HHVA 3K7UC 5IYCH 3MXGA 5K5PA 2K5WA 4DKAC 1Y1WG 2XWBB 1OXUA 1L1OA 1D5MC 2A74C 3T56B 4N8FA 1EEID 4BBSB 4ZUJA 1VQBA 2WB1B 3LGJA 1BNZA 3FKIB 4L5RC 3PGZA 1CUKA 3CW2C 4DR1L 2J0TD 4YCWA 5JPNC 4K2LA 3D6WA 1Q8IA 4QUFA 1TU2B 4LFBL 2D2CC 1LTGD 1E22A 1EIHA 4IZ8A 1WJJA 4I7AA 1TQOA 3A8KE 4E6IA 3X3MA 3KYHC 5GAGC 3A5UA 1PRTF 4DR4L 1OXVA 1QNKA 1VQ5A 1RCVD 4DUYL 2WACA 1VQ9A 1BCPF 3FEWX 1MSHA 1WD1A 3A8IE 1QVCA 3C1FA 1Y69U 1B3QA 3NWTA 3X3NA 4RGOS 2F0NA 2A1AA 2EJGC 2B29A 5C4JB 3CQZB 2FINB 5M3MB 2DNCA 1EQTA 2XSCA 2F3IA 5C5MA 2MO0A 5JOBA 1PFBA 1YEZA 1PLFA 5CORA 1D6EC 4KKTA 3PIO3 5A2QE 4H02A 2F4VQ 5IYBH 1BO0A 2EY5A 4QQBX 4ZQ3A 2F0GA 3J7A5 3M85A 4QIWE 3NBHB 1A0IA 5JVG3 4UPAA 2WKDA 1XNRQ 1RODA 2Z6BA 4CGYB 4IUVA 3E6ZX 2CQOA 2IL8A 4FF2A 4DA2A 1NAPA 3IFTA 4DNTB 1YVCA 4L5SA 4BBSG 5C0XH 1SMYC 3D4WA 3FKIH 4QUCA 4XQNA 1YNNC 4ZK9B 5C0XG 1WI5A 3HGBA 1G6PA 1DGSA 2RHSB 2MO1A 1L1OC 2WAQG 4GKJL 2L4NA 2JXMB 3QR8A 1F77A 4ULLA 4POFA 4H44C 1I94Q 3BU2A 1LTAD 3CKIB 1RDPD 2K4KA 4PMWA 3PF4A 3F2DA 1IBLL 2B63H 1HNWQ 1Q12A 2XTIA 3T51B 1DOMA 2ENBA 1DD2A 1VMCA 1JMCA 1X6OA 5EGTA 1GO3E 5BR8L 5C4JH 3CQZH 1S5FD 5M3MH 2L55A 3HRZC 1BKBA 1TY2A 1K8GA 4B3ML 2VXWA 3D0FA 2B8FA 5M3MG 1BBUA 4IPGA 1ASYA 4P72A 1S5ED 3VYRA 1DOKA 2PZWA 5LMUQ 3QG1A 3NQIA 4DV2L 4ZLTF 1F2ZA 1N34L 1JE4A 3KLWA 4IJHA 1MD2D 5C44B 1BVSA 1UWVA 2ATWA 2KVMA 2VQFQ 1SE8A 3TBIB 2UXDL 1UEAB 2E2HB 3SVMA 4GS3A 4OX9Q 1A6XA 5DLQE 5J22A 2DJGC 3D4RA 4P74A 4JI3Q 2KENA 1IBKQ 1CZGA 2R3ZA 1Q90A 3J80c 3HOUB 3CCQA 2JN4A 4DV5L 1BF4A 3BYYB 3NK9A 2UUAQ 5DAUA 4DAPA 3H94A 4V0BA 1SYGA 4HMJA 4MTKA 2ZT9C 3I55A 2PNRC 2JK8A 4G7OC 3JAMi 4U673 4K0KL 2F4IA 2RA4A 4X3UA 4MN3A 1JWMD 1ZYRD 4UAIA 1TWHB 1KNEA 4DF7A 1QJOA 4R1JA 4DR2L 1CKNA 2JP1A 3ERQA 4XXEA 4KD3A 2PNHA 5AJ3L 1CA6A 2I5LX 2CWPA 3J81i 1LO5D 2ZXOA 2Q8TA 3K0XA 5DM73 1PH6A 1JT8A 4JI8L 2D5DA 5IGEA 2HCIA 5IGFA 3FRPB 2CH4A 4UP7A 2BA0A 1G91A 4KY5A 4PZ8A 1XMOL 4BY1B 3QWNA 4YWLA 3K80C 3CMEA 1QOHA 1NMGA 4NXML 2R6GA 3KLSX 4OWTB 4DGZA 1A3UA 3D6CA 3MEHA 5C44H 2JA7B 4A3LG 1SJED 3K5LA 4HR7B 2QCPX 1M4VA 1G8ZD 1MKHA 1PTOD 2NN6G 2E2HH 2PZTA 2PO4A 4DFAA 4FF4A 1CTMA 3STBC 1BR9A 4HIKA 1OO9B 4LJZC 4AQYL 3SK8A 2O4XA 3D3RA 1U9RA 3K5MA 3CCUA 2AUKA 2Y0SB 3JAML 3HOUG 1EYCA 4C3JG 4ZCKA 1QWYA 3I4OA 3BVZA 2FFKB 4BXXH 4CKCA 2RHQB 4ODGA 1AW7A 1FYCA 4OWWB 5E1FA 4DAMA 2AHOB 1PHJA 2OQKA 2WB1E 2UUCQ 2D62A 1B3AA 5KYLA 1HNZQ 2PMZB 1TWHH 2F0UA 1CHQD 3TSSA 4HCEA 3TDQA 1EQRA 1UE5A 2B2YA 1STGA 2G9HD 4A3GG 1ONLA 3RLFA 5FO9B 4IUPA 1FR3A 4LF5L 3P20A 2ZM6L 2ZJPA 2K7VA 5CV4A 4L6TB 4DAYA 1JWSD 3HOZG 3SR1A 5GADC 4KD4A 4DV1L 1GUWA 4A3IB 4BY1H 1GM5A 1HNXL 4R4IA 4BY1G 4KN7C 1JWUD 1CKNB 2JA7H 1WTPA 2MFIA 2JA7G 4IJLA 3VYSA 3S1NH 2E2IB 4YWMA 3SE0A 2JE6I 3T13A 4NXNQ 3EN2A 5LMNL 4DV4Q 1HQMC 2CFMA 1J8IA 1IBMQ 3OIQA 3IL8A 4HJ8A 4QL5A 5CR3A 4LAAA 1FNUA 2N78A 4HJAA 2EJMA 1XMQQ 4KMUC 4UHVA 3S2DB 2NZHA 3OW2A 2Y0SG 3F2CA 1Q81C 2CWAA 4KHPL 1LT3D 3RR5A 1N36Q 2JA8B 2Z9HA 2F0MA 2L15A 5CYUA 3A5ZB 5KGUA 2EYJA 2NTTA 1FNWA 1X65A 4KY7A 2A6ED 1CHPD 4QGUA 2CW0C 1N32L 1Q82C 4JI7L 3S1QB 2K14A 3S14B 2BDNA 4DR6L 2K6AA 3CP0A 2VQEQ 5M5XB 3I70A 1VQIA 2OEOA 3ULPA 4A3EB 2Q8RE 2F0TA 2PQAB 2XRQD 3PO3B 1F2MA 1CK1A 1JE5A 4HIOA 2DGYA 5ISRA 1N9WA 1YNJC 2ALYB 3BDOA 2ICEC 2VB2X 2VZAA 4CDEC 2B2YC 5HGQA 2EYOA 4B3TL 3HOWB 4KV6A 2A73B 4JI0L 2NZ1D 4BA2I 1H9JA 1E2ZA 1ZEQX 5M5YB 3I72A 5JEAJ 4RCNA 4A3IH 1K8AC 5LHY1 3GO5A 1RTNA 2HQLA 3CC2A 3W3AA 1EYGA 4B3RL 1DONA 3ULJA 2QF7A 2MPMA 4PQXA 3PF5A 3GV6A 3ICEA 3ND9A 5CV7A 4QJFA 4UY8C 2R93G 3HG9A 4DV7L 4C3HB 4RCOA 2E2IH 4YCVA 2K75A 4DNRB 1N33Q 4RH6A 5H1SE 3IRBA 2NYZD 4KK7A 4IPHA 3UDFA 4LMQD 1FGBD 3PUVA 4L63B 1A62A 1B1ZA 3I4NB 3VR3A 2B2WA 3GTJB 2SOBA 2F1MA 1KHIA 3S2DH 4YY3Q 3KOJA 5M9OA 3K58A 3PO2G 3HFZB 3MXNA 1S5DD 3KBGA 5A2QL 4LF7Q 1TS5A 3NP8A 1EUJA 3MFYA 4GN5A 1D1KA 4WJ3M 2JA8H 4PZ7A 2SNSA 2NVYB 4LFCL 4H13C 4JCVE 1C7YA 1EY9A 5GAHC 5FJ8H 1PYSB 4CJ0B 1PYBA 4L5QA 1FJGQ 4A3KB 4O2DA 2IW3A 3S1QH 3DXJC 3S14H 1NSNS 4FP5D 1JORA 1D7QA 4IFDH 1SYDA 2XNAC 2ZJQA 4A3EH 3HKSA 3E3XA 1I50B 1D8LA 3PO3H 4A93H 3DWAA 4C56C 3AFQA 3K8AA 3SDZA 4YHHQ 1PFNA 3NBIA 2VNUD 2H4OA 1HR0L 3HOWH 3H3VC 2VUMH 5M5YH 1K0SA 1VQNA 4X62L 3HOWG 1PZJD 5LL6S 3EQLC 1HPCA 2YTYA 1M90C 2E5LL 3WOFA 1IL2A 1X3EA 3L0OA 2EYLA 4X3SA 1LABA 4P75A 4C3HH 3K57A 4CKEA 3NHHA 4JI2L 4C3HG 4JYAQ 1JJ2A 5F2DA 4JI5L 3MFGA 3CXCA 2CCZA 3KLRA 1QZHA 3I4NH 1EWIA 3GTKH 3ER0A 3L7ZC 3GTJH 2Q2TA 3FPPA 4XYOA 4KKSA 5IIFA 1KQSA 4M8AA 2CQAA 4GNXB 1FD7D 2NN6I 4DUZQ 4A3MG 3BS1A 3HOVB 3W1GA 2QEXA 5KNDA 1NR4A 3HOXG 1SNDA 4ZKBB 2C5CA 2NVYH 1WTHA 1E7ZA 4X66Q 1EU3A 1D2BA 4TSSA 1I3QB 2QEJC 2R7FA 4Q0FA 5I9OA 3TP6A 1LYLA 2BOSA 4A3KH 3VR6A 1WCMB 2HCCA 1V1OA 2RDGA 3MWYW 5CV8A 3QO2A 1ENFA 1V1PA 3PV0A 4BY7H 2GVBA 1GJXA 1VQAA 3J81E 1GUGA 2Y0SE 3MXNB 3ZYYX 5IWAQ 1K28A 4HSPA 1A2UA 3V96A 5IODA 1I50H 4IUUA 4HJ9A 5IGCA 2BE5D 1STHA 3HOYB 1LV9A 1J5EQ 3NENA 5ELNA 2K04A 1D1IA 1VQ8A 4FNFA 5GAEC 2PMZE 3E9HA 3JAMc 2JJQA 2KCMA 4DV3Q 2OQ0A 2BDOA 4RGTA 5E4WC 1EYAA 2HDLA 4HIDA 3FVQA 3H3VH 1SN8A 3EVQA 2JA5B 1I4RA 1SXTA 4PV1C 3I4MG 3OTOQ 1M1KC 1AEXA 4B3SQ 1BXTA 1WTXA 1BCPD 4NMZA 3OWEB 2Z4IA 4K6DA 4P73A 4YWKA 4CHTB 3J81c 5IGGA 4LF8L 1UUPA 2UU9Q 1C0AA 1PXUA 4DV0Q 4DU9A 4TVAB 1EIYB 3G6JB 4MHEA 2MP1A 3BZCA 1B9NA 1DXMA 3IFDA 1QB5D 3W1BA 2K28A 4R4TA 3HOVH 1CKMA 5IYCG 2IJ0A 1EOVA 5IT9L 2EYHA 2NVXB 1JB3A 3CD6A 1IW7D 3U9SA 3KJPA 2EY1A 1I3QH 2QDBA 5CMDA 1NJIC 1G6ZA 3OMCA 1WCMH 2Q8IB 3MVVA 2A68D 4K8IA 4P71A 1WCMG 1U4LA 3CRKC 2EZVA 3K0YA 3KJOA 2NWGA 4UDUC 2NUCA 2PI2A 1IHZA 3HZXA 3H0GB 3HOYH 2BH8A 2L12A 2I07B 1HZBA 5FKAC 2B63B 1PH7A 5E7NA 5ELEA 1G51A 1PV4A 1FL0A 5C0XJ 1O78A 2V1CC 1B7YB 3A56A 3DHQA 4A3JB 1V1PB 1GUOA 2I0QA 3LX0A 2NTSA 5C4ZA 3GTMB 4LF4Q 1VDZA 2IX0A 3A74A 2OTJA 4XTCS 1HFGA 1RL2A 2JA5H 4DV6Q 4XT1B 4K5VA 2A6HD 1HJPA 3U50C 1XNQQ 1AP0A 5CV9A 2OT2A 2O5JC 2K05A 3SGIA 1DYQA 5IYBG 2YV5A 1UE7A 2LS01 3VYTA 1V1QA 4XYQA 2XVSA 3R8BA 1EY8A 2I5HA 3CCEA 3CCRA 1EOTA 2F0OA 2JQOA 4C1NI 4A3DB 4DR5Q 1LTBD 2MQHA 3OPOA 4QY7A 4B9WA 4DK3C 3J81j 4ILWA 2BE5C 4C2MB 4MZ9A 3G6EA 1HCZA 1TS4A 1EEFD 4MIUA 3NWSA 3A7LA 4X64L 2SEBD 1SNCA 2NBFA 3MA2B 5C5LA 2NVXH 3BG3A 3Q0AA 3AU7A 3OMGA 5CBAE 1MHWC 4G7HC 4A75A 2WB1G 2IHEA 3FKIG 4LF9L 3T1HQ 2N88A 1PRTC 3NTHA 3W5OA 2SDFA 4HMIA 2LSSA 3ZJYC 1BCPC 2QKIC 1Q1EA 4LF6Q 3SXHA 3VR4A 5TSSA 1TWAB 3TZUA 3M7NA 1L1OB 2BA1A 1Z9FA 1TXYA 3I90A 3ULLA 4NB3A 3H0GH 3P1HA 2AMCB 1K73C 3R2TA 2LY7A 1ML0D 1R4QB 1SBBB 4KY6A 1SE2A 2B63G 2WKCA 1TKWB 4CBVA 4K8JA 4DK1A 2E75C 4A3JH 2UXBL 2M9VA 4FXGC 3EIVA 1TT2A 4ZYSA 4OGQC 3WWVA 4RHRA 3GTMH 1LTRD 2H1EA 2RQXA 4PZ6A 3OW7A 4GLVB 3J80E 3S9WA 1PH9A 1IW7C 3VA5A 1VQ6A 1VQJA 3K81C 2UXCL 1VS0A 3G71A 1NY4A 3M3YB 4GKKL 4JW0A 4XDXA 4DR3Q 4XQQA 3R3OA 4LNQA 5FLMH 2KUMA 1P8LA 2ZTCA 4A3DH 3BVMA 1CQFA 4WJWA 4A3DG 1O7YA 1LTTD 4C2MH 4A3FB 1CQVA 2WIIB 1SDFA 2KCCA 1SNMA 2YYZA 4ME5A 5IP9H 3PCOB 3PIOA 3D31A 1LT4D 4F87A 4JI4L 1GVPA 3FP9A 4U68A 5IP7H 3PIP3 4NPSA 1IBML 1CZWA 5DM63 1BUVT 1CSQA 2VW9A 4MNOA 1A63A 1TWAH 1H9SA 3LNNA 4OO1H 4DR1Q 4OWXB 3OHXC 1E2WA 4LFBQ 5J39A 1ET6A 3UI2A 3W2DA 3S17B 2K50A 4HEDA 5C6AA 2HQEA 5LL6X 4BS9A 3KLSA 1KAAA 4DK0A 2EIFA 4IO9A 4DUYQ 5IOCA 1VF7A 1I4PA 1WTWA 1IYVA 1LTSD 4AH6A 4ZAIA 1TVXA 1GUSA 5KEEA 3M3YH 4XIGS 1D5ZC 3NELA 2AWNA 2KBNA 1PH8A 1KRSA 4BBRB 2K1BA 5E4XA 2WINB 3D8GA 3CAMA 1HTLD 5AFWA 3TMEA 2D9UA 1G291 4C3IB 3MHBA 4A3FH 1BOSA 4P2CB 2PZUA 4KLKA 5C44G 3S1NB 3I73A 2XRSD 3M4YA 1GHKA 1OXSC 1SE4A 1W6KA 3T4AC 1RIPA 3RN5A 5HURA 2YTXA 2F0SA 2HHHL 5I4DA 3FDTA 3HS0C 2PCFB 4K6LA 1NUCA 4A3CH 4F8MA 2PYKA 4FDBA 1QCBD 1SMXA 5DEHA 2RF4A 2AQ3B 2LXKA 3TS0A 2CH4W 3EBEA 5EAYA 2AKWB 1EQQA 5M5WB 1C4QA 3L2PA 1I4XA 4DPGA 4BXXG 3H15A 2E8GA 2F0DA 4FVMA 3S17H 4GKJQ 4X3KA 1Q1BA 1U4RA 1Y8NB 3CCVA 4YCUA 4ABNA 1HZAA 2F0HA 3QJYA 5FLXL 4OIKA 5JJKA 2R7DA 1VMPA 2Z8LA 4POGA 1YZ6A 3C46A 4JV5L 1IBLQ 3K6OA 1I5FA 1IZ6A 2R61A 3T1YQ 1Y14B 1H9RA 5BR8Q 1TS3A 1AE3A 3NQTA 2ZJRA 1MSGA 3DEPA 1EFID 1MI2A 4R8NA 4B3MQ 4UP9A 4BBRH 5CBEE 4IQZA 1MGSA 4BBRG 3DEOA 1SAPA 4F88A 1MIUA 1O80A 2UUBL 3TEHB 1U0LA 1ESFA 4C3IH 1HA5A 1M8AA 2PW7A 4TKOB 3U4VA 4DNIA 3OYYA 1ICWA 4DV2Q 1B9MA 3TN2A 1SNPA 4A3BB 4DR7L 5D3IB 4ZRZA 1A3VA 1ZXTA 4K14A 1ZYRC 1N34Q 2B2UA 4AYBB 2EYPA 3S24A 4HTHA 1WOCA 1PH3A 3HEJA 4HSVA 1SE3A 2UXDQ 4L5TA 4XT3B 3TZDA 5I9PA 1WTRA 4JI6L 3BZDB 3GTOH 3DWPA 4R4OA 1J6QA 1V9PA 1P16A 1VQ7A 1E0BA 4R9WA 4LFAL 4GOPA 2NVTB 4PG3A 2A69D 4QF4A 3KFUA 5M5WH 4ME3A 4Z9CB 2EYFA 5C0XI 1T5EA 2N49A 2TMPA 4LUVA 1HXYD 4JBMA 1DOLA 3CC4A 2RSNA 2G5DA 4KTAA 2F3WA 1Y8OB 1L0WA 5ELBA 2E2JH 1A3TA 2F0LA 3JC66 3CCSA 1I6VC 1Q3LA 3VYUA 1TWGB 2QW7A 4KJNA 4GLXA 1PTOC 4A4IA 4K0KQ 1AN8A 1EU4A 1A8VA 2XN9C 5EPJA 3VA7A 5G3LF 2ASBA 2RCNA 4A93B 2M2LA 4DR2Q 3KDFA 2AWOA 5D14A 5CGKA 2RDFA 4J1MA 1I4QA 2X6GA 2VUMB 5AJ3Q 3DLLA 3DM3A 4OIJA 3S16B 1EYDA 4A3IG 2KCNA 1X54A 2KJXA 1L0YB 1EZ6A 1V8QA 3M7GA 4JI8Q 1WVLA 4JI1Q 1K3BC 3URYA 3K5NA 1RD9D 1UNSA 4DXGA 4IFDJ 2R92B 4A3BH 3P7JA 1E3PA 1CFMA 5EBCA 1EQVA 3I7FA 1HUNA 3E0EA 4PMCA 3TQYA 4NXMQ 2B2VC 4DAYB 4ZKCB 2GVAA 1HA6A 4Y7NB 4I65A 3GTKB 1SYFA 3S15B 2DN8A 3MEFA 1JICA 4ALPA 2CHBD 1QVFA 1K9MC 4GLAC 4WORA 2AQ1B 2NVTH 2B2UC 1K0RA 3GTQH 2LFNA 2L0CA 1EY4A 1HUMA 1LM0A 1XTCD 1EZ8A 2BH2A 5BN4A 4N8X1 4PNYA 5HY6A 4AQYQ 2JA8G 3F8TA 3TP8A 1GD7A 2N3SA 3J7ZC 3AEVA 1X55A 4IN3A 4GOPC 5FJ8G 5M3FH 2R7ZB 2JA6B 2FMMA 1TWGH 2HT1A 4BY7B 4V190 1KDBA 1STYA 1VQKA 4GOPB 1VQLA 1PDQA 1S4ZA 2K32A 3LWEA 1W2BA 3FPUB 5JAVA 3GTPB 1TWFB 4IFDG 2EE1A 2KEEA 4IUTA 4JVZA 1KL9A 1PTOH 4A3EG 1EY6A 2IY5B 2H5XA 3PO3G 4XQJA 4A93G 1LUZA 5T1IA 1DZ1A 4JBKA 2AUJD 3S16H 2VUMG 4LF5Q 2ZM6Q 5EQ0A 1IYJB 3Q6SA 1YJWA 1T9HA 2Z6KA 1T5XD 3CU7A 3RMHA 4DV1Q 2R92H 4K5XA 2PQEA 1HNXQ 4A76A 2R92G 1SR3A 2A6EC 5FO8B 5A35A 2HD3A 2F0PA 1NMFA 4RHSA 2RBMA 5KNBA 1GXDC 2Z1CA 1R4PB 2RSOA 1VF5C 3C2PA 3O13A 1XNQL 4Y7NH 1PZKD 2CKZB 2F4VL 2ZTDA 1NBWA 2SNMA 3I4NG 3S15H 3PQIA 3C3LA 3NPPA 1QUQA 1ILQA 3FHWA 3F2UA 2F3VA 1QE6A 3N6RA 1BBXC 1H9KA 3KUPA 3JAME 3NTIA 1XNRL 1Y1VB 4QB4A 1FGUA 2OTLA 1O7ZA 2PW5A 3U9OA 2FJ2A 2WP8J 1GUTA 1F9SA 4K5WA 3QIAA 1PH2A 4N9PA 4KHPQ 1GHJA 2R7ZH 2JA6H 2CVRA 1VQOA 1BBWA 1H9MA 4A3KG 1VQMA 3VDYA 1Y1WB 3I91A 1H95A 1SYCA 4BY7G 3A0JA 4NP5A 3T1HL 3GTPH 1TWFH 3D4DA 1EWCA 4X65Q 5COYA 1E1OA 3R93A 1WTOA 1N32Q 1G2SA 4JI7Q 1HTPA 1RJTA 4WFN3 1VQPA 1AZQA 5IGBA 1I94L 4WJ4A 4DR6Q 1AZPA 1NNXA 1DCZA 1UE6A 3RZDB 2RCFA 1HNWL 2KA7A 1HRJA 4J15A 4RG1A 3CC7A 4OEMB 1R9TB 1ZKOA 3OWFA 4B3TQ 3QB3A 2IPKD 4JI0Q 3C1EA 3I2ZA 4LUOA 1GKHA
chains in the Genus database with same CATH topology
3MTSA 2XIWA 3EA6A 1NCVA 1E2VA 3NUCA 3ITPA 3OIPA 1SMYD 2K5DA 1AFPA 1LTID 1YNND 5J1ZA 3G7LA 1RF2D 4C1NK 3T53B 3WOEA 1STEA 1RKNA 2B39A 1SNQA 3FMCA 3S1RB 2JEBI 1CA5A 5KNCA 1CI3M 2EXZA 4FXKC 2EY6A 1CT1D 1SEBD 1G2TA 3GP7A 3J7AF 1II3A 5BN3A 2V4DA 4I7ZC 2L1BA 2ID0A 5I2XA 4L8JA 5JJZA 5D65A 4KI0A 2WAQB 3PUWA 1OXTA 3GV3A 2E74C 1ENAA 2JYOA 4IUQA 1XXGA 3E5SA 4KHZA 4RKLA 1IL8A 2OF1A 4F7XA 1B50A 3WDNA 1JR0D 5T1GA 2JSOA 5DNFA 3BYTB 3BDCA 1LLRD 4LK1C 1I6HB 1JCKB 1TS2A 5E3FA 2HDMA 4HCSA 1ESRA 3MC0B 3KBXA 2MJ8A 5CV6A 1L0XB 5EKKA 3P75A 2F0VA 1PRTB 3N52A 1JC7A 3J7YW 1F2YA 1Z47A 1V43A 1BCPB 2KHSA 5JPMC 3K7AB 3SK4A 2WV6D 1DM0B 2VB3X 4EQNA 2IX1A 5K36H 1SFOB 2F0KA 4H0LC 1TY0A 5K36G 3RD4A 4KJOA 1SSOA 1B4OA 4IFDI 2BCOA 2EPBA 3KF8A 3Q24A 1WTVA 4JBWA 5JVH3 2OXPA 3A7AB 2LKVA 3MZ5A 2Z4HA 1ENCA 1NR2A 3PUZA 2A68C 1KTKA 1S5BD 3RUZA 1JOKA 4J6HA 3DMUA 5KYIA 4DN4M 4TQUS 4RGMA 2EYMA 2JEAI 1ET9A 5C3WA 5I6YA 3QOJA 1W6JA 4K2KA 2F0FA 5EKLA 2RVLA 1IKMA 2K5QA 3V05A 1PFMA 2KOLA 2A6HC 1Y8PB 5EPLA 2F0EA 4OO1G 4O1NA 5KIXA 1A15A 1F9QA 2F0QA 1EIGA 4CKBA 1K83B 2DNEA 4EVOA 4C3JB 3EFXD 4M1UB 1A2TA 3MAQA 2DY8A 4CJ1B 1X32A 4N9TA 3SHLA 1SYEA 5NUCA 3S2HB 3LWUA 2MGSA 4A3GB 3CRLC 4RA8A 1TIID 1U4MA 3L9AX 1EY0A 3K59A 3RZOB 1PMRA 3A55A 4Q5VA 3J7AV 5HGTA 3HOZB 5ELFA 2KQ3A 5IT9E 2EJFC 1B53A 2J7ZA 1KNAA 2C9OA 3MXPA 2QILA 2CW0D 2IWHA 2FMCA 3GTOB 4IUNA 2NN6H 1KDCA 1SYBA 2F0WA 4RFBA 3NXWA 2F03A 1JOQA 1YNJD 1STAA 3GQBA 2ZXPA 1LT5D 4HAEA 4RWSC 1LACA 2E2JB 2K33A 4FF1A 4QCLA 3Q22A 4O42A 3EROA 1H9SB 4G4KA 1U4PA 3NE5B 2B2TA 2L5TA 1O7LA 4GZYC 2O5IC 5CC4A 3GTGB 5C4HA 4FXDA 2KEDA 4JK1C 3J81L 1RHPA 3GTLB 2B2VA 3TP7A 2G9DA 5G3LD 5CV5A 5ELDA 1PYWD 1C8CA 4C3IG 1ILPA 3I3CA 3AB9A 3AMUA 2F0JA 1GUNA 1VCIA 3DM1A 1PTOF 1QILA 5EPKA 3SK5A 2RKSA 3HKZB 5FOBB 2R93B 4YIJA 5C3EB 1WD0A 1KLGD 1TR5A 3GTQB 1EY5A 2O2LD 1F9RA 3OSOA 2ICIA 2IT1A 1Z6HA 3E0JA 3NSWA 3PUXA 3H91A 3HP3A 1PZID 3Q23A 2NVQB 2E2DC 4RGNA 3PO2B 5M3FB 3KK7A 5IGDA 2A5HA 4R8IA 5I2YA 4ID6A 1BDOA 1PTOB 1D5XC 1TWCB 4NW2A 1SJHD 4PMBA 4OL7A 2B2TC 1EY7A 4KKUA 5FK9C 1KDAA 3M4OB 2GA4B 3TP5A 2IX3A 3L3OC 3BVGA 4QIWB 3IKJA 4ZUIA 5ELCA 4CJ2C 1KLUD 5C4XB 2ZXRA 2RDHA 3ONAB 5I6WA 3V2TA 4B9XA 1UAPA 1K8OA 1FNVA 3ND8A 4BA1I 3I4LA 1QG7A 1K8MA 1EL0A 3BDLA 2F0IA 1JQYD 1KABA 3CHBD 4S3SA 3OOCA 1STNA 4EQOA 4IURA 4A3MB 3S1MB 4OO1I 4KHVA 3DUZA 2N55A 2M00A 1X3QA 4TRDA 4BWGB 5EBDA 3HOXB 1QNUA 4FYDA 3H09A 5BN5A 5JEAH 2K01A 4DXFA 1B2TA 2MUYA 2LMCB 5JEAG 2AQ2B 1J9OA 3K5OA 1F9PA 3T16A 1B44D 2A69C 1XX8A 1S5CD 1LT6D 4RAUC 1HQRD 2EY2A 2YU9B 1EWHA 4H7BA 1XWEA 5KRUA 3PUYA 2PPBC 2X69A 4J8QA 3I8ZA 2TSSA 2DY7A 3SEBA 3EJIA 3SK6A 4FF3A 2X6LA 3I4MB 3J80L 4FO2A 1WTQA 1GOZA 4QMGA 1DJRD 1SNOA 4IALA 3IAYA 1STBA 2EOTA 2B8GA 3QOLA 1IYUA 1HFNA 3NTKA 2L11A 2NB0A 1OXXK 5D3DA 3GD7A 4G7ZC 5FLXE 3VR2A 2K03A 4NKLA 1X3PA 4X3TA 4EQPA 2B2WC 2EDGA 2HUGA 3H6MA 2FHTA 4KN4C 5EKIA 4EGVA 5FO7B 4B08A 4WRDA 3A8JE 2MHVA 5EJWA 1C48A 1Z7TA 3A54A 4DAVA 1RTOA 4RKBA 3NBHA 1I4GA 1F2LA 3DWQA 4OHJA 2XWJB 1PRTD 1MBYA 1IKLA 4G57A 4NDXA 4HN7A 1BQQT 2I46A 1XYIA 3PMFA 1CM9A 3MXUA 2KECA 2EVBA 5C3XA 2L9HA 1JOOA 3R2IA 2J4XA 1I4HA 2E76C 3VR5A 1HHVA 3MXGA 5K5PA 2K5WA 2XWBB 1OXUA 1D5MC 2A74C 3T56B 1EEID 4BBSB 4ZUJA 2WB1B 1BNZA 3FKIB 2J0TD 5JPNC 4K2LA 3D6WA 1Q8IA 4QUFA 1TU2B 2D2CC 1LTGD 1EIHA 4IZ8A 1TQOA 3A8KE 4E6IA 3X3MA 1PRTF 1OXVA 1QNKA 1RCVD 2WACA 1BCPF 3FEWX 1MSHA 1WD1A 3A8IE 3C1FA 1Y69U 3NWTA 3X3NA 4RGOS 2F0NA 5C4JB 2EJGC 3CQZB 2FINB 5M3MB 2DNCA 1EQTA 2XSCA 5C5MA 5JOBA 1PFBA 1PLFA 5CORA 1D6EC 4KKTA 3PIO3 5A2QE 1BO0A 2EY5A 4ZQ3A 2F0GA 3M85A 5JVG3 2WKDA 1RODA 4CGYB 4IUVA 3E6ZX 2IL8A 4FF2A 4DA2A 1NAPA 3IFTA 4DNTB 5C0XH 1SMYC 3D4WA 4QUCA 4XQNA 1YNNC 4ZK9B 5C0XG 3HGBA 2L4NA 2JXMB 1F77A 4ULLA 4H44C 1LTAD 3CKIB 1RDPD 4PMWA 1Q12A 3T51B 1DD2A 1DOMA 2ENBA 1VMCA 5EGTA 1S5FD 2L55A 3HRZC 1TY2A 2VXWA 2B8FA 1S5ED 3VYRA 1DOKA 2PZWA 3QG1A 3NQIA 4ZLTF 1F2ZA 1JE4A 1MD2D 5C44B 2KVMA 3TBIB 1UEAB 2E2HB 3SVMA 1A6XA 5J22A 3D4RA 1CZGA 2R3ZA 1Q90A 3HOUB 1BF4A 3BYYB 3NK9A 5DAUA 4DAPA 3H94A 4V0BA 1SYGA 4HMJA 2ZT9C 2PNRC 4G7OC 4U673 2F4IA 2RA4A 4X3UA 4MN3A 1JWMD 1ZYRD 4UAIA 1TWHB 1KNEA 4DF7A 1QJOA 2JP1A 3ERQA 4XXEA 4KD3A 1CA6A 1LO5D 2ZXOA 2Q8TA 5DM73 2D5DA 5IGEA 2HCIA 5IGFA 3FRPB 2BA0A 1G91A 4KY5A 4BY1B 3QWNA 1QOHA 2R6GA 3KLSX 4DGZA 2JA7B 1A3UA 3D6CA 3MEHA 1SJED 3K5LA 4HR7B 2QCPX 1M4VA 1G8ZD 1PTOD 2NN6G 2PZTA 2PO4A 4DFAA 4FF4A 1CTMA 1BR9A 1OO9B 4LJZC 3SK8A 2O4XA 3D3RA 1U9RA 3K5MA 2AUKA 2Y0SB 3JAML 1EYCA 4C3JG 1QWYA 3BVZA 2FFKB 4CKCA 4ODGA 1AW7A 1FYCA 5E1FA 2D62A 1B3AA 5KYLA 2PMZB 2F0UA 1CHQD 3TSSA 4HCEA 3TDQA 2B2YA 1STGA 2G9HD 1ONLA 3RLFA 5FO9B 4IUPA 1FR3A 3P20A 2K7VA 5CV4A 4L6TB 4DAYA 1JWSD 3SR1A 4KD4A 1GUWA 4A3IB 4KN7C 1JWUD 1WTPA 3VYSA 2E2IB 3SE0A 2JE6I 3T13A 1HQMC 1J8IA 3OIQA 3IL8A 5CR3A 4LAAA 1FNUA 2EJMA 4KMUC 3S2DB 1LT3D 2JA8B 2F0MA 5CYUA 5KGUA 2EYJA 2NTTA 1FNWA 4KY7A 2A6ED 1CHPD 2CW0C 3S1QB 3S14B 2BDNA 2K6AA 5M5XB 3I70A 2OEOA 4A3EB 2Q8RE 2F0TA 2XRQD 3PO3B 1F2MA 1CK1A 5ISRA 1YNJC 3BDOA 2ICEC 2VB2X 2B2YC 2EYOA 3HOWB 4KV6A 2A73B 2NZ1D 4BA2I 1H9JA 1E2ZA 1ZEQX 5M5YB 3I72A 5JEAJ 4RCNA 5LHY1 3GO5A 1RTNA 1DONA 3W3AA 2QF7A 2MPMA 4PQXA 3GV6A 3ND9A 5CV7A 3HG9A 4C3HB 4RCOA 4DNRB 4RH6A 2NYZD 4KK7A 4LMQD 1FGBD 3PUVA 4L63B 1B1ZA 3I4NB 3VR3A 2B2WA 3GTJB 2SOBA 2F1MA 5M9OA 3K58A 3MXNA 1S5DD 3KBGA 5A2QL 1TS5A 3NP8A 3MFYA 1D1KA 2SNSA 2NVYB 4H13C 1EY9A 4CJ0B 4A3KB 2IW3A 3DXJC 1NSNS 4FP5D 1JORA 4IFDH 1SYDA 2XNAC 1I50B 3DWAA 4C56C 3SDZA 1PFNA 3NBIA 2VNUD 2H4OA 3H3VC 1PZJD 5LL6S 3EQLC 1HPCA 3WOFA 2EYLA 4X3SA 1LABA 3K57A 4CKEA 3NHHA 4C3HG 5F2DA 3MFGA 3KLRA 3L7ZC 3FPPA 4XYOA 4KKSA 5IIFA 4M8AA 2CQAA 1FD7D 2NN6I 3BS1A 3HOVB 5KNDA 1NR4A 1SNDA 4ZKBB 2C5CA 1EU3A 1D2BA 4TSSA 1I3QB 2QEJC 4Q0FA 5I9OA 3TP6A 2BOSA 3VR6A 1WCMB 2HCCA 1V1OA 2RDGA 3MWYW 5CV8A 3QO2A 1ENFA 1V1PA 3PV0A 1GJXA 3J81E 1GUGA 3ZYYX 4HSPA 1A2UA 3V96A 5IODA 4IUUA 5IGCA 2BE5D 1STHA 3HOYB 1LV9A 2K04A 1D1IA 4FNFA 2BDOA 4RGTA 5E4WC 1EYAA 2HDLA 3FVQA 3EVQA 2JA5B 1I4RA 1SXTA 4PV1C 1AEXA 1BXTA 1WTXA 1BCPD 4NMZA 3OWEB 2Z4IA 4K6DA 4CHTB 5IGGA 1UUPA 1PXUA 4DU9A 3G6JB 4MHEA 2MP1A 1B9NA 1DXMA 3IFDA 1QB5D 2K28A 2IJ0A 5IT9L 2EYHA 2NVXB 1JB3A 1IW7D 3U9SA 2EY1A 2QDBA 5CMDA 1G6ZA 3OMCA 2Q8IB 3MVVA 2A68D 4K8IA 1U4LA 3CRKC 2EZVA 3K0YA 2NWGA 4UDUC 2NUCA 1IHZA 3HZXA 3H0GB 2L12A 2I07B 5FKAC 2B63B 5ELEA 5C0XJ 1O78A 3A56A 3DHQA 4A3JB 1V1PB 1GUOA 3LX0A 2NTSA 5C4ZA 3GTMB 1VDZA 2IX0A 4XTCS 1HFGA 4XT1B 4K5VA 2A6HD 1AP0A 5CV9A 2OT2A 2O5JC 2K05A 1DYQA 2LS01 3VYTA 4XYQA 2XVSA 3R8BA 1EY8A 1EOTA 2F0OA 4C1NI 4A3DB 1LTBD 3OPOA 4B9WA 4ILWA 2BE5C 4C2MB 1HCZA 1TS4A 1EEFD 4MIUA 3NWSA 3A7LA 2SEBD 1SNCA 2NBFA 3MA2B 5C5LA 3BG3A 3Q0AA 3AU7A 3OMGA 5CBAE 4G7HC 2N88A 1PRTC 3NTHA 2SDFA 4HMIA 1BCPC 2QKIC 1Q1EA 3SXHA 3VR4A 5TSSA 1TWAB 3TZUA 3M7NA 2BA1A 3I90A 3P1HA 3R2TA 2LY7A 1ML0D 1R4QB 1SBBB 4KY6A 1SE2A 2WKCA 1TKWB 4CBVA 4K8JA 4DK1A 2E75C 2M9VA 4FXGC 1TT2A 4ZYSA 4OGQC 4RHRA 1LTRD 2H1EA 2RQXA 3OW7A 3J80E 3S9WA 1IW7C 3VA5A 3M3YB 4XDXA 4XQQA 3R3OA 2KUMA 3BVMA 1CQFA 4WJWA 1O7YA 1LTTD 4A3FB 1CQVA 2WIIB 1SDFA 2KCCA 1SNMA 2YYZA 4ME5A 3D31A 1LT4D 4F87A 4U68A 3PIP3 1CZWA 5DM63 1BUVT 3LNNA 1H9SA 4OO1H 3OHXC 1E2WA 5J39A 1ET6A 3UI2A 3W2DA 3S17B 4HEDA 5C6AA 2HQEA 5LL6X 4BS9A 3KLSA 1KAAA 4DK0A 5IOCA 1VF7A 1I4PA 1WTWA 1IYVA 1LTSD 4ZAIA 1TVXA 1GUSA 5KEEA 4XIGS 1D5ZC 2AWNA 4BBRB 2K1BA 5E4XA 2WINB 3D8GA 1HTLD 5AFWA 3TMEA 2D9UA 1G291 4C3IB 3MHBA 1BOSA 4P2CB 2PZUA 3S1NB 3I73A 2XRSD 3M4YA 1GHKA 1OXSC 1SE4A 1W6KA 3T4AC 5HURA 2F0SA 5I4DA 3FDTA 3HS0C 2PCFB 4K6LA 1NUCA 4F8MA 2PYKA 1QCBD 5DEHA 2AQ3B 5M5WB 1C4QA 1I4XA 2F0DA 4FVMA 4X3KA 1Q1BA 1U4RA 1Y8NB 4ABNA 2F0HA 3QJYA 5FLXL 4OIKA 1VMPA 2Z8LA 3C46A 3K6OA 2R61A 1H9RA 1TS3A 3NQTA 1MSGA 3DEPA 1EFID 1MI2A 4R8NA 5CBEE 4IQZA 1MGSA 4F88A 3DEOA 1SAPA 1O80A 1ESFA 1HA5A 1M8AA 2PW7A 4TKOB 1ICWA 1B9MA 3TN2A 1SNPA 4A3BB 5D3IB 4ZRZA 1A3VA 1ZXTA 4K14A 1ZYRC 2B2UA 4AYBB 2EYPA 4HTHA 3HEJA 4HSVA 1SE3A 4XT3B 5I9PA 3TZDA 1WTRA 3BZDB 3DWPA 1E0BA 4R9WA 2NVTB 2A69D 4QF4A 4Z9CB 2EYFA 5C0XI 1T5EA 2TMPA 1HXYD 1DOLA 2RSNA 4KTAA 2F3WA 1Y8OB 5ELBA 1A3TA 2F0LA 1I6VC 1Q3LA 3VYUA 1TWGB 4KJNA 1PTOC 1AN8A 1EU4A 2XN9C 5EPJA 3VA7A 5G3LF 4A93B 2M2LA 2AWOA 5D14A 5CGKA 2RDFA 4J1MA 1I4QA 2X6GA 2VUMB 4OIJA 3S16B 1EYDA 2KCNA 2KJXA 1EZ6A 1L0YB 1V8QA 3M7GA 1WVLA 3URYA 3K5NA 1RD9D 1UNSA 4DXGA 4IFDJ 2R92B 3P7JA 1CFMA 5EBCA 1EQVA 1HUNA 4PMCA 2B2VC 4ZKCB 1HA6A 4Y7NB 4I65A 3GTKB 1SYFA 3S15B 2DN8A 1JICA 2CHBD 4WORA 2AQ1B 2B2UC 2LFNA 2L0CA 1EY4A 1HUMA 1XTCD 1EZ8A 5BN4A 4PNYA 3TP8A 4IN3A 2R7ZB 2JA6B 2FMMA 4BY7B 4V190 1KDBA 1STYA 1PDQA 1S4ZA 2K32A 3LWEA 3GTPB 3FPUB 5JAVA 4IFDG 1TWFB 2EE1A 2KEEA 4IUTA 1PTOH 1EY6A 4XQJA 5T1IA 1DZ1A 2AUJD 5EQ0A 3Q6SA 1T5XD 3CU7A 3RMHA 4K5XA 2PQEA 2A6EC 5FO8B 5A35A 2F0PA 4RHSA 5KNBA 2RBMA 1GXDC 2Z1CA 1R4PB 2RSOA 1VF5C 3C2PA 3O13A 1PZKD 2SNMA 3C3LA 3NPPA 1ILQA 3F2UA 2F3VA 1QE6A 3N6RA 1BBXC 1H9KA 3KUPA 3JAME 3NTIA 1Y1VB 4QB4A 1O7ZA 2PW5A 3U9OA 2FJ2A 2WP8J 1GUTA 1F9SA 4K5WA 3QIAA 4N9PA 1GHJA 2CVRA 1H9MA 1Y1WB 3I91A 1SYCA 4NP5A 3D4DA 1EWCA 1WTOA 5COYA 3R93A 1G2SA 1HTPA 1RJTA 4WFN3 1AZQA 5IGBA 1AZPA 1DCZA 3RZDB 2KA7A 1HRJA 1R9TB 1ZKOA 3OWFA 3QB3A 2IPKD 3C1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWE A;  3MTS A;  3FPU B;  4X3T A;  2XIW A;  4HCS A;  5E4X A;  1E0B A;  1ESR A;  1MSH A;  2EE1 A;  2KEE A;  4IUT A;  4R9W A;  3KBX A;  5AFW A;  1WD1 A;  1JE4 A;  1NCV A;  2B2W C;  2MJ8 A;  2Q8R E;  5CMD A;  1QG7 A;  2D9U A;  2HUG A;  1G6Z A;  1EL0 A;  2FFK B;  1C8C A;  1ILP A;  2H1E A;  2FHT A;  3I3C A;  2FIN B;  5T1I A;  5EKI A;  1EQT A;  1DZ1 A;  1DOL A;  1U4L A;  2B2Y C;  2RSN A;  3G7L A;  3N52 A;  1PFB A;  2KVM A;  2NZ1 D;  3DM1 A;  2NWG A;  1PLF A;  2DY8 A;  5COR A;  4CJ1 B;  3SVM A;  1B3A A;  1X32 A;  5EPK A;  5EQ0 A;  1RTN A;  2BDN A;  4IUR A;  3Q6S A;  1DON A;  1Q3L A;  2MPM A;  3FDT A;  3GV6 A;  1BO0 A;  2L12 A;  2N55 A;  2R3Z A;  2B2Y A;  4XDX A;  5EJW A;  1X3Q A;  2MGS A;  1NR4 A;  1RTO A;  4ZKB B;  1CA5 A;  2KUM A;  1WD0 A;  1BF4 A;  1SSO A;  4RA8 A;  1B4O A;  5EPJ A;  2K1B A;  1F9R A;  1ROD A;  2K01 A;  4IUP A;  1B2T A;  1U4M A;  2M2L A;  1O7Y A;  2NYZ D;  2RSO A;  2EPB A;  4IUV A;  1F2L A;  1J9O A;  1SDF A;  2HCC A;  4LMQ D;  1G2T A;  3MWY W;  1HFG A;  3QO2 A;  2IL8 A;  5D14 A;  1WTV A;  1F9P A;  4X3K A;  3H91 A;  3HP3 A;  2X6G A;  2B2W A;  1IKL A;  1NAP A;  4OIJ A;  4XT1 B;  1ILQ A;  1U4R A;  3F2U A;  1XX8 A;  1GUW A;  1QE6 A;  1BBX C;  2RA4 A;  4X3U A;  3KUP A;  1B53 A;  4MN3 A;  2J7Z A;  1AP0 A;  2L1B A;  4IUU A;  1NR2 A;  4OIK A;  4QUC A;  2K05 A;  1KNA A;  4RAU C;  4UAI A;  1WVL A;  1KNE A;  1VMP A;  4ZK9 B;  1XYI A;  4R8I A;  4U68 A;  1WTP A;  1CM9 A;  1LV9 A;  5JJZ A;  2KEC A;  5D65 A;  1O7Z A;  2JP1 A;  3P7J A;  2L9H A;  4DN4 M;  2FJ2 A;  2K04 A;  2X69 A;  2L4N A;  1HUN A;  1EOT A;  1F9S A;  3GV3 A;  3I8Z A;  1CA6 A;  2B2V C;  4NW2 A;  4ZKC B;  5E4W C;  4CJ0 B;  2DY7 A;  2HDL A;  1J8I A;  1HHV A;  2Q8T A;  1HA6 A;  2JYO A;  2CVR A;  1MSG A;  3DEP A;  1MI2 A;  4IUQ A;  2X6L A;  3I91 A;  3IL8 A;  3UI2 A;  2HCI A;  1WTQ A;  5CBE E;  1WTX A;  1JIC A;  4HAE A;  1MGS A;  2B2T C;  2RVL A;  3DEO A;  1SAP A;  4HED A;  4RWS C;  1O80 A;  1IKM A;  1G91 A;  1WTO A;  5COY A;  3R93 A;  2B2U C;  5CBA E;  1DOM A;  1G2S A;  1BNZ A;  1VMC A;  1RJT A;  1AZQ A;  1HUM A;  1PFM A;  4O42 A;  1M8A A;  1IL8 A;  2KOL A;  2N88 A;  1PFN A;  1B50 A;  1ICW A;  2SDF A;  3D6W A;  5T1G A;  3TN2 A;  4QUF A;  1U4P A;  1AZP A;  2B2T A;  5DNF A;  1WTR A;  2VXW A;  1WTW A;  1ZXT A;  2B2U A;  1EIH A;  5EPL A;  4ZAI A;  2EOT A;  4MHE A;  2MP1 A;  1TVX A;  4CJ2 C;  1HFN A;  2L11 A;  1HRJ A;  1DOK A;  3IFD A;  3I90 A;  2FMM A;  2K28 A;  1A15 A;  2KED A;  1F9Q A;  4HSV A;  3ONA B;  1ML0 D;  2K03 A;  1EIG A;  1PDQ A;  1RHP A;  1S4Z A;  1QNK A;  4X3S A;  2HDM A;  4XT3 B;  2B2V A;  3TZD A;  4ZLT F;  1X3P A; 
#chains in the Genus database with same CATH topology
 3MTS A;  2XIW A;  4B3R Q;  3EA6 A;  1NCV A;  1E2V A;  3NUC A;  3ITP A;  5FLX c;  2ES2 A;  3OIP A;  4DV7 Q;  1SMY D;  2K5D A;  1AFP A;  1LTI D;  1YNN D;  2Z6K C;  5J1Z A;  5LMU L;  1KXL A;  2D0O A;  3G7L A;  1RF2 D;  5IYD H;  4C1N K;  3T53 B;  3WOE A;  5IYD G;  1STE A;  1KRT A;  1Q46 A;  2VS1 A;  1RKN A;  3M4Q A;  2B39 A;  1Y1V H;  1XPU A;  1SNQ A;  3HOV G;  3FMC A;  3BZK A;  3S1R B;  2JEB I;  1CA5 A;  5KNC A;  1CI3 M;  2EXZ A;  4FXK C;  3BJU A;  4AYB E;  2VQF L;  2EY6 A;  4APV A;  1CT1 D;  1SEB D;  1HZC A;  4OX9 L;  2JA9 A;  4IPC A;  3GP7 A;  3J7A F;  1G2T A;  1Y1W H;  1II3 A;  4JI3 L;  4LFC Q;  3RLO A;  5BN3 A;  1IBK L;  2V4D A;  4I7Z C;  2IHF A;  2L1B A;  2UUA L;  2ID0 A;  5I2X A;  2B3G A;  4L8J A;  1YI2 A;  3HOY G;  5JJZ A;  5D65 A;  4KI0 A;  2WAQ B;  3PUW A;  1OXT A;  4R4C A;  3RZD H;  3GV3 A;  2E74 C;  1ENA A;  2JYO A;  1R9T H;  4IUQ A;  1HR0 Q;  1XXG A;  2JA5 G;  1JJG A;  3E5S A;  4KHZ A;  4RKL A;  2WFW A;  4X62 Q;  3TS2 A;  2E5L Q;  1B70 B;  1IL8 A;  2OF1 A;  4F7X A;  1YNX A;  3E9I A;  1XPO A;  3WDN A;  1JR0 D;  3CMA A;  1B50 A;  5T1G A;  2JSO A;  5DNF A;  3BYT B;  4JI2 Q;  1MJE A;  3BDC A;  1LLR D;  1VQ4 A;  4CDC C;  4HJ5 A;  4LK1 C;  4DK6 C;  4JI5 Q;  1KAW A;  1I6H B;  1JCK B;  1TS2 A;  5E3F A;  3B6Y A;  3S1R H;  2HDM A;  4HCS A;  1ESR A;  3MC0 B;  3KBX A;  2MJ8 A;  5CV6 A;  1L0X B;  3G48 A;  5EKK A;  3P75 A;  3ERS X;  2F0V A;  2P5Z X;  1PRT B;  3N52 A;  5ELO A;  1JC7 A;  3J7Y W;  1F2Y A;  4HJ7 A;  1Z47 A;  1E1T A;  1BCP B;  1V43 A;  2KHS A;  5JPM C;  4BBS H;  3K7A B;  3SK4 A;  3TRE A;  1VQH A;  2WV6 D;  1DM0 B;  2VB3 X;  4EQN A;  2Q2H A;  3AFP A;  2IX1 A;  5K36 H;  3H0G G;  2F0K A;  1SFO B;  2KHJ A;  4H0L C;  1TY0 A;  3CCM A;  5K36 G;  3RD4 A;  4KJO A;  2XGT A;  1SSO A;  4EX5 A;  1UE1 A;  1B4O A;  4IFD I;  2QDL A;  4A3J G;  2UUC L;  2BCO A;  2EPB A;  1HNZ L;  3KF8 A;  3Q24 A;  1WTV A;  4JBW A;  5JVH 3;  2OXP A;  3A7A B;  2LKV A;  3MZ5 A;  2Z4H A;  1ENC A;  1NR2 A;  3PUZ A;  2A68 C;  3T1Y L;  1W3S A;  1KTK A;  1S5B D;  3RUZ A;  1JOK A;  3STB D;  4J6H A;  3DMU A;  5KYI A;  4DN4 M;  5FLM G;  4TQU S;  4RGM A;  2EYM A;  2JEA I;  1HH2 P;  1ET9 A;  5C3W A;  4LF8 Q;  5I6Y A;  1I6H H;  3QOJ A;  1W6J A;  1LTL A;  4K2K A;  5GRO A;  2F0F A;  5EKL A;  5IP9 G;  1CKO A;  2RVL A;  1IKM A;  2K5Q A;  1XJV A;  4NXN L;  3V05 A;  1JB7 A;  1PFM A;  4DV4 L;  2KOL A;  2A6H C;  5IP7 G;  1Y8P B;  1XMQ L;  5EPL A;  2F0E A;  3K7A H;  4OO1 G;  4O1N A;  5KIX A;  1A15 A;  4EQ5 A;  1F9Q A;  1SFO H;  4MTN A;  2F0Q A;  1EIG A;  4CKB A;  1N36 L;  1K83 B;  2DNE A;  2K52 A;  4EVO A;  3CPW A;  4C3J B;  4DR4 Q;  3EFX D;  4IPD A;  3UE1 A;  4M1U B;  1A2T A;  3MAQ A;  2DY8 A;  4CJ1 B;  1X32 A;  3F2B A;  2VQE L;  4N9T A;  2Q2I A;  3SHL A;  1SYE A;  1IXR A;  5NUC A;  2DUD A;  2MGS A;  3LWU A;  4A3G B;  3S2H B;  3H3V I;  1SLJ A;  3CRL C;  4RA8 A;  1TII D;  1Q8K A;  3KF8 B;  1QZG A;  5LMN W;  1U4M A;  3L9A X;  1EY0 A;  3K59 A;  4A3F G;  3RZO B;  1PMR A;  3A55 A;  4Q5V A;  2GN5 A;  4IOC A;  3J7A V;  5HGT A;  3HOZ B;  5ELF A;  4OON A;  4JI1 L;  1QVG A;  2KQ3 A;  5IT9 E;  3RN2 A;  2EJF C;  1B53 A;  2J7Z A;  1U5K A;  1N33 L;  1KNA A;  2A8V A;  2C9O A;  3MXP A;  4A3L H;  2A19 A;  2QIL A;  4X64 Q;  5IY0 A;  4A3C G;  1VQC A;  2CW0 D;  2IWH A;  2FMC A;  3GTO B;  4IUN A;  1WYD A;  2NN6 H;  1S3O A;  1S72 A;  4LF9 Q;  1KDC A;  1SYB A;  4YY3 L;  3AYH B;  4X6A H;  4JC0 A;  2F0W A;  4RFB A;  4LF7 L;  1VQG A;  1KD1 C;  3NXW A;  2F03 A;  1JOQ A;  1YNJ D;  4LW1 A;  1MJC A;  1STA A;  1K83 H;  3GQB A;  2ZXP A;  1LT5 D;  4HAE A;  4RWS C;  3HOU H;  1LAC A;  2E2J B;  4C3J H;  2K33 A;  3CCJ A;  4FF1 A;  4QCL A;  1L2F A;  3Q22 A;  4OEL B;  4O42 A;  3ERO A;  3PIP A;  1H9S B;  4G4K A;  1FJG L;  1U4P A;  3NE5 B;  2B2T A;  5IT9 c;  2PQA A;  2L5T A;  2UXB Q;  1O7L A;  4GZY C;  1PVO A;  2O5I C;  5CC4 A;  3GTG B;  5C4H A;  4FXD A;  1PFS A;  3M4P A;  2KED A;  3AQQ A;  4JK1 C;  2N8N A;  3S2H H;  2WAQ E;  5J3B A;  3J81 L;  4A3G H;  1RHP A;  4YHH L;  3GTL B;  2B2V A;  3G4S A;  3TP7 A;  1X9N A;  1NTG A;  2G9D A;  1K3R A;  5G3L D;  5CV5 A;  5ELD A;  2UXC Q;  1SRO A;  3CPF A;  4GKK Q;  1PYW D;  4GN4 B;  1C8C A;  2K5H A;  4C3I G;  1ILP A;  3RZO H;  3I3C A;  2Q2U A;  2K5N A;  3HOZ H;  5JJL A;  3AB9 A;  3AMU A;  2F0J A;  1AH9 A;  1GUN A;  1ASZ A;  1VCI A;  3DM1 A;  1PTO F;  1QIL A;  5EPK A;  3SK5 A;  1XTD A;  4JYA L;  2ZTE A;  2RKS A;  2KHI A;  3HKZ B;  5FOB B;  2R93 B;  3KF6 A;  4OXP A;  4YIJ A;  5C3E B;  1WD0 A;  4JI4 Q;  1KLG D;  1TR5 A;  3GTQ B;  1EY5 A;  2O2L D;  1F9R A;  1VQD A;  3OSO A;  2ICI A;  2IT1 A;  4DUZ L;  4DV5 Q;  1PA6 A;  1Z6H A;  3E0J A;  3NSW A;  3PUX A;  1VQE A;  3U4Z A;  3H91 A;  3HP3 A;  1PZI D;  4CDF C;  3RNU A;  3Q23 A;  2NVQ B;  2E2D C;  1B8A A;  4RGN A;  3PO2 B;  1O7I A;  4X66 L;  5M3F B;  3KK7 A;  5IGD A;  2A5H A;  4R8I A;  3RLN A;  5I2Y A;  4ID6 A;  1BDO A;  1HR0 W;  1PTO B;  1X56 A;  1YJN A;  5IWA L;  4JPB W;  1D5X C;  1TWC B;  4NW2 A;  2NZO A;  3GTG H;  1Q7Y C;  1SJH D;  4X65 L;  2QA4 A;  4PMB A;  1Q86 C;  3UDI A;  4OL7 A;  3GTL H;  1J5E L;  1CSP A;  2B2T C;  1EY7 A;  4KKU A;  5FK9 C;  1YHB A;  2QGQ A;  1KDA A;  3M4O B;  2GA4 B;  4DV3 L;  1N8R C;  2FXQ A;  3TP5 A;  2IX3 A;  1WFQ A;  3L3O C;  2PI2 E;  1XMO Q;  3BVG A;  3GDE A;  4A3B G;  4QIW B;  3OTO L;  4B3S L;  3IKJ A;  4ZUI A;  5ELC A;  4CJ2 C;  4AIM A;  1KLU D;  1SRU A;  4AYB G;  5C4X B;  2ZXR A;  2RDH A;  2R93 H;  3ONA B;  4GNX A;  5I6W A;  3V2T A;  3HKZ G;  2K5V A;  4B9X A;  2UU9 L;  5C3E H;  1UAP A;  1K8O A;  1FNV A;  3ND8 A;  4BA1 I;  4DV0 L;  5C3E G;  4R4Q A;  2HHH Q;  2I5M X;  3I4L A;  1QG7 A;  1K8M A;  3CCL A;  1EL0 A;  3BDL A;  1XPR A;  3J80 i;  2F0I A;  1JQY D;  1KAB A;  3CHB D;  3F1Z A;  4S3S A;  1X3F A;  2NVQ H;  3OOC A;  3PO2 H;  1STN A;  3KF6 B;  4EQO A;  4IUR A;  4A3M B;  3S1M B;  4Y52 H;  5M3F G;  4LUZ A;  4OO1 I;  4KHV A;  3DUZ A;  2N55 A;  2M00 A;  1X3Q A;  4TRD A;  4BWG B;  5EBD A;  3HOX B;  3UDG A;  1HZ9 A;  1QNU A;  2D0P A;  2DJF C;  4FYD A;  3H09 A;  1JJC B;  2F52 A;  5BN5 A;  4IOA A;  1TWC H;  4LWC A;  5JEA H;  2K01 A;  4DXF A;  1B2T A;  1YHA A;  2MUY A;  4JV5 Q;  2LMC B;  3Q8D A;  4JG2 A;  2AQ2 B;  5JEA G;  3CF5 A;  1J9O A;  1YIJ A;  3K5O A;  1F9P A;  3T16 A;  1B44 D;  2A69 C;  1XX8 A;  3UDX A;  1S5C D;  1LT6 D;  2Z0S A;  4GN3 B;  5M5X H;  3M4O H;  4RAU C;  1HQR D;  1KIX A;  2EY2 A;  2YU9 B;  1EWH A;  4H7B A;  1YJ9 A;  1XWE A;  5KRU A;  4LF4 L;  3PUY A;  2UUB Q;  1PH5 A;  4CDD C;  4DV6 L;  3KDF B;  1YIT A;  2PPB C;  2X69 A;  4J8Q A;  5JJI A;  1PH1 A;  2EQS A;  3I8Z A;  2VL6 A;  2TSS A;  1C9O A;  1ICF B;  2DY7 A;  3SEB A;  1S40 A;  3EJI A;  5C4X H;  3SK6 A;  4JOI A;  4FF3 A;  4DR7 Q;  2X6L A;  3I4M B;  5C4X G;  3J80 L;  4FO2 A;  1WTQ A;  3TRZ A;  5LMN Q;  1GOZ A;  1PH4 A;  4DR5 L;  4QMG A;  1EFW A;  1DJR D;  4HIM A;  1SNO A;  4IAL A;  2OCE A;  4JI6 Q;  4RMF A;  4GNX C;  4LFA Q;  3IAY A;  1AE2 A;  1STB A;  2EOT A;  2B8G A;  3QOL A;  1IYU A;  1HFN A;  3NTK A;  2L11 A;  2NB0 A;  4A3M H;  1OXX K;  5D3D A;  3GD7 A;  1E24 A;  3S1M H;  1UEB A;  2HIV A;  4G7Z C;  5FLX E;  2R7Z G;  2JA6 G;  3VR2 A;  2K03 A;  2LXJ A;  3HOX H;  1NE3 A;  1YBY A;  4NKL A;  1X3P A;  4X3T A;  4LF6 L;  4JBJ A;  4EQP A;  2B2W C;  2EDG A;  2HUG A;  3H6M A;  5GQO A;  2FHT A;  2C35 B;  4KN4 C;  1KC8 C;  1X3G A;  2KCT A;  5EKI A;  5IE8 A;  4EGV A;  5FO7 B;  3NEM A;  1FVI A;  4WRD A;  4B08 A;  5L37 A;  2EXD A;  3A8J E;  2MHV A;  1OTC A;  3M9B A;  2YU9 H;  5EJW A;  1C48 A;  1Z7T A;  3A54 A;  4DAV A;  1RTO A;  2YTV A;  1VQF A;  2VY3 A;  4RKB A;  3NBH A;  1I4G A;  1F2L A;  3DWQ A;  4OHJ A;  2HIX A;  3PSI A;  3I4M H;  2XWJ B;  1PRT D;  1MBY A;  1IKL A;  4O0A A;  4DR3 L;  1EIF A;  2OWO A;  4G57 A;  4NDX A;  4HN7 A;  2MNA A;  1YHQ A;  1BQQ T;  2I46 A;  1XYI A;  1Y1V G;  3PMF A;  1CM9 A;  3MXU A;  4JOI C;  3UE0 A;  4UP8 A;  2KEC A;  3U58 A;  2EVB A;  5C3X A;  2L9H A;  1JOO A;  3R2I A;  2J4X A;  3I56 A;  1I4H A;  2E76 C;  3HKZ E;  1QUQ B;  3VR5 A;  1HHV A;  3K7U C;  5IYC H;  3MXG A;  5K5P A;  2K5W A;  4DKA C;  1Y1W G;  2XWB B;  1OXU A;  1L1O A;  1D5M C;  2A74 C;  3T56 B;  4N8F A;  1EEI D;  4BBS B;  4ZUJ A;  1VQB A;  2WB1 B;  3LGJ A;  1BNZ A;  3FKI B;  4L5R C;  3PGZ A;  1CUK A;  3CW2 C;  4DR1 L;  2J0T D;  4YCW A;  5JPN C;  4K2L A;  3D6W A;  1Q8I A;  4QUF A;  1TU2 B;  4LFB L;  2D2C C;  1LTG D;  1E22 A;  1EIH A;  4IZ8 A;  1WJJ A;  4I7A A;  1TQO A;  3A8K E;  4E6I A;  3X3M A;  3KYH C;  5GAG C;  3A5U A;  1PRT F;  4DR4 L;  1OXV A;  1QNK A;  1VQ5 A;  1RCV D;  4DUY L;  2WAC A;  1VQ9 A;  1BCP F;  3FEW X;  1MSH A;  1WD1 A;  3A8I E;  1QVC A;  3C1F A;  1Y69 U;  1B3Q A;  3NWT A;  3X3N A;  4RGO S;  2F0N A;  2A1A A;  2EJG C;  2B29 A;  5C4J B;  3CQZ B;  2FIN B;  5M3M B;  2DNC A;  1EQT A;  2XSC A;  2F3I A;  5C5M A;  2MO0 A;  5JOB A;  1PFB A;  1YEZ A;  1PLF A;  5COR A;  1D6E C;  4KKT A;  3PIO 3;  5A2Q E;  4H02 A;  2F4V Q;  5IYB H;  1BO0 A;  2EY5 A;  4QQB X;  4ZQ3 A;  2F0G A;  3J7A 5;  3M85 A;  4QIW E;  3NBH B;  1A0I A;  5JVG 3;  4UPA A;  2WKD A;  1XNR Q;  1ROD A;  2Z6B A;  4CGY B;  4IUV A;  3E6Z X;  2CQO A;  2IL8 A;  4FF2 A;  4DA2 A;  1NAP A;  3IFT A;  4DNT B;  1YVC A;  4L5S A;  4BBS G;  5C0X H;  1SMY C;  3D4W A;  3FKI H;  4QUC A;  4XQN A;  1YNN C;  4ZK9 B;  5C0X G;  1WI5 A;  3HGB A;  1G6P A;  1DGS A;  2RHS B;  2MO1 A;  1L1O C;  2WAQ G;  4GKJ L;  2L4N A;  2JXM B;  3QR8 A;  1F77 A;  4ULL A;  4POF A;  4H44 C;  1I94 Q;  3BU2 A;  1LTA D;  3CKI B;  1RDP D;  2K4K A;  4PMW A;  3PF4 A;  3F2D A;  1IBL L;  2B63 H;  1HNW Q;  1Q12 A;  2XTI A;  3T51 B;  1DOM A;  2ENB A;  1DD2 A;  1VMC A;  1JMC A;  1X6O A;  5EGT A;  1GO3 E;  5BR8 L;  5C4J H;  3CQZ H;  1S5F D;  5M3M H;  2L55 A;  3HRZ C;  1BKB A;  1TY2 A;  1K8G A;  4B3M L;  2VXW A;  3D0F A;  2B8F A;  5M3M G;  1BBU A;  4IPG A;  1ASY A;  4P72 A;  1S5E D;  3VYR A;  1DOK A;  2PZW A;  5LMU Q;  3QG1 A;  3NQI A;  4DV2 L;  4ZLT F;  1F2Z A;  1N34 L;  1JE4 A;  3KLW A;  4IJH A;  1MD2 D;  5C44 B;  1BVS A;  1UWV A;  2ATW A;  2KVM A;  2VQF Q;  1SE8 A;  3TBI B;  2UXD L;  1UEA B;  2E2H B;  3SVM A;  4GS3 A;  4OX9 Q;  1A6X A;  5DLQ E;  5J22 A;  2DJG C;  3D4R A;  4P74 A;  4JI3 Q;  2KEN A;  1IBK Q;  1CZG A;  2R3Z A;  1Q90 A;  3J80 c;  3HOU B;  3CCQ A;  2JN4 A;  4DV5 L;  1BF4 A;  3BYY B;  3NK9 A;  2UUA Q;  5DAU A;  4DAP A;  3H94 A;  4V0B A;  1SYG A;  4HMJ A;  4MTK A;  2ZT9 C;  3I55 A;  2PNR C;  2JK8 A;  4G7O C;  3JAM i;  4U67 3;  4K0K L;  2F4I A;  2RA4 A;  4X3U A;  4MN3 A;  1JWM D;  1ZYR D;  4UAI A;  1TWH B;  1KNE A;  4DF7 A;  1QJO A;  4R1J A;  4DR2 L;  1CKN A;  2JP1 A;  3ERQ A;  4XXE A;  4KD3 A;  2PNH A;  5AJ3 L;  1CA6 A;  2I5L X;  2CWP A;  3J81 i;  1LO5 D;  2ZXO A;  2Q8T A;  3K0X A;  5DM7 3;  1PH6 A;  1JT8 A;  4JI8 L;  2D5D A;  5IGE A;  2HCI A;  5IGF A;  3FRP B;  2CH4 A;  4UP7 A;  2BA0 A;  1G91 A;  4KY5 A;  4PZ8 A;  1XMO L;  4BY1 B;  3QWN A;  4YWL A;  3K80 C;  3CME A;  1QOH A;  1NMG A;  4NXM L;  2R6G A;  3KLS X;  4OWT B;  4DGZ A;  1A3U A;  3D6C A;  3MEH A;  5C44 H;  2JA7 B;  4A3L G;  1SJE D;  3K5L A;  4HR7 B;  2QCP X;  1M4V A;  1G8Z D;  1MKH A;  1PTO D;  2NN6 G;  2E2H H;  2PZT A;  2PO4 A;  4DFA A;  4FF4 A;  1CTM A;  3STB C;  1BR9 A;  4HIK A;  1OO9 B;  4LJZ C;  4AQY L;  3SK8 A;  2O4X A;  3D3R A;  1U9R A;  3K5M A;  3CCU A;  2AUK A;  2Y0S B;  3JAM L;  3HOU G;  1EYC A;  4C3J G;  4ZCK A;  1QWY A;  3I4O A;  3BVZ A;  2FFK B;  4BXX H;  4CKC A;  2RHQ B;  4ODG A;  1AW7 A;  1FYC A;  4OWW B;  5E1F A;  4DAM A;  2AHO B;  1PHJ A;  2OQK A;  2WB1 E;  2UUC Q;  2D62 A;  1B3A A;  5KYL A;  1HNZ Q;  2PMZ B;  1TWH H;  2F0U A;  1CHQ D;  3TSS A;  4HCE A;  3TDQ A;  1EQR A;  1UE5 A;  2B2Y A;  1STG A;  2G9H D;  4A3G G;  1ONL A;  3RLF A;  5FO9 B;  4IUP A;  1FR3 A;  4LF5 L;  3P20 A;  2ZM6 L;  2ZJP A;  2K7V A;  5CV4 A;  4L6T B;  4DAY A;  1JWS D;  3HOZ G;  3SR1 A;  5GAD C;  4KD4 A;  4DV1 L;  1GUW A;  4A3I B;  4BY1 H;  1GM5 A;  1HNX L;  4R4I A;  4BY1 G;  4KN7 C;  1JWU D;  1CKN B;  2JA7 H;  1WTP A;  2MFI A;  2JA7 G;  4IJL A;  3VYS A;  3S1N H;  2E2I B;  4YWM A;  3SE0 A;  2JE6 I;  3T13 A;  4NXN Q;  3EN2 A;  5LMN L;  4DV4 Q;  1HQM C;  2CFM A;  1J8I A;  1IBM Q;  3OIQ A;  3IL8 A;  4HJ8 A;  4QL5 A;  5CR3 A;  4LAA A;  1FNU A;  2N78 A;  4HJA A;  2EJM A;  1XMQ Q;  4KMU C;  4UHV A;  3S2D B;  2NZH A;  3OW2 A;  2Y0S G;  3F2C A;  1Q81 C;  2CWA A;  4KHP L;  1LT3 D;  3RR5 A;  1N36 Q;  2JA8 B;  2Z9H A;  2F0M A;  2L15 A;  5CYU A;  3A5Z B;  5KGU A;  2EYJ A;  2NTT A;  1FNW A;  1X65 A;  4KY7 A;  2A6E D;  1CHP D;  4QGU A;  2CW0 C;  1N32 L;  1Q82 C;  4JI7 L;  3S1Q B;  2K14 A;  3S14 B;  2BDN A;  4DR6 L;  2K6A A;  3CP0 A;  2VQE Q;  5M5X B;  3I70 A;  1VQI A;  2OEO A;  3ULP A;  4A3E B;  2Q8R E;  2F0T A;  2PQA B;  2XRQ D;  3PO3 B;  1F2M A;  1CK1 A;  1JE5 A;  4HIO A;  2DGY A;  5ISR A;  1N9W A;  1YNJ C;  2ALY B;  3BDO A;  2ICE C;  2VB2 X;  2VZA A;  4CDE C;  2B2Y C;  5HGQ A;  2EYO A;  4B3T L;  3HOW B;  4KV6 A;  2A73 B;  4JI0 L;  2NZ1 D;  4BA2 I;  1H9J A;  1E2Z A;  1ZEQ X;  5M5Y B;  3I72 A;  5JEA J;  4RCN A;  4A3I H;  1K8A C;  5LHY 1;  3GO5 A;  1RTN A;  2HQL A;  3CC2 A;  3W3A A;  1EYG A;  4B3R L;  1DON A;  3ULJ A;  2QF7 A;  2MPM A;  4PQX A;  3PF5 A;  3GV6 A;  3ICE A;  3ND9 A;  5CV7 A;  4QJF A;  4UY8 C;  2R93 G;  3HG9 A;  4DV7 L;  4C3H B;  4RCO A;  2E2I H;  4YCV A;  2K75 A;  4DNR B;  1N33 Q;  4RH6 A;  5H1S E;  3IRB A;  2NYZ D;  4KK7 A;  4IPH A;  3UDF A;  4LMQ D;  1FGB D;  3PUV A;  4L63 B;  1A62 A;  1B1Z A;  3I4N B;  3VR3 A;  2B2W A;  3GTJ B;  2SOB A;  2F1M A;  1KHI A;  3S2D H;  4YY3 Q;  3KOJ A;  5M9O A;  3K58 A;  3PO2 G;  3HFZ B;  3MXN A;  1S5D D;  3KBG A;  5A2Q L;  4LF7 Q;  1TS5 A;  3NP8 A;  1EUJ A;  3MFY A;  4GN5 A;  1D1K A;  4WJ3 M;  2JA8 H;  4PZ7 A;  2SNS A;  2NVY B;  4LFC L;  4H13 C;  4JCV E;  1C7Y A;  1EY9 A;  5GAH C;  5FJ8 H;  1PYS B;  4CJ0 B;  1PYB A;  4L5Q A;  1FJG Q;  4A3K B;  4O2D A;  2IW3 A;  3S1Q H;  3DXJ C;  3S14 H;  1NSN S;  4FP5 D;  1JOR A;  1D7Q A;  4IFD H;  1SYD A;  2XNA C;  2ZJQ A;  4A3E H;  3HKS A;  3E3X A;  1I50 B;  1D8L A;  3PO3 H;  4A93 H;  3DWA A;  4C56 C;  3AFQ A;  3K8A A;  3SDZ A;  4YHH Q;  1PFN A;  3NBI A;  2VNU D;  2H4O A;  1HR0 L;  3HOW H;  3H3V C;  2VUM H;  5M5Y H;  1K0S A;  1VQN A;  4X62 L;  3HOW G;  1PZJ D;  5LL6 S;  3EQL C;  1HPC A;  2YTY A;  1M90 C;  2E5L L;  3WOF A;  1IL2 A;  1X3E A;  3L0O A;  2EYL A;  4X3S A;  1LAB A;  4P75 A;  4C3H H;  3K57 A;  4CKE A;  3NHH A;  4JI2 L;  4C3H G;  4JYA Q;  1JJ2 A;  5F2D A;  4JI5 L;  3MFG A;  3CXC A;  2CCZ A;  3KLR A;  1QZH A;  3I4N H;  1EWI A;  3GTK H;  3ER0 A;  3L7Z C;  3GTJ H;  2Q2T A;  3FPP A;  4XYO A;  4KKS A;  5IIF A;  1KQS A;  4M8A A;  2CQA A;  4GNX B;  1FD7 D;  2NN6 I;  4DUZ Q;  4A3M G;  3BS1 A;  3HOV B;  3W1G A;  2QEX A;  5KND A;  1NR4 A;  3HOX G;  1SND A;  4ZKB B;  2C5C A;  2NVY H;  1WTH A;  1E7Z A;  4X66 Q;  1EU3 A;  1D2B A;  4TSS A;  1I3Q B;  2QEJ C;  2R7F A;  4Q0F A;  5I9O A;  3TP6 A;  1LYL A;  2BOS A;  4A3K H;  3VR6 A;  1WCM B;  2HCC A;  1V1O A;  2RDG A;  3MWY W;  5CV8 A;  3QO2 A;  1ENF A;  1V1P A;  3PV0 A;  4BY7 H;  2GVB A;  1GJX A;  1VQA A;  3J81 E;  1GUG A;  2Y0S E;  3MXN B;  3ZYY X;  5IWA Q;  1K28 A;  4HSP A;  1A2U A;  3V96 A;  5IOD A;  1I50 H;  4IUU A;  4HJ9 A;  5IGC A;  2BE5 D;  1STH A;  3HOY B;  1LV9 A;  1J5E Q;  3NEN A;  5ELN A;  2K04 A;  1D1I A;  1VQ8 A;  4FNF A;  5GAE C;  2PMZ E;  3E9H A;  3JAM c;  2JJQ A;  2KCM A;  4DV3 Q;  2OQ0 A;  2BDO A;  4RGT A;  5E4W C;  1EYA A;  2HDL A;  4HID A;  3FVQ A;  3H3V H;  1SN8 A;  3EVQ A;  2JA5 B;  1I4R A;  1SXT A;  4PV1 C;  3I4M G;  3OTO Q;  1M1K C;  1AEX A;  4B3S Q;  1BXT A;  1WTX A;  1BCP D;  4NMZ A;  3OWE B;  2Z4I A;  4K6D A;  4P73 A;  4YWK A;  4CHT B;  3J81 c;  5IGG A;  4LF8 L;  1UUP A;  2UU9 Q;  1C0A A;  1PXU A;  4DV0 Q;  4DU9 A;  4TVA B;  1EIY B;  3G6J B;  4MHE A;  2MP1 A;  3BZC A;  1B9N A;  1DXM A;  3IFD A;  1QB5 D;  3W1B A;  2K28 A;  4R4T A;  3HOV H;  1CKM A;  5IYC G;  2IJ0 A;  1EOV A;  5IT9 L;  2EYH A;  2NVX B;  1JB3 A;  3CD6 A;  1IW7 D;  3U9S A;  3KJP A;  2EY1 A;  1I3Q H;  2QDB A;  5CMD A;  1NJI C;  1G6Z A;  3OMC A;  1WCM H;  2Q8I B;  3MVV A;  2A68 D;  4K8I A;  4P71 A;  1WCM G;  1U4L A;  3CRK C;  2EZV A;  3K0Y A;  3KJO A;  2NWG A;  4UDU C;  2NUC A;  2PI2 A;  1IHZ A;  3HZX A;  3H0G B;  3HOY H;  2BH8 A;  2L12 A;  2I07 B;  1HZB A;  5FKA C;  2B63 B;  1PH7 A;  5E7N A;  5ELE A;  1G51 A;  1PV4 A;  1FL0 A;  5C0X J;  1O78 A;  2V1C C;  1B7Y B;  3A56 A;  3DHQ A;  4A3J B;  1V1P B;  1GUO A;  2I0Q A;  3LX0 A;  2NTS A;  5C4Z A;  3GTM B;  4LF4 Q;  1VDZ A;  2IX0 A;  3A74 A;  2OTJ A;  4XTC S;  1HFG A;  1RL2 A;  2JA5 H;  4DV6 Q;  4XT1 B;  4K5V A;  2A6H D;  1HJP A;  3U50 C;  1XNQ Q;  1AP0 A;  5CV9 A;  2OT2 A;  2O5J C;  2K05 A;  3SGI A;  1DYQ A;  5IYB G;  2YV5 A;  1UE7 A;  2LS0 1;  3VYT A;  1V1Q A;  4XYQ A;  2XVS A;  3R8B A;  1EY8 A;  2I5H A;  3CCE A;  3CCR A;  1EOT A;  2F0O A;  2JQO A;  4C1N I;  4A3D B;  4DR5 Q;  1LTB D;  2MQH A;  3OPO A;  4QY7 A;  4B9W A;  4DK3 C;  3J81 j;  4ILW A;  2BE5 C;  4C2M B;  4MZ9 A;  3G6E A;  1HCZ A;  1TS4 A;  1EEF D;  4MIU A;  3NWS A;  3A7L A;  4X64 L;  2SEB D;  1SNC A;  2NBF A;  3MA2 B;  5C5L A;  2NVX H;  3BG3 A;  3Q0A A;  3AU7 A;  3OMG A;  5CBA E;  1MHW C;  4G7H C;  4A75 A;  2WB1 G;  2IHE A;  3FKI G;  4LF9 L;  3T1H Q;  2N88 A;  1PRT C;  3NTH A;  3W5O A;  2SDF A;  4HMI A;  2LSS A;  3ZJY C;  1BCP C;  2QKI C;  1Q1E A;  4LF6 Q;  3SXH A;  3VR4 A;  5TSS A;  1TWA B;  3TZU A;  3M7N A;  1L1O B;  2BA1 A;  1Z9F A;  1TXY A;  3I90 A;  3ULL A;  4NB3 A;  3H0G H;  3P1H A;  2AMC B;  1K73 C;  3R2T A;  2LY7 A;  1ML0 D;  1R4Q B;  1SBB B;  4KY6 A;  1SE2 A;  2B63 G;  2WKC A;  1TKW B;  4CBV A;  4K8J A;  4DK1 A;  2E75 C;  4A3J H;  2UXB L;  2M9V A;  4FXG C;  3EIV A;  1TT2 A;  4ZYS A;  4OGQ C;  3WWV A;  4RHR A;  3GTM H;  1LTR D;  2H1E A;  2RQX A;  4PZ6 A;  3OW7 A;  4GLV B;  3J80 E;  3S9W A;  1PH9 A;  1IW7 C;  3VA5 A;  1VQ6 A;  1VQJ A;  3K81 C;  2UXC L;  1VS0 A;  3G71 A;  1NY4 A;  3M3Y B;  4GKK L;  4JW0 A;  4XDX A;  4DR3 Q;  4XQQ A;  3R3O A;  4LNQ A;  5FLM H;  2KUM A;  1P8L A;  2ZTC A;  4A3D H;  3BVM A;  1CQF A;  4WJW A;  4A3D G;  1O7Y A;  1LTT D;  4C2M H;  4A3F B;  1CQV A;  2WII B;  1SDF A;  2KCC A;  1SNM A;  2YYZ A;  4ME5 A;  5IP9 H;  3PCO B;  3PIO A;  3D31 A;  1LT4 D;  4F87 A;  4JI4 L;  1GVP A;  3FP9 A;  4U68 A;  5IP7 H;  3PIP 3;  4NPS A;  1IBM L;  1CZW A;  5DM6 3;  1BUV T;  1CSQ A;  2VW9 A;  4MNO A;  1A63 A;  1TWA H;  1H9S A;  3LNN A;  4OO1 H;  4DR1 Q;  4OWX B;  3OHX C;  1E2W A;  4LFB Q;  5J39 A;  1ET6 A;  3UI2 A;  3W2D A;  3S17 B;  2K50 A;  4HED A;  5C6A A;  2HQE A;  5LL6 X;  4BS9 A;  3KLS A;  1KAA A;  4DK0 A;  2EIF A;  4IO9 A;  4DUY Q;  5IOC A;  1VF7 A;  1I4P A;  1WTW A;  1IYV A;  1LTS D;  4AH6 A;  4ZAI A;  1TVX A;  1GUS A;  5KEE A;  3M3Y H;  4XIG S;  1D5Z C;  3NEL A;  2AWN A;  2KBN A;  1PH8 A;  1KRS A;  4BBR B;  2K1B A;  5E4X A;  2WIN B;  3D8G A;  3CAM A;  1HTL D;  5AFW A;  3TME A;  2D9U A;  1G29 1;  4C3I B;  3MHB A;  4A3F H;  1BOS A;  4P2C B;  2PZU A;  4KLK A;  5C44 G;  3S1N B;  3I73 A;  2XRS D;  3M4Y A;  1GHK A;  1OXS C;  1SE4 A;  1W6K A;  3T4A C;  1RIP A;  3RN5 A;  5HUR A;  2YTX A;  2F0S A;  2HHH L;  5I4D A;  3FDT A;  3HS0 C;  2PCF B;  4K6L A;  1NUC A;  4A3C H;  4F8M A;  2PYK A;  4FDB A;  1QCB D;  1SMX A;  5DEH A;  2RF4 A;  2AQ3 B;  2LXK A;  3TS0 A;  2CH4 W;  3EBE A;  5EAY A;  2AKW B;  1EQQ A;  5M5W B;  1C4Q A;  3L2P A;  1I4X A;  4DPG A;  4BXX G;  3H15 A;  2E8G A;  2F0D A;  4FVM A;  3S17 H;  4GKJ Q;  4X3K A;  1Q1B A;  1U4R A;  1Y8N B;  3CCV A;  4YCU A;  4ABN A;  1HZA A;  2F0H A;  3QJY A;  5FLX L;  4OIK A;  5JJK A;  2R7D A;  1VMP A;  2Z8L A;  4POG A;  1YZ6 A;  3C46 A;  4JV5 L;  1IBL Q;  3K6O A;  1I5F A;  1IZ6 A;  2R61 A;  3T1Y Q;  1Y14 B;  1H9R A;  5BR8 Q;  1TS3 A;  1AE3 A;  3NQT A;  2ZJR A;  1MSG A;  3DEP A;  1EFI D;  1MI2 A;  4R8N A;  4B3M Q;  4UP9 A;  4BBR H;  5CBE E;  4IQZ A;  1MGS A;  4BBR G;  3DEO A;  1SAP A;  4F88 A;  1MIU A;  1O80 A;  2UUB L;  3TEH B;  1U0L A;  1ESF A;  4C3I H;  1HA5 A;  1M8A A;  2PW7 A;  4TKO B;  3U4V A;  4DNI A;  3OYY A;  1ICW A;  4DV2 Q;  1B9M A;  3TN2 A;  1SNP A;  4A3B B;  4DR7 L;  5D3I B;  4ZRZ A;  1A3V A;  1ZXT A;  4K14 A;  1ZYR C;  1N34 Q;  2B2U A;  4AYB B;  2EYP A;  3S24 A;  4HTH A;  1WOC A;  1PH3 A;  3HEJ A;  4HSV A;  1SE3 A;  2UXD Q;  4L5T A;  4XT3 B;  3TZD A;  5I9P A;  1WTR A;  4JI6 L;  3BZD B;  3GTO H;  3DWP A;  4R4O A;  1J6Q A;  1V9P A;  1P16 A;  1VQ7 A;  1E0B A;  4R9W A;  4LFA L;  4GOP A;  2NVT B;  4PG3 A;  2A69 D;  4QF4 A;  3KFU A;  5M5W H;  4ME3 A;  4Z9C B;  2EYF A;  5C0X I;  1T5E A;  2N49 A;  2TMP A;  4LUV A;  1HXY D;  4JBM A;  1DOL A;  3CC4 A;  2RSN A;  2G5D A;  4KTA A;  2F3W A;  1Y8O B;  1L0W A;  5ELB A;  2E2J H;  1A3T A;  2F0L A;  3JC6 6;  3CCS A;  1I6V C;  1Q3L A;  3VYU A;  1TWG B;  2QW7 A;  4KJN A;  4GLX A;  1PTO C;  4A4I A;  4K0K Q;  1AN8 A;  1EU4 A;  1A8V A;  2XN9 C;  5EPJ A;  3VA7 A;  5G3L F;  2ASB A;  2RCN A;  4A93 B;  2M2L A;  4DR2 Q;  3KDF A;  2AWO A;  5D14 A;  5CGK A;  2RDF A;  4J1M A;  1I4Q A;  2X6G A;  2VUM B;  5AJ3 Q;  3DLL A;  3DM3 A;  4OIJ A;  3S16 B;  1EYD A;  4A3I G;  2KCN A;  1X54 A;  2KJX A;  1L0Y B;  1EZ6 A;  1V8Q A;  3M7G A;  4JI8 Q;  1WVL A;  4JI1 Q;  1K3B C;  3URY A;  3K5N A;  1RD9 D;  1UNS A;  4DXG A;  4IFD J;  2R92 B;  4A3B H;  3P7J A;  1E3P A;  1CFM A;  5EBC A;  1EQV A;  3I7F A;  1HUN A;  3E0E A;  4PMC A;  3TQY A;  4NXM Q;  2B2V C;  4DAY B;  4ZKC B;  2GVA A;  1HA6 A;  4Y7N B;  4I65 A;  3GTK B;  1SYF A;  3S15 B;  2DN8 A;  3MEF A;  1JIC A;  4ALP A;  2CHB D;  1QVF A;  1K9M C;  4GLA C;  4WOR A;  2AQ1 B;  2NVT H;  2B2U C;  1K0R A;  3GTQ H;  2LFN A;  2L0C A;  1EY4 A;  1HUM A;  1LM0 A;  1XTC D;  1EZ8 A;  2BH2 A;  5BN4 A;  4N8X 1;  4PNY A;  5HY6 A;  4AQY Q;  2JA8 G;  3F8T A;  3TP8 A;  1GD7 A;  2N3S A;  3J7Z C;  3AEV A;  1X55 A;  4IN3 A;  4GOP C;  5FJ8 G;  5M3F H;  2R7Z B;  2JA6 B;  2FMM A;  1TWG H;  2HT1 A;  4BY7 B;  4V19 0;  1KDB A;  1STY A;  1VQK A;  4GOP B;  1VQL A;  1PDQ A;  1S4Z A;  2K32 A;  3LWE A;  1W2B A;  3FPU B;  5JAV A;  3GTP B;  1TWF B;  4IFD G;  2EE1 A;  2KEE A;  4IUT A;  4JVZ A;  1KL9 A;  1PTO H;  4A3E G;  1EY6 A;  2IY5 B;  2H5X A;  3PO3 G;  4XQJ A;  4A93 G;  1LUZ A;  5T1I A;  1DZ1 A;  4JBK A;  2AUJ D;  3S16 H;  2VUM G;  4LF5 Q;  2ZM6 Q;  5EQ0 A;  1IYJ B;  3Q6S A;  1YJW A;  1T9H A;  2Z6K A;  1T5X D;  3CU7 A;  3RMH A;  4DV1 Q;  2R92 H;  4K5X A;  2PQE A;  1HNX Q;  4A76 A;  2R92 G;  1SR3 A;  2A6E C;  5FO8 B;  5A35 A;  2HD3 A;  2F0P A;  1NMF A;  4RHS A;  2RBM A;  5KNB A;  1GXD C;  2Z1C A;  1R4P B;  2RSO A;  1VF5 C;  3C2P A;  3O13 A;  1XNQ L;  4Y7N H;  1PZK D;  2CKZ B;  2F4V L;  2ZTD A;  1NBW A;  2SNM A;  3I4N G;  3S15 H;  3PQI A;  3C3L A;  3NPP A;  1QUQ A;  1ILQ A;  3FHW A;  3F2U A;  2F3V A;  1QE6 A;  3N6R A;  1BBX C;  1H9K A;  3KUP A;  3JAM E;  3NTI A;  1XNR L;  1Y1V B;  4QB4 A;  1FGU A;  2OTL A;  1O7Z A;  2PW5 A;  3U9O A;  2FJ2 A;  2WP8 J;  1GUT A;  1F9S A;  4K5W A;  3QIA A;  1PH2 A;  4N9P A;  4KHP Q;  1GHJ A;  2R7Z H;  2JA6 H;  2CVR A;  1VQO A;  1BBW A;  1H9M A;  4A3K G;  1VQM A;  3VDY A;  1Y1W B;  3I91 A;  1H95 A;  1SYC A;  4BY7 G;  3A0J A;  4NP5 A;  3T1H L;  3GTP H;  1TWF H;  3D4D A;  1EWC A;  4X65 Q;  5COY A;  1E1O A;  3R93 A;  1WTO A;  1N32 Q;  1G2S A;  4JI7 Q;  1HTP A;  1RJT A;  4WFN 3;  1VQP A;  1AZQ A;  5IGB A;  1I94 L;  4WJ4 A;  4DR6 Q;  1AZP A;  1NNX A;  1DCZ A;  1UE6 A;  3RZD B;  2RCF A;  1HNW L;  2KA7 A;  1HRJ A;  4J15 A;  4RG1 A;  3CC7 A;  4OEM B;  1R9T B;  1ZKO A;  3OWF A;  4B3T Q;  3QB3 A;  2IPK D;  4JI0 Q;  3C1E A;  3I2Z A;  4LUO A;  1GKH A; 
#chains in the Genus database with same CATH homology
 3MTS A;  2XIW A;  3EA6 A;  1NCV A;  1E2V A;  3NUC A;  3ITP A;  3OIP A;  1SMY D;  2K5D A;  1AFP A;  1LTI D;  1YNN D;  5J1Z A;  3G7L A;  1RF2 D;  4C1N K;  3T53 B;  3WOE A;  1STE A;  1RKN A;  2B39 A;  1SNQ A;  3FMC A;  3S1R B;  2JEB I;  1CA5 A;  5KNC A;  1CI3 M;  2EXZ A;  4FXK C;  2EY6 A;  1CT1 D;  1SEB D;  1G2T A;  3GP7 A;  3J7A F;  1II3 A;  5BN3 A;  2V4D A;  4I7Z C;  2L1B A;  2ID0 A;  5I2X A;  4L8J A;  5JJZ A;  5D65 A;  4KI0 A;  2WAQ B;  3PUW A;  1OXT A;  3GV3 A;  2E74 C;  1ENA A;  2JYO A;  4IUQ A;  1XXG A;  3E5S A;  4KHZ A;  4RKL A;  1IL8 A;  2OF1 A;  4F7X A;  1B50 A;  3WDN A;  1JR0 D;  5T1G A;  2JSO A;  5DNF A;  3BYT B;  3BDC A;  1LLR D;  4LK1 C;  1I6H B;  1JCK B;  1TS2 A;  5E3F A;  2HDM A;  4HCS A;  1ESR A;  3MC0 B;  3KBX A;  2MJ8 A;  5CV6 A;  1L0X B;  5EKK A;  3P75 A;  2F0V A;  1PRT B;  3N52 A;  1JC7 A;  3J7Y W;  1F2Y A;  1Z47 A;  1V43 A;  1BCP B;  2KHS A;  5JPM C;  3K7A B;  3SK4 A;  2WV6 D;  1DM0 B;  2VB3 X;  4EQN A;  2IX1 A;  5K36 H;  1SFO B;  2F0K A;  4H0L C;  1TY0 A;  5K36 G;  3RD4 A;  4KJO A;  1SSO A;  1B4O A;  4IFD I;  2BCO A;  2EPB A;  3KF8 A;  3Q24 A;  1WTV A;  4JBW A;  5JVH 3;  2OXP A;  3A7A B;  2LKV A;  3MZ5 A;  2Z4H A;  1ENC A;  1NR2 A;  3PUZ A;  2A68 C;  1KTK A;  1S5B D;  3RUZ A;  1JOK A;  4J6H A;  3DMU A;  5KYI A;  4DN4 M;  4TQU S;  4RGM A;  2EYM A;  2JEA I;  1ET9 A;  5C3W A;  5I6Y A;  3QOJ A;  1W6J A;  4K2K A;  2F0F A;  5EKL A;  2RVL A;  1IKM A;  2K5Q A;  3V05 A;  1PFM A;  2KOL A;  2A6H C;  1Y8P B;  5EPL A;  2F0E A;  4OO1 G;  4O1N A;  5KIX A;  1A15 A;  1F9Q A;  2F0Q A;  1EIG A;  4CKB A;  1K83 B;  2DNE A;  4EVO A;  4C3J B;  3EFX D;  4M1U B;  1A2T A;  3MAQ A;  2DY8 A;  4CJ1 B;  1X32 A;  4N9T A;  3SHL A;  1SYE A;  5NUC A;  3S2H B;  3LWU A;  2MGS A;  4A3G B;  3CRL C;  4RA8 A;  1TII D;  1U4M A;  3L9A X;  1EY0 A;  3K59 A;  3RZO B;  1PMR A;  3A55 A;  4Q5V A;  3J7A V;  5HGT A;  3HOZ B;  5ELF A;  2KQ3 A;  5IT9 E;  2EJF C;  1B53 A;  2J7Z A;  1KNA A;  2C9O A;  3MXP A;  2QIL A;  2CW0 D;  2IWH A;  2FMC A;  3GTO B;  4IUN A;  2NN6 H;  1KDC A;  1SYB A;  2F0W A;  4RFB A;  3NXW A;  2F03 A;  1JOQ A;  1YNJ D;  1STA A;  3GQB A;  2ZXP A;  1LT5 D;  4HAE A;  4RWS C;  1LAC A;  2E2J B;  2K33 A;  4FF1 A;  4QCL A;  3Q22 A;  4O42 A;  3ERO A;  1H9S B;  4G4K A;  1U4P A;  3NE5 B;  2B2T A;  2L5T A;  1O7L A;  4GZY C;  2O5I C;  5CC4 A;  3GTG B;  5C4H A;  4FXD A;  2KED A;  4JK1 C;  3J81 L;  1RHP A;  3GTL B;  2B2V A;  3TP7 A;  2G9D A;  5G3L D;  5CV5 A;  5ELD A;  1PYW D;  1C8C A;  4C3I G;  1ILP A;  3I3C A;  3AB9 A;  3AMU A;  2F0J A;  1GUN A;  1VCI A;  3DM1 A;  1PTO F;  1QIL A;  5EPK A;  3SK5 A;  2RKS A;  3HKZ B;  5FOB B;  2R93 B;  4YIJ A;  5C3E B;  1WD0 A;  1KLG D;  1TR5 A;  3GTQ B;  1EY5 A;  2O2L D;  1F9R A;  3OSO A;  2ICI A;  2IT1 A;  1Z6H A;  3E0J A;  3NSW A;  3PUX A;  3H91 A;  3HP3 A;  1PZI D;  3Q23 A;  2NVQ B;  2E2D C;  4RGN A;  3PO2 B;  5M3F B;  3KK7 A;  5IGD A;  2A5H A;  4R8I A;  5I2Y A;  4ID6 A;  1BDO A;  1PTO B;  1D5X C;  1TWC B;  4NW2 A;  1SJH D;  4PMB A;  4OL7 A;  2B2T C;  1EY7 A;  4KKU A;  5FK9 C;  1KDA A;  3M4O B;  2GA4 B;  3TP5 A;  2IX3 A;  3L3O C;  3BVG A;  4QIW B;  3IKJ A;  4ZUI A;  5ELC A;  4CJ2 C;  1KLU D;  5C4X B;  2ZXR A;  2RDH A;  3ONA B;  5I6W A;  3V2T A;  4B9X A;  1UAP A;  1K8O A;  1FNV A;  3ND8 A;  4BA1 I;  3I4L A;  1QG7 A;  1K8M A;  1EL0 A;  3BDL A;  2F0I A;  1JQY D;  1KAB A;  3CHB D;  4S3S A;  3OOC A;  1STN A;  4EQO A;  4IUR A;  4A3M B;  3S1M B;  4OO1 I;  4KHV A;  3DUZ A;  2N55 A;  2M00 A;  1X3Q A;  4TRD A;  4BWG B;  5EBD A;  3HOX B;  1QNU A;  4FYD A;  3H09 A;  5BN5 A;  5JEA H;  2K01 A;  4DXF A;  1B2T A;  2MUY A;  2LMC B;  5JEA G;  2AQ2 B;  1J9O A;  3K5O A;  1F9P A;  3T16 A;  1B44 D;  2A69 C;  1XX8 A;  1S5C D;  1LT6 D;  4RAU C;  1HQR D;  2EY2 A;  2YU9 B;  1EWH A;  4H7B A;  1XWE A;  5KRU A;  3PUY A;  2PPB C;  2X69 A;  4J8Q A;  3I8Z A;  2TSS A;  2DY7 A;  3SEB A;  3EJI A;  3SK6 A;  4FF3 A;  2X6L A;  3I4M B;  3J80 L;  4FO2 A;  1WTQ A;  1GOZ A;  4QMG A;  1DJR D;  1SNO A;  4IAL A;  3IAY A;  1STB A;  2EOT A;  2B8G A;  3QOL A;  1IYU A;  1HFN A;  3NTK A;  2L11 A;  2NB0 A;  1OXX K;  5D3D A;  3GD7 A;  4G7Z C;  5FLX E;  3VR2 A;  2K03 A;  4NKL A;  1X3P A;  4X3T A;  4EQP A;  2B2W C;  2EDG A;  2HUG A;  3H6M A;  2FHT A;  4KN4 C;  5EKI A;  4EGV A;  5FO7 B;  4B08 A;  4WRD A;  3A8J E;  2MHV A;  5EJW A;  1C48 A;  1Z7T A;  3A54 A;  4DAV A;  1RTO A;  4RKB A;  3NBH A;  1I4G A;  1F2L A;  3DWQ A;  4OHJ A;  2XWJ B;  1PRT D;  1MBY A;  1IKL A;  4G57 A;  4NDX A;  4HN7 A;  1BQQ T;  2I46 A;  1XYI A;  3PMF A;  1CM9 A;  3MXU A;  2KEC A;  2EVB A;  5C3X A;  2L9H A;  1JOO A;  3R2I A;  2J4X A;  1I4H A;  2E76 C;  3VR5 A;  1HHV A;  3MXG A;  5K5P A;  2K5W A;  2XWB B;  1OXU A;  1D5M C;  2A74 C;  3T56 B;  1EEI D;  4BBS B;  4ZUJ A;  2WB1 B;  1BNZ A;  3FKI B;  2J0T D;  5JPN C;  4K2L A;  3D6W A;  1Q8I A;  4QUF A;  1TU2 B;  2D2C C;  1LTG D;  1EIH A;  4IZ8 A;  1TQO A;  3A8K E;  4E6I A;  3X3M A;  1PRT F;  1OXV A;  1QNK A;  1RCV D;  2WAC A;  1BCP F;  3FEW X;  1MSH A;  1WD1 A;  3A8I E;  3C1F A;  1Y69 U;  3NWT A;  3X3N A;  4RGO S;  2F0N A;  5C4J B;  2EJG C;  3CQZ B;  2FIN B;  5M3M B;  2DNC A;  1EQT A;  2XSC A;  5C5M A;  5JOB A;  1PFB A;  1PLF A;  5COR A;  1D6E C;  4KKT A;  3PIO 3;  5A2Q E;  1BO0 A;  2EY5 A;  4ZQ3 A;  2F0G A;  3M85 A;  5JVG 3;  2WKD A;  1ROD A;  4CGY B;  4IUV A;  3E6Z X;  2IL8 A;  4FF2 A;  4DA2 A;  1NAP A;  3IFT A;  4DNT B;  5C0X H;  1SMY C;  3D4W A;  4QUC A;  4XQN A;  1YNN C;  4ZK9 B;  5C0X G;  3HGB A;  2L4N A;  2JXM B;  1F77 A;  4ULL A;  4H44 C;  1LTA D;  3CKI B;  1RDP D;  4PMW A;  1Q12 A;  3T51 B;  1DD2 A;  1DOM A;  2ENB A;  1VMC A;  5EGT A;  1S5F D;  2L55 A;  3HRZ C;  1TY2 A;  2VXW A;  2B8F A;  1S5E D;  3VYR A;  1DOK A;  2PZW A;  3QG1 A;  3NQI A;  4ZLT F;  1F2Z A;  1JE4 A;  1MD2 D;  5C44 B;  2KVM A;  3TBI B;  1UEA B;  2E2H B;  3SVM A;  1A6X A;  5J22 A;  3D4R A;  1CZG A;  2R3Z A;  1Q90 A;  3HOU B;  1BF4 A;  3BYY B;  3NK9 A;  5DAU A;  4DAP A;  3H94 A;  4V0B A;  1SYG A;  4HMJ A;  2ZT9 C;  2PNR C;  4G7O C;  4U67 3;  2F4I A;  2RA4 A;  4X3U A;  4MN3 A;  1JWM D;  1ZYR D;  4UAI A;  1TWH B;  1KNE A;  4DF7 A;  1QJO A;  2JP1 A;  3ERQ A;  4XXE A;  4KD3 A;  1CA6 A;  1LO5 D;  2ZXO A;  2Q8T A;  5DM7 3;  2D5D A;  5IGE A;  2HCI A;  5IGF A;  3FRP B;  2BA0 A;  1G91 A;  4KY5 A;  4BY1 B;  3QWN A;  1QOH A;  2R6G A;  3KLS X;  4DGZ A;  2JA7 B;  1A3U A;  3D6C A;  3MEH A;  1SJE D;  3K5L A;  4HR7 B;  2QCP X;  1M4V A;  1G8Z D;  1PTO D;  2NN6 G;  2PZT A;  2PO4 A;  4DFA A;  4FF4 A;  1CTM A;  1BR9 A;  1OO9 B;  4LJZ C;  3SK8 A;  2O4X A;  3D3R A;  1U9R A;  3K5M A;  2AUK A;  2Y0S B;  3JAM L;  1EYC A;  4C3J G;  1QWY A;  3BVZ A;  2FFK B;  4CKC A;  4ODG A;  1AW7 A;  1FYC A;  5E1F A;  2D62 A;  1B3A A;  5KYL A;  2PMZ B;  2F0U A;  1CHQ D;  3TSS A;  4HCE A;  3TDQ A;  2B2Y A;  1STG A;  2G9H D;  1ONL A;  3RLF A;  5FO9 B;  4IUP A;  1FR3 A;  3P20 A;  2K7V A;  5CV4 A;  4L6T B;  4DAY A;  1JWS D;  3SR1 A;  4KD4 A;  1GUW A;  4A3I B;  4KN7 C;  1JWU D;  1WTP A;  3VYS A;  2E2I B;  3SE0 A;  2JE6 I;  3T13 A;  1HQM C;  1J8I A;  3OIQ A;  3IL8 A;  5CR3 A;  4LAA A;  1FNU A;  2EJM A;  4KMU C;  3S2D B;  1LT3 D;  2JA8 B;  2F0M A;  5CYU A;  5KGU A;  2EYJ A;  2NTT A;  1FNW A;  4KY7 A;  2A6E D;  1CHP D;  2CW0 C;  3S1Q B;  3S14 B;  2BDN A;  2K6A A;  5M5X B;  3I70 A;  2OEO A;  4A3E B;  2Q8R E;  2F0T A;  2XRQ D;  3PO3 B;  1F2M A;  1CK1 A;  5ISR A;  1YNJ C;  3BDO A;  2ICE C;  2VB2 X;  2B2Y C;  2EYO A;  3HOW B;  4KV6 A;  2A73 B;  2NZ1 D;  4BA2 I;  1H9J A;  1E2Z A;  1ZEQ X;  5M5Y B;  3I72 A;  5JEA J;  4RCN A;  5LHY 1;  3GO5 A;  1RTN A;  1DON A;  3W3A A;  2QF7 A;  2MPM A;  4PQX A;  3GV6 A;  3ND9 A;  5CV7 A;  3HG9 A;  4C3H B;  4RCO A;  4DNR B;  4RH6 A;  2NYZ D;  4KK7 A;  4LMQ D;  1FGB D;  3PUV A;  4L63 B;  1B1Z A;  3I4N B;  3VR3 A;  2B2W A;  3GTJ B;  2SOB A;  2F1M A;  5M9O A;  3K58 A;  3MXN A;  1S5D D;  3KBG A;  5A2Q L;  1TS5 A;  3NP8 A;  3MFY A;  1D1K A;  2SNS A;  2NVY B;  4H13 C;  1EY9 A;  4CJ0 B;  4A3K B;  2IW3 A;  3DXJ C;  1NSN S;  4FP5 D;  1JOR A;  4IFD H;  1SYD A;  2XNA C;  1I50 B;  3DWA A;  4C56 C;  3SDZ A;  1PFN A;  3NBI A;  2VNU D;  2H4O A;  3H3V C;  1PZJ D;  5LL6 S;  3EQL C;  1HPC A;  3WOF A;  2EYL A;  4X3S A;  1LAB A;  3K57 A;  4CKE A;  3NHH A;  4C3H G;  5F2D A;  3MFG A;  3KLR A;  3L7Z C;  3FPP A;  4XYO A;  4KKS A;  5IIF A;  4M8A A;  2CQA A;  1FD7 D;  2NN6 I;  3BS1 A;  3HOV B;  5KND A;  1NR4 A;  1SND A;  4ZKB B;  2C5C A;  1EU3 A;  1D2B A;  4TSS A;  1I3Q B;  2QEJ C;  4Q0F A;  5I9O A;  3TP6 A;  2BOS A;  3VR6 A;  1WCM B;  2HCC A;  1V1O A;  2RDG A;  3MWY W;  5CV8 A;  3QO2 A;  1ENF A;  1V1P A;  3PV0 A;  1GJX A;  3J81 E;  1GUG A;  3ZYY X;  4HSP A;  1A2U A;  3V96 A;  5IOD A;  4IUU A;  5IGC A;  2BE5 D;  1STH A;  3HOY B;  1LV9 A;  2K04 A;  1D1I A;  4FNF A;  2BDO A;  4RGT A;  5E4W C;  1EYA A;  2HDL A;  3FVQ A;  3EVQ A;  2JA5 B;  1I4R A;  1SXT A;  4PV1 C;  1AEX A;  1BXT A;  1WTX A;  1BCP D;  4NMZ A;  3OWE B;  2Z4I A;  4K6D A;  4CHT B;  5IGG A;  1UUP A;  1PXU A;  4DU9 A;  3G6J B;  4MHE A;  2MP1 A;  1B9N A;  1DXM A;  3IFD A;  1QB5 D;  2K28 A;  2IJ0 A;  5IT9 L;  2EYH A;  2NVX B;  1JB3 A;  1IW7 D;  3U9S A;  2EY1 A;  2QDB A;  5CMD A;  1G6Z A;  3OMC A;  2Q8I B;  3MVV A;  2A68 D;  4K8I A;  1U4L A;  3CRK C;  2EZV A;  3K0Y A;  2NWG A;  4UDU C;  2NUC A;  1IHZ A;  3HZX A;  3H0G B;  2L12 A;  2I07 B;  5FKA C;  2B63 B;  5ELE A;  5C0X J;  1O78 A;  3A56 A;  3DHQ A;  4A3J B;  1V1P B;  1GUO A;  3LX0 A;  2NTS A;  5C4Z A;  3GTM B;  1VDZ A;  2IX0 A;  4XTC S;  1HFG A;  4XT1 B;  4K5V A;  2A6H D;  1AP0 A;  5CV9 A;  2OT2 A;  2O5J C;  2K05 A;  1DYQ A;  2LS0 1;  3VYT A;  4XYQ A;  2XVS A;  3R8B A;  1EY8 A;  1EOT A;  2F0O A;  4C1N I;  4A3D B;  1LTB D;  3OPO A;  4B9W A;  4ILW A;  2BE5 C;  4C2M B;  1HCZ A;  1TS4 A;  1EEF D;  4MIU A;  3NWS A;  3A7L A;  2SEB D;  1SNC A;  2NBF A;  3MA2 B;  5C5L A;  3BG3 A;  3Q0A A;  3AU7 A;  3OMG A;  5CBA E;  4G7H C;  2N88 A;  1PRT C;  3NTH A;  2SDF A;  4HMI A;  1BCP C;  2QKI C;  1Q1E A;  3SXH A;  3VR4 A;  5TSS A;  1TWA B;  3TZU A;  3M7N A;  2BA1 A;  3I90 A;  3P1H A;  3R2T A;  2LY7 A;  1ML0 D;  1R4Q B;  1SBB B;  4KY6 A;  1SE2 A;  2WKC A;  1TKW B;  4CBV A;  4K8J A;  4DK1 A;  2E75 C;  2M9V A;  4FXG C;  1TT2 A;  4ZYS A;  4OGQ C;  4RHR A;  1LTR D;  2H1E A;  2RQX A;  3OW7 A;  3J80 E;  3S9W A;  1IW7 C;  3VA5 A;  3M3Y B;  4XDX A;  4XQQ A;  3R3O A;  2KUM A;  3BVM A;  1CQF A;  4WJW A;  1O7Y A;  1LTT D;  4A3F B;  1CQV A;  2WII B;  1SDF A;  2KCC A;  1SNM A;  2YYZ A;  4ME5 A;  3D31 A;  1LT4 D;  4F87 A;  4U68 A;  3PIP 3;  1CZW A;  5DM6 3;  1BUV T;  3LNN A;  1H9S A;  4OO1 H;  3OHX C;  1E2W A;  5J39 A;  1ET6 A;  3UI2 A;  3W2D A;  3S17 B;  4HED A;  5C6A A;  2HQE A;  5LL6 X;  4BS9 A;  3KLS A;  1KAA A;  4DK0 A;  5IOC A;  1VF7 A;  1I4P A;  1WTW A;  1IYV A;  1LTS D;  4ZAI A;  1TVX A;  1GUS A;  5KEE A;  4XIG S;  1D5Z C;  2AWN A;  4BBR B;  2K1B A;  5E4X A;  2WIN B;  3D8G A;  1HTL D;  5AFW A;  3TME A;  2D9U A;  1G29 1;  4C3I B;  3MHB A;  1BOS A;  4P2C B;  2PZU A;  3S1N B;  3I73 A;  2XRS D;  3M4Y A;  1GHK A;  1OXS C;  1SE4 A;  1W6K A;  3T4A C;  5HUR A;  2F0S A;  5I4D A;  3FDT A;  3HS0 C;  2PCF B;  4K6L A;  1NUC A;  4F8M A;  2PYK A;  1QCB D;  5DEH A;  2AQ3 B;  5M5W B;  1C4Q A;  1I4X A;  2F0D A;  4FVM A;  4X3K A;  1Q1B A;  1U4R A;  1Y8N B;  4ABN A;  2F0H A;  3QJY A;  5FLX L;  4OIK A;  1VMP A;  2Z8L A;  3C46 A;  3K6O A;  2R61 A;  1H9R A;  1TS3 A;  3NQT A;  1MSG A;  3DEP A;  1EFI D;  1MI2 A;  4R8N A;  5CBE E;  4IQZ A;  1MGS A;  4F88 A;  3DEO A;  1SAP A;  1O80 A;  1ESF A;  1HA5 A;  1M8A A;  2PW7 A;  4TKO B;  1ICW A;  1B9M A;  3TN2 A;  1SNP A;  4A3B B;  5D3I B;  4ZRZ A;  1A3V A;  1ZXT A;  4K14 A;  1ZYR C;  2B2U A;  4AYB B;  2EYP A;  4HTH A;  3HEJ A;  4HSV A;  1SE3 A;  4XT3 B;  5I9P A;  3TZD A;  1WTR A;  3BZD B;  3DWP A;  1E0B A;  4R9W A;  2NVT B;  2A69 D;  4QF4 A;  4Z9C B;  2EYF A;  5C0X I;  1T5E A;  2TMP A;  1HXY D;  1DOL A;  2RSN A;  4KTA A;  2F3W A;  1Y8O B;  5ELB A;  1A3T A;  2F0L A;  1I6V C;  1Q3L A;  3VYU A;  1TWG B;  4KJN A;  1PTO C;  1AN8 A;  1EU4 A;  2XN9 C;  5EPJ A;  3VA7 A;  5G3L F;  4A93 B;  2M2L A;  2AWO A;  5D14 A;  5CGK A;  2RDF A;  4J1M A;  1I4Q A;  2X6G A;  2VUM B;  4OIJ A;  3S16 B;  1EYD A;  2KCN A;  2KJX A;  1EZ6 A;  1L0Y B;  1V8Q A;  3M7G A;  1WVL A;  3URY A;  3K5N A;  1RD9 D;  1UNS A;  4DXG A;  4IFD J;  2R92 B;  3P7J A;  1CFM A;  5EBC A;  1EQV A;  1HUN A;  4PMC A;  2B2V C;  4ZKC B;  1HA6 A;  4Y7N B;  4I65 A;  3GTK B;  1SYF A;  3S15 B;  2DN8 A;  1JIC A;  2CHB D;  4WOR A;  2AQ1 B;  2B2U C;  2LFN A;  2L0C A;  1EY4 A;  1HUM A;  1XTC D;  1EZ8 A;  5BN4 A;  4PNY A;  3TP8 A;  4IN3 A;  2R7Z B;  2JA6 B;  2FMM A;  4BY7 B;  4V19 0;  1KDB A;  1STY A;  1PDQ A;  1S4Z A;  2K32 A;  3LWE A;  3GTP B;  3FPU B;  5JAV A;  4IFD G;  1TWF B;  2EE1 A;  2KEE A;  4IUT A;  1PTO H;  1EY6 A;  4XQJ A;  5T1I A;  1DZ1 A;  2AUJ D;  5EQ0 A;  3Q6S A;  1T5X D;  3CU7 A;  3RMH A;  4K5X A;  2PQE A;  2A6E C;  5FO8 B;  5A35 A;  2F0P A;  4RHS A;  5KNB A;  2RBM A;  1GXD C;  2Z1C A;  1R4P B;  2RSO A;  1VF5 C;  3C2P A;  3O13 A;  1PZK D;  2SNM A;  3C3L A;  3NPP A;  1ILQ A;  3F2U A;  2F3V A;  1QE6 A;  3N6R A;  1BBX C;  1H9K A;  3KUP A;  3JAM E;  3NTI A;  1Y1V B;  4QB4 A;  1O7Z A;  2PW5 A;  3U9O A;  2FJ2 A;  2WP8 J;  1GUT A;  1F9S A;  4K5W A;  3QIA A;  4N9P A;  1GHJ A;  2CVR A;  1H9M A;  1Y1W B;  3I91 A;  1SYC A;  4NP5 A;  3D4D A;  1EWC A;  1WTO A;  5COY A;  3R93 A;  1G2S A;  1HTP A;  1RJT A;  4WFN 3;  1AZQ A;  5IGB A;  1AZP A;  1DCZ A;  3RZD B;  2KA7 A;  1HRJ A;  1R9T B;  1ZKO A;  3OWF A;  3QB3 A;  2IPK D;  3C1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...