4X3TA

Crystal structure of chromobox homolog 7 (cbx7) chromodomain with ms37452
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
HMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 13
structure length 62
sequence length 62
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4x3tA00
1J9OA 1JE4A 4U68A 3FDTA 2K05A 1HFGA 1XX8A 1IKLA 2N88A 4OIJA 1X3QA 3I3CA 3D6WA 5EQ0A 1WTPA 1RODA 2H1EA 4HCSA 5T1IA 1KNAA 2Q8TA 3LWEA 2EOTA 1PFBA 1RTOA 2KECA 1A15A 1G2SA 2B2TA 2MGSA 1BNZA 5EJWA 1O7ZA 3IL8A 1J8IA 5AFWA 1RHPA 2X6LA 4XT3B 2HDMA 5JJZA 1BO0A 4MHEA 3QO2A 1EIHA 2B2UA 2B2VC 4CJ0B 5E4XA 1WVLA 2JYOA 2B2WA 2IL8A 4HEDA 1B4OA 1MSGA 2R3ZA 2X69A 1ICWA 2N55A 5COYA 1PFMA 1JICA 1X32A 4OIKA 4ZAIA 1WTWA 1B3AA 1BF4A 3IFDA 1U4PA 4ZLTF 4CJ1B 3R93A 3MWYW 1HRJA 1U4LA 1AZPA 1GUWA 1MGSA 2B2YA 1Q3LA 1QNKA 4QUCA 3Q6SA 4LMQD 1ESRA 5DNFA 3TZDA 1F2LA 1WTQA 1WD0A 5EPLA 4ZK9B 1EL0A 1NR4A 2NYZD 1ZXTA 2HDLA 1XYIA 4R9WA 1EOTA 1F9PA 4XT1B 1WTOA 1WTVA 1DOKA 4HSVA 1NAPA 2RSNA 3MTSA 1QE6A 2KEDA 2XIWA 2NWGA 3UI2A 4ZKBB 1B50A 1PLFA 3GV3A 2KVMA 3HP3A 3KUPA 1F9RA 5CBEE 2HCCA 2EE1A 1DZ1A 1U4MA 2B2VA 2L12A 3N52A 4RWSC 1IL8A 4IUPA 4DN4M 2K03A 1SDFA 2KOLA 1CM9A 2DY7A 3SVMA 4R8IA 2L11A 1LV9A 2FINB 3F2UA 4X3SA 2EPBA 2FFKB 4IUVA 1M8AA 2L9HA 2RA4A 4IURA 5EPKA 3DEOA 1WD1A 1EQTA 5T1GA 4O42A 1HA6A 2RSOA 1G6ZA 3FPUB 4HAEA 1U4RA 3DM1A 2FJ2A 4X3UA 1ILPA 1PFNA 2CVRA 3TN2A 2Q8RE 1MI2A 2K1BA 2MJ8A 4CJ2C 5CMDA 1F9SA 1DOMA 1O7YA 1RJTA 4ZKCB 2VXWA 4IUQA 3P7JA 1ILQA 2L1BA 1CA6A 1HHVA 2NZ1D 1PDQA 4IUUA 4X3KA 1NR2A 2L4NA 5CORA 1O80A 1MSHA 2B2TC 5CBAE 1AP0A 1EIGA 2K01A 2J7ZA 1KNEA 1C8CA 1B2TA 2FMMA 3I8ZA 1CA5A 2HCIA 5EPJA 2MPMA 3KBXA 2BDNA 3I90A 1DOLA 3ONAB 1F9QA 4MN3A 2X6GA 1ML0D 5D65A 2FHTA 1WTXA 1HUMA 2K04A 3I91A 2B2UC 2SDFA 1QG7A 5D14A 1E0BA 2B2WC 1B53A 2JP1A 2MP1A 4XDXA 1BBXC 2DY8A 4RAUC 5E4WC 3GV6A 1NCVA 1VMCA 4RA8A 2M2LA 1RTNA 4UAIA 1SSOA 1VMPA 2KUMA 3H91A 2KEEA 1SAPA 1DONA 1G2TA 4QUFA 1HFNA 5EKIA 2D9UA 1WTRA 2RVLA 1IKMA 2HUGA 2B2YC 3G7LA 1G91A 1S4ZA 3DEPA 4NW2A 1AZQA 1TVXA 2K28A 4X3TA 1X3PA 1HUNA 4IUTA
chains in the Genus database with same CATH superfamily
3X3MA 2E2HB 4RGOS 3CKIB 5EQ0A 3F1ZA 3LWEA 1EY4A 1RTOA 5ELDA 3T1YQ 1K8OA 2WAQB 3T1YL 4MHEA 1H9SA 1EQQA 2IY5B 1JT8A 1EYAA 1EU4A 2F0LA 4F87A 3K6OA 1K3BC 3S24A 5M5WH 4BY7H 2R3ZA 1JOKA 3H09A 3G6EA 3K80C 1OXVA 2BA1A 3MEFA 4DKAC 1U4PA 1EEFD 1SE2A 4K5VA 1K8AC 3K58A 1JB7A 2PW5A 2IX3A 2K5NA 3Q0AA 2JEBI 5C4XG 2LKVA 1LUZA 3TREA 4ZK9B 4FF4A 5IE8A 2EYFA 2R93G 5JEAH 4C3HB 1VQJA 1WTOA 3TP5A 1GM5A 3A7LA 1L2FA 1U5KA 3J7A5 3UI2A 1TWFH 5F2DA 4XQNA 1HH2P 1YNJD 2KHSA 4LF6Q 1FL0A 4AIMA 1DZ1A 3PV0A 4HIMA 3RR5A 4LF6L 4X3SA 1K28A 3W2DA 5M5WB 1PHJA 4A75A 2QILA 1GUOA 3A5UA 3NHHA 2I5HA 4KY6A 3WOFA 3ICEA 1JC7A 1TU2B 2B63H 1TWCB 4K2LA 3AU7A 2WB1B 4HR7B 2CCZA 4H02A 1RD9D 1SYDA 2F03A 2E5LQ 3KF6A 1D5MC 1F9SA 2F0GA 2XTIA 2E5LL 1FNVA 3BG3A 1HR0Q 4K2KA 2Z1CA 5AJ3L 1HR0L 2B2TC 5C44G 5IY0A 4X62Q 3DM3A 2BDNA 3TS0A 1JMCA 2X6GA 4UY8C 4LWCA 4X62L 1QJOA 1A62A 1NMFA 1EEID 2MP1A 2MHVA 1XTDA 1KTKA 5GROA 4A3BG 4AQYL 3RD4A 1HFNA 1I50H 1EWHA 4DV7Q 4YCVA 4O0AA 4DV7L 2B8FA 1AZQA 1PH2A 1EQRA 2BDOA 3S1RH 2Z9HA 5C0XI 3S14H 4IOCA 4A3IH 2NB0A 1O7ZA 1Z9FA 1WCMB 3VDYA 3PIP3 1A6XA 1VS0A 1LTLA 3CHBD 3GTKH 2IL8A 4O2DA 5EKKA 4GOPB 2RF4A 2BE5C 2N55A 1YEZA 4OIKA 1B3AA 1U9RA 1GHJA 3M4QA 2K5DA 1HRJA 1A3VA 5IP7G 2R6GA 2DJFC 1QZGA 4LMQD 5IIFA 1A2UA 3DUZA 4BY1H 1VQPA 1FR3A 5IT9c 1D8LA 2OEOA 1H9SB 3S14B 1JJ2A 3S1QB 1PRTB 1Q86C 1B50A 1FYCA 1PLFA 4LNQA 5CV6A 2DJGC 3I70A 3FKIB 3J81c 5FO8B 4UP7A 3H0GH 4JI3Q 4R8IA 4POFA 2NTSA 4JI3L 2IHFA 3RLOA 1QVGA 2AQ1B 4AYBG 4CDEC 2RSOA 1FVIA 4QB4A 1HA6A 1LT3D 4A3KG 2ICIA 5JAVA 2EQSA 2CVRA 1KDCA 1MI2A 3U4VA 1NUCA 4LF9Q 4JV5Q 4LF9L 4JV5L 2RCFA 1YJWA 3NUCA 2NN6G 4IUUA 5CV4A 4A93H 3WWVA 3VR6A 4HJ9A 3SXHA 1CA5A 1YJNA 1PH9A 3LWUA 4DV3Q 2OTLA 3CRLC 4DV3L 3M4PA 1EUJA 4C3IB 1EYCA 4XDXA 2L55A 4IUNA 2OF1A 1BCPC 2BCOA 2JEAI 3KF6B 3HOYB 5ELCA 2K50A 2Z0SA 2EVBA 3HRZC 1GKHA 2EYLA 5T1IA 3NTKA 1JE4A 5I9OA 1HFGA 4F8MA 2D62A 3D6WA 2LXJA 1GUGA 3CCVA 5IWAQ 1J5EQ 2F0EA 1PFBA 2MGSA 3E9IA 5IWAL 1TS3A 4U673 2H4OA 1J5EL 2JA5G 3CD6A 4XT3B 4A3LG 5JJZA 1R4PB 3PF4A 1FGBD 3PUXA 2P5ZX 1PXUA 4MTKA 2JYOA 2Y0SE 2DGYA 2UXDL 3FPPA 3GTPH 1EY6A 5COYA 5LMNW 1WTWA 1UWVA 4C1NK 1Y14B 4K6DA 1I5FA 2KA7A 1STHA 1EYGA 1DD2A 5C4XB 4TRDA 5DNFA 2ID0A 3HOXH 3OYYA 4TSSA 4JYAQ 2A69C 2PQEA 1SYBA 4DU9A 2CWPA 4JYAL 2PNRC 1WTVA 1O7IA 1S5ED 1PMRA 2NVYB 2R7ZG 3CCLA 2F4VQ 1KAWA 2GA4B 1A8VA 1F9RA 4GLVB 1CZGA 3G6JB 1TY0A 2F4VL 2LSSA 2VY3A 1PTOC 4DN4M 3D6CA 2FINB 2FFKB 1M8AA 3BYYB 3OOCA 1WD1A 3HS0C 4DUZQ 3GTPB 4JI0Q 3ITPA 1CHPD 2A1AA 3VYUA 3W5OA 2HHHL 4DUZL 4JI0L 4QGUA 4C1NI 3U4ZA 3CPWA 4PMWA 2Z4IA 3G4SA 4BWGB 1TS5A 2PZTA 3QJYA 3GTJH 3E6ZX 2L4NA 3URYA 3TS2A 3GTQH 2E74C 4M8AA 1Q82C 1M1KC 1BNZA 1DOLA 1IBKQ 2F0IA 1G291 1SJED 2B2UC 2YV5A 4HSPA 5E3FA 2K5QA 3IRBA 1IBKL 1Q90A 2E8GA 4A3BB 1LT4D 2K52A 1I4RA 3H91A 4FXGC 1J6QA 1X3EA 2WP8J 1I4HA 1KAAA 4RGMA 1PTOF 4JI8L 3QWNA 2NBFA 3SR1A 2OTJA 1XMOQ 2QDBA 3E3XA 2K33A 1L1OC 1V43A 2YTXA 3I3CA 1XMOL 4WJ4A 1P8LA 2NN6I 2NVQH 2RKSA 3DHQA 1FNWA 5FLXc 1JWSD 2D2CC 4JC0A 3NQIA 2IWHA 2VUMG 1SE4A 1EWCA 3D4WA 1QVCA 3OWEB 3R8BA 1MSGA 4DAPA 4JBMA 4FO2A 3NTIA 1E2ZA 1X32A 2IW3A 2UUBL 2YU9H 1VQ6A 3OHXC 4KMUC 3CCJA 4GNXC 1SN8A 2PMZB 2PCFB 1LTBD 4AH6A 5FKAC 3J81L 4FVMA 3H15A 1EL0A 4KI0A 3I7FA 4YCWA 3D31A 4XT1B 4HSVA 4H44C 5KNCA 1HZCA 4FXKC 3MZ5A 3EROA 4HIKA 1CKNA 2Q2TA 4PMCA 4RWSC 4Y7NH 1CHQD 2N49A 4S3SA 4QMGA 1HZAA 3PUVA 4EQ5A 2PPBC 3UDFA 1WD0A 5EPKA 2RA4A 4MTNA 5T1GA 5IP9H 3K8AA 4A3KB 4OO1H 5BN4A 4X3UA 4BBRG 3CF5A 3J81E 1KLUD 1Q1BA 1VQGA 2Y0SB 1Y1WH 3HGBA 2K1BA 4A3CH 1MIUA 2C9OA 2VW9A 3K0XA 1M4VA 4DR1Q 2NZ1D 5K36H 3TSSA 3NPPA 2D5DA 3MXPA 4EGVA 3HOZH 4DR1L 4PV1C 3PQIA 3EIVA 1KNEA 4YY3Q 3I90A 3MHBA 5E1FA 4A3MG 2ASBA 3S15H 2VB2X 2FHTA 4DR4Q 4YY3L 1S5FD 5GADC 2QW7A 4DR4L 5IGDA 3S17H 2DY8A 1YHQA 2F4IA 2M2LA 3A8IE 5J1ZA 1SAPA 5LMNQ 2F3IA 4HIDA 2B2YC 5LMNL 1PA6A 3KFUA 1S5DD 3E0EA 4UDUC 3OTOL 4WRDA 1X3PA 5DM73 3T13A 4A3GH 3SK6A 3PO3H 1GO3E 2N88A 3I56A 1WTPA 3BJUA 3PUZA 3WOEA 1FD7D 4KY7A 1B8AA 3A74A 1T5XD 4DPGA 4A3JG 2JA5B 4TQUS 5JVH3 3IL8A 1UE6A 2PI2E 1B1ZA 1K8MA 2EXDA 2PZUA 3CAMA 3D4DA 3K7AH 1VQKA 2WFWA 2EY6A 1T5EA 4DK0A 1SROA 4IQZA 3VR4A 4DUYL 1BCPB 3KJOA 3CQZH 4B08A 3S17B 1E1OA 1E22A 2EZVA 4JBKA 4KHPQ 2F0VA 4KHPL 4BBSG 3M4YA 3T4AC 4GNXA 2JA8G 2RQXA 4H7BA 4CKBA 2A8VA 3NSWA 5FO7B 5FJ8H 1XYIA 1SNDA 3D0FA 3VR5A 5DEHA 2RSNA 2R7ZB 1JJGA 1HTPA 4GKKQ 4CGYB 2JQOA 1G8ZD 2JA6G 4PMBA 1AFPA 2CQAA 2JXMB 2PYKA 1ZYRD 2FXQA 4ZUJA 4GKKL 3HKZG 1QUQB 4IFDH 1EIFA 1PFSA 5M3FH 1E1TA 1X55A 4RG1A 3K81C 3QB3A 4JI5Q 4R4OA 2KQ3A 2PO4A 4JI5L 4B9WA 3GTOB 5M5XH 2QGQA 1K9MC 3J7ZC 3V05A 1HNXQ 5IYDH 1JWMD 1HNXL 3U9SA 1EY7A 4ZKCB 5BN3A 1VQLA 1SR3A 3C3LA 4LUZA 1IW7D 3NBHA 3RZOH 5KYLA 4X3KA 4DNRB 3CPFA 1EQVA 5FLMH 5CBAE 1V8QA 3JC66 5BN5A 5GAEC 5C3EH 4I7ZC 1YJ9A 1QB5D 3AB9A 2J0TD 2AWOA 3M85A 4KD4A 1STAA 1EY8A 1VQBA 2Q2IA 2NVXB 5IYCG 3KK7A 2KUMA 1CI3M 2EDGA 2KEEA 1EY0A 4NB3A 5LL6S 1PH6A 4HMIA 4NW2A 2Z6KC 2DUDA 4JK1C 1S5CD 1IBML 2RHQB 5FO9B 1STGA 1KNAA 1FJGQ 3GTMB 2XWBB 3BU2A 3EA6A 3RZOB 1FJGL 2VUMB 2QA4A 2EY5A 5GQOA 1EZ6A 3NWSA 2DN8A 1YBYA 4LJZC 1KRSA 4OXPA 2PW7A 3NBIA 5FOBB 4L63B 5JJLA 1SMYD 2JA9A 2MQHA 4ZLTF 1PYBA 4C3HH 3L9AX 3PMFA 1AZPA 4BXXH 4QUCA 3TZDA 5ELBA 3RN5A 4CHTB 1TT2A 2A5HA 1H9MA 2YTVA 4IZ8A 4KD3A 2BH2A 2NYZD 1EOTA 1XNRQ 5KGUA 1NAPA 1T9HA 1D2BA 1XNRL 1SBBB 3H3VC 3HP3A 1O7LA 3I2ZA 2ALYB 5J3BA 1Z7TA 1MBYA 2EE1A 1TWCH 3N52A 1RIPA 3JAMc 1GVPA 4QIWB 2DY7A 2KCCA 3UE1A 2EPBA 1EY9A 2E76C 2UXBQ 1G6ZA 1JCKB 1VDZA 3FPUB 4BBRB 4GNXB 1E7ZA 2CKZB 5D3IB 1KQSA 1LACA 3E0JA 4KN7C 4RKBA 5G3LD 4ODGA 2MJ8A 5EBCA 3D3RA 5CV8A 4V0BA 4OWTB 3A5ZB 4IJHA 4XQQA 5I6YA 4IPDA 5E7NA 3D4RA 3S16B 1O80A 3M3YB 4UP8A 3OPOA 2EYJA 4N9TA 1C8CA 2HQEA 1N33Q 3F2BA 1VQCA 4HJ7A 3WDNA 4A3MB 3ERQA 1Y1VG 2ZXRA 4LFCQ 4LFAQ 1N33L 4ZCKA 4LFCL 4N8FA 4UPAA 4LFAL 4XQJA 1VQ4A 5KRUA 1SYFA 1SXTA 1LABA 3FHWA 1RTNA 1HCZA 1OTCA 2R92G 2DNEA 1CT1D 2RVLA 1V1PB 3NBHB 1LTID 3J80c 3M4OB 2K28A 3KF8A 4APVA 4K0KQ 1WCMH 1ZEQX 2SOBA 2K05A 5M9OA 3MXNA 1KABA 5JJIA 1S40A 3L0OA 1QOHA 4CDCC 3HOWG 4JOIA 4K0KL 1ICFB 4H13C 2D0OA 3Q23A 1PH8A 1I4QA 1ONLA 1EWIA 5ELFA 4YWLA 1K0RA 2XNAC 4IJLA 1PYSB 4LF7Q 1QILA 2O4XA 3PO2H 3TZUA 4LF7L 3S1MH 3CCUA 1TKWB 1PYWD 5K5PA 1ET6A 1Z47A 2Q2HA 4CJ1B 2K5WA 1JORA 3Q24A 5M5YB 5IODA 1QNKA 2CW0D 3S1QH 3VA5A 4BBSB 2JA8B 5HY6A 4G4KA 2VQFQ 1LO5D 5BR8Q 5EPLA 3I73A 2VQFL 1NBWA 4R9WA 5BR8L 1GD7A 3FKIH 4NXMQ 2XN9C 2A6HC 2L5TA 3CRKC 3SK4A 1AH9A 1BR9A 1BVSA 2F0JA 3IFTA 2JA6B 3GV3A 3HKZB 3R3OA 1MJEA 3A0JA 2KHJA 1W2BA 3PO2B 3AFQA 1TS4A 3S1MB 2Q2UA 3I4NG 3ULPA 1Q12A 5C0XH 4DNTB 3HOVG 2MFIA 3RLFA 3L3OC 2FJ2A 3G71A 4K6LA 1B44D 5CMDA 3X3NA 2F0MA 4GLAC 1G6PA 2AHOB 4X65Q 1HHVA 4DAYA 4C3IH 3SK8A 1KIXA 5CORA 3VYTA 4X65L 1STYA 4L5RC 3HOUG 1AP0A 2QEJC 3GTLB 1SRUA 5JOBA 3K0YA 3QIAA 2E2IB 2OXPA 3ONAB 1TWGB 4GS3A 3T56B 4JVZA 4DK1A 2EJFC 2B29A 3I91A 3HOYH 3K7UC 1ENAA 4OWWB 5IYBG 1GOZA 3K5LA 2ZTDA 3FVQA 3GV6A 3S1NB 4DNIA 3Q8DA 1HPCA 1DONA 5KEEA 4JI6Q 5ELOA 1CZWA 2AMCB 4JI6L 3AEVA 1TVXA 2A68D 2KBNA 3I4MG 3RLNA 1I6HB 3KDFB 2ZXPA 4DR2Q 2BA0A 4JI1Q 1X65A 3CCSA 1ESFA 4DR2L 4JI1L 2B2TA 3W1BA 1EOVA 1J8IA 2PMZE 1BO0A 4YHHQ 3H3VI 1VQOA 2FMCA 3J81i 2VQEQ 2B2VC 1LYLA 2HIXA 2RCNA 4ZRZA 1SNOA 4RMFA 1B4OA 5C4XH 2VQEL 1PRTD 3BDOA 1JICA 4ZAIA 3H6MA 4CKCA 2R93H 1BF4A 3KF8B 3TEHB 3R93A 2JE6I 3GO5A 3MXNB 3TMEA 5CV5A 1PH4A 5CYUA 3M9BA 1OXTA 1IW7C 2NVYH 3JAML 4PNYA 1VQNA 4AYBE 1SNMA 4DR5Q 3HKSA 4DV6Q 3TP7A 2I5LX 4L5SA 3NEMA 2V1CC 3QR8A 3HG9A 1VQIA 4DR5L 4DV6L 2KEDA 2XRSD 4JI4Q 4PZ6A 1VQMA 4JI4L 1EIYB 4WJ3M 1LTGD 4A3DG 3F2UA 4BA2I 2KCMA 1LTRD 3EVQA 1D6EC 4B3TQ 4PG3A 2I07B 3HZXA 1CKMA 4HAEA 1ASYA 2R93B 5TSSA 4IALA 5C44H 3JAME 4OWXB 3TN2A 1BQQT 3A54A 3J7YW 1RJTA 3QOJA 1MD2D 4HMJA 5EAYA 2ZM6Q 5J39A 4QCLA 1PDQA 1IXRA 2ZM6L 2JA7G 1AE2A 5C3WA 1Y1VB 4A3BH 1KRTA 1I4GA 2FMMA 4DFAA 1XWEA 5EGTA 3J80L 3K5NA 4PZ8A 3S9WA 2ATWA 3DWAA 3S2DH 1SMYC 1B53A 4C3JG 4YWKA 1N8RC 2JSOA 4UAIA 2R92B 1TWHB 3BZCA 4ZQ3A 3EJIA 1HXYD 3H94A 2BOSA 1DCZA 5J22A 2F0WA 2OQKA 1C7YA 1S4ZA 4KJOA 4J1MA 3F2CA 4DAYB 1YNND 5C44B 1HUNA 4HCEA 1C0AA 2GVBA 3HOWB 2KCNA 4R4CA 3LGJA 2IPKD 1AN8A 2WACA 5CV7A 3F8TA 2CHBD 5EJWA 1HQRD 4K8IA 3J80E 2AUKA 4OELB 1R9TB 3GDEA 2DNCA 4HN7A 4B9XA 3RZDB 2AUJD 5IP7H 4NMZA 1BBUA 3S2DB 1FGUA 2N8NA 4TVAB 2G9HD 1NMGA 4DGZA 1RKNA 4EQPA 1I4PA 2Z4HA 2I46A 1JQYD 4RCOA 1MGSA 4EX5A 1IL2A 1GXDC 4HIOA 1YIJA 1WTQA 4F7XA 1YNJC 3O13A 4MZ9A 3C1EA 1KDBA 1F9PA 3AFPA 3FP9A 5C5LA 1S5BD 2CWAA 1CK1A 1HZ9A 1BXTA 3VYRA 1OXXK 5CBEE 4A3KH 1QUQA 5M3MG 4IUPA 3K57A 3TP6A 3I4NB 2L11A 1HZBA 1LV9A 4OHJA 2ZT9C 1PH1A 3HOVB 1SMXA 1PVOA 4ZYSA 2NZHA 1JWUD 2NN6H 3I4OA 1NJIC 4DR3Q 4I65A 3RN2A 1JE5A 1V9PA 3T51B 4KLKA 5ELEA 4IN3A 3AMUA 4P75A 4IUQA 1SNPA 1SE3A 3ER0A 1KLGD 3CCEA 3HOUB 3BDLA 2GVAA 1ENCA 1STEA 1CQVA 5CC4A 3KJPA 2K75A 3CMEA 1B2TA 3OMGA 5D65A 4AYBB 5I6WA 1HUMA 2EXZA 2AQ2B 1A3TA 1E0BA 2B2WC 4G7ZC 3UDGA 1UUPA 3S2HB 2RBMA 3NWTA 1L0YB 2HT1A 2F0QA 1EU3A 5EKIA 1WTRA 1VQEA 3DXJC 4PZ7A 2JA5H 3I4MB 2CFMA 4A3LH 1RL2A 2E2DC 4QQBX 1J9OA 2ZTCA 1XX8A 5EBDA 3CMAA 4LUVA 4HCSA 3FMCA 3KLSA 2UUAQ 4NPSA 1EZ8A 5DM63 4A3FG 1RHPA 4LUOA 3DLLA 3FRPB 4ILWA 2UUAL 4A3EG 1E24A 2XGTA 1HQMC 4YIJA 2B2UA 5KNDA 1NSNS 2BH8A 2X69A 1ICWA 3T1HQ 4RCNA 3I55A 1TQOA 1GJXA 4LF5Q 3T1HL 4LF5L 5JEAJ 4KHZA 2L0CA 1PV4A 4BY7G 3Q6SA 2ENBA 4L8JA 4RGTA 2BE5D 2R7ZH 3E5SA 4MIUA 4QIWE 1GUTA 1UE1A 1KXLA 1L1OA 1MKHA 3C46A 3NELA 1STBA 3I72A 1BUVT 4GN5A 3W3AA 3PUYA 2ZJQA 3GTOH 4A3DB 5JEAG 2GN5A 1Y69U 1H9KA 1H95A 2K6AA 3HFZB 2A6ED 2K5HA 4GKJQ 2G9DA 2JK8A 5I2XA 4GOPC 2A68C 5C4ZA 3RNUA 4B3RQ 1HNWQ 2OCEA 1S3OA 3ND9A 4B3RL 4C56C 1KHIA 4QL5A 2L15A 1HNWL 1K83B 2OQ0A 3P1HA 2IHEA 4G7HC 1CA6A 2B63G 1IZ6A 3BDCA 3OW7A 1PTOH 1PZKD 1KD1C 3CCMA 2I5MX 3VA7A 2VNUD 1I94Q 1UE5A 1B9MA 5IGBA 1UEBA 2NVXH 2J7ZA 1I94L 1X9NA 3TQYA 2MPMA 4X6AH 1Q8IA 3CP0A 1PRTC 1UAPA 2QCPX 3EBEA 1Z6HA 5D14A 3MC0B 1VQDA 4C2MB 1BBXC 1YZ6A 5JPMC 4LF8Q 1G2TA 1VMPA 4ULLA 1W6KA 1UE7A 4LF8L 3TRZA 3VYSA 4NP5A 2D9UA 3GTMH 1NTGA 3TBIB 1V1PA 4FP5D 1U0LA 4X3TA 2VUMH 1A3UA 1BCPD 4U68A 4Z9CB 4OIJA 3OIPA 4HJ5A 2E75C 5C4JB 1SYCA 1PTOB 5AFWA 4BS9A 5EKLA 3IKJA 3C1FA 4HEDA 4A3IG 2RDHA 1VF5C 2PNHA 4QJFA 1PRTF 4EQNA 3HKZE 4HJAA 4G57A 2B2YA 4R4QA 1I4XA 3UE0A 4DR7Q 1F2LA 5IGFA 4DF7A 2H5XA 1X54A 4DR7L 1LTTD 2IX1A 1LTAD 5ELNA 1II3A 2CQOA 2WIIB 2KJXA 2F0UA 1TWAB 2VS1A 1ZKOA 3MEHA 5A2QL 4BY1G 5M3MB 2QEXA 2HCCA 1U4MA 2K7VA 3RMHA 1IYJB 4BBRH 5JJKA 4Q5VA 3ZJYC 2PZWA 3U9OA 3PIOA 1N34Q 1KDAA 4L6TB 4RKLA 2JN4A 1N34L 2LY7A 1ENFA 1QZHA 4KKTA 5JPNC 1C9OA 4R4TA 2HD3A 1YNNC 3AYHB 1L1OB 1PFNA 2WINB 1ILPA 1QVFA 3S16H 2K14A 3H0GG 1XPRA 3M3YH 3GTGH 1AEXA 4GZYC 1SNCA 3PGZA 2A73B 4A3MH 1O78A 4CBVA 2Z6BA 3NE5B 2TMPA 2PQAB 4N9PA 5LL6X 3PUWA 5A2QE 2E2JB 5JVG3 4G7OC 2SNSA 1YHBA 4NDXA 3PIO3 2RDGA 1D5XC 1DXMA 3F2DA 4H0LC 2HCIA 3SEBA 1WYDA 3DWQA 4L5QA 2NVTB 1QG7A 4P71A 4A93G 3M4OH 1SFOB 2UXBL 1IBLQ 4J6HA 5E4WC 4XIGS 4WORA 1G51A 1IBLL 4QUFA 5HURA 4A3JH 1K0SA 4HTHA 4JG2A 4KTAA 4CKEA 4DV0Q 1OO9B 4JBJA 1W6JA 2LFNA 4DV0L 3FDTA 4NXNQ 3GTGB 1TIID 1JOQA 2LS01 3KDFA 3ND8A 3MAQA 4NXNL 3A8KE 2UUCQ 4A3FB 4IO9A 1CFMA 2UUCL 4A3EB 2X6LA 1N9WA 1XTCD 3CU7A 4ID6A 4HJ8A 3AQQA 3JAMi 3A7AB 2A74C 5M5YH 4BBSH 2JA8H 4DAMA 1D1IA 4F88A 4P72A 3IFDA 3MXUA 3MWYW 2JJQA 4B3MQ 4BY7B 1FNUA 4BA1I 1Q3LA 2KHIA 2MO1A 3Q22A 1SJHD 4A3JB 2Z6KA 4B3ML 3NENA 2JA6H 5IGEA 3J81j 4XXEA 3BVGA 4EVOA 3TDQA 4YCUA 1ET9A 1SNQA 3MA2B 4X66Q 4DXGA 3HOXG 5AJ3Q 4X66L 2O5IC 1K73C 1S72A 2NUCA 3I4LA 2SEBD 3P75A 4XTCS 1I3QH 3N6RA 3SVMA 1HJPA 1TWFB 2NTTA 3DEOA 3KLSX 3E9HA 1U4RA 4DV5Q 4AQYQ 2CH4A 3J80i 2Q8RE 2HIVA 3PIPA 4DV5L 3J7AV 3EN2A 1TR5A 4CDFC 3GTLH 1DOMA 4GN3B 3IAYA 1O7YA 4KKUA 2E2IH 4NXML 1TWGH 4K8JA 2B63B 5IGCA 1X56A 3L7ZC 1D7QA 2QF7A 4JCVE 2V4DA 5IYCH 4DK6C 1E2WA 1N36Q 2EY1A 3S1NH 3KBXA 3W1GA 3A56A 3K5MA 3R2TA 1N36L 2UXCQ 1Q1EA 3CXCA 1GUSA 4P74A 1Q7YC 2UXCL 1I3QB 1W3SA 2EY2A 4OL7A 1I6HH 4KV6A 4DAVA 2M9VA 1KC8C 5CGKA 1G91A 2XVSA 1C4QA 1EYDA 2J4XA 2R61A 4DV4Q 2YTYA 3BZKA 1I50B 4IOAA 1DYQA 1JB3A 1RODA 4DV4L 5I4DA 4DK3C 1A15A 1RDPD 3FEWX 1YITA 1P16A 3S1RB 4KJNA 2YYZA 2O5JC 1A0IA 4DV1Q 3SHLA 5C3XA 4A3IB 4DV1L 2ES2A 5FK9C 4GLXA 2A6EC 4KKSA 3EQLC 3A8JE 1WJJA 2RDFA 3V2TA 1BBWA 2AWNA 4J15A 4QY7A 3STBD 3C2PA 3GTKB 1U4LA 2RHSB 4IPGA 1WI5A 2OT2A 2WKCA 3OIQA 1L0WA 3V96A 1F77A 1ZYRC 1STNA 2MO0A 4POGA 1F2ZA 2Y0SG 3MFYA 1X6OA 3MTSA 1SYGA 4YHHL 2O2LD 4BY1B 4UP9A 2L12A 3J7AF 3BS1A 1QCBD 1H9JA 3SK5A 2N78A 3H0GB 1YNXA 1SE8A 1I6VC 3R2IA 1VQ5A 1D1KA 1Y1VH 3H3VH 3DWPA 1PH5A 5IP9G 4OO1G 2L1BA 4EQOA 5DLQE 1TS2A 3CCQA 1Y1WG 4A3CG 3L2PA 2R92H 2VB3X 1TWHH 1WTXA 5KIXA 4A93B 1VF7A 1JOOA 2EJGC 5K36G 4MNOA 4Y52H 2IX0A 4B3TL 3HOZG 2B3GA 2UXDQ 2F0FA 3HOWH 4CDDC 1EFWA 2F0HA 2IT1A 4JI7Q 1MJCA 2HUGA 4A3EH 4JI7L 2QKIC 1R9TH 1IKLA 1X3QA 3RZDH 4XYOA 1V1QA 1BCPF 3U58A 5A35A 1UEAB 1G2SA 1BDOA 4QF4A 3K59A 4A3GG 4FXDA 1GUNA 4A4IA 1EIHA 4FYDA 3PO3G 2EYHA 4LF4Q 2EIFA 3MXGA 4IPCA 1WOCA 2HQLA 4LF4L 4DXFA 2K32A 3OSOA 2SNMA 2F1MA 4LW1A 5I2YA 1LM0A 1DM0B 3MVVA 2HHHQ 2EYMA 1H9RA 2F0DA 1NE3A 4OEMB 4DV2Q 1MHWC 1VCIA 4A76A 4YWMA 1JR0D 1DOKA 4L5TA 4DV2L 4IFDJ 3HOXB 1B3QA 1F2YA 3I4NH 3PCOB 2NWGA 4DA2A 4OONA 3SDZA 3HOVH 1VQ7A 3LNNA 2B2VA 3M7NA 5FJ8G 1Q46A 1HTLD 4PQXA 1E3PA 5I9PA 1BOSA 2K03A 1SDFA 4KN4C 1CM9A 4FF2A 1LTSD 4IUVA 2L9HA 3UDXA 5HGQA 1EQTA 1RCVD 1VQ8A 4JBWA 3DM1A 3NP8A 2F52A 2C5CA 4IFDG 2F3WA 1CUKA 5M3FG 3HOUH 4JI8Q 1Y8PB 3D8GA 4R4IA 4CJ2C 5C6AA 1PH7A 1D5ZC 2OWOA 1VQAA 1AW7A 3P7JA 1B70B 1F2MA 3TP8A 4ALPA 2VL6A 4JI2Q 5IYBH 5GAHC 2F0PA 4RFBA 1PZID 5IYDG 3S2HH 4JI2L 2K01A 5C4HA 3I8ZA 4GN4B 1C48A 2KENA 3PSIA 4FF1A 3GTJB 2K04A 1IYVA 2JP1A 5KYIA 3KYHC 2K5VA 5FLMG 3I4MH 3GTQB 2C35B 2K4KA 3KLWA 1NCVA 1VMCA 2VZAA 4RA8A 3U50C 5C3EG 4DR3L 4UHVA 4X64Q 2QDLA 2UUBQ 3ZYYX 4I7AA 5G3LF 2G5DA 4TKOB 5IT9L 2F0NA 4X64L 3DEPA 2WV6D 3K5OA 4R1JA 3KBGA 4RGNA 2F0OA 2H1EA 4LFBQ 4OO1I 4KY5A 2XRQD 5LHY1 2R7DA 4LFBL 3EFXD 1Y8OB 5NUCA 4KK7A 4ME3A 2WAQG 3VR3A 3QO2A 4N8X1 1YI2A 1BKBA 3NTHA 4K5WA 2ICEC 2NVQB 1OXSC 1WVLA 3G48A 1B7YB 2CW0C 1YVCA 5IT9E 1E2VA 2I0QA 4V190 2MUYA 5L37A 1OXUA 3CC7A 3PF5A 1LT6D 1GUWA 1UNSA 3CC2A 2EYOA 3B6YA 4Q0FA 2YU9B 1NR4A 1ZXTA 4A3DH 4C3HG 3LX0A 1XNQQ 4BXXG 1B9NA 3GP7A 4WFN3 1VQHA 1XNQL 3T53B 1CSQA 2KVMA 1EY5A 3SGIA 2M00A 1VQ9A 1JJCB 1TXYA 1LLRD 2LMCB 1A63A 2A19A 2A6HD 2EYPA 3KLRA 2LXKA 4R8NA 4O42A 1K83H 4RHRA 1DGSA 2XWJB 1V1OA 4Y7NB 1DJRD 2JA7H 2AKWB 2WB1G 2XSCA 2B39A 2WAQE 1K8GA 2CH4W 3CW2C 5KNBA 3OTOQ 1CSPA 4RH6A 3P20A 2PQAA 1XXGA 1LT5D 4ME5A 4C3JH 1NR2A 4FF3A 1PH3A 4OX9Q 1Y1WB 1IYUA 3T16A 4C2MH 1EIGA 4OX9L 1AE3A 4B3SQ 3HEJA 1A2TA 1ML0D 1EFID 4B3SL 2KCTA 3A55A 3HOZB 1HNZQ 4GKJL 3STBC 2F3VA 1HNZL 4DUYQ 1XPUA 3S15B 2D0PA 2MNAA 1YHAA 5ISRA 4IFDI 3G7LA 3ERSX 5C4JH 3CCRA 4WJWA 3GD7A 2JA7B 1HR0W 4K14A 4P2CB 2Q8IB 3UDIA 1IHZA 5IOCA 2NZOA 4O1NA 1XJVA 5GAGC 2PI2A 4FDBA 2Q8TA 2EOTA 1N32Q 2KECA 2F0SA 3SE0A 3CC4A 4C3JB 5CR3A 4A3GB 1N32L 1CQFA 5LMUQ 2HDMA 3PO3B 2ZJPA 4P73A 1WCMG 3DMUA 2AQ3B 1QNUA 5LMUL 2WB1E 4KHVA 4XYQA 3ULLA 4CJ0B 3NK9A 5E4XA 2B2WA 4M1UB 2N3SA 3RUZA 1HA5A 1PFMA 4JPBW 1XMQQ 1CKOA 2ZTEA 4LK1C 3K7AB 3PO2G 1XMQL 3BYTB 3OW2A 1M90C 4J8QA 2B8GA 1TWAH 1ESRA 1QWYA 2UU9Q 1X3FA 1VQFA 3CQZB 5IGGA 4RHSA 2UU9L 1CTMA 5M3MH 1R4QB 2HDLA 1L0XB 2ZXOA 2ZJRA 1KL9A 3QOLA 3OMCA 1GHKA 3ULJA 4E6IA 1QE6A 2XIWA 4FNFA 5DAUA 4ZKBB 5C5MA 4K5XA 1CKNB 3KUPA 2R7FA 4DR6Q 1NNXA 1Q8KA 5C0XJ 4JW0A 4DR6L 4IPHA 1IL8A 3FKIG 2KOLA 1X3GA 5CV9A 3KOJA 4IURA 4ABNA 2Z8LA 2IJ0A 5M3FB 3QG1A 2E2JH 1K3RA 2EJMA 3VR2A 3BVMA 2E2HH 3M7GA 3NXWA 5D3DA 5FLXL 3BVZA 3MFGA 3BZDB 2VXWA 1ILQA 5C0XG 5M5XB 2A69D 4JOIC 1IBMQ 3NQTA 2NVTH 3GQBA 1MSHA 1TY2A 1SFOH 3OWFA 5EPJA 2F0KA 1RF2D 4MN3A 1F9QA 4ZUIA 1SEBD 1WTHA 1WFQA 2SDFA 2F0TA 1Q81C 1ASZA 1SYEA 4C3IG 4LAAA 2TSSA 5H1SE 4RAUC 5C3EB 1PTOD 1SSOA 1SLJA 1PZJD 1XPOA 1Y8NB 2WKDA 4GOPA 4OGQC 5FLXE 1IKMA 3HOYG 4A3FH 1NY4A 5HGTA 4NKLA 4IUTA
chains in the Genus database with same CATH topology
3X3MA 2E2HB 4RGOS 3CKIB 5EQ0A 3LWEA 1EY4A 1RTOA 5ELDA 1K8OA 2WAQB 4MHEA 1H9SA 1EYAA 1EU4A 2F0LA 4F87A 3K6OA 2R3ZA 1JOKA 3H09A 1OXVA 2BA1A 1U4PA 1EEFD 1SE2A 4K5VA 3K58A 2PW5A 2IX3A 3Q0AA 2JEBI 2LKVA 4ZK9B 4FF4A 2EYFA 5JEAH 4C3HB 1WTOA 3TP5A 3A7LA 3UI2A 5F2DA 4XQNA 1YNJD 2KHSA 1DZ1A 3PV0A 4X3SA 3W2DA 5M5WB 2QILA 1GUOA 3NHHA 4KY6A 3WOFA 1JC7A 1TU2B 1TWCB 4K2LA 3AU7A 2WB1B 4HR7B 1RD9D 1SYDA 2F03A 1D5MC 1F9SA 2F0GA 1FNVA 3BG3A 4K2KA 2Z1CA 2B2TC 2BDNA 2X6GA 1QJOA 1EEID 2MP1A 2MHVA 1KTKA 3RD4A 1HFNA 1EWHA 2B8FA 1AZQA 2BDOA 5C0XI 2NB0A 1O7ZA 1WCMB 3PIP3 1A6XA 3CHBD 2IL8A 5EKKA 2BE5C 2N55A 4OIKA 1B3AA 1U9RA 1GHJA 2K5DA 1HRJA 1A3VA 2R6GA 4LMQD 5IIFA 1A2UA 3DUZA 1FR3A 2OEOA 1H9SB 3S14B 3S1QB 1PRTB 1B50A 1FYCA 1PLFA 5CV6A 3I70A 3FKIB 5FO8B 4R8IA 2NTSA 2AQ1B 1HA6A 2RSOA 4QB4A 1LT3D 2ICIA 5JAVA 2CVRA 1KDCA 1MI2A 1NUCA 3NUCA 2NN6G 4IUUA 5CV4A 3VR6A 3SXHA 1CA5A 3LWUA 3CRLC 4C3IB 1EYCA 4XDXA 2L55A 4IUNA 2OF1A 1BCPC 2BCOA 2JEAI 3HOYB 5ELCA 2EVBA 3HRZC 2EYLA 5T1IA 3NTKA 1JE4A 5I9OA 4F8MA 1HFGA 2D62A 3D6WA 1GUGA 2F0EA 1PFBA 2MGSA 1TS3A 4U673 2H4OA 4XT3B 5JJZA 1R4PB 1FGBD 3PUXA 1PXUA 2JYOA 3FPPA 1EY6A 5COYA 1WTWA 4C1NK 4K6DA 2KA7A 1STHA 1DD2A 5C4XB 4TRDA 5DNFA 2ID0A 4TSSA 2A69C 2PQEA 1SYBA 4DU9A 2PNRC 1WTVA 1S5ED 1PMRA 2NVYB 2GA4B 1F9RA 1CZGA 3G6JB 1TY0A 1PTOC 4DN4M 3D6CA 2FINB 2FFKB 1M8AA 3BYYB 3OOCA 1WD1A 3HS0C 3GTPB 3ITPA 1CHPD 3VYUA 4C1NI 4PMWA 2Z4IA 4BWGB 1TS5A 2PZTA 3QJYA 3E6ZX 2L4NA 3URYA 2E74C 4M8AA 1BNZA 1DOLA 2F0IA 1G291 1SJED 2B2UC 4HSPA 5E3FA 2K5QA 1Q90A 4A3BB 1LT4D 1I4RA 3H91A 4FXGC 2WP8J 1I4HA 1KAAA 4RGMA 1PTOF 3QWNA 2NBFA 3SR1A 2QDBA 2K33A 1V43A 3I3CA 2NN6I 2RKSA 3DHQA 1FNWA 1JWSD 2D2CC 3NQIA 2IWHA 1SE4A 1EWCA 3D4WA 3OWEB 3R8BA 1MSGA 4DAPA 4FO2A 3NTIA 1E2ZA 1X32A 2IW3A 3OHXC 4KMUC 2PMZB 2PCFB 1LTBD 5FKAC 3J81L 4FVMA 1EL0A 4KI0A 3D31A 4XT1B 4HSVA 4H44C 5KNCA 4FXKC 3MZ5A 3EROA 4PMCA 4RWSC 1CHQD 4S3SA 4QMGA 3PUVA 2PPBC 1WD0A 5EPKA 2RA4A 5T1GA 4A3KB 4OO1H 5BN4A 4X3UA 3J81E 1KLUD 1Q1BA 2Y0SB 3HGBA 2K1BA 2C9OA 1M4VA 2NZ1D 5K36H 3TSSA 3NPPA 2D5DA 3MXPA 4EGVA 4PV1C 1KNEA 5E1FA 3I90A 3MHBA 2VB2X 2FHTA 1S5FD 5IGDA 2DY8A 2F4IA 2M2LA 3A8IE 5J1ZA 1SAPA 2B2YC 1S5DD 4UDUC 4WRDA 1X3PA 5DM73 3T13A 3SK6A 2N88A 1WTPA 3PUZA 3WOEA 1FD7D 4KY7A 1T5XD 2JA5B 4TQUS 5JVH3 3IL8A 1B1ZA 1K8MA 2PZUA 3D4DA 2EY6A 1T5EA 4DK0A 4IQZA 3VR4A 1BCPB 4B08A 3S17B 2EZVA 2F0VA 3M4YA 3T4AC 2RQXA 4H7BA 4CKBA 3NSWA 5FO7B 1XYIA 1SNDA 3VR5A 5DEHA 2RSNA 2R7ZB 1HTPA 4CGYB 1G8ZD 4PMBA 1AFPA 2CQAA 2JXMB 2PYKA 1ZYRD 4ZUJA 4IFDH 3QB3A 2KQ3A 2PO4A 4B9WA 3GTOB 3V05A 1JWMD 3U9SA 1EY7A 4ZKCB 5BN3A 3C3LA 1IW7D 3NBHA 5KYLA 4X3KA 4DNRB 1EQVA 5CBAE 1V8QA 5BN5A 4I7ZC 1QB5D 3AB9A 2J0TD 2AWOA 3M85A 4KD4A 1STAA 1EY8A 2NVXB 3KK7A 2KUMA 1CI3M 2EDGA 2KEEA 1EY0A 5LL6S 4HMIA 4NW2A 4JK1C 1S5CD 5FO9B 1STGA 1KNAA 3GTMB 2XWBB 3EA6A 3RZOB 2VUMB 2EY5A 1EZ6A 3NWSA 2DN8A 4LJZC 2PW7A 3NBIA 5FOBB 4L63B 1SMYD 4ZLTF 3L9AX 3PMFA 1AZPA 4QUCA 3TZDA 5ELBA 4CHTB 1TT2A 2A5HA 1H9MA 4IZ8A 4KD3A 2NYZD 1EOTA 5KGUA 1NAPA 1D2BA 1SBBB 3H3VC 3HP3A 1O7LA 1Z7TA 1MBYA 2EE1A 3N52A 4QIWB 2DY7A 2KCCA 2EPBA 1EY9A 2E76C 1G6ZA 1JCKB 1VDZA 3FPUB 4BBRB 5D3IB 1LACA 3E0JA 4KN7C 4RKBA 5G3LD 4ODGA 2MJ8A 5EBCA 3D3RA 5CV8A 4V0BA 4XQQA 5I6YA 3D4RA 3S16B 1O80A 3M3YB 3OPOA 2EYJA 4N9TA 1C8CA 2HQEA 3WDNA 4A3MB 3ERQA 2ZXRA 4XQJA 5KRUA 1SYFA 1SXTA 1LABA 1RTNA 1HCZA 2DNEA 1CT1D 2RVLA 1V1PB 1LTID 3M4OB 2K28A 3KF8A 1ZEQX 2SOBA 2K05A 5M9OA 3MXNA 1KABA 1QOHA 4H13C 3Q23A 1I4QA 1ONLA 5ELFA 2XNAC 1QILA 2O4XA 3TZUA 1TKWB 1PYWD 5K5PA 1ET6A 1Z47A 4CJ1B 2K5WA 1JORA 3Q24A 5M5YB 5IODA 1QNKA 2CW0D 3VA5A 4BBSB 2JA8B 4G4KA 1LO5D 5EPLA 3I73A 4R9WA 2XN9C 2A6HC 2L5TA 3CRKC 3SK4A 1BR9A 2F0JA 2JA6B 3IFTA 3GV3A 3HKZB 3R3OA 3PO2B 1TS4A 3S1MB 1Q12A 5C0XH 4DNTB 3RLFA 3L3OC 2FJ2A 4K6LA 1B44D 5CMDA 3X3NA 2F0MA 1HHVA 4DAYA 3SK8A 5CORA 3VYTA 1STYA 1AP0A 2QEJC 3GTLB 5JOBA 3K0YA 3QIAA 2E2IB 2OXPA 3ONAB 1TWGB 3T56B 4DK1A 2EJFC 3I91A 1ENAA 1GOZA 3K5LA 3S1NB 3FVQA 3GV6A 1HPCA 1DONA 5KEEA 1CZWA 1TVXA 2A68D 1I6HB 2ZXPA 2BA0A 1ESFA 2B2TA 1J8IA 1BO0A 2FMCA 2B2VC 4ZRZA 1SNOA 1B4OA 1PRTD 3BDOA 1JICA 4ZAIA 3H6MA 4CKCA 1BF4A 3R93A 2JE6I 3GO5A 3TMEA 5CV5A 5CYUA 1OXTA 1IW7C 3JAML 4PNYA 1SNMA 3TP7A 3HG9A 2KEDA 2XRSD 1LTGD 3F2UA 4BA2I 1LTRD 3EVQA 1D6EC 2I07B 3HZXA 4HAEA 2R93B 5TSSA 4IALA 3JAME 3TN2A 1BQQT 3A54A 3J7YW 1RJTA 3QOJA 1MD2D 4HMJA 5J39A 4QCLA 1PDQA 5C3WA 1Y1VB 1I4GA 2FMMA 4DFAA 1XWEA 5EGTA 3J80L 3K5NA 3S9WA 3DWAA 1SMYC 1B53A 4C3JG 2JSOA 4UAIA 2R92B 1TWHB 4ZQ3A 3EJIA 1HXYD 3H94A 2BOSA 1DCZA 5J22A 2F0WA 1S4ZA 4KJOA 4J1MA 1YNND 5C44B 1HUNA 4HCEA 3HOWB 2KCNA 2IPKD 1AN8A 2WACA 5CV7A 2CHBD 5EJWA 1HQRD 4K8IA 3J80E 2AUKA 1R9TB 4B9XA 2DNCA 4HN7A 3RZDB 2AUJD 4NMZA 3S2DB 2G9HD 4DGZA 1RKNA 4EQPA 1I4PA 2Z4HA 2I46A 1JQYD 4RCOA 1MGSA 1GXDC 1WTQA 4F7XA 1YNJC 3O13A 3C1EA 1KDBA 1F9PA 5C5LA 1S5BD 1CK1A 1BXTA 3VYRA 1OXXK 5CBEE 4IUPA 3K57A 3TP6A 3I4NB 2L11A 1LV9A 4OHJA 2ZT9C 3HOVB 4ZYSA 1JWUD 2NN6H 4I65A 3T51B 5ELEA 4IN3A 3AMUA 4IUQA 1SNPA 1SE3A 1KLGD 3HOUB 3BDLA 1ENCA 1STEA 1CQVA 5CC4A 1B2TA 3OMGA 5D65A 4AYBB 5I6WA 1HUMA 2EXZA 2AQ2B 1A3TA 1E0BA 2B2WC 4G7ZC 1UUPA 3S2HB 2RBMA 3NWTA 1L0YB 2F0QA 1EU3A 5EKIA 1WTRA 3DXJC 3I4MB 2E2DC 1J9OA 1XX8A 5EBDA 4HCSA 3FMCA 3KLSA 5DM63 1EZ8A 1RHPA 3FRPB 4ILWA 1HQMC 4YIJA 2B2UA 5KNDA 1NSNS 2X69A 1ICWA 4RCNA 1TQOA 1GJXA 5JEAJ 4KHZA 2L0CA 3Q6SA 4RGTA 2ENBA 4L8JA 2BE5D 3E5SA 4MIUA 1GUTA 3C46A 1STBA 3I72A 1BUVT 3W3AA 3PUYA 4A3DB 5JEAG 1Y69U 1H9KA 2K6AA 2A6ED 2G9DA 5I2XA 2A68C 5C4ZA 3ND9A 4C56C 1K83B 3P1HA 4G7HC 1CA6A 3BDCA 3OW7A 1PTOH 1PZKD 3VA7A 2VNUD 1B9MA 5IGBA 2J7ZA 2MPMA 1Q8IA 1PRTC 1UAPA 2QCPX 5D14A 1Z6HA 3MC0B 4C2MB 1BBXC 5JPMC 1G2TA 1VMPA 4ULLA 1W6KA 3VYSA 4NP5A 2D9UA 3TBIB 1V1PA 4FP5D 4X3TA 1A3UA 1BCPD 4U68A 4Z9CB 4OIJA 3OIPA 2E75C 5C4JB 1SYCA 1PTOB 5AFWA 4BS9A 5EKLA 3IKJA 3C1FA 4HEDA 2RDHA 1VF5C 1PRTF 4EQNA 4G57A 2B2YA 1I4XA 1F2LA 5IGFA 4DF7A 1LTTD 2IX1A 1LTAD 1II3A 2WIIB 2KJXA 2F0UA 1TWAB 1ZKOA 3MEHA 5A2QL 5M3MB 2HCCA 1U4MA 2K7VA 3RMHA 4Q5VA 2PZWA 3U9OA 1KDAA 4L6TB 4RKLA 2LY7A 1ENFA 4KKTA 5JPNC 1YNNC 2WINB 1PFNA 1ILPA 1AEXA 4GZYC 1SNCA 2A73B 1O78A 4CBVA 3NE5B 2TMPA 4N9PA 5LL6X 3PUWA 5A2QE 2E2JB 5JVG3 4G7OC 2SNSA 4NDXA 3PIO3 2RDGA 1D5XC 1DXMA 4H0LC 2HCIA 3SEBA 3DWQA 2NVTB 1QG7A 1SFOB 4J6HA 5E4WC 4XIGS 4WORA 4QUFA 5HURA 4HTHA 4KTAA 4CKEA 1OO9B 1W6JA 2LFNA 3FDTA 3GTGB 1TIID 1JOQA 2LS01 3MAQA 3ND8A 3A8KE 4A3FB 1CFMA 4A3EB 2X6LA 1XTCD 3CU7A 4ID6A 3A7AB 2A74C 1D1IA 4F88A 3IFDA 3MXUA 3MWYW 4BY7B 1FNUA 4BA1I 1Q3LA 3Q22A 1SJHD 4A3JB 5IGEA 4XXEA 3BVGA 4EVOA 3TDQA 1ET9A 1SNQA 3MA2B 4DXGA 2O5IC 2NUCA 3I4LA 2SEBD 3P75A 4XTCS 3N6RA 3SVMA 1TWFB 2NTTA 3DEOA 3KLSX 1U4RA 2Q8RE 3J7AV 1TR5A 1DOMA 3IAYA 1O7YA 4KKUA 4K8JA 2B63B 5IGCA 3L7ZC 2QF7A 2V4DA 1E2WA 2EY1A 3KBXA 3A56A 3K5MA 3R2TA 1Q1EA 1GUSA 1I3QB 2EY2A 4OL7A 4KV6A 4DAVA 2M9VA 5CGKA 1G91A 2XVSA 1C4QA 1EYDA 2J4XA 2R61A 1I50B 1DYQA 1JB3A 1RODA 5I4DA 1A15A 1RDPD 3FEWX 3S1RB 4KJNA 2YYZA 2O5JC 3SHLA 5C3XA 4A3IB 5FK9C 2A6EC 4KKSA 3EQLC 3A8JE 2RDFA 3V2TA 2AWNA 3C2PA 3GTKB 1U4LA 2OT2A 2WKCA 3OIQA 3V96A 1F77A 1ZYRC 1STNA 1F2ZA 3MFYA 3MTSA 1SYGA 2O2LD 4BY1B 2L12A 3J7AF 3BS1A 1QCBD 1H9JA 3SK5A 3H0GB 1I6VC 3R2IA 1D1KA 3DWPA 4OO1G 2L1BA 4EQOA 1TS2A 2VB3X 1WTXA 5KIXA 4A93B 1VF7A 1JOOA 2EJGC 5K36G 2IX0A 2F0FA 2F0HA 2IT1A 2HUGA 2QKIC 1IKLA 1X3QA 4XYOA 1BCPF 5A35A 1UEAB 1G2SA 1BDOA 4QF4A 3K59A 4FXDA 1GUNA 1EIHA 4FYDA 2EYHA 3MXGA 4DXFA 2K32A 3OSOA 2SNMA 2F1MA 5I2YA 1DM0B 3MVVA 2EYMA 1H9RA 2F0DA 1VCIA 1JR0D 1DOKA 4IFDJ 3HOXB 1F2YA 2NWGA 4DA2A 3SDZA 3LNNA 2B2VA 3M7NA 1HTLD 4PQXA 5I9PA 4FF2A 1BOSA 2K03A 1SDFA 4KN4C 1CM9A 1LTSD 4IUVA 2L9HA 1EQTA 1RCVD 4JBWA 3DM1A 3NP8A 2C5CA 4IFDG 2F3WA 1Y8PB 3D8GA 5C6AA 4CJ2C 1D5ZC 1AW7A 3P7JA 1F2MA 3TP8A 2F0PA 4RFBA 1PZID 2K01A 5C4HA 3I8ZA 1C48A 4FF1A 3GTJB 2K04A 1IYVA 2JP1A 5KYIA 3GTQB 1NCVA 1VMCA 4RA8A 3ZYYX 5G3LF 4TKOB 5IT9L 2F0NA 3DEPA 2WV6D 3K5OA 3KBGA 4RGNA 2F0OA 2H1EA 4OO1I 4KY5A 2XRQD 5LHY1 3EFXD 1Y8OB 5NUCA 4KK7A 3VR3A 3QO2A 3NTHA 4K5WA 2ICEC 2NVQB 1OXSC 1WVLA 2CW0C 5IT9E 1E2VA 4V190 2MUYA 1OXUA 1LT6D 1GUWA 1UNSA 2EYOA 4Q0FA 2YU9B 1NR4A 1ZXTA 4C3HG 3LX0A 1B9NA 3GP7A 4WFN3 3T53B 2KVMA 1EY5A 2M00A 1LLRD 2LMCB 2A6HD 2EYPA 3KLRA 4R8NA 4O42A 4RHRA 2XWJB 1V1OA 4Y7NB 1DJRD 2XSCA 2B39A 5KNBA 4RH6A 3P20A 1XXGA 1LT5D 4ME5A 1NR2A 4FF3A 1Y1WB 1IYUA 3T16A 1EIGA 3HEJA 1A2TA 1ML0D 1EFID 3A55A 3HOZB 2F3VA 3S15B 5ISRA 4IFDI 3G7LA 4WJWA 3GD7A 2JA7B 4K14A 4P2CB 2Q8IB 1IHZA 5IOCA 4O1NA 2Q8TA 2EOTA 2KECA 2F0SA 3SE0A 4C3JB 5CR3A 4A3GB 1CQFA 2HDMA 3PO3B 3DMUA 2AQ3B 1QNUA 4KHVA 4XYQA 4CJ0B 3NK9A 5E4XA 2B2WA 4M1UB 3RUZA 1HA5A 1PFMA 4LK1C 3K7AB 3BYTB 4J8QA 2B8GA 1ESRA 1QWYA 3CQZB 5IGGA 4RHSA 1CTMA 1R4QB 2HDLA 1L0XB 2ZXOA 3QOLA 3OMCA 1GHKA 4E6IA 1QE6A 2XIWA 4FNFA 5DAUA 4ZKBB 5C5MA 4K5XA 3KUPA 5C0XJ 1IL8A 2KOLA 5CV9A 4IURA 4ABNA 2Z8LA 2IJ0A 5M3FB 3QG1A 3VR2A 2EJMA 3BVMA 3M7GA 3NXWA 5D3DA 5FLXL 3BVZA 3MFGA 3BZDB 2VXWA 1ILQA 5C0XG 5M5XB 2A69D 3NQTA 3GQBA 1MSHA 1TY2A 3OWFA 5EPJA 2F0KA 1RF2D 4MN3A 1F9QA 4ZUIA 1SEBD 2SDFA 2F0TA 1SYEA 4C3IG 4LAAA 2TSSA 4RAUC 5C3EB 1PTOD 1SSOA 1PZJD 1Y8NB 2WKDA 4OGQC 5FLXE 1IKMA 5HGTA 4NKLA 4IUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J9O A;  1JE4 A;  4U68 A;  3FDT A;  2K05 A;  1HFG A;  1XX8 A;  1IKL A;  2N88 A;  4OIJ A;  1X3Q A;  3I3C A;  3D6W A;  5EQ0 A;  1WTP A;  1ROD A;  2H1E A;  4HCS A;  5T1I A;  1KNA A;  2Q8T A;  3LWE A;  2EOT A;  1PFB A;  1RTO A;  2KEC A;  1A15 A;  1G2S A;  2B2T A;  2MGS A;  1BNZ A;  5EJW A;  1O7Z A;  3IL8 A;  1J8I A;  5AFW A;  1RHP A;  2X6L A;  4XT3 B;  2HDM A;  5JJZ A;  1BO0 A;  4MHE A;  3QO2 A;  1EIH A;  2B2U A;  2B2V C;  4CJ0 B;  5E4X A;  1WVL A;  2JYO A;  2B2W A;  2IL8 A;  4HED A;  1B4O A;  1MSG A;  2R3Z A;  2X69 A;  1ICW A;  2N55 A;  5COY A;  1PFM A;  1JIC A;  1X32 A;  4OIK A;  4ZAI A;  1WTW A;  1B3A A;  1BF4 A;  3IFD A;  1U4P A;  4ZLT F;  4CJ1 B;  3R93 A;  3MWY W;  1HRJ A;  1U4L A;  1AZP A;  1GUW A;  1MGS A;  2B2Y A;  1Q3L A;  1QNK A;  4QUC A;  3Q6S A;  4LMQ D;  1ESR A;  5DNF A;  3TZD A;  1F2L A;  1WTQ A;  1WD0 A;  5EPL A;  4ZK9 B;  1EL0 A;  1NR4 A;  2NYZ D;  1ZXT A;  2HDL A;  1XYI A;  4R9W A;  1EOT A;  1F9P A;  4XT1 B;  1WTO A;  1WTV A;  1DOK A;  4HSV A;  1NAP A;  2RSN A;  3MTS A;  1QE6 A;  2KED A;  2XIW A;  2NWG A;  3UI2 A;  4ZKB B;  1B50 A;  1PLF A;  3GV3 A;  2KVM A;  3HP3 A;  3KUP A;  1F9R A;  5CBE E;  2HCC A;  2EE1 A;  1DZ1 A;  1U4M A;  2B2V A;  2L12 A;  3N52 A;  4RWS C;  1IL8 A;  4IUP A;  4DN4 M;  2K03 A;  1SDF A;  2KOL A;  1CM9 A;  2DY7 A;  3SVM A;  4R8I A;  2L11 A;  1LV9 A;  2FIN B;  3F2U A;  4X3S A;  2EPB A;  2FFK B;  4IUV A;  1M8A A;  2L9H A;  2RA4 A;  4IUR A;  5EPK A;  3DEO A;  1WD1 A;  1EQT A;  5T1G A;  4O42 A;  1HA6 A;  2RSO A;  1G6Z A;  3FPU B;  4HAE A;  1U4R A;  3DM1 A;  2FJ2 A;  4X3U A;  1ILP A;  1PFN A;  2CVR A;  3TN2 A;  2Q8R E;  1MI2 A;  2K1B A;  2MJ8 A;  4CJ2 C;  5CMD A;  1F9S A;  1DOM A;  1O7Y A;  1RJT A;  4ZKC B;  2VXW A;  4IUQ A;  3P7J A;  1ILQ A;  2L1B A;  1CA6 A;  1HHV A;  2NZ1 D;  1PDQ A;  4IUU A;  4X3K A;  1NR2 A;  2L4N A;  5COR A;  1O80 A;  1MSH A;  2B2T C;  5CBA E;  1AP0 A;  1EIG A;  2K01 A;  2J7Z A;  1KNE A;  1C8C A;  1B2T A;  2FMM A;  3I8Z A;  1CA5 A;  2HCI A;  5EPJ A;  2MPM A;  3KBX A;  2BDN A;  3I90 A;  1DOL A;  3ONA B;  1F9Q A;  4MN3 A;  2X6G A;  1ML0 D;  5D65 A;  2FHT A;  1WTX A;  1HUM A;  2K04 A;  3I91 A;  2B2U C;  2SDF A;  1QG7 A;  5D14 A;  1E0B A;  2B2W C;  1B53 A;  2JP1 A;  2MP1 A;  4XDX A;  1BBX C;  2DY8 A;  4RAU C;  5E4W C;  3GV6 A;  1NCV A;  1VMC A;  4RA8 A;  2M2L A;  1RTN A;  4UAI A;  1SSO A;  1VMP A;  2KUM A;  3H91 A;  2KEE A;  1SAP A;  1DON A;  1G2T A;  4QUF A;  1HFN A;  5EKI A;  2D9U A;  1WTR A;  2RVL A;  1IKM A;  2HUG A;  2B2Y C;  3G7L A;  1G91 A;  1S4Z A;  3DEP A;  4NW2 A;  1AZQ A;  1TVX A;  2K28 A;  4X3T A;  1X3P A;  1HUN A;  4IUT A; 
#chains in the Genus database with same CATH topology
 3X3M A;  2E2H B;  4RGO S;  3CKI B;  5EQ0 A;  3F1Z A;  3LWE A;  1EY4 A;  1RTO A;  5ELD A;  3T1Y Q;  1K8O A;  2WAQ B;  3T1Y L;  4MHE A;  1H9S A;  1EQQ A;  2IY5 B;  1JT8 A;  1EYA A;  1EU4 A;  2F0L A;  4F87 A;  3K6O A;  1K3B C;  3S24 A;  5M5W H;  4BY7 H;  2R3Z A;  1JOK A;  3H09 A;  3G6E A;  3K80 C;  1OXV A;  2BA1 A;  3MEF A;  4DKA C;  1U4P A;  1EEF D;  1SE2 A;  4K5V A;  1K8A C;  3K58 A;  1JB7 A;  2PW5 A;  2IX3 A;  2K5N A;  3Q0A A;  2JEB I;  5C4X G;  2LKV A;  1LUZ A;  3TRE A;  4ZK9 B;  4FF4 A;  5IE8 A;  2EYF A;  2R93 G;  5JEA H;  4C3H B;  1VQJ A;  1WTO A;  3TP5 A;  1GM5 A;  3A7L A;  1L2F A;  1U5K A;  3J7A 5;  3UI2 A;  1TWF H;  5F2D A;  4XQN A;  1HH2 P;  1YNJ D;  2KHS A;  4LF6 Q;  1FL0 A;  4AIM A;  1DZ1 A;  3PV0 A;  4HIM A;  3RR5 A;  4LF6 L;  4X3S A;  1K28 A;  3W2D A;  5M5W B;  1PHJ A;  4A75 A;  2QIL A;  1GUO A;  3A5U A;  3NHH A;  2I5H A;  4KY6 A;  3WOF A;  3ICE A;  1JC7 A;  1TU2 B;  2B63 H;  1TWC B;  4K2L A;  3AU7 A;  2WB1 B;  4HR7 B;  2CCZ A;  4H02 A;  1RD9 D;  1SYD A;  2F03 A;  2E5L Q;  3KF6 A;  1D5M C;  1F9S A;  2F0G A;  2XTI A;  2E5L L;  1FNV A;  3BG3 A;  1HR0 Q;  4K2K A;  2Z1C A;  5AJ3 L;  1HR0 L;  2B2T C;  5C44 G;  5IY0 A;  4X62 Q;  3DM3 A;  2BDN A;  3TS0 A;  1JMC A;  2X6G A;  4UY8 C;  4LWC A;  4X62 L;  1QJO A;  1A62 A;  1NMF A;  1EEI D;  2MP1 A;  2MHV A;  1XTD A;  1KTK A;  5GRO A;  4A3B G;  4AQY L;  3RD4 A;  1HFN A;  1I50 H;  1EWH A;  4DV7 Q;  4YCV A;  4O0A A;  4DV7 L;  2B8F A;  1AZQ A;  1PH2 A;  1EQR A;  2BDO A;  3S1R H;  2Z9H A;  5C0X I;  3S14 H;  4IOC A;  4A3I H;  2NB0 A;  1O7Z A;  1Z9F A;  1WCM B;  3VDY A;  3PIP 3;  1A6X A;  1VS0 A;  1LTL A;  3CHB D;  3GTK H;  2IL8 A;  4O2D A;  5EKK A;  4GOP B;  2RF4 A;  2BE5 C;  2N55 A;  1YEZ A;  4OIK A;  1B3A A;  1U9R A;  1GHJ A;  3M4Q A;  2K5D A;  1HRJ A;  1A3V A;  5IP7 G;  2R6G A;  2DJF C;  1QZG A;  4LMQ D;  5IIF A;  1A2U A;  3DUZ A;  4BY1 H;  1VQP A;  1FR3 A;  5IT9 c;  1D8L A;  2OEO A;  1H9S B;  3S14 B;  1JJ2 A;  3S1Q B;  1PRT B;  1Q86 C;  1B50 A;  1FYC A;  1PLF A;  4LNQ A;  5CV6 A;  2DJG C;  3I70 A;  3FKI B;  3J81 c;  5FO8 B;  4UP7 A;  3H0G H;  4JI3 Q;  4R8I A;  4POF A;  2NTS A;  4JI3 L;  2IHF A;  3RLO A;  1QVG A;  2AQ1 B;  4AYB G;  4CDE C;  2RSO A;  1FVI A;  4QB4 A;  1HA6 A;  1LT3 D;  4A3K G;  2ICI A;  5JAV A;  2EQS A;  2CVR A;  1KDC A;  1MI2 A;  3U4V A;  1NUC A;  4LF9 Q;  4JV5 Q;  4LF9 L;  4JV5 L;  2RCF A;  1YJW A;  3NUC A;  2NN6 G;  4IUU A;  5CV4 A;  4A93 H;  3WWV A;  3VR6 A;  4HJ9 A;  3SXH A;  1CA5 A;  1YJN A;  1PH9 A;  3LWU A;  4DV3 Q;  2OTL A;  3CRL C;  4DV3 L;  3M4P A;  1EUJ A;  4C3I B;  1EYC A;  4XDX A;  2L55 A;  4IUN A;  2OF1 A;  1BCP C;  2BCO A;  2JEA I;  3KF6 B;  3HOY B;  5ELC A;  2K50 A;  2Z0S A;  2EVB A;  3HRZ C;  1GKH A;  2EYL A;  5T1I A;  3NTK A;  1JE4 A;  5I9O A;  1HFG A;  4F8M A;  2D62 A;  3D6W A;  2LXJ A;  1GUG A;  3CCV A;  5IWA Q;  1J5E Q;  2F0E A;  1PFB A;  2MGS A;  3E9I A;  5IWA L;  1TS3 A;  4U67 3;  2H4O A;  1J5E L;  2JA5 G;  3CD6 A;  4XT3 B;  4A3L G;  5JJZ A;  1R4P B;  3PF4 A;  1FGB D;  3PUX A;  2P5Z X;  1PXU A;  4MTK A;  2JYO A;  2Y0S E;  2DGY A;  2UXD L;  3FPP A;  3GTP H;  1EY6 A;  5COY A;  5LMN W;  1WTW A;  1UWV A;  4C1N K;  1Y14 B;  4K6D A;  1I5F A;  2KA7 A;  1STH A;  1EYG A;  1DD2 A;  5C4X B;  4TRD A;  5DNF A;  2ID0 A;  3HOX H;  3OYY A;  4TSS A;  4JYA Q;  2A69 C;  2PQE A;  1SYB A;  4DU9 A;  2CWP A;  4JYA L;  2PNR C;  1WTV A;  1O7I A;  1S5E D;  1PMR A;  2NVY B;  2R7Z G;  3CCL A;  2F4V Q;  1KAW A;  2GA4 B;  1A8V A;  1F9R A;  4GLV B;  1CZG A;  3G6J B;  1TY0 A;  2F4V L;  2LSS A;  2VY3 A;  1PTO C;  4DN4 M;  3D6C A;  2FIN B;  2FFK B;  1M8A A;  3BYY B;  3OOC A;  1WD1 A;  3HS0 C;  4DUZ Q;  3GTP B;  4JI0 Q;  3ITP A;  1CHP D;  2A1A A;  3VYU A;  3W5O A;  2HHH L;  4DUZ L;  4JI0 L;  4QGU A;  4C1N I;  3U4Z A;  3CPW A;  4PMW A;  2Z4I A;  3G4S A;  4BWG B;  1TS5 A;  2PZT A;  3QJY A;  3GTJ H;  3E6Z X;  2L4N A;  3URY A;  3TS2 A;  3GTQ H;  2E74 C;  4M8A A;  1Q82 C;  1M1K C;  1BNZ A;  1DOL A;  1IBK Q;  2F0I A;  1G29 1;  1SJE D;  2B2U C;  2YV5 A;  4HSP A;  5E3F A;  2K5Q A;  3IRB A;  1IBK L;  1Q90 A;  2E8G A;  4A3B B;  1LT4 D;  2K52 A;  1I4R A;  3H91 A;  4FXG C;  1J6Q A;  1X3E A;  2WP8 J;  1I4H A;  1KAA A;  4RGM A;  1PTO F;  4JI8 L;  3QWN A;  2NBF A;  3SR1 A;  2OTJ A;  1XMO Q;  2QDB A;  3E3X A;  2K33 A;  1L1O C;  1V43 A;  2YTX A;  3I3C A;  1XMO L;  4WJ4 A;  1P8L A;  2NN6 I;  2NVQ H;  2RKS A;  3DHQ A;  1FNW A;  5FLX c;  1JWS D;  2D2C C;  4JC0 A;  3NQI A;  2IWH A;  2VUM G;  1SE4 A;  1EWC A;  3D4W A;  1QVC A;  3OWE B;  3R8B A;  1MSG A;  4DAP A;  4JBM A;  4FO2 A;  3NTI A;  1E2Z A;  1X32 A;  2IW3 A;  2UUB L;  2YU9 H;  1VQ6 A;  3OHX C;  4KMU C;  3CCJ A;  4GNX C;  1SN8 A;  2PMZ B;  2PCF B;  1LTB D;  4AH6 A;  5FKA C;  3J81 L;  4FVM A;  3H15 A;  1EL0 A;  4KI0 A;  3I7F A;  4YCW A;  3D31 A;  4XT1 B;  4HSV A;  4H44 C;  5KNC A;  1HZC A;  4FXK C;  3MZ5 A;  3ERO A;  4HIK A;  1CKN A;  2Q2T A;  4PMC A;  4RWS C;  4Y7N H;  1CHQ D;  2N49 A;  4S3S A;  4QMG A;  1HZA A;  3PUV A;  4EQ5 A;  2PPB C;  3UDF A;  1WD0 A;  5EPK A;  2RA4 A;  4MTN A;  5T1G A;  5IP9 H;  3K8A A;  4A3K B;  4OO1 H;  5BN4 A;  4X3U A;  4BBR G;  3CF5 A;  3J81 E;  1KLU D;  1Q1B A;  1VQG A;  2Y0S B;  1Y1W H;  3HGB A;  2K1B A;  4A3C H;  1MIU A;  2C9O A;  2VW9 A;  3K0X A;  1M4V A;  4DR1 Q;  2NZ1 D;  5K36 H;  3TSS A;  3NPP A;  2D5D A;  3MXP A;  4EGV A;  3HOZ H;  4DR1 L;  4PV1 C;  3PQI A;  3EIV A;  1KNE A;  4YY3 Q;  3I90 A;  3MHB A;  5E1F A;  4A3M G;  2ASB A;  3S15 H;  2VB2 X;  2FHT A;  4DR4 Q;  4YY3 L;  1S5F D;  5GAD C;  2QW7 A;  4DR4 L;  5IGD A;  3S17 H;  2DY8 A;  1YHQ A;  2F4I A;  2M2L A;  3A8I E;  5J1Z A;  1SAP A;  5LMN Q;  2F3I A;  4HID A;  2B2Y C;  5LMN L;  1PA6 A;  3KFU A;  1S5D D;  3E0E A;  4UDU C;  3OTO L;  4WRD A;  1X3P A;  5DM7 3;  3T13 A;  4A3G H;  3SK6 A;  3PO3 H;  1GO3 E;  2N88 A;  3I56 A;  1WTP A;  3BJU A;  3PUZ A;  3WOE A;  1FD7 D;  4KY7 A;  1B8A A;  3A74 A;  1T5X D;  4DPG A;  4A3J G;  2JA5 B;  4TQU S;  5JVH 3;  3IL8 A;  1UE6 A;  2PI2 E;  1B1Z A;  1K8M A;  2EXD A;  2PZU A;  3CAM A;  3D4D A;  3K7A H;  1VQK A;  2WFW A;  2EY6 A;  1T5E A;  4DK0 A;  1SRO A;  4IQZ A;  3VR4 A;  4DUY L;  1BCP B;  3KJO A;  3CQZ H;  4B08 A;  3S17 B;  1E1O A;  1E22 A;  2EZV A;  4JBK A;  4KHP Q;  2F0V A;  4KHP L;  4BBS G;  3M4Y A;  3T4A C;  4GNX A;  2JA8 G;  2RQX A;  4H7B A;  4CKB A;  2A8V A;  3NSW A;  5FO7 B;  5FJ8 H;  1XYI A;  1SND A;  3D0F A;  3VR5 A;  5DEH A;  2RSN A;  2R7Z B;  1JJG A;  1HTP A;  4GKK Q;  4CGY B;  2JQO A;  1G8Z D;  2JA6 G;  4PMB A;  1AFP A;  2CQA A;  2JXM B;  2PYK A;  1ZYR D;  2FXQ A;  4ZUJ A;  4GKK L;  3HKZ G;  1QUQ B;  4IFD H;  1EIF A;  1PFS A;  5M3F H;  1E1T A;  1X55 A;  4RG1 A;  3K81 C;  3QB3 A;  4JI5 Q;  4R4O A;  2KQ3 A;  2PO4 A;  4JI5 L;  4B9W A;  3GTO B;  5M5X H;  2QGQ A;  1K9M C;  3J7Z C;  3V05 A;  1HNX Q;  5IYD H;  1JWM D;  1HNX L;  3U9S A;  1EY7 A;  4ZKC B;  5BN3 A;  1VQL A;  1SR3 A;  3C3L A;  4LUZ A;  1IW7 D;  3NBH A;  3RZO H;  5KYL A;  4X3K A;  4DNR B;  3CPF A;  1EQV A;  5FLM H;  5CBA E;  1V8Q A;  3JC6 6;  5BN5 A;  5GAE C;  5C3E H;  4I7Z C;  1YJ9 A;  1QB5 D;  3AB9 A;  2J0T D;  2AWO A;  3M85 A;  4KD4 A;  1STA A;  1EY8 A;  1VQB A;  2Q2I A;  2NVX B;  5IYC G;  3KK7 A;  2KUM A;  1CI3 M;  2EDG A;  2KEE A;  1EY0 A;  4NB3 A;  5LL6 S;  1PH6 A;  4HMI A;  4NW2 A;  2Z6K C;  2DUD A;  4JK1 C;  1S5C D;  1IBM L;  2RHQ B;  5FO9 B;  1STG A;  1KNA A;  1FJG Q;  3GTM B;  2XWB B;  3BU2 A;  3EA6 A;  3RZO B;  1FJG L;  2VUM B;  2QA4 A;  2EY5 A;  5GQO A;  1EZ6 A;  3NWS A;  2DN8 A;  1YBY A;  4LJZ C;  1KRS A;  4OXP A;  2PW7 A;  3NBI A;  5FOB B;  4L63 B;  5JJL A;  1SMY D;  2JA9 A;  2MQH A;  4ZLT F;  1PYB A;  4C3H H;  3L9A X;  3PMF A;  1AZP A;  4BXX H;  4QUC A;  3TZD A;  5ELB A;  3RN5 A;  4CHT B;  1TT2 A;  2A5H A;  1H9M A;  2YTV A;  4IZ8 A;  4KD3 A;  2BH2 A;  2NYZ D;  1EOT A;  1XNR Q;  5KGU A;  1NAP A;  1T9H A;  1D2B A;  1XNR L;  1SBB B;  3H3V C;  3HP3 A;  1O7L A;  3I2Z A;  2ALY B;  5J3B A;  1Z7T A;  1MBY A;  2EE1 A;  1TWC H;  3N52 A;  1RIP A;  3JAM c;  1GVP A;  4QIW B;  2DY7 A;  2KCC A;  3UE1 A;  2EPB A;  1EY9 A;  2E76 C;  2UXB Q;  1G6Z A;  1JCK B;  1VDZ A;  3FPU B;  4BBR B;  4GNX B;  1E7Z A;  2CKZ B;  5D3I B;  1KQS A;  1LAC A;  3E0J A;  4KN7 C;  4RKB A;  5G3L D;  4ODG A;  2MJ8 A;  5EBC A;  3D3R A;  5CV8 A;  4V0B A;  4OWT B;  3A5Z B;  4IJH A;  4XQQ A;  5I6Y A;  4IPD A;  5E7N A;  3D4R A;  3S16 B;  1O80 A;  3M3Y B;  4UP8 A;  3OPO A;  2EYJ A;  4N9T A;  1C8C A;  2HQE A;  1N33 Q;  3F2B A;  1VQC A;  4HJ7 A;  3WDN A;  4A3M B;  3ERQ A;  1Y1V G;  2ZXR A;  4LFC Q;  4LFA Q;  1N33 L;  4ZCK A;  4LFC L;  4N8F A;  4UPA A;  4LFA L;  4XQJ A;  1VQ4 A;  5KRU A;  1SYF A;  1SXT A;  1LAB A;  3FHW A;  1RTN A;  1HCZ A;  1OTC A;  2R92 G;  2DNE A;  1CT1 D;  2RVL A;  1V1P B;  3NBH B;  1LTI D;  3J80 c;  3M4O B;  2K28 A;  3KF8 A;  4APV A;  4K0K Q;  1WCM H;  1ZEQ X;  2SOB A;  2K05 A;  5M9O A;  3MXN A;  1KAB A;  5JJI A;  1S40 A;  3L0O A;  1QOH A;  4CDC C;  3HOW G;  4JOI A;  4K0K L;  1ICF B;  4H13 C;  2D0O A;  3Q23 A;  1PH8 A;  1I4Q A;  1ONL A;  1EWI A;  5ELF A;  4YWL A;  1K0R A;  2XNA C;  4IJL A;  1PYS B;  4LF7 Q;  1QIL A;  2O4X A;  3PO2 H;  3TZU A;  4LF7 L;  3S1M H;  3CCU A;  1TKW B;  1PYW D;  5K5P A;  1ET6 A;  1Z47 A;  2Q2H A;  4CJ1 B;  2K5W A;  1JOR A;  3Q24 A;  5M5Y B;  5IOD A;  1QNK A;  2CW0 D;  3S1Q H;  3VA5 A;  4BBS B;  2JA8 B;  5HY6 A;  4G4K A;  2VQF Q;  1LO5 D;  5BR8 Q;  5EPL A;  3I73 A;  2VQF L;  1NBW A;  4R9W A;  5BR8 L;  1GD7 A;  3FKI H;  4NXM Q;  2XN9 C;  2A6H C;  2L5T A;  3CRK C;  3SK4 A;  1AH9 A;  1BR9 A;  1BVS A;  2F0J A;  3IFT A;  2JA6 B;  3GV3 A;  3HKZ B;  3R3O A;  1MJE A;  3A0J A;  2KHJ A;  1W2B A;  3PO2 B;  3AFQ A;  1TS4 A;  3S1M B;  2Q2U A;  3I4N G;  3ULP A;  1Q12 A;  5C0X H;  4DNT B;  3HOV G;  2MFI A;  3RLF A;  3L3O C;  2FJ2 A;  3G71 A;  4K6L A;  1B44 D;  5CMD A;  3X3N A;  2F0M A;  4GLA C;  1G6P A;  2AHO B;  4X65 Q;  1HHV A;  4DAY A;  4C3I H;  3SK8 A;  1KIX A;  5COR A;  3VYT A;  4X65 L;  1STY A;  4L5R C;  3HOU G;  1AP0 A;  2QEJ C;  3GTL B;  1SRU A;  5JOB A;  3K0Y A;  3QIA A;  2E2I B;  2OXP A;  3ONA B;  1TWG B;  4GS3 A;  3T56 B;  4JVZ A;  4DK1 A;  2EJF C;  2B29 A;  3I91 A;  3HOY H;  3K7U C;  1ENA A;  4OWW B;  5IYB G;  1GOZ A;  3K5L A;  2ZTD A;  3FVQ A;  3GV6 A;  3S1N B;  4DNI A;  3Q8D A;  1HPC A;  1DON A;  5KEE A;  4JI6 Q;  5ELO A;  1CZW A;  2AMC B;  4JI6 L;  3AEV A;  1TVX A;  2A68 D;  2KBN A;  3I4M G;  3RLN A;  1I6H B;  3KDF B;  2ZXP A;  4DR2 Q;  2BA0 A;  4JI1 Q;  1X65 A;  3CCS A;  1ESF A;  4DR2 L;  4JI1 L;  2B2T A;  3W1B A;  1EOV A;  1J8I A;  2PMZ E;  1BO0 A;  4YHH Q;  3H3V I;  1VQO A;  2FMC A;  3J81 i;  2VQE Q;  2B2V C;  1LYL A;  2HIX A;  2RCN A;  4ZRZ A;  1SNO A;  4RMF A;  1B4O A;  5C4X H;  2VQE L;  1PRT D;  3BDO A;  1JIC A;  4ZAI A;  3H6M A;  4CKC A;  2R93 H;  1BF4 A;  3KF8 B;  3TEH B;  3R93 A;  2JE6 I;  3GO5 A;  3MXN B;  3TME A;  5CV5 A;  1PH4 A;  5CYU A;  3M9B A;  1OXT A;  1IW7 C;  2NVY H;  3JAM L;  4PNY A;  1VQN A;  4AYB E;  1SNM A;  4DR5 Q;  3HKS A;  4DV6 Q;  3TP7 A;  2I5L X;  4L5S A;  3NEM A;  2V1C C;  3QR8 A;  3HG9 A;  1VQI A;  4DR5 L;  4DV6 L;  2KED A;  2XRS D;  4JI4 Q;  4PZ6 A;  1VQM A;  4JI4 L;  1EIY B;  4WJ3 M;  1LTG D;  4A3D G;  3F2U A;  4BA2 I;  2KCM A;  1LTR D;  3EVQ A;  1D6E C;  4B3T Q;  4PG3 A;  2I07 B;  3HZX A;  1CKM A;  4HAE A;  1ASY A;  2R93 B;  5TSS A;  4IAL A;  5C44 H;  3JAM E;  4OWX B;  3TN2 A;  1BQQ T;  3A54 A;  3J7Y W;  1RJT A;  3QOJ A;  1MD2 D;  4HMJ A;  5EAY A;  2ZM6 Q;  5J39 A;  4QCL A;  1PDQ A;  1IXR A;  2ZM6 L;  2JA7 G;  1AE2 A;  5C3W A;  1Y1V B;  4A3B H;  1KRT A;  1I4G A;  2FMM A;  4DFA A;  1XWE A;  5EGT A;  3J80 L;  3K5N A;  4PZ8 A;  3S9W A;  2ATW A;  3DWA A;  3S2D H;  1SMY C;  1B53 A;  4C3J G;  4YWK A;  1N8R C;  2JSO A;  4UAI A;  2R92 B;  1TWH B;  3BZC A;  4ZQ3 A;  3EJI A;  1HXY D;  3H94 A;  2BOS A;  1DCZ A;  5J22 A;  2F0W A;  2OQK A;  1C7Y A;  1S4Z A;  4KJO A;  4J1M A;  3F2C A;  4DAY B;  1YNN D;  5C44 B;  1HUN A;  4HCE A;  1C0A A;  2GVB A;  3HOW B;  2KCN A;  4R4C A;  3LGJ A;  2IPK D;  1AN8 A;  2WAC A;  5CV7 A;  3F8T A;  2CHB D;  5EJW A;  1HQR D;  4K8I A;  3J80 E;  2AUK A;  4OEL B;  1R9T B;  3GDE A;  2DNC A;  4HN7 A;  4B9X A;  3RZD B;  2AUJ D;  5IP7 H;  4NMZ A;  1BBU A;  3S2D B;  1FGU A;  2N8N A;  4TVA B;  2G9H D;  1NMG A;  4DGZ A;  1RKN A;  4EQP A;  1I4P A;  2Z4H A;  2I46 A;  1JQY D;  4RCO A;  1MGS A;  4EX5 A;  1IL2 A;  1GXD C;  4HIO A;  1YIJ A;  1WTQ A;  4F7X A;  1YNJ C;  3O13 A;  4MZ9 A;  3C1E A;  1KDB A;  1F9P A;  3AFP A;  3FP9 A;  5C5L A;  1S5B D;  2CWA A;  1CK1 A;  1HZ9 A;  1BXT A;  3VYR A;  1OXX K;  5CBE E;  4A3K H;  1QUQ A;  5M3M G;  4IUP A;  3K57 A;  3TP6 A;  3I4N B;  2L11 A;  1HZB A;  1LV9 A;  4OHJ A;  2ZT9 C;  1PH1 A;  3HOV B;  1SMX A;  1PVO A;  4ZYS A;  2NZH A;  1JWU D;  2NN6 H;  3I4O A;  1NJI C;  4DR3 Q;  4I65 A;  3RN2 A;  1JE5 A;  1V9P A;  3T51 B;  4KLK A;  5ELE A;  4IN3 A;  3AMU A;  4P75 A;  4IUQ A;  1SNP A;  1SE3 A;  3ER0 A;  1KLG D;  3CCE A;  3HOU B;  3BDL A;  2GVA A;  1ENC A;  1STE A;  1CQV A;  5CC4 A;  3KJP A;  2K75 A;  3CME A;  1B2T A;  3OMG A;  5D65 A;  4AYB B;  5I6W A;  1HUM A;  2EXZ A;  2AQ2 B;  1A3T A;  1E0B A;  2B2W C;  4G7Z C;  3UDG A;  1UUP A;  3S2H B;  2RBM A;  3NWT A;  1L0Y B;  2HT1 A;  2F0Q A;  1EU3 A;  5EKI A;  1WTR A;  1VQE A;  3DXJ C;  4PZ7 A;  2JA5 H;  3I4M B;  2CFM A;  4A3L H;  1RL2 A;  2E2D C;  4QQB X;  1J9O A;  2ZTC A;  1XX8 A;  5EBD A;  3CMA A;  4LUV A;  4HCS A;  3FMC A;  3KLS A;  2UUA Q;  4NPS A;  1EZ8 A;  5DM6 3;  4A3F G;  1RHP A;  4LUO A;  3DLL A;  3FRP B;  4ILW A;  2UUA L;  4A3E G;  1E24 A;  2XGT A;  1HQM C;  4YIJ A;  2B2U A;  5KND A;  1NSN S;  2BH8 A;  2X69 A;  1ICW A;  3T1H Q;  4RCN A;  3I55 A;  1TQO A;  1GJX A;  4LF5 Q;  3T1H L;  4LF5 L;  5JEA J;  4KHZ A;  2L0C A;  1PV4 A;  4BY7 G;  3Q6S A;  2ENB A;  4L8J A;  4RGT A;  2BE5 D;  2R7Z H;  3E5S A;  4MIU A;  4QIW E;  1GUT A;  1UE1 A;  1KXL A;  1L1O A;  1MKH A;  3C46 A;  3NEL A;  1STB A;  3I72 A;  1BUV T;  4GN5 A;  3W3A A;  3PUY A;  2ZJQ A;  3GTO H;  4A3D B;  5JEA G;  2GN5 A;  1Y69 U;  1H9K A;  1H95 A;  2K6A A;  3HFZ B;  2A6E D;  2K5H A;  4GKJ Q;  2G9D A;  2JK8 A;  5I2X A;  4GOP C;  2A68 C;  5C4Z A;  3RNU A;  4B3R Q;  1HNW Q;  2OCE A;  1S3O A;  3ND9 A;  4B3R L;  4C56 C;  1KHI A;  4QL5 A;  2L15 A;  1HNW L;  1K83 B;  2OQ0 A;  3P1H A;  2IHE A;  4G7H C;  1CA6 A;  2B63 G;  1IZ6 A;  3BDC A;  3OW7 A;  1PTO H;  1PZK D;  1KD1 C;  3CCM A;  2I5M X;  3VA7 A;  2VNU D;  1I94 Q;  1UE5 A;  1B9M A;  5IGB A;  1UEB A;  2NVX H;  2J7Z A;  1I94 L;  1X9N A;  3TQY A;  2MPM A;  4X6A H;  1Q8I A;  3CP0 A;  1PRT C;  1UAP A;  2QCP X;  3EBE A;  1Z6H A;  5D14 A;  3MC0 B;  1VQD A;  4C2M B;  1BBX C;  1YZ6 A;  5JPM C;  4LF8 Q;  1G2T A;  1VMP A;  4ULL A;  1W6K A;  1UE7 A;  4LF8 L;  3TRZ A;  3VYS A;  4NP5 A;  2D9U A;  3GTM H;  1NTG A;  3TBI B;  1V1P A;  4FP5 D;  1U0L A;  4X3T A;  2VUM H;  1A3U A;  1BCP D;  4U68 A;  4Z9C B;  4OIJ A;  3OIP A;  4HJ5 A;  2E75 C;  5C4J B;  1SYC A;  1PTO B;  5AFW A;  4BS9 A;  5EKL A;  3IKJ A;  3C1F A;  4HED A;  4A3I G;  2RDH A;  1VF5 C;  2PNH A;  4QJF A;  1PRT F;  4EQN A;  3HKZ E;  4HJA A;  4G57 A;  2B2Y A;  4R4Q A;  1I4X A;  3UE0 A;  4DR7 Q;  1F2L A;  5IGF A;  4DF7 A;  2H5X A;  1X54 A;  4DR7 L;  1LTT D;  2IX1 A;  1LTA D;  5ELN A;  1II3 A;  2CQO A;  2WII B;  2KJX A;  2F0U A;  1TWA B;  2VS1 A;  1ZKO A;  3MEH A;  5A2Q L;  4BY1 G;  5M3M B;  2QEX A;  2HCC A;  1U4M A;  2K7V A;  3RMH A;  1IYJ B;  4BBR H;  5JJK A;  4Q5V A;  3ZJY C;  2PZW A;  3U9O A;  3PIO A;  1N34 Q;  1KDA A;  4L6T B;  4RKL A;  2JN4 A;  1N34 L;  2LY7 A;  1ENF A;  1QZH A;  4KKT A;  5JPN C;  1C9O A;  4R4T A;  2HD3 A;  1YNN C;  3AYH B;  1L1O B;  1PFN A;  2WIN B;  1ILP A;  1QVF A;  3S16 H;  2K14 A;  3H0G G;  1XPR A;  3M3Y H;  3GTG H;  1AEX A;  4GZY C;  1SNC A;  3PGZ A;  2A73 B;  4A3M H;  1O78 A;  4CBV A;  2Z6B A;  3NE5 B;  2TMP A;  2PQA B;  4N9P A;  5LL6 X;  3PUW A;  5A2Q E;  2E2J B;  5JVG 3;  4G7O C;  2SNS A;  1YHB A;  4NDX A;  3PIO 3;  2RDG A;  1D5X C;  1DXM A;  3F2D A;  4H0L C;  2HCI A;  3SEB A;  1WYD A;  3DWQ A;  4L5Q A;  2NVT B;  1QG7 A;  4P71 A;  4A93 G;  3M4O H;  1SFO B;  2UXB L;  1IBL Q;  4J6H A;  5E4W C;  4XIG S;  4WOR A;  1G51 A;  1IBL L;  4QUF A;  5HUR A;  4A3J H;  1K0S A;  4HTH A;  4JG2 A;  4KTA A;  4CKE A;  4DV0 Q;  1OO9 B;  4JBJ A;  1W6J A;  2LFN A;  4DV0 L;  3FDT A;  4NXN Q;  3GTG B;  1TII D;  1JOQ A;  2LS0 1;  3KDF A;  3ND8 A;  3MAQ A;  4NXN L;  3A8K E;  2UUC Q;  4A3F B;  4IO9 A;  1CFM A;  2UUC L;  4A3E B;  2X6L A;  1N9W A;  1XTC D;  3CU7 A;  4ID6 A;  4HJ8 A;  3AQQ A;  3JAM i;  3A7A B;  2A74 C;  5M5Y H;  4BBS H;  2JA8 H;  4DAM A;  1D1I A;  4F88 A;  4P72 A;  3IFD A;  3MXU A;  3MWY W;  2JJQ A;  4B3M Q;  4BY7 B;  1FNU A;  4BA1 I;  1Q3L A;  2KHI A;  2MO1 A;  3Q22 A;  1SJH D;  4A3J B;  2Z6K A;  4B3M L;  3NEN A;  2JA6 H;  5IGE A;  3J81 j;  4XXE A;  3BVG A;  4EVO A;  3TDQ A;  4YCU A;  1ET9 A;  1SNQ A;  3MA2 B;  4X66 Q;  4DXG A;  3HOX G;  5AJ3 Q;  4X66 L;  2O5I C;  1K73 C;  1S72 A;  2NUC A;  3I4L A;  2SEB D;  3P75 A;  4XTC S;  1I3Q H;  3N6R A;  3SVM A;  1HJP A;  1TWF B;  2NTT A;  3DEO A;  3KLS X;  3E9H A;  1U4R A;  4DV5 Q;  4AQY Q;  2CH4 A;  3J80 i;  2Q8R E;  2HIV A;  3PIP A;  4DV5 L;  3J7A V;  3EN2 A;  1TR5 A;  4CDF C;  3GTL H;  1DOM A;  4GN3 B;  3IAY A;  1O7Y A;  4KKU A;  2E2I H;  4NXM L;  1TWG H;  4K8J A;  2B63 B;  5IGC A;  1X56 A;  3L7Z C;  1D7Q A;  2QF7 A;  4JCV E;  2V4D A;  5IYC H;  4DK6 C;  1E2W A;  1N36 Q;  2EY1 A;  3S1N H;  3KBX A;  3W1G A;  3A56 A;  3K5M A;  3R2T A;  1N36 L;  2UXC Q;  1Q1E A;  3CXC A;  1GUS A;  4P74 A;  1Q7Y C;  2UXC L;  1I3Q B;  1W3S A;  2EY2 A;  4OL7 A;  1I6H H;  4KV6 A;  4DAV A;  2M9V A;  1KC8 C;  5CGK A;  1G91 A;  2XVS A;  1C4Q A;  1EYD A;  2J4X A;  2R61 A;  4DV4 Q;  2YTY A;  3BZK A;  1I50 B;  4IOA A;  1DYQ A;  1JB3 A;  1ROD A;  4DV4 L;  5I4D A;  4DK3 C;  1A15 A;  1RDP D;  3FEW X;  1YIT A;  1P16 A;  3S1R B;  4KJN A;  2YYZ A;  2O5J C;  1A0I A;  4DV1 Q;  3SHL A;  5C3X A;  4A3I B;  4DV1 L;  2ES2 A;  5FK9 C;  4GLX A;  2A6E C;  4KKS A;  3EQL C;  3A8J E;  1WJJ A;  2RDF A;  3V2T A;  1BBW A;  2AWN A;  4J15 A;  4QY7 A;  3STB D;  3C2P A;  3GTK B;  1U4L A;  2RHS B;  4IPG A;  1WI5 A;  2OT2 A;  2WKC A;  3OIQ A;  1L0W A;  3V96 A;  1F77 A;  1ZYR C;  1STN A;  2MO0 A;  4POG A;  1F2Z A;  2Y0S G;  3MFY A;  1X6O A;  3MTS A;  1SYG A;  4YHH L;  2O2L D;  4BY1 B;  4UP9 A;  2L12 A;  3J7A F;  3BS1 A;  1QCB D;  1H9J A;  3SK5 A;  2N78 A;  3H0G B;  1YNX A;  1SE8 A;  1I6V C;  3R2I A;  1VQ5 A;  1D1K A;  1Y1V H;  3H3V H;  3DWP A;  1PH5 A;  5IP9 G;  4OO1 G;  2L1B A;  4EQO A;  5DLQ E;  1TS2 A;  3CCQ A;  1Y1W G;  4A3C G;  3L2P A;  2R92 H;  2VB3 X;  1TWH H;  1WTX A;  5KIX A;  4A93 B;  1VF7 A;  1JOO A;  2EJG C;  5K36 G;  4MNO A;  4Y52 H;  2IX0 A;  4B3T L;  3HOZ G;  2B3G A;  2UXD Q;  2F0F A;  3HOW H;  4CDD C;  1EFW A;  2F0H A;  2IT1 A;  4JI7 Q;  1MJC A;  2HUG A;  4A3E H;  4JI7 L;  2QKI C;  1R9T H;  1IKL A;  1X3Q A;  3RZD H;  4XYO A;  1V1Q A;  1BCP F;  3U58 A;  5A35 A;  1UEA B;  1G2S A;  1BDO A;  4QF4 A;  3K59 A;  4A3G G;  4FXD A;  1GUN A;  4A4I A;  1EIH A;  4FYD A;  3PO3 G;  2EYH A;  4LF4 Q;  2EIF A;  3MXG A;  4IPC A;  1WOC A;  2HQL A;  4LF4 L;  4DXF A;  2K32 A;  3OSO A;  2SNM A;  2F1M A;  4LW1 A;  5I2Y A;  1LM0 A;  1DM0 B;  3MVV A;  2HHH Q;  2EYM A;  1H9R A;  2F0D A;  1NE3 A;  4OEM B;  4DV2 Q;  1MHW C;  1VCI A;  4A76 A;  4YWM A;  1JR0 D;  1DOK A;  4L5T A;  4DV2 L;  4IFD J;  3HOX B;  1B3Q A;  1F2Y A;  3I4N H;  3PCO B;  2NWG A;  4DA2 A;  4OON A;  3SDZ A;  3HOV H;  1VQ7 A;  3LNN A;  2B2V A;  3M7N A;  5FJ8 G;  1Q46 A;  1HTL D;  4PQX A;  1E3P A;  5I9P A;  1BOS A;  2K03 A;  1SDF A;  4KN4 C;  1CM9 A;  4FF2 A;  1LTS D;  4IUV A;  2L9H A;  3UDX A;  5HGQ A;  1EQT A;  1RCV D;  1VQ8 A;  4JBW A;  3DM1 A;  3NP8 A;  2F52 A;  2C5C A;  4IFD G;  2F3W A;  1CUK A;  5M3F G;  3HOU H;  4JI8 Q;  1Y8P B;  3D8G A;  4R4I A;  4CJ2 C;  5C6A A;  1PH7 A;  1D5Z C;  2OWO A;  1VQA A;  1AW7 A;  3P7J A;  1B70 B;  1F2M A;  3TP8 A;  4ALP A;  2VL6 A;  4JI2 Q;  5IYB H;  5GAH C;  2F0P A;  4RFB A;  1PZI D;  5IYD G;  3S2H H;  4JI2 L;  2K01 A;  5C4H A;  3I8Z A;  4GN4 B;  1C48 A;  2KEN A;  3PSI A;  4FF1 A;  3GTJ B;  2K04 A;  1IYV A;  2JP1 A;  5KYI A;  3KYH C;  2K5V A;  5FLM G;  3I4M H;  3GTQ B;  2C35 B;  2K4K A;  3KLW A;  1NCV A;  1VMC A;  2VZA A;  4RA8 A;  3U50 C;  5C3E G;  4DR3 L;  4UHV A;  4X64 Q;  2QDL A;  2UUB Q;  3ZYY X;  4I7A A;  5G3L F;  2G5D A;  4TKO B;  5IT9 L;  2F0N A;  4X64 L;  3DEP A;  2WV6 D;  3K5O A;  4R1J A;  3KBG A;  4RGN A;  2F0O A;  2H1E A;  4LFB Q;  4OO1 I;  4KY5 A;  2XRQ D;  5LHY 1;  2R7D A;  4LFB L;  3EFX D;  1Y8O B;  5NUC A;  4KK7 A;  4ME3 A;  2WAQ G;  3VR3 A;  3QO2 A;  4N8X 1;  1YI2 A;  1BKB A;  3NTH A;  4K5W A;  2ICE C;  2NVQ B;  1OXS C;  1WVL A;  3G48 A;  1B7Y B;  2CW0 C;  1YVC A;  5IT9 E;  1E2V A;  2I0Q A;  4V19 0;  2MUY A;  5L37 A;  1OXU A;  3CC7 A;  3PF5 A;  1LT6 D;  1GUW A;  1UNS A;  3CC2 A;  2EYO A;  3B6Y A;  4Q0F A;  2YU9 B;  1NR4 A;  1ZXT A;  4A3D H;  4C3H G;  3LX0 A;  1XNQ Q;  4BXX G;  1B9N A;  3GP7 A;  4WFN 3;  1VQH A;  1XNQ L;  3T53 B;  1CSQ A;  2KVM A;  1EY5 A;  3SGI A;  2M00 A;  1VQ9 A;  1JJC B;  1TXY A;  1LLR D;  2LMC B;  1A63 A;  2A19 A;  2A6H D;  2EYP A;  3KLR A;  2LXK A;  4R8N A;  4O42 A;  1K83 H;  4RHR A;  1DGS A;  2XWJ B;  1V1O A;  4Y7N B;  1DJR D;  2JA7 H;  2AKW B;  2WB1 G;  2XSC A;  2B39 A;  2WAQ E;  1K8G A;  2CH4 W;  3CW2 C;  5KNB A;  3OTO Q;  1CSP A;  4RH6 A;  3P20 A;  2PQA A;  1XXG A;  1LT5 D;  4ME5 A;  4C3J H;  1NR2 A;  4FF3 A;  1PH3 A;  4OX9 Q;  1Y1W B;  1IYU A;  3T16 A;  4C2M H;  1EIG A;  4OX9 L;  1AE3 A;  4B3S Q;  3HEJ A;  1A2T A;  1ML0 D;  1EFI D;  4B3S L;  2KCT A;  3A55 A;  3HOZ B;  1HNZ Q;  4GKJ L;  3STB C;  2F3V A;  1HNZ L;  4DUY Q;  1XPU A;  3S15 B;  2D0P A;  2MNA A;  1YHA A;  5ISR A;  4IFD I;  3G7L A;  3ERS X;  5C4J H;  3CCR A;  4WJW A;  3GD7 A;  2JA7 B;  1HR0 W;  4K14 A;  4P2C B;  2Q8I B;  3UDI A;  1IHZ A;  5IOC A;  2NZO A;  4O1N A;  1XJV A;  5GAG C;  2PI2 A;  4FDB A;  2Q8T A;  2EOT A;  1N32 Q;  2KEC A;  2F0S A;  3SE0 A;  3CC4 A;  4C3J B;  5CR3 A;  4A3G B;  1N32 L;  1CQF A;  5LMU Q;  2HDM A;  3PO3 B;  2ZJP A;  4P73 A;  1WCM G;  3DMU A;  2AQ3 B;  1QNU A;  5LMU L;  2WB1 E;  4KHV A;  4XYQ A;  3ULL A;  4CJ0 B;  3NK9 A;  5E4X A;  2B2W A;  4M1U B;  2N3S A;  3RUZ A;  1HA5 A;  1PFM A;  4JPB W;  1XMQ Q;  1CKO A;  2ZTE A;  4LK1 C;  3K7A B;  3PO2 G;  1XMQ L;  3BYT B;  3OW2 A;  1M90 C;  4J8Q A;  2B8G A;  1TWA H;  1ESR A;  1QWY A;  2UU9 Q;  1X3F A;  1VQF A;  3CQZ B;  5IGG A;  4RHS A;  2UU9 L;  1CTM A;  5M3M H;  1R4Q B;  2HDL A;  1L0X B;  2ZXO A;  2ZJR A;  1KL9 A;  3QOL A;  3OMC A;  1GHK A;  3ULJ A;  4E6I A;  1QE6 A;  2XIW A;  4FNF A;  5DAU A;  4ZKB B;  5C5M A;  4K5X A;  1CKN B;  3KUP A;  2R7F A;  4DR6 Q;  1NNX A;  1Q8K A;  5C0X J;  4JW0 A;  4DR6 L;  4IPH A;  1IL8 A;  3FKI G;  2KOL A;  1X3G A;  5CV9 A;  3KOJ A;  4IUR A;  4ABN A;  2Z8L A;  2IJ0 A;  5M3F B;  3QG1 A;  2E2J H;  1K3R A;  2EJM A;  3VR2 A;  3BVM A;  2E2H H;  3M7G A;  3NXW A;  5D3D A;  5FLX L;  3BVZ A;  3MFG A;  3BZD B;  2VXW A;  1ILQ A;  5C0X G;  5M5X B;  2A69 D;  4JOI C;  1IBM Q;  3NQT A;  2NVT H;  3GQB A;  1MSH A;  1TY2 A;  1SFO H;  3OWF A;  5EPJ A;  2F0K A;  1RF2 D;  4MN3 A;  1F9Q A;  4ZUI A;  1SEB D;  1WTH A;  1WFQ A;  2SDF A;  2F0T A;  1Q81 C;  1ASZ A;  1SYE A;  4C3I G;  4LAA A;  2TSS A;  5H1S E;  4RAU C;  5C3E B;  1PTO D;  1SSO A;  1SLJ A;  1PZJ D;  1XPO A;  1Y8N B;  2WKD A;  4GOP A;  4OGQ C;  5FLX E;  1IKM A;  3HOY G;  4A3F H;  1NY4 A;  5HGT A;  4NKL A;  4IUT A; 
#chains in the Genus database with same CATH homology
 3X3M A;  2E2H B;  4RGO S;  3CKI B;  5EQ0 A;  3LWE A;  1EY4 A;  1RTO A;  5ELD A;  1K8O A;  2WAQ B;  4MHE A;  1H9S A;  1EYA A;  1EU4 A;  2F0L A;  4F87 A;  3K6O A;  2R3Z A;  1JOK A;  3H09 A;  1OXV A;  2BA1 A;  1U4P A;  1EEF D;  1SE2 A;  4K5V A;  3K58 A;  2PW5 A;  2IX3 A;  3Q0A A;  2JEB I;  2LKV A;  4ZK9 B;  4FF4 A;  2EYF A;  5JEA H;  4C3H B;  1WTO A;  3TP5 A;  3A7L A;  3UI2 A;  5F2D A;  4XQN A;  1YNJ D;  2KHS A;  1DZ1 A;  3PV0 A;  4X3S A;  3W2D A;  5M5W B;  2QIL A;  1GUO A;  3NHH A;  4KY6 A;  3WOF A;  1JC7 A;  1TU2 B;  1TWC B;  4K2L A;  3AU7 A;  2WB1 B;  4HR7 B;  1RD9 D;  1SYD A;  2F03 A;  1D5M C;  1F9S A;  2F0G A;  1FNV A;  3BG3 A;  4K2K A;  2Z1C A;  2B2T C;  2BDN A;  2X6G A;  1QJO A;  1EEI D;  2MP1 A;  2MHV A;  1KTK A;  3RD4 A;  1HFN A;  1EWH A;  2B8F A;  1AZQ A;  2BDO A;  5C0X I;  2NB0 A;  1O7Z A;  1WCM B;  3PIP 3;  1A6X A;  3CHB D;  2IL8 A;  5EKK A;  2BE5 C;  2N55 A;  4OIK A;  1B3A A;  1U9R A;  1GHJ A;  2K5D A;  1HRJ A;  1A3V A;  2R6G A;  4LMQ D;  5IIF A;  1A2U A;  3DUZ A;  1FR3 A;  2OEO A;  1H9S B;  3S14 B;  3S1Q B;  1PRT B;  1B50 A;  1FYC A;  1PLF A;  5CV6 A;  3I70 A;  3FKI B;  5FO8 B;  4R8I A;  2NTS A;  2AQ1 B;  1HA6 A;  2RSO A;  4QB4 A;  1LT3 D;  2ICI A;  5JAV A;  2CVR A;  1KDC A;  1MI2 A;  1NUC A;  3NUC A;  2NN6 G;  4IUU A;  5CV4 A;  3VR6 A;  3SXH A;  1CA5 A;  3LWU A;  3CRL C;  4C3I B;  1EYC A;  4XDX A;  2L55 A;  4IUN A;  2OF1 A;  1BCP C;  2BCO A;  2JEA I;  3HOY B;  5ELC A;  2EVB A;  3HRZ C;  2EYL A;  5T1I A;  3NTK A;  1JE4 A;  5I9O A;  4F8M A;  1HFG A;  2D62 A;  3D6W A;  1GUG A;  2F0E A;  1PFB A;  2MGS A;  1TS3 A;  4U67 3;  2H4O A;  4XT3 B;  5JJZ A;  1R4P B;  1FGB D;  3PUX A;  1PXU A;  2JYO A;  3FPP A;  1EY6 A;  5COY A;  1WTW A;  4C1N K;  4K6D A;  2KA7 A;  1STH A;  1DD2 A;  5C4X B;  4TRD A;  5DNF A;  2ID0 A;  4TSS A;  2A69 C;  2PQE A;  1SYB A;  4DU9 A;  2PNR C;  1WTV A;  1S5E D;  1PMR A;  2NVY B;  2GA4 B;  1F9R A;  1CZG A;  3G6J B;  1TY0 A;  1PTO C;  4DN4 M;  3D6C A;  2FIN B;  2FFK B;  1M8A A;  3BYY B;  3OOC A;  1WD1 A;  3HS0 C;  3GTP B;  3ITP A;  1CHP D;  3VYU A;  4C1N I;  4PMW A;  2Z4I A;  4BWG B;  1TS5 A;  2PZT A;  3QJY A;  3E6Z X;  2L4N A;  3URY A;  2E74 C;  4M8A A;  1BNZ A;  1DOL A;  2F0I A;  1G29 1;  1SJE D;  2B2U C;  4HSP A;  5E3F A;  2K5Q A;  1Q90 A;  4A3B B;  1LT4 D;  1I4R A;  3H91 A;  4FXG C;  2WP8 J;  1I4H A;  1KAA A;  4RGM A;  1PTO F;  3QWN A;  2NBF A;  3SR1 A;  2QDB A;  2K33 A;  1V43 A;  3I3C A;  2NN6 I;  2RKS A;  3DHQ A;  1FNW A;  1JWS D;  2D2C C;  3NQI A;  2IWH A;  1SE4 A;  1EWC A;  3D4W A;  3OWE B;  3R8B A;  1MSG A;  4DAP A;  4FO2 A;  3NTI A;  1E2Z A;  1X32 A;  2IW3 A;  3OHX C;  4KMU C;  2PMZ B;  2PCF B;  1LTB D;  5FKA C;  3J81 L;  4FVM A;  1EL0 A;  4KI0 A;  3D31 A;  4XT1 B;  4HSV A;  4H44 C;  5KNC A;  4FXK C;  3MZ5 A;  3ERO A;  4PMC A;  4RWS C;  1CHQ D;  4S3S A;  4QMG A;  3PUV A;  2PPB C;  1WD0 A;  5EPK A;  2RA4 A;  5T1G A;  4A3K B;  4OO1 H;  5BN4 A;  4X3U A;  3J81 E;  1KLU D;  1Q1B A;  2Y0S B;  3HGB A;  2K1B A;  2C9O A;  1M4V A;  2NZ1 D;  5K36 H;  3TSS A;  3NPP A;  2D5D A;  3MXP A;  4EGV A;  4PV1 C;  1KNE A;  5E1F A;  3I90 A;  3MHB A;  2VB2 X;  2FHT A;  1S5F D;  5IGD A;  2DY8 A;  2F4I A;  2M2L A;  3A8I E;  5J1Z A;  1SAP A;  2B2Y C;  1S5D D;  4UDU C;  4WRD A;  1X3P A;  5DM7 3;  3T13 A;  3SK6 A;  2N88 A;  1WTP A;  3PUZ A;  3WOE A;  1FD7 D;  4KY7 A;  1T5X D;  2JA5 B;  4TQU S;  5JVH 3;  3IL8 A;  1B1Z A;  1K8M A;  2PZU A;  3D4D A;  2EY6 A;  1T5E A;  4DK0 A;  4IQZ A;  3VR4 A;  1BCP B;  4B08 A;  3S17 B;  2EZV A;  2F0V A;  3M4Y A;  3T4A C;  2RQX A;  4H7B A;  4CKB A;  3NSW A;  5FO7 B;  1XYI A;  1SND A;  3VR5 A;  5DEH A;  2RSN A;  2R7Z B;  1HTP A;  4CGY B;  1G8Z D;  4PMB A;  1AFP A;  2CQA A;  2JXM B;  2PYK A;  1ZYR D;  4ZUJ A;  4IFD H;  3QB3 A;  2KQ3 A;  2PO4 A;  4B9W A;  3GTO B;  3V05 A;  1JWM D;  3U9S A;  1EY7 A;  4ZKC B;  5BN3 A;  3C3L A;  1IW7 D;  3NBH A;  5KYL A;  4X3K A;  4DNR B;  1EQV A;  5CBA E;  1V8Q A;  5BN5 A;  4I7Z C;  1QB5 D;  3AB9 A;  2J0T D;  2AWO A;  3M85 A;  4KD4 A;  1STA A;  1EY8 A;  2NVX B;  3KK7 A;  2KUM A;  1CI3 M;  2EDG A;  2KEE A;  1EY0 A;  5LL6 S;  4HMI A;  4NW2 A;  4JK1 C;  1S5C D;  5FO9 B;  1STG A;  1KNA A;  3GTM B;  2XWB B;  3EA6 A;  3RZO B;  2VUM B;  2EY5 A;  1EZ6 A;  3NWS A;  2DN8 A;  4LJZ C;  2PW7 A;  3NBI A;  5FOB B;  4L63 B;  1SMY D;  4ZLT F;  3L9A X;  3PMF A;  1AZP A;  4QUC A;  3TZD A;  5ELB A;  4CHT B;  1TT2 A;  2A5H A;  1H9M A;  4IZ8 A;  4KD3 A;  2NYZ D;  1EOT A;  5KGU A;  1NAP A;  1D2B A;  1SBB B;  3H3V C;  3HP3 A;  1O7L A;  1Z7T A;  1MBY A;  2EE1 A;  3N52 A;  4QIW B;  2DY7 A;  2KCC A;  2EPB A;  1EY9 A;  2E76 C;  1G6Z A;  1JCK B;  1VDZ A;  3FPU B;  4BBR B;  5D3I B;  1LAC A;  3E0J A;  4KN7 C;  4RKB A;  5G3L D;  4ODG A;  2MJ8 A;  5EBC A;  3D3R A;  5CV8 A;  4V0B A;  4XQQ A;  5I6Y A;  3D4R A;  3S16 B;  1O80 A;  3M3Y B;  3OPO A;  2EYJ A;  4N9T A;  1C8C A;  2HQE A;  3WDN A;  4A3M B;  3ERQ A;  2ZXR A;  4XQJ A;  5KRU A;  1SYF A;  1SXT A;  1LAB A;  1RTN A;  1HCZ A;  2DNE A;  1CT1 D;  2RVL A;  1V1P B;  1LTI D;  3M4O B;  2K28 A;  3KF8 A;  1ZEQ X;  2SOB A;  2K05 A;  5M9O A;  3MXN A;  1KAB A;  1QOH A;  4H13 C;  3Q23 A;  1I4Q A;  1ONL A;  5ELF A;  2XNA C;  1QIL A;  2O4X A;  3TZU A;  1TKW B;  1PYW D;  5K5P A;  1ET6 A;  1Z47 A;  4CJ1 B;  2K5W A;  1JOR A;  3Q24 A;  5M5Y B;  5IOD A;  1QNK A;  2CW0 D;  3VA5 A;  4BBS B;  2JA8 B;  4G4K A;  1LO5 D;  5EPL A;  3I73 A;  4R9W A;  2XN9 C;  2A6H C;  2L5T A;  3CRK C;  3SK4 A;  1BR9 A;  2F0J A;  2JA6 B;  3IFT A;  3GV3 A;  3HKZ B;  3R3O A;  3PO2 B;  1TS4 A;  3S1M B;  1Q12 A;  5C0X H;  4DNT B;  3RLF A;  3L3O C;  2FJ2 A;  4K6L A;  1B44 D;  5CMD A;  3X3N A;  2F0M A;  1HHV A;  4DAY A;  3SK8 A;  5COR A;  3VYT A;  1STY A;  1AP0 A;  2QEJ C;  3GTL B;  5JOB A;  3K0Y A;  3QIA A;  2E2I B;  2OXP A;  3ONA B;  1TWG B;  3T56 B;  4DK1 A;  2EJF C;  3I91 A;  1ENA A;  1GOZ A;  3K5L A;  3S1N B;  3FVQ A;  3GV6 A;  1HPC A;  1DON A;  5KEE A;  1CZW A;  1TVX A;  2A68 D;  1I6H B;  2ZXP A;  2BA0 A;  1ESF A;  2B2T A;  1J8I A;  1BO0 A;  2FMC A;  2B2V C;  4ZRZ A;  1SNO A;  1B4O A;  1PRT D;  3BDO A;  1JIC A;  4ZAI A;  3H6M A;  4CKC A;  1BF4 A;  3R93 A;  2JE6 I;  3GO5 A;  3TME A;  5CV5 A;  5CYU A;  1OXT A;  1IW7 C;  3JAM L;  4PNY A;  1SNM A;  3TP7 A;  3HG9 A;  2KED A;  2XRS D;  1LTG D;  3F2U A;  4BA2 I;  1LTR D;  3EVQ A;  1D6E C;  2I07 B;  3HZX A;  4HAE A;  2R93 B;  5TSS A;  4IAL A;  3JAM E;  3TN2 A;  1BQQ T;  3A54 A;  3J7Y W;  1RJT A;  3QOJ A;  1MD2 D;  4HMJ A;  5J39 A;  4QCL A;  1PDQ A;  5C3W A;  1Y1V B;  1I4G A;  2FMM A;  4DFA A;  1XWE A;  5EGT A;  3J80 L;  3K5N A;  3S9W A;  3DWA A;  1SMY C;  1B53 A;  4C3J G;  2JSO A;  4UAI A;  2R92 B;  1TWH B;  4ZQ3 A;  3EJI A;  1HXY D;  3H94 A;  2BOS A;  1DCZ A;  5J22 A;  2F0W A;  1S4Z A;  4KJO A;  4J1M A;  1YNN D;  5C44 B;  1HUN A;  4HCE A;  3HOW B;  2KCN A;  2IPK D;  1AN8 A;  2WAC A;  5CV7 A;  2CHB D;  5EJW A;  1HQR D;  4K8I A;  3J80 E;  2AUK A;  1R9T B;  4B9X A;  2DNC A;  4HN7 A;  3RZD B;  2AUJ D;  4NMZ A;  3S2D B;  2G9H D;  4DGZ A;  1RKN A;  4EQP A;  1I4P A;  2Z4H A;  2I46 A;  1JQY D;  4RCO A;  1MGS A;  1GXD C;  1WTQ A;  4F7X A;  1YNJ C;  3O13 A;  3C1E A;  1KDB A;  1F9P A;  5C5L A;  1S5B D;  1CK1 A;  1BXT A;  3VYR A;  1OXX K;  5CBE E;  4IUP A;  3K57 A;  3TP6 A;  3I4N B;  2L11 A;  1LV9 A;  4OHJ A;  2ZT9 C;  3HOV B;  4ZYS A;  1JWU D;  2NN6 H;  4I65 A;  3T51 B;  5ELE A;  4IN3 A;  3AMU A;  4IUQ A;  1SNP A;  1SE3 A;  1KLG D;  3HOU B;  3BDL A;  1ENC A;  1STE A;  1CQV A;  5CC4 A;  1B2T A;  3OMG A;  5D65 A;  4AYB B;  5I6W A;  1HUM A;  2EXZ A;  2AQ2 B;  1A3T A;  1E0B A;  2B2W C;  4G7Z C;  1UUP A;  3S2H B;  2RBM A;  3NWT A;  1L0Y B;  2F0Q A;  1EU3 A;  5EKI A;  1WTR A;  3DXJ C;  3I4M B;  2E2D C;  1J9O A;  1XX8 A;  5EBD A;  4HCS A;  3FMC A;  3KLS A;  5DM6 3;  1EZ8 A;  1RHP A;  3FRP B;  4ILW A;  1HQM C;  4YIJ A;  2B2U A;  5KND A;  1NSN S;  2X69 A;  1ICW A;  4RCN A;  1TQO A;  1GJX A;  5JEA J;  4KHZ A;  2L0C A;  3Q6S A;  4RGT A;  2ENB A;  4L8J A;  2BE5 D;  3E5S A;  4MIU A;  1GUT A;  3C46 A;  1STB A;  3I72 A;  1BUV T;  3W3A A;  3PUY A;  4A3D B;  5JEA G;  1Y69 U;  1H9K A;  2K6A A;  2A6E D;  2G9D A;  5I2X A;  2A68 C;  5C4Z A;  3ND9 A;  4C56 C;  1K83 B;  3P1H A;  4G7H C;  1CA6 A;  3BDC A;  3OW7 A;  1PTO H;  1PZK D;  3VA7 A;  2VNU D;  1B9M A;  5IGB A;  2J7Z A;  2MPM A;  1Q8I A;  1PRT C;  1UAP A;  2QCP X;  5D14 A;  1Z6H A;  3MC0 B;  4C2M B;  1BBX C;  5JPM C;  1G2T A;  1VMP A;  4ULL A;  1W6K A;  3VYS A;  4NP5 A;  2D9U A;  3TBI B;  1V1P A;  4FP5 D;  4X3T A;  1A3U A;  1BCP D;  4U68 A;  4Z9C B;  4OIJ A;  3OIP A;  2E75 C;  5C4J B;  1SYC A;  1PTO B;  5AFW A;  4BS9 A;  5EKL A;  3IKJ A;  3C1F A;  4HED A;  2RDH A;  1VF5 C;  1PRT F;  4EQN A;  4G57 A;  2B2Y A;  1I4X A;  1F2L A;  5IGF A;  4DF7 A;  1LTT D;  2IX1 A;  1LTA D;  1II3 A;  2WII B;  2KJX A;  2F0U A;  1TWA B;  1ZKO A;  3MEH A;  5A2Q L;  5M3M B;  2HCC A;  1U4M A;  2K7V A;  3RMH A;  4Q5V A;  2PZW A;  3U9O A;  1KDA A;  4L6T B;  4RKL A;  2LY7 A;  1ENF A;  4KKT A;  5JPN C;  1YNN C;  2WIN B;  1PFN A;  1ILP A;  1AEX A;  4GZY C;  1SNC A;  2A73 B;  1O78 A;  4CBV A;  3NE5 B;  2TMP A;  4N9P A;  5LL6 X;  3PUW A;  5A2Q E;  2E2J B;  5JVG 3;  4G7O C;  2SNS A;  4NDX A;  3PIO 3;  2RDG A;  1D5X C;  1DXM A;  4H0L C;  2HCI A;  3SEB A;  3DWQ A;  2NVT B;  1QG7 A;  1SFO B;  4J6H A;  5E4W C;  4XIG S;  4WOR A;  4QUF A;  5HUR A;  4HTH A;  4KTA A;  4CKE A;  1OO9 B;  1W6J A;  2LFN A;  3FDT A;  3GTG B;  1TII D;  1JOQ A;  2LS0 1;  3MAQ A;  3ND8 A;  3A8K E;  4A3F B;  1CFM A;  4A3E B;  2X6L A;  1XTC D;  3CU7 A;  4ID6 A;  3A7A B;  2A74 C;  1D1I A;  4F88 A;  3IFD A;  3MXU A;  3MWY W;  4BY7 B;  1FNU A;  4BA1 I;  1Q3L A;  3Q22 A;  1SJH D;  4A3J B;  5IGE A;  4XXE A;  3BVG A;  4EVO A;  3TDQ A;  1ET9 A;  1SNQ A;  3MA2 B;  4DXG A;  2O5I C;  2NUC A;  3I4L A;  2SEB D;  3P75 A;  4XTC S;  3N6R A;  3SVM A;  1TWF B;  2NTT A;  3DEO A;  3KLS X;  1U4R A;  2Q8R E;  3J7A V;  1TR5 A;  1DOM A;  3IAY A;  1O7Y A;  4KKU A;  4K8J A;  2B63 B;  5IGC A;  3L7Z C;  2QF7 A;  2V4D A;  1E2W A;  2EY1 A;  3KBX A;  3A56 A;  3K5M A;  3R2T A;  1Q1E A;  1GUS A;  1I3Q B;  2EY2 A;  4OL7 A;  4KV6 A;  4DAV A;  2M9V A;  5CGK A;  1G91 A;  2XVS A;  1C4Q A;  1EYD A;  2J4X A;  2R61 A;  1I50 B;  1DYQ A;  1JB3 A;  1ROD A;  5I4D A;  1A15 A;  1RDP D;  3FEW X;  3S1R B;  4KJN A;  2YYZ A;  2O5J C;  3SHL A;  5C3X A;  4A3I B;  5FK9 C;  2A6E C;  4KKS A;  3EQL C;  3A8J E;  2RDF A;  3V2T A;  2AWN A;  3C2P A;  3GTK B;  1U4L A;  2OT2 A;  2WKC A;  3OIQ A;  3V96 A;  1F77 A;  1ZYR C;  1STN A;  1F2Z A;  3MFY A;  3MTS A;  1SYG A;  2O2L D;  4BY1 B;  2L12 A;  3J7A F;  3BS1 A;  1QCB D;  1H9J A;  3SK5 A;  3H0G B;  1I6V C;  3R2I A;  1D1K A;  3DWP A;  4OO1 G;  2L1B A;  4EQO A;  1TS2 A;  2VB3 X;  1WTX A;  5KIX A;  4A93 B;  1VF7 A;  1JOO A;  2EJG C;  5K36 G;  2IX0 A;  2F0F A;  2F0H A;  2IT1 A;  2HUG A;  2QKI C;  1IKL A;  1X3Q A;  4XYO A;  1BCP F;  5A35 A;  1UEA B;  1G2S A;  1BDO A;  4QF4 A;  3K59 A;  4FXD A;  1GUN A;  1EIH A;  4FYD A;  2EYH A;  3MXG A;  4DXF A;  2K32 A;  3OSO A;  2SNM A;  2F1M A;  5I2Y A;  1DM0 B;  3MVV A;  2EYM A;  1H9R A;  2F0D A;  1VCI A;  1JR0 D;  1DOK A;  4IFD J;  3HOX B;  1F2Y A;  2NWG A;  4DA2 A;  3SDZ A;  3LNN A;  2B2V A;  3M7N A;  1HTL D;  4PQX A;  5I9P A;  4FF2 A;  1BOS A;  2K03 A;  1SDF A;  4KN4 C;  1CM9 A;  1LTS D;  4IUV A;  2L9H A;  1EQT A;  1RCV D;  4JBW A;  3DM1 A;  3NP8 A;  2C5C A;  4IFD G;  2F3W A;  1Y8P B;  3D8G A;  5C6A A;  4CJ2 C;  1D5Z C;  1AW7 A;  3P7J A;  1F2M A;  3TP8 A;  2F0P A;  4RFB A;  1PZI D;  2K01 A;  5C4H A;  3I8Z A;  1C48 A;  4FF1 A;  3GTJ B;  2K04 A;  1IYV A;  2JP1 A;  5KYI A;  3GTQ B;  1NCV A;  1VMC A;  4RA8 A;  3ZYY X;  5G3L F;  4TKO B;  5IT9 L;  2F0N A;  3DEP A;  2WV6 D;  3K5O A;  3KBG A;  4RGN A;  2F0O A;  2H1E A;  4OO1 I;  4KY5 A;  2XRQ D;  5LHY 1;  3EFX D;  1Y8O B;  5NUC A;  4KK7 A;  3VR3 A;  3QO2 A;  3NTH A;  4K5W A;  2ICE C;  2NVQ B;  1OXS C;  1WVL A;  2CW0 C;  5IT9 E;  1E2V A;  4V19 0;  2MUY A;  1OXU A;  1LT6 D;  1GUW A;  1UNS A;  2EYO A;  4Q0F A;  2YU9 B;  1NR4 A;  1ZXT A;  4C3H G;  3LX0 A;  1B9N A;  3GP7 A;  4WFN 3;  3T53 B;  2KVM A;  1EY5 A;  2M00 A;  1LLR D;  2LMC B;  2A6H D;  2EYP A;  3KLR A;  4R8N A;  4O42 A;  4RHR A;  2XWJ B;  1V1O A;  4Y7N B;  1DJR D;  2XSC A;  2B39 A;  5KNB A;  4RH6 A;  3P20 A;  1XXG A;  1LT5 D;  4ME5 A;  1NR2 A;  4FF3 A;  1Y1W B;  1IYU A;  3T16 A;  1EIG A;  3HEJ A;  1A2T A;  1ML0 D;  1EFI D;  3A55 A;  3HOZ B;  2F3V A;  3S15 B;  5ISR A;  4IFD I;  3G7L A;  4WJW A;  3GD7 A;  2JA7 B;  4K14 A;  4P2C B;  2Q8I B;  1IHZ A;  5IOC A;  4O1N A;  2Q8T A;  2EOT A;  2KEC A;  2F0S A;  3SE0 A;  4C3J B;  5CR3 A;  4A3G B;  1CQF A;  2HDM A;  3PO3 B;  3DMU A;  2AQ3 B;  1QNU A;  4KHV A;  4XYQ A;  4CJ0 B;  3NK9 A;  5E4X A;  2B2W A;  4M1U B;  3RUZ A;  1HA5 A;  1PFM A;  4LK1 C;  3K7A B;  3BYT B;  4J8Q A;  2B8G A;  1ESR A;  1QWY A;  3CQZ B;  5IGG A;  4RHS A;  1CTM A;  1R4Q B;  2HDL A;  1L0X B;  2ZXO A;  3QOL A;  3OMC A;  1GHK A;  4E6I A;  1QE6 A;  2XIW A;  4FNF A;  5DAU A;  4ZKB B;  5C5M A;  4K5X A;  3KUP A;  5C0X J;  1IL8 A;  2KOL A;  5CV9 A;  4IUR A;  4ABN A;  2Z8L A;  2IJ0 A;  5M3F B;  3QG1 A;  3VR2 A;  2EJM A;  3BVM A;  3M7G A;  3NXW A;  5D3D A;  5FLX L;  3BVZ A;  3MFG A;  3BZD B;  2VXW A;  1ILQ A;  5C0X G;  5M5X B;  2A69 D;  3NQT A;  3GQB A;  1MSH A;  1TY2 A;  3OWF A;  5EPJ A;  2F0K A;  1RF2 D;  4MN3 A;  1F9Q A;  4ZUI A;  1SEB D;  2SDF A;  2F0T A;  1SYE A;  4C3I G;  4LAA A;  2TSS A;  4RAU C;  5C3E B;  1PTO D;  1SSO A;  1PZJ D;  1Y8N B;  2WKD A;  4OGQ C;  5FLX E;  1IKM A;  5HGT A;  4NKL A;  4IUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...