4X4BA

Radiation damage to the nucleoprotein complex c.esp1396i: dose (dwd) 2.1 mgy
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage to nucleoprotein complexes in macromolecular crystallography.
pubmed doi rcsb
source organism Enterobacter sp. rfl1396
molecule tags Gene regulation
molecule keywords Regulatory protein
total genus 30
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4x4bA00
3GN5B 3SCGA 1VPWA 1X2LA 1PRVA 4FN3A 3L1PA 1WIZA 1LCDA 4O8BA 4IA8A 4X4CA 4X4FA 2LYPA 2EWTA 1RIOA 3IVPA 3SCHA 3JXBC 2O4AA 3TRBA 3UFDA 3MLFA 1QP7A 1ZZ9A 1LMB3 1ZZ6A 2PUCA 1UTXA 4Z58A 4YG7B 3OQNA 4PU7A 2LYSA 1HF0A 1LLIA 1ADRA 3F52A 4NDWA 2KZ8A 2AUWA 1BDIA 4X4DA 2MEZA 3H5TA 1IC8A 2XCJA 3QWGA 3S8QA 3LISA 4YARA 1RZRD 3BD1A 4I6RA 3QYXA 1BDHA 4I8TA 4Z5CA 2AXVA 1R69A 1YSEA 2GRLA 2KPJA 2LYLA 1E3OC 4JCYA 4YG4A 2PPXA 3GN5A 2OFYA 3KXAA 3B7HA 3FYAA 2KEJA 2CSFA 4J1XA 2IU7A 2ICTA 2PIJA 4Y42A 2AW6A 3R1FA 1QP0A 3BDNA 1WH6A 1QPZA 3OQMA 4YBAA 3SCFA 2R1JL 1OCTC 3U3WA 1Y7YA 2XSDC 2XIUA 4I6UA 2PE5A 2D5VA 4JQDA 4FBIA 3QQ6A 4J1WA 2WIUB 4JCXA 2FJRA 1JFSA 1ZS4A 2OR1L 3RZZA 3CECA 3EUSA 2PUAA 1ZZBA 4GQMA 4MCXA 1PRAA 3HZIB 2LCVA 3D1NI 4GHJA 2AXUA 2CROA 4Z5DA 1WETA 3QF3A 3CLCA 2XJ3A 1NEQA 2B5AA 3OP9A 3KJXA 1OSLA 2EF8A 1QQBA 3FMYA 5K98B 3CROL 3KZ3A 1L1MA 3ZHIA 2ICPA 2MQKA 4Z59A 3JXCL 3OMTA 1X57A 1QQAA 2LYRA 1B0NA 1PRUA 1PNRA 2BNNA 4F8DA 1RPEL 1SQ8A 4I6TA 3FYMA 4PU4C 2BNMA 1LQCA 2IVQA 3F6WA 1ZPQA 2H8RA 2JCGA 2PUBA 1ZAYA 1CJGA 3ZHMA 4OB4A 2PUDA 2LYKA 4X4IA 1RZSA 4IVZA 4Z5HA 1CQTA 3LFPA 2A6CA 1ZZ8A 3ZKCA 2KEKA 2L49A 3PXPA 1UXCA 1R63A 3G7DA 2IVGA 4YG1A 3JXDL 2HINA 1GT0C 1DWKA 1UXDA 1Y9QA 1EFAA 2L8NA 1LCCA 4IWRA 2IVBA 1PERL 2LYQA 2GRMA 2GZUA 4PU8A 2KEIA 2PUFA 1JFTA 4X4GA 1JH9A 1POUA 1ZZCA 2BNOA 2WUSR 1DW9A 3O9XA 1AU7A 3DNVB 4X4EA 1ZVVA 2O49A 2IV1A 3G5GA 5A7LA 3GBFA 1XWRA 2O38A 2JVLA 1QP4A 4X4BA 1S7EA 4PU3C 1ZUGA 2LYJA 1NERA 3VK0A 2AXZA 2PUGA 3BS3A 2EBYA 2HSGA 2R63A 1ZZ7A 1JWLA 2PUEA 3OQOA 4X4HA 2AWIA 1RZRA 4MCTA 2BJCA 1O4XA 1WH8A 3F51A 2XI8A 2IUOA
chains in the Genus database with same CATH superfamily
2XXQA 1VPWA 1X2LA 3TELA 1LCDA 4O8BA 3SX0A 4X4CA 3GZDA 2LNMA 3JXBC 3UFDA 4EZIA 1QP7A 1ZZ9A 1LMB3 4Z58A 1HF0A 1LLIA 2KZ8A 2J7WA 1IC8A 2PXTA 3LISA 4I6RA 4Z5CA 1R69A 1YSEA 2KPJA 2PXKA 2AW6A 3R1FA 1WH6A 3SCFA 3U3WA 2XSDC 2XIUA 4FBIA 3QQ6A 3MEJA 2PUAA 1HQ1A 3ME5A 4GQMA 2PXDA 2XJ3A 1NEQA 3OP9A 4WVLA 5DTRA 1QQAA 3OWQA 2LYRA 4F8DA 5GAGi 2BNMA 1LQCA 2HCSA 3QFIA 2LYKA 3DM5A 2KEKA 3PXPA 5DTMA 1GT0C 1UXDA 1Y9QA 4IWRA 1PERL 2GZUA 2KEIA 1POUA 1ZZCA 3G5GA 5A7LA 1QP4A 3QOXA 2HSGA 2PUEA 2AWIA 3KL4A 1U2ZA 1WH8A 4FN3A 3QOWA 3A9YA 4IA8A 3IVPA 2O4AA 3MLFA 2PUCA 1ZZ6A 4YG7B 3OQNA 4PU7A 2LYSA 4ER7A 1ADRA 2AUWA 2XCJA 2L1PA 3QWGA 3NROA 2FFHA 2V3CC 4EKIA 4JCYA 2OFYA 3KXAA 3B7HA 3FYAA 4J1XA 2ICTA 5DT2A 4EK9A 2PXQA 4YBAA 2R1JL 1NW3A 4I6UA 4J1WA 1QZXA 3OKZA 1PRAA 2LCVA 3TFLA 2YBDA 1OSLA 2EF8A 1QQBA 3FMYA 3CROL 3KZ3A 2PXBA 2ICPA 1X57A 1B0NA 1PRUA 1PNRA 2BNNA 1SQ8A 4I6TA 5JUWA 4PU4C 2H8RA 1ZAYA 3NZLA 4X4IA 1CQTA 3PE5A 1ZZ8A 3GUUA 3G7DA 2IVGA 4YG1A 1EFAA 2L8NA 1LCCA 2GRMA 2WUSR 3DNVB 2IV1A 2LYJA 3VK0A 4ER0A 2AXZA 2EBYA 1JWLA 1ZZ7A 2XXPA 3ZPXA 3F51A 2PXFA 3VWSA 2ODRD 3GN5B 1PRVA 3L1PA 1WIZA 2HFZA 1DULA 1RIOA 2PXUA 3SCHA 3TRBA 1UTXA 4EKGA 1BDIA 2J7UA 3S8QA 4YARA 1RZRD 2AXVA 4YG4A 3GN5A 3GZDC 4HRAA 3TEPA 2PXPA 2CSFA 1QP0A 1QPZA 3BDNA 2MXDA 3OQMA 4ER3A 1OCTC 4JQDA 2D5VA 1Y7YA 2WIUB 1MFQC 4JCXA 2OR1L 3CECA 3EUSA 1ZZBA 4MCXA 3HZIB 3D1NI 4GHJA 2CROA 3CLCA 3A9ZA 3GZCA 5DSXA 3KJXA 4OBMA 4ER5A 2PXLA 2PXEA 2IVQA 3F6WA 2PUBA 2LLVA 3ZHMA 2PUDA 1RZSA 4IVZA 4Z5HA 3ZKCA 2L49A 2HINA 1DWKA 2JQEA 1JFTA 4X4GA 1JH9A 2BNOA 1AU7A 2XXAA 3NDBB 1ZVVA 4X4EA 1XWRA 2O38A 4DE8A 2JVLA 4X4BA 1S7EA 2PUGA 3BS3A 2R63A 3R09A 4X4HA 1RZRA 4MCTA 5DTQA 1O4XA 2M4HA 2XI8A 3SCGA 4DE9A 1QB2A 4X4FA 2LYPA 2EWTA 3NXHA 3F52A 4NDWA 4X4DA 2MEZA 3H5TA 3BD1A 3QYXA 1BDHA 4I8TA 2GRLA 5DRYA 2LYLA 1E3OC 2PPXA 5DRTA 2KEJA 2IU7A 4Q2JA 2PIJA 4Y42A 3LQXA 3G0TA 2PE5A 2FJRA 1JFSA 1ZS4A 3RZZA 3SR4A 1WETA 2AXUA 2HCNA 4Z5DA 3QF3A 2B5AA 5K98B 1L1MA 3ZHIA 4Z59A 2MQKA 3JXCL 3OMTA 1RPEL 5GAHi 3FYMA 2LLWA 2VEOA 1ZPQA 2JCGA 1CJGA 4OB4A 4EQZA 3LFPA 2A6CA 1UXCA 1R63A 3JXDL 2IVBA 2LYQA 2PUFA 4PU8A 3A9XA 3O9XA 1DW9A 2O49A 2PXVA 3UWPA 3GBFA 4ER6A 4PU3C 1ZUGA 1NERA 3OQOA 2BJCA 3M9LA 2IUOA
chains in the Genus database with same CATH topology
3GN5B 3SCGA 1VPWA 1X2LA 1PRVA 4FN3A 3L1PA 1WIZA 1LCDA 4O8BA 4IA8A 4X4CA 4X4FA 2LYPA 2EWTA 1RIOA 3IVPA 3SCHA 3JXBC 2O4AA 3TRBA 3UFDA 3MLFA 1QP7A 1ZZ9A 1LMB3 1ZZ6A 2PUCA 1UTXA 4Z58A 4YG7B 3OQNA 4PU7A 2LYSA 1HF0A 1LLIA 1ADRA 3F52A 4NDWA 2KZ8A 2AUWA 1BDIA 4X4DA 2MEZA 3H5TA 1IC8A 2XCJA 3QWGA 3S8QA 3LISA 4YARA 1RZRD 3BD1A 4I6RA 3QYXA 1BDHA 4I8TA 4Z5CA 2AXVA 1R69A 1YSEA 2GRLA 2KPJA 2LYLA 1E3OC 4JCYA 4YG4A 2PPXA 3GN5A 2OFYA 3KXAA 3B7HA 3FYAA 2KEJA 2CSFA 4J1XA 2IU7A 2ICTA 2PIJA 4Y42A 2AW6A 3R1FA 1QP0A 3BDNA 1WH6A 1QPZA 3OQMA 4YBAA 3SCFA 2R1JL 1OCTC 3U3WA 1Y7YA 2XSDC 2XIUA 4I6UA 2PE5A 2D5VA 4JQDA 4FBIA 3QQ6A 4J1WA 2WIUB 4JCXA 2FJRA 1JFSA 1ZS4A 2OR1L 3RZZA 3CECA 3EUSA 2PUAA 1ZZBA 4GQMA 4MCXA 1PRAA 3HZIB 2LCVA 3D1NI 4GHJA 2AXUA 2CROA 4Z5DA 1WETA 3QF3A 3CLCA 2XJ3A 1NEQA 2B5AA 3OP9A 3KJXA 1OSLA 2EF8A 1QQBA 3FMYA 5K98B 3CROL 3KZ3A 1L1MA 3ZHIA 2ICPA 2MQKA 4Z59A 3JXCL 3OMTA 1X57A 1QQAA 2LYRA 1B0NA 1PRUA 1PNRA 2BNNA 4F8DA 1RPEL 1SQ8A 4I6TA 3FYMA 4PU4C 2BNMA 1LQCA 2IVQA 3F6WA 1ZPQA 2H8RA 2JCGA 2PUBA 1ZAYA 1CJGA 3ZHMA 4OB4A 2PUDA 2LYKA 4X4IA 1RZSA 4IVZA 4Z5HA 1CQTA 3LFPA 2A6CA 1ZZ8A 3ZKCA 2KEKA 2L49A 3PXPA 1UXCA 1R63A 3G7DA 2IVGA 4YG1A 3JXDL 2HINA 1GT0C 1DWKA 1UXDA 1Y9QA 1EFAA 2L8NA 1LCCA 4IWRA 2IVBA 1PERL 2LYQA 2GRMA 2GZUA 4PU8A 2KEIA 2PUFA 1JFTA 4X4GA 1JH9A 1POUA 1ZZCA 2BNOA 2WUSR 1DW9A 3O9XA 1AU7A 3DNVB 4X4EA 1ZVVA 2O49A 2IV1A 3G5GA 5A7LA 3GBFA 1XWRA 2O38A 2JVLA 1QP4A 4X4BA 1S7EA 4PU3C 1ZUGA 2LYJA 1NERA 3VK0A 2AXZA 2PUGA 3BS3A 2EBYA 2HSGA 2R63A 1ZZ7A 1JWLA 2PUEA 3OQOA 4X4HA 2AWIA 1RZRA 4MCTA 2BJCA 1O4XA 1WH8A 3F51A 2XI8A 2IUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GN5 B;  3SCG A;  1VPW A;  1X2L A;  1PRV A;  4FN3 A;  3L1P A;  1WIZ A;  1LCD A;  4O8B A;  4IA8 A;  4X4C A;  4X4F A;  2LYP A;  2EWT A;  1RIO A;  3IVP A;  3SCH A;  3JXB C;  2O4A A;  3TRB A;  3UFD A;  3MLF A;  1QP7 A;  1ZZ9 A;  1LMB 3;  1ZZ6 A;  2PUC A;  1UTX A;  4Z58 A;  4YG7 B;  3OQN A;  4PU7 A;  2LYS A;  1HF0 A;  1LLI A;  1ADR A;  3F52 A;  4NDW A;  2KZ8 A;  2AUW A;  1BDI A;  4X4D A;  2MEZ A;  3H5T A;  1IC8 A;  2XCJ A;  3QWG A;  3S8Q A;  3LIS A;  4YAR A;  1RZR D;  3BD1 A;  4I6R A;  3QYX A;  1BDH A;  4I8T A;  4Z5C A;  2AXV A;  1R69 A;  1YSE A;  2GRL A;  2KPJ A;  2LYL A;  1E3O C;  4JCY A;  4YG4 A;  2PPX A;  3GN5 A;  2OFY A;  3KXA A;  3B7H A;  3FYA A;  2KEJ A;  2CSF A;  4J1X A;  2IU7 A;  2ICT A;  2PIJ A;  4Y42 A;  2AW6 A;  3R1F A;  1QP0 A;  3BDN A;  1WH6 A;  1QPZ A;  3OQM A;  4YBA A;  3SCF A;  2R1J L;  1OCT C;  3U3W A;  1Y7Y A;  2XSD C;  2XIU A;  4I6U A;  2PE5 A;  2D5V A;  4JQD A;  4FBI A;  3QQ6 A;  4J1W A;  2WIU B;  4JCX A;  2FJR A;  1JFS A;  1ZS4 A;  2OR1 L;  3RZZ A;  3CEC A;  3EUS A;  2PUA A;  1ZZB A;  4GQM A;  4MCX A;  1PRA A;  3HZI B;  2LCV A;  3D1N I;  4GHJ A;  2AXU A;  2CRO A;  4Z5D A;  1WET A;  3QF3 A;  3CLC A;  2XJ3 A;  1NEQ A;  2B5A A;  3OP9 A;  3KJX A;  1OSL A;  2EF8 A;  1QQB A;  3FMY A;  5K98 B;  3CRO L;  3KZ3 A;  1L1M A;  3ZHI A;  2ICP A;  2MQK A;  4Z59 A;  3JXC L;  3OMT A;  1X57 A;  1QQA A;  2LYR A;  1B0N A;  1PRU A;  1PNR A;  2BNN A;  4F8D A;  1RPE L;  1SQ8 A;  4I6T A;  3FYM A;  4PU4 C;  2BNM A;  1LQC A;  2IVQ A;  3F6W A;  1ZPQ A;  2H8R A;  2JCG A;  2PUB A;  1ZAY A;  1CJG A;  3ZHM A;  4OB4 A;  2PUD A;  2LYK A;  4X4I A;  1RZS A;  4IVZ A;  4Z5H A;  1CQT A;  3LFP A;  2A6C A;  1ZZ8 A;  3ZKC A;  2KEK A;  2L49 A;  3PXP A;  1UXC A;  1R63 A;  3G7D A;  2IVG A;  4YG1 A;  3JXD L;  2HIN A;  1GT0 C;  1DWK A;  1UXD A;  1Y9Q A;  1EFA A;  2L8N A;  1LCC A;  4IWR A;  2IVB A;  1PER L;  2LYQ A;  2GRM A;  2GZU A;  4PU8 A;  2KEI A;  2PUF A;  1JFT A;  4X4G A;  1JH9 A;  1POU A;  1ZZC A;  2BNO A;  2WUS R;  1DW9 A;  3O9X A;  1AU7 A;  3DNV B;  4X4E A;  1ZVV A;  2O49 A;  2IV1 A;  3G5G A;  5A7L A;  3GBF A;  1XWR A;  2O38 A;  2JVL A;  1QP4 A;  4X4B A;  1S7E A;  4PU3 C;  1ZUG A;  2LYJ A;  1NER A;  3VK0 A;  2AXZ A;  2PUG A;  3BS3 A;  2EBY A;  2HSG A;  2R63 A;  1ZZ7 A;  1JWL A;  2PUE A;  3OQO A;  4X4H A;  2AWI A;  1RZR A;  4MCT A;  2BJC A;  1O4X A;  1WH8 A;  3F51 A;  2XI8 A;  2IUO A; 
#chains in the Genus database with same CATH topology
 2XXQ A;  1VPW A;  1X2L A;  3TEL A;  1LCD A;  4O8B A;  3SX0 A;  4X4C A;  3GZD A;  2LNM A;  3JXB C;  3UFD A;  4EZI A;  1QP7 A;  1ZZ9 A;  1LMB 3;  4Z58 A;  1HF0 A;  1LLI A;  2KZ8 A;  2J7W A;  1IC8 A;  2PXT A;  3LIS A;  4I6R A;  4Z5C A;  1R69 A;  1YSE A;  2KPJ A;  2PXK A;  2AW6 A;  3R1F A;  1WH6 A;  3SCF A;  3U3W A;  2XSD C;  2XIU A;  4FBI A;  3QQ6 A;  3MEJ A;  2PUA A;  1HQ1 A;  3ME5 A;  4GQM A;  2PXD A;  2XJ3 A;  1NEQ A;  3OP9 A;  4WVL A;  5DTR A;  1QQA A;  3OWQ A;  2LYR A;  4F8D A;  5GAG i;  2BNM A;  1LQC A;  2HCS A;  3QFI A;  2LYK A;  3DM5 A;  2KEK A;  3PXP A;  5DTM A;  1GT0 C;  1UXD A;  1Y9Q A;  4IWR A;  1PER L;  2GZU A;  2KEI A;  1POU A;  1ZZC A;  3G5G A;  5A7L A;  1QP4 A;  3QOX A;  2HSG A;  2PUE A;  2AWI A;  3KL4 A;  1U2Z A;  1WH8 A;  4FN3 A;  3QOW A;  3A9Y A;  4IA8 A;  3IVP A;  2O4A A;  3MLF A;  2PUC A;  1ZZ6 A;  4YG7 B;  3OQN A;  4PU7 A;  2LYS A;  4ER7 A;  1ADR A;  2AUW A;  2XCJ A;  2L1P A;  3QWG A;  3NRO A;  2FFH A;  2V3C C;  4EKI A;  4JCY A;  2OFY A;  3KXA A;  3B7H A;  3FYA A;  4J1X A;  2ICT A;  5DT2 A;  4EK9 A;  2PXQ A;  4YBA A;  2R1J L;  1NW3 A;  4I6U A;  4J1W A;  1QZX A;  3OKZ A;  1PRA A;  2LCV A;  3TFL A;  2YBD A;  1OSL A;  2EF8 A;  1QQB A;  3FMY A;  3CRO L;  3KZ3 A;  2PXB A;  2ICP A;  1X57 A;  1B0N A;  1PRU A;  1PNR A;  2BNN A;  1SQ8 A;  4I6T A;  5JUW A;  4PU4 C;  2H8R A;  1ZAY A;  3NZL A;  4X4I A;  1CQT A;  3PE5 A;  1ZZ8 A;  3GUU A;  3G7D A;  2IVG A;  4YG1 A;  1EFA A;  2L8N A;  1LCC A;  2GRM A;  2WUS R;  3DNV B;  2IV1 A;  2LYJ A;  3VK0 A;  4ER0 A;  2AXZ A;  2EBY A;  1JWL A;  1ZZ7 A;  2XXP A;  3ZPX A;  3F51 A;  2PXF A;  3VWS A;  2ODR D;  3GN5 B;  1PRV A;  3L1P A;  1WIZ A;  2HFZ A;  1DUL A;  1RIO A;  2PXU A;  3SCH A;  3TRB A;  1UTX A;  4EKG A;  1BDI A;  2J7U A;  3S8Q A;  4YAR A;  1RZR D;  2AXV A;  4YG4 A;  3GN5 A;  3GZD C;  4HRA A;  3TEP A;  2PXP A;  2CSF A;  1QP0 A;  1QPZ A;  3BDN A;  2MXD A;  3OQM A;  4ER3 A;  1OCT C;  4JQD A;  2D5V A;  1Y7Y A;  2WIU B;  1MFQ C;  4JCX A;  2OR1 L;  3CEC A;  3EUS A;  1ZZB A;  4MCX A;  3HZI B;  3D1N I;  4GHJ A;  2CRO A;  3CLC A;  3A9Z A;  3GZC A;  5DSX A;  3KJX A;  4OBM A;  4ER5 A;  2PXL A;  2PXE A;  2IVQ A;  3F6W A;  2PUB A;  2LLV A;  3ZHM A;  2PUD A;  1RZS A;  4IVZ A;  4Z5H A;  3ZKC A;  2L49 A;  2HIN A;  1DWK A;  2JQE A;  1JFT A;  4X4G A;  1JH9 A;  2BNO A;  1AU7 A;  2XXA A;  3NDB B;  1ZVV A;  4X4E A;  1XWR A;  2O38 A;  4DE8 A;  2JVL A;  4X4B A;  1S7E A;  2PUG A;  3BS3 A;  2R63 A;  3R09 A;  4X4H A;  1RZR A;  4MCT A;  5DTQ A;  1O4X A;  2M4H A;  2XI8 A;  3SCG A;  4DE9 A;  1QB2 A;  4X4F A;  2LYP A;  2EWT A;  3NXH A;  3F52 A;  4NDW A;  4X4D A;  2MEZ A;  3H5T A;  3BD1 A;  3QYX A;  1BDH A;  4I8T A;  2GRL A;  5DRY A;  2LYL A;  1E3O C;  2PPX A;  5DRT A;  2KEJ A;  2IU7 A;  4Q2J A;  2PIJ A;  4Y42 A;  3LQX A;  3G0T A;  2PE5 A;  2FJR A;  1JFS A;  1ZS4 A;  3RZZ A;  3SR4 A;  1WET A;  2AXU A;  2HCN A;  4Z5D A;  3QF3 A;  2B5A A;  5K98 B;  1L1M A;  3ZHI A;  4Z59 A;  2MQK A;  3JXC L;  3OMT A;  1RPE L;  5GAH i;  3FYM A;  2LLW A;  2VEO A;  1ZPQ A;  2JCG A;  1CJG A;  4OB4 A;  4EQZ A;  3LFP A;  2A6C A;  1UXC A;  1R63 A;  3JXD L;  2IVB A;  2LYQ A;  2PUF A;  4PU8 A;  3A9X A;  3O9X A;  1DW9 A;  2O49 A;  2PXV A;  3UWP A;  3GBF A;  4ER6 A;  4PU3 C;  1ZUG A;  1NER A;  3OQO A;  2BJC A;  3M9L A;  2IUO A; 
#chains in the Genus database with same CATH homology
 3GN5 B;  3SCG A;  1VPW A;  1X2L A;  1PRV A;  4FN3 A;  3L1P A;  1WIZ A;  1LCD A;  4O8B A;  4IA8 A;  4X4C A;  4X4F A;  2LYP A;  2EWT A;  1RIO A;  3IVP A;  3SCH A;  3JXB C;  2O4A A;  3TRB A;  3UFD A;  3MLF A;  1QP7 A;  1ZZ9 A;  1LMB 3;  1ZZ6 A;  2PUC A;  1UTX A;  4Z58 A;  4YG7 B;  3OQN A;  4PU7 A;  2LYS A;  1HF0 A;  1LLI A;  1ADR A;  3F52 A;  4NDW A;  2KZ8 A;  2AUW A;  1BDI A;  4X4D A;  2MEZ A;  3H5T A;  1IC8 A;  2XCJ A;  3QWG A;  3S8Q A;  3LIS A;  4YAR A;  1RZR D;  3BD1 A;  4I6R A;  3QYX A;  1BDH A;  4I8T A;  4Z5C A;  2AXV A;  1R69 A;  1YSE A;  2GRL A;  2KPJ A;  2LYL A;  1E3O C;  4JCY A;  4YG4 A;  2PPX A;  3GN5 A;  2OFY A;  3KXA A;  3B7H A;  3FYA A;  2KEJ A;  2CSF A;  4J1X A;  2IU7 A;  2ICT A;  2PIJ A;  4Y42 A;  2AW6 A;  3R1F A;  1QP0 A;  3BDN A;  1WH6 A;  1QPZ A;  3OQM A;  4YBA A;  3SCF A;  2R1J L;  1OCT C;  3U3W A;  1Y7Y A;  2XSD C;  2XIU A;  4I6U A;  2PE5 A;  2D5V A;  4JQD A;  4FBI A;  3QQ6 A;  4J1W A;  2WIU B;  4JCX A;  2FJR A;  1JFS A;  1ZS4 A;  2OR1 L;  3RZZ A;  3CEC A;  3EUS A;  2PUA A;  1ZZB A;  4GQM A;  4MCX A;  1PRA A;  3HZI B;  2LCV A;  3D1N I;  4GHJ A;  2AXU A;  2CRO A;  4Z5D A;  1WET A;  3QF3 A;  3CLC A;  2XJ3 A;  1NEQ A;  2B5A A;  3OP9 A;  3KJX A;  1OSL A;  2EF8 A;  1QQB A;  3FMY A;  5K98 B;  3CRO L;  3KZ3 A;  1L1M A;  3ZHI A;  2ICP A;  2MQK A;  4Z59 A;  3JXC L;  3OMT A;  1X57 A;  1QQA A;  2LYR A;  1B0N A;  1PRU A;  1PNR A;  2BNN A;  4F8D A;  1RPE L;  1SQ8 A;  4I6T A;  3FYM A;  4PU4 C;  2BNM A;  1LQC A;  2IVQ A;  3F6W A;  1ZPQ A;  2H8R A;  2JCG A;  2PUB A;  1ZAY A;  1CJG A;  3ZHM A;  4OB4 A;  2PUD A;  2LYK A;  4X4I A;  1RZS A;  4IVZ A;  4Z5H A;  1CQT A;  3LFP A;  2A6C A;  1ZZ8 A;  3ZKC A;  2KEK A;  2L49 A;  3PXP A;  1UXC A;  1R63 A;  3G7D A;  2IVG A;  4YG1 A;  3JXD L;  2HIN A;  1GT0 C;  1DWK A;  1UXD A;  1Y9Q A;  1EFA A;  2L8N A;  1LCC A;  4IWR A;  2IVB A;  1PER L;  2LYQ A;  2GRM A;  2GZU A;  4PU8 A;  2KEI A;  2PUF A;  1JFT A;  4X4G A;  1JH9 A;  1POU A;  1ZZC A;  2BNO A;  2WUS R;  1DW9 A;  3O9X A;  1AU7 A;  3DNV B;  4X4E A;  1ZVV A;  2O49 A;  2IV1 A;  3G5G A;  5A7L A;  3GBF A;  1XWR A;  2O38 A;  2JVL A;  1QP4 A;  4X4B A;  1S7E A;  4PU3 C;  1ZUG A;  2LYJ A;  1NER A;  3VK0 A;  2AXZ A;  2PUG A;  3BS3 A;  2EBY A;  2HSG A;  2R63 A;  1ZZ7 A;  1JWL A;  2PUE A;  3OQO A;  4X4H A;  2AWI A;  1RZR A;  4MCT A;  2BJC A;  1O4X A;  1WH8 A;  3F51 A;  2XI8 A;  2IUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...