4X4EA

Radiation damage to the nucleoprotein complex c.esp1396i: dose (dwd) 14.4 mgy
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage to nucleoprotein complexes in macromolecular crystallography.
pubmed doi rcsb
source organism Enterobacter sp. rfl1396
molecule tags Gene regulation
molecule keywords Regulatory protein
total genus 30
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4x4eA00
2ICTA 3GN5A 1WH8A 2PUGA 3O9XA 2IV1A 4F8DA 1BDIA 4IA8A 3F51A 1LLIA 3IVPA 4MCXA 3SCFA 3KJXA 3OMTA 1QQBA 2H8RA 3CROL 4JCXA 2R63A 1Y7YA 4PU3C 3EUSA 3B7HA 1BDHA 3BD1A 3BDNA 1QQAA 4X4GA 2PUDA 1PRAA 1Y9QA 1UXDA 2AUWA 4Z59A 1RZRA 1ZS4A 1ZUGA 1RIOA 2HINA 2IVQA 3FMYA 1LCCA 2OR1L 1ZZ6A 2L49A 4X4HA 3SCHA 3QF3A 3JXDL 2B5AA 2IU7A 3TRBA 4GHJA 4Z58A 4J1XA 3FYAA 3U3WA 1E3OC 1AU7A 3S8QA 2JVLA 2KPJA 2IVBA 4PU4C 1DW9A 1ZAYA 2R1JL 2IVGA 1JFTA 4X4FA 3QQ6A 1NEQA 2KZ8A 2LYKA 2MQKA 4I8TA 1ZZ8A 4X4IA 2D5VA 1CQTA 4I6UA 2XIUA 4X4CA 2XSDC 2GRLA 1HF0A 4YG1A 3L1PA 3ZHIA 4X4DA 4PU8A 3HZIB 1RPEL 2BNMA 1ZPQA 2LCVA 2WUSR 3JXBC 1WH6A 1YSEA 1ZZCA 3OP9A 3JXCL 3OQOA 1JWLA 3DNVB 1POUA 4PU7A 1LCDA 1PERL 2CSFA 2O4AA 1ADRA 2AXVA 1NERA 2LYPA 2XI8A 2O38A 3D1NI 4X4EA 1LQCA 3GN5B 2PE5A 1PRUA 2AXUA 4Z5DA 1S7EA 3KXAA 4JCYA 4IWRA 1WETA 3FYMA 2GZUA 2LYJA 2ICPA 2EBYA 2FJRA 2MEZA 3UFDA 1WIZA 3ZHMA 2XJ3A 1VPWA 2AW6A 4YBAA 3CECA 4FBIA 1PRVA 1B0NA 1EFAA 1SQ8A 4Y42A 1LMB3 3QYXA 4NDWA 2XCJA 1X57A 5A7LA 2BNNA 3SCGA 1RZSA 2CROA 2PUCA 1RZRD 4O8BA 3LFPA 1CJGA 4I6RA 3F52A 2IUOA 1QP0A 1O4XA 4OB4A 3BS3A 3VK0A 2WIUB 2EWTA 3KZ3A 3RZZA 1R63A 2LYRA 3G5GA 1GT0C 2GRMA 4X4BA 4MCTA 2PUBA 3R1FA 4IVZA 2L8NA 2LYQA 1ZZBA 3GBFA 1UXCA 1QP7A 2PUEA 4I6TA 4YARA 1XWRA 2KEKA 4YG7B 4GQMA 2A6CA 2JCGA 5K98B 2PIJA 3G7DA 3QWGA 2PUFA 1OSLA 3OQMA 2AWIA 1DWKA 1ZZ7A 2HSGA 2BNOA 3PXPA 2KEJA 2PPXA 1L1MA 3CLCA 4J1WA 1ZVVA 2KEIA 3F6WA 1UTXA 1IC8A 2LYLA 2BJCA 2OFYA 1X2LA 1JH9A 2PUAA 1PNRA 3H5TA 4FN3A 2AXZA 3MLFA 1R69A 2LYSA 1OCTC 4YG4A 4JQDA 4Z5CA 1JFSA 1QP4A 1QPZA 3ZKCA 2O49A 1ZZ9A 4Z5HA 3OQNA 3LISA 2EF8A
chains in the Genus database with same CATH superfamily
2ICTA 2IV1A 4IA8A 1QQBA 2R63A 3OKZA 3BD1A 3BDNA 5DTRA 3A9XA 2J7WA 1ZS4A 2HINA 3FMYA 5GAGi 2PXEA 1ZZ6A 3QF3A 2LLWA 3NDBB 3U3WA 4EKGA 1E3OC 4PU4C 1JFTA 2KZ8A 1ZZ8A 2D5VA 2XSDC 4DE9A 1RPEL 2BNMA 2MXDA 2WUSR 3JXBC 1WH6A 1ZZCA 2LNMA 3OP9A 3OQOA 3DNVB 1POUA 2CSFA 2AXVA 2LYPA 2XI8A 2PXQA 2PE5A 3NXHA 1MFQC 1VPWA 2AW6A 4YBAA 2YBDA 2L1PA 3TEPA 2HCSA 2PUCA 1RZSA 1HQ1A 4I6RA 4ER3A 2IUOA 3BS3A 2XXPA 2XXAA 2WIUB 3RZZA 4X4BA 4EK9A 4IVZA 2L8NA 2PXLA 3A9YA 2PUEA 4YARA 4YG7B 2LLVA 5JUWA 5K98B 2XXQA 3G7DA 3QWGA 3LQXA 1OSLA 1DWKA 1ZZ7A 3CLCA 1IC8A 1PNRA 3G0TA 1OCTC 1ZZ9A 3OQNA 3PXPA 3KL4A 3O9XA 1LLIA 1BDIA 4HRAA 3KJXA 4PU3C 3EUSA 3B7HA 4X4GA 5DT2A 1Y9QA 2AUWA 4Z59A 5DRYA 3GUUA 2IVQA 1LCCA 2OR1L 2L49A 3SCHA 2B5AA 3FYAA 1AU7A 2JVLA 2IVGA 4X4FA 3NROA 4X4IA 1CQTA 1DULA 2GRLA 4X4DA 4PU8A 1YSEA 1LCDA 4PU7A 4X4EA 2PXVA 2AXUA 4JCYA 4IWRA 5DTQA 1WETA 3PE5A 2MEZA 2ODRD 4Q2JA 3UFDA 2XJ3A 3CECA 1PRVA 3ME5A 4NDWA 1X57A 5A7LA 2CROA 4O8BA 2PXDA 1QP0A 1O4XA 3KZ3A 1GT0C 3GBFA 4I6TA 3SX0A 2JCGA 2PIJA 2PXKA 2HFZA 2PUFA 1L1MA 3OQMA 2AWIA 3A9ZA 2KEJA 3QOXA 2BJCA 2OFYA 3H5TA 3MLFA 4WVLA 4JQDA 1QPZA 3ZKCA 4DE8A 3OWQA 3ZHIA 2PUGA 4F8DA 3IVPA 4MCXA 3SCFA 4JCXA 3CROL 1Y7YA 1BDHA 2V3CC 1QQAA 1UXDA 1NW3A 2J7UA 1RIOA 2EF8A 2IU7A 3MEJA 3R09A 4GHJA 4Z58A 2PUAA 2KPJA 2IVBA 2PXTA 1NEQA 2LYKA 1QB2A 4I6UA 4X4CA 4ER0A 4YG1A 3L1PA 3HZIB 3JXCL 1PERL 2O4AA 2PXFA 2O38A 1PRUA 3NZLA 2EBYA 4FBIA 1B0NA 1EFAA 1SQ8A 4Y42A 4OBMA 1LMB3 3QYXA 2XCJA 3SCGA 1RZRD 3LFPA 3F52A 3VK0A 2LYRA 3M9LA 3G5GA 2LYQA 1ZZBA 1UXCA 1XWRA 2HCNA 2A6CA 2HSGA 2PPXA 4J1WA 3TFLA 4EZIA 2PXBA 2KEIA 3F6WA 2LYLA 2AXZA 3GZDA 3QFIA 1R69A 3GZDC 1QP4A 2O49A 4Z5HA 3ZHMA 3GN5A 1WH8A 1QZXA 3F51A 2H8RA 3OMTA 2PUDA 1PRAA 1RZRA 1ZUGA 2VEOA 4X4HA 3UWPA 4EQZA 2PXPA 3SR4A 4ER5A 3TRBA 4J1XA 3S8QA 1ZAYA 1DW9A 2R1JL 3ZPXA 3TELA 3QQ6A 2MQKA 4I8TA 4ER7A 2XIUA 1HF0A 2PXUA 2LCVA 1ZPQA 1JWLA 1ADRA 1NERA 3D1NI 1LQCA 2FFHA 3GN5B 3DM5A 1S7EA 3KXAA 5DTMA 4Z5DA 3FYMA 2GZUA 2LYJA 2ICPA 2FJRA 4EKIA 1WIZA 5GAHi 5DRTA 2BNNA 1CJGA 2M4HA 4OB4A 2EWTA 4ER6A 1R63A 2GRMA 1U2ZA 4MCTA 3R1FA 1QP7A 3GZCA 2KEKA 2JQEA 4GQMA 2PUBA 2BNOA 1ZVVA 1UTXA 3VWSA 1X2LA 3QOWA 1JH9A 4FN3A 2LYSA 4YG4A 4Z5CA 1JFSA 5DSXA 3LISA 3JXDL
chains in the Genus database with same CATH topology
2ICTA 3GN5A 1WH8A 2PUGA 3O9XA 2IV1A 4F8DA 1BDIA 4IA8A 3F51A 1LLIA 3IVPA 4MCXA 3SCFA 3KJXA 3OMTA 1QQBA 2H8RA 3CROL 4JCXA 2R63A 1Y7YA 4PU3C 3EUSA 3B7HA 1BDHA 3BD1A 3BDNA 1QQAA 4X4GA 2PUDA 1PRAA 1Y9QA 1UXDA 2AUWA 4Z59A 1RZRA 1ZS4A 1ZUGA 1RIOA 2HINA 2IVQA 3FMYA 1LCCA 2OR1L 1ZZ6A 2L49A 4X4HA 3SCHA 3QF3A 3JXDL 2B5AA 2IU7A 3TRBA 4GHJA 4Z58A 4J1XA 3FYAA 3U3WA 1E3OC 1AU7A 3S8QA 2JVLA 2KPJA 2IVBA 4PU4C 1DW9A 1ZAYA 2R1JL 2IVGA 1JFTA 4X4FA 3QQ6A 1NEQA 2KZ8A 2LYKA 2MQKA 4I8TA 1ZZ8A 4X4IA 2D5VA 1CQTA 4I6UA 2XIUA 4X4CA 2XSDC 2GRLA 1HF0A 4YG1A 3L1PA 3ZHIA 4X4DA 4PU8A 3HZIB 1RPEL 2BNMA 1ZPQA 2LCVA 2WUSR 3JXBC 1WH6A 1YSEA 1ZZCA 3OP9A 3JXCL 3OQOA 1JWLA 3DNVB 1POUA 4PU7A 1LCDA 1PERL 2CSFA 2O4AA 1ADRA 2AXVA 1NERA 2LYPA 2XI8A 2O38A 3D1NI 4X4EA 1LQCA 3GN5B 2PE5A 1PRUA 2AXUA 4Z5DA 1S7EA 3KXAA 4JCYA 4IWRA 1WETA 3FYMA 2GZUA 2LYJA 2ICPA 2EBYA 2FJRA 2MEZA 3UFDA 1WIZA 3ZHMA 2XJ3A 1VPWA 2AW6A 4YBAA 3CECA 4FBIA 1PRVA 1B0NA 1EFAA 1SQ8A 4Y42A 1LMB3 3QYXA 4NDWA 2XCJA 1X57A 5A7LA 2BNNA 3SCGA 1RZSA 2CROA 2PUCA 1RZRD 4O8BA 3LFPA 1CJGA 4I6RA 3F52A 2IUOA 1QP0A 1O4XA 4OB4A 3BS3A 3VK0A 2WIUB 2EWTA 3KZ3A 3RZZA 1R63A 2LYRA 3G5GA 1GT0C 2GRMA 4X4BA 4MCTA 2PUBA 3R1FA 4IVZA 2L8NA 2LYQA 1ZZBA 3GBFA 1UXCA 1QP7A 2PUEA 4I6TA 4YARA 1XWRA 2KEKA 4YG7B 4GQMA 2A6CA 2JCGA 5K98B 2PIJA 3G7DA 3QWGA 2PUFA 1OSLA 3OQMA 2AWIA 1DWKA 1ZZ7A 2HSGA 2BNOA 3PXPA 2KEJA 2PPXA 1L1MA 3CLCA 4J1WA 1ZVVA 2KEIA 3F6WA 1UTXA 1IC8A 2LYLA 2BJCA 2OFYA 1X2LA 1JH9A 2PUAA 1PNRA 3H5TA 4FN3A 2AXZA 3MLFA 1R69A 2LYSA 1OCTC 4YG4A 4JQDA 4Z5CA 1JFSA 1QP4A 1QPZA 3ZKCA 2O49A 1ZZ9A 4Z5HA 3OQNA 3LISA 2EF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICT A;  3GN5 A;  1WH8 A;  2PUG A;  3O9X A;  2IV1 A;  4F8D A;  1BDI A;  4IA8 A;  3F51 A;  1LLI A;  3IVP A;  4MCX A;  3SCF A;  3KJX A;  3OMT A;  1QQB A;  2H8R A;  3CRO L;  4JCX A;  2R63 A;  1Y7Y A;  4PU3 C;  3EUS A;  3B7H A;  1BDH A;  3BD1 A;  3BDN A;  1QQA A;  4X4G A;  2PUD A;  1PRA A;  1Y9Q A;  1UXD A;  2AUW A;  4Z59 A;  1RZR A;  1ZS4 A;  1ZUG A;  1RIO A;  2HIN A;  2IVQ A;  3FMY A;  1LCC A;  2OR1 L;  1ZZ6 A;  2L49 A;  4X4H A;  3SCH A;  3QF3 A;  3JXD L;  2B5A A;  2IU7 A;  3TRB A;  4GHJ A;  4Z58 A;  4J1X A;  3FYA A;  3U3W A;  1E3O C;  1AU7 A;  3S8Q A;  2JVL A;  2KPJ A;  2IVB A;  4PU4 C;  1DW9 A;  1ZAY A;  2R1J L;  2IVG A;  1JFT A;  4X4F A;  3QQ6 A;  1NEQ A;  2KZ8 A;  2LYK A;  2MQK A;  4I8T A;  1ZZ8 A;  4X4I A;  2D5V A;  1CQT A;  4I6U A;  2XIU A;  4X4C A;  2XSD C;  2GRL A;  1HF0 A;  4YG1 A;  3L1P A;  3ZHI A;  4X4D A;  4PU8 A;  3HZI B;  1RPE L;  2BNM A;  1ZPQ A;  2LCV A;  2WUS R;  3JXB C;  1WH6 A;  1YSE A;  1ZZC A;  3OP9 A;  3JXC L;  3OQO A;  1JWL A;  3DNV B;  1POU A;  4PU7 A;  1LCD A;  1PER L;  2CSF A;  2O4A A;  1ADR A;  2AXV A;  1NER A;  2LYP A;  2XI8 A;  2O38 A;  3D1N I;  4X4E A;  1LQC A;  3GN5 B;  2PE5 A;  1PRU A;  2AXU A;  4Z5D A;  1S7E A;  3KXA A;  4JCY A;  4IWR A;  1WET A;  3FYM A;  2GZU A;  2LYJ A;  2ICP A;  2EBY A;  2FJR A;  2MEZ A;  3UFD A;  1WIZ A;  3ZHM A;  2XJ3 A;  1VPW A;  2AW6 A;  4YBA A;  3CEC A;  4FBI A;  1PRV A;  1B0N A;  1EFA A;  1SQ8 A;  4Y42 A;  1LMB 3;  3QYX A;  4NDW A;  2XCJ A;  1X57 A;  5A7L A;  2BNN A;  3SCG A;  1RZS A;  2CRO A;  2PUC A;  1RZR D;  4O8B A;  3LFP A;  1CJG A;  4I6R A;  3F52 A;  2IUO A;  1QP0 A;  1O4X A;  4OB4 A;  3BS3 A;  3VK0 A;  2WIU B;  2EWT A;  3KZ3 A;  3RZZ A;  1R63 A;  2LYR A;  3G5G A;  1GT0 C;  2GRM A;  4X4B A;  4MCT A;  2PUB A;  3R1F A;  4IVZ A;  2L8N A;  2LYQ A;  1ZZB A;  3GBF A;  1UXC A;  1QP7 A;  2PUE A;  4I6T A;  4YAR A;  1XWR A;  2KEK A;  4YG7 B;  4GQM A;  2A6C A;  2JCG A;  5K98 B;  2PIJ A;  3G7D A;  3QWG A;  2PUF A;  1OSL A;  3OQM A;  2AWI A;  1DWK A;  1ZZ7 A;  2HSG A;  2BNO A;  3PXP A;  2KEJ A;  2PPX A;  1L1M A;  3CLC A;  4J1W A;  1ZVV A;  2KEI A;  3F6W A;  1UTX A;  1IC8 A;  2LYL A;  2BJC A;  2OFY A;  1X2L A;  1JH9 A;  2PUA A;  1PNR A;  3H5T A;  4FN3 A;  2AXZ A;  3MLF A;  1R69 A;  2LYS A;  1OCT C;  4YG4 A;  4JQD A;  4Z5C A;  1JFS A;  1QP4 A;  1QPZ A;  3ZKC A;  2O49 A;  1ZZ9 A;  4Z5H A;  3OQN A;  3LIS A;  2EF8 A; 
#chains in the Genus database with same CATH topology
 2ICT A;  2IV1 A;  4IA8 A;  1QQB A;  2R63 A;  3OKZ A;  3BD1 A;  3BDN A;  5DTR A;  3A9X A;  2J7W A;  1ZS4 A;  2HIN A;  3FMY A;  5GAG i;  2PXE A;  1ZZ6 A;  3QF3 A;  2LLW A;  3NDB B;  3U3W A;  4EKG A;  1E3O C;  4PU4 C;  1JFT A;  2KZ8 A;  1ZZ8 A;  2D5V A;  2XSD C;  4DE9 A;  1RPE L;  2BNM A;  2MXD A;  2WUS R;  3JXB C;  1WH6 A;  1ZZC A;  2LNM A;  3OP9 A;  3OQO A;  3DNV B;  1POU A;  2CSF A;  2AXV A;  2LYP A;  2XI8 A;  2PXQ A;  2PE5 A;  3NXH A;  1MFQ C;  1VPW A;  2AW6 A;  4YBA A;  2YBD A;  2L1P A;  3TEP A;  2HCS A;  2PUC A;  1RZS A;  1HQ1 A;  4I6R A;  4ER3 A;  2IUO A;  3BS3 A;  2XXP A;  2XXA A;  2WIU B;  3RZZ A;  4X4B A;  4EK9 A;  4IVZ A;  2L8N A;  2PXL A;  3A9Y A;  2PUE A;  4YAR A;  4YG7 B;  2LLV A;  5JUW A;  5K98 B;  2XXQ A;  3G7D A;  3QWG A;  3LQX A;  1OSL A;  1DWK A;  1ZZ7 A;  3CLC A;  1IC8 A;  1PNR A;  3G0T A;  1OCT C;  1ZZ9 A;  3OQN A;  3PXP A;  3KL4 A;  3O9X A;  1LLI A;  1BDI A;  4HRA A;  3KJX A;  4PU3 C;  3EUS A;  3B7H A;  4X4G A;  5DT2 A;  1Y9Q A;  2AUW A;  4Z59 A;  5DRY A;  3GUU A;  2IVQ A;  1LCC A;  2OR1 L;  2L49 A;  3SCH A;  2B5A A;  3FYA A;  1AU7 A;  2JVL A;  2IVG A;  4X4F A;  3NRO A;  4X4I A;  1CQT A;  1DUL A;  2GRL A;  4X4D A;  4PU8 A;  1YSE A;  1LCD A;  4PU7 A;  4X4E A;  2PXV A;  2AXU A;  4JCY A;  4IWR A;  5DTQ A;  1WET A;  3PE5 A;  2MEZ A;  2ODR D;  4Q2J A;  3UFD A;  2XJ3 A;  3CEC A;  1PRV A;  3ME5 A;  4NDW A;  1X57 A;  5A7L A;  2CRO A;  4O8B A;  2PXD A;  1QP0 A;  1O4X A;  3KZ3 A;  1GT0 C;  3GBF A;  4I6T A;  3SX0 A;  2JCG A;  2PIJ A;  2PXK A;  2HFZ A;  2PUF A;  1L1M A;  3OQM A;  2AWI A;  3A9Z A;  2KEJ A;  3QOX A;  2BJC A;  2OFY A;  3H5T A;  3MLF A;  4WVL A;  4JQD A;  1QPZ A;  3ZKC A;  4DE8 A;  3OWQ A;  3ZHI A;  2PUG A;  4F8D A;  3IVP A;  4MCX A;  3SCF A;  4JCX A;  3CRO L;  1Y7Y A;  1BDH A;  2V3C C;  1QQA A;  1UXD A;  1NW3 A;  2J7U A;  1RIO A;  2EF8 A;  2IU7 A;  3MEJ A;  3R09 A;  4GHJ A;  4Z58 A;  2PUA A;  2KPJ A;  2IVB A;  2PXT A;  1NEQ A;  2LYK A;  1QB2 A;  4I6U A;  4X4C A;  4ER0 A;  4YG1 A;  3L1P A;  3HZI B;  3JXC L;  1PER L;  2O4A A;  2PXF A;  2O38 A;  1PRU A;  3NZL A;  2EBY A;  4FBI A;  1B0N A;  1EFA A;  1SQ8 A;  4Y42 A;  4OBM A;  1LMB 3;  3QYX A;  2XCJ A;  3SCG A;  1RZR D;  3LFP A;  3F52 A;  3VK0 A;  2LYR A;  3M9L A;  3G5G A;  2LYQ A;  1ZZB A;  1UXC A;  1XWR A;  2HCN A;  2A6C A;  2HSG A;  2PPX A;  4J1W A;  3TFL A;  4EZI A;  2PXB A;  2KEI A;  3F6W A;  2LYL A;  2AXZ A;  3GZD A;  3QFI A;  1R69 A;  3GZD C;  1QP4 A;  2O49 A;  4Z5H A;  3ZHM A;  3GN5 A;  1WH8 A;  1QZX A;  3F51 A;  2H8R A;  3OMT A;  2PUD A;  1PRA A;  1RZR A;  1ZUG A;  2VEO A;  4X4H A;  3UWP A;  4EQZ A;  2PXP A;  3SR4 A;  4ER5 A;  3TRB A;  4J1X A;  3S8Q A;  1ZAY A;  1DW9 A;  2R1J L;  3ZPX A;  3TEL A;  3QQ6 A;  2MQK A;  4I8T A;  4ER7 A;  2XIU A;  1HF0 A;  2PXU A;  2LCV A;  1ZPQ A;  1JWL A;  1ADR A;  1NER A;  3D1N I;  1LQC A;  2FFH A;  3GN5 B;  3DM5 A;  1S7E A;  3KXA A;  5DTM A;  4Z5D A;  3FYM A;  2GZU A;  2LYJ A;  2ICP A;  2FJR A;  4EKI A;  1WIZ A;  5GAH i;  5DRT A;  2BNN A;  1CJG A;  2M4H A;  4OB4 A;  2EWT A;  4ER6 A;  1R63 A;  2GRM A;  1U2Z A;  4MCT A;  3R1F A;  1QP7 A;  3GZC A;  2KEK A;  2JQE A;  4GQM A;  2PUB A;  2BNO A;  1ZVV A;  1UTX A;  3VWS A;  1X2L A;  3QOW A;  1JH9 A;  4FN3 A;  2LYS A;  4YG4 A;  4Z5C A;  1JFS A;  5DSX A;  3LIS A;  3JXD L; 
#chains in the Genus database with same CATH homology
 2ICT A;  3GN5 A;  1WH8 A;  2PUG A;  3O9X A;  2IV1 A;  4F8D A;  1BDI A;  4IA8 A;  3F51 A;  1LLI A;  3IVP A;  4MCX A;  3SCF A;  3KJX A;  3OMT A;  1QQB A;  2H8R A;  3CRO L;  4JCX A;  2R63 A;  1Y7Y A;  4PU3 C;  3EUS A;  3B7H A;  1BDH A;  3BD1 A;  3BDN A;  1QQA A;  4X4G A;  2PUD A;  1PRA A;  1Y9Q A;  1UXD A;  2AUW A;  4Z59 A;  1RZR A;  1ZS4 A;  1ZUG A;  1RIO A;  2HIN A;  2IVQ A;  3FMY A;  1LCC A;  2OR1 L;  1ZZ6 A;  2L49 A;  4X4H A;  3SCH A;  3QF3 A;  3JXD L;  2B5A A;  2IU7 A;  3TRB A;  4GHJ A;  4Z58 A;  4J1X A;  3FYA A;  3U3W A;  1E3O C;  1AU7 A;  3S8Q A;  2JVL A;  2KPJ A;  2IVB A;  4PU4 C;  1DW9 A;  1ZAY A;  2R1J L;  2IVG A;  1JFT A;  4X4F A;  3QQ6 A;  1NEQ A;  2KZ8 A;  2LYK A;  2MQK A;  4I8T A;  1ZZ8 A;  4X4I A;  2D5V A;  1CQT A;  4I6U A;  2XIU A;  4X4C A;  2XSD C;  2GRL A;  1HF0 A;  4YG1 A;  3L1P A;  3ZHI A;  4X4D A;  4PU8 A;  3HZI B;  1RPE L;  2BNM A;  1ZPQ A;  2LCV A;  2WUS R;  3JXB C;  1WH6 A;  1YSE A;  1ZZC A;  3OP9 A;  3JXC L;  3OQO A;  1JWL A;  3DNV B;  1POU A;  4PU7 A;  1LCD A;  1PER L;  2CSF A;  2O4A A;  1ADR A;  2AXV A;  1NER A;  2LYP A;  2XI8 A;  2O38 A;  3D1N I;  4X4E A;  1LQC A;  3GN5 B;  2PE5 A;  1PRU A;  2AXU A;  4Z5D A;  1S7E A;  3KXA A;  4JCY A;  4IWR A;  1WET A;  3FYM A;  2GZU A;  2LYJ A;  2ICP A;  2EBY A;  2FJR A;  2MEZ A;  3UFD A;  1WIZ A;  3ZHM A;  2XJ3 A;  1VPW A;  2AW6 A;  4YBA A;  3CEC A;  4FBI A;  1PRV A;  1B0N A;  1EFA A;  1SQ8 A;  4Y42 A;  1LMB 3;  3QYX A;  4NDW A;  2XCJ A;  1X57 A;  5A7L A;  2BNN A;  3SCG A;  1RZS A;  2CRO A;  2PUC A;  1RZR D;  4O8B A;  3LFP A;  1CJG A;  4I6R A;  3F52 A;  2IUO A;  1QP0 A;  1O4X A;  4OB4 A;  3BS3 A;  3VK0 A;  2WIU B;  2EWT A;  3KZ3 A;  3RZZ A;  1R63 A;  2LYR A;  3G5G A;  1GT0 C;  2GRM A;  4X4B A;  4MCT A;  2PUB A;  3R1F A;  4IVZ A;  2L8N A;  2LYQ A;  1ZZB A;  3GBF A;  1UXC A;  1QP7 A;  2PUE A;  4I6T A;  4YAR A;  1XWR A;  2KEK A;  4YG7 B;  4GQM A;  2A6C A;  2JCG A;  5K98 B;  2PIJ A;  3G7D A;  3QWG A;  2PUF A;  1OSL A;  3OQM A;  2AWI A;  1DWK A;  1ZZ7 A;  2HSG A;  2BNO A;  3PXP A;  2KEJ A;  2PPX A;  1L1M A;  3CLC A;  4J1W A;  1ZVV A;  2KEI A;  3F6W A;  1UTX A;  1IC8 A;  2LYL A;  2BJC A;  2OFY A;  1X2L A;  1JH9 A;  2PUA A;  1PNR A;  3H5T A;  4FN3 A;  2AXZ A;  3MLF A;  1R69 A;  2LYS A;  1OCT C;  4YG4 A;  4JQD A;  4Z5C A;  1JFS A;  1QP4 A;  1QPZ A;  3ZKC A;  2O49 A;  1ZZ9 A;  4Z5H A;  3OQN A;  3LIS A;  2EF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...