4X4EA

Radiation damage to the nucleoprotein complex c.esp1396i: dose (dwd) 14.4 mgy
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage to nucleoprotein complexes in macromolecular crystallography.
pubmed doi rcsb
source organism Enterobacter sp. rfl1396
molecule tags Gene regulation
molecule keywords Regulatory protein
total genus 30
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4x4eA00
2AUWA 2GZUA 1ZZ8A 1QP7A 2R1JL 2R63A 1NEQA 1B0NA 2KZ8A 2PIJA 1RIOA 2PUEA 2PPXA 3LISA 1DW9A 3CECA 3PXPA 2XIUA 4I6TA 2LYRA 2HSGA 3F52A 1Y7YA 3CLCA 3MLFA 2IUOA 3GN5B 3SCFA 1RZRA 3OP9A 2AXVA 3UFDA 1QQBA 3B7HA 1VPWA 1ADRA 2KPJA 3L1PA 4MCXA 1IC8A 2D5VA 3S8QA 2IVQA 3GN5A 1UXCA 4J1XA 4X4DA 2IV1A 1JFTA 4X4IA 1SQ8A 1Y9QA 1BDHA 4Z5DA 2O4AA 2B5AA 1WIZA 2ICTA 4Z59A 1ZUGA 2OFYA 3JXCL 1AU7A 1LLIA 2A6CA 4Z5HA 2LYJA 4JQDA 2H8RA 1LQCA 1RPEL 2KEJA 3EUSA 2LYQA 1QQAA 3LFPA 1JFSA 3KJXA 4X4EA 2KEKA 1UTXA 2AXUA 3DNVB 2PUGA 4X4CA 2AXZA 2XCJA 1JH9A 2JCGA 1OCTC 1PERL 1X57A 4I8TA 1GT0C 4JCXA 3FYAA 1ZVVA 1ZZCA 5A7LA 4O8BA 4YG4A 1L1MA 2BNNA 3R1FA 2PUFA 1DWKA 2MEZA 2EF8A 2O49A 2GRMA 4GHJA 3G5GA 1WH6A 4PU7A 3H5TA 4NDWA 1BDIA 2OR1L 1ZPQA 1ZZBA 1UXDA 3G7DA 2PE5A 1LMB3 5K98B 1ZS4A 2CSFA 2XI8A 4YG7B 2AW6A 2AWIA 4YG1A 3FMYA 4F8DA 2GRLA 3ZKCA 4X4HA 4Y42A 1LCDA 3BDNA 3BS3A 1PRAA 3O9XA 1QPZA 4OB4A 3FYMA 2L49A 4I6RA 2MQKA 2WUSR 2CROA 2FJRA 1RZRD 1S7EA 3QYXA 4X4BA 3U3WA 1OSLA 2EWTA 2HINA 3BD1A 3F6WA 2IVBA 1QP4A 2XJ3A 4YBAA 4J1WA 3OQNA 2PUBA 2IU7A 3D1NI 1HF0A 4I6UA 4YARA 2ICPA 3OQMA 3CROL 4FBIA 1O4XA 2IVGA 3QWGA 4IA8A 4IVZA 2LYKA 2BJCA 1EFAA 3OQOA 1RZSA 1E3OC 3ZHMA 3SCHA 1POUA 1ZZ6A 2JVLA 1ZAYA 1R63A 2PUDA 3TRBA 1JWLA 3HZIB 4X4FA 1YSEA 3QF3A 3JXBC 1XWRA 2LYLA 3ZHIA 3IVPA 2EBYA 4Z58A 2XSDC 1CQTA 1WH8A 1PNRA 3JXDL 1ZZ9A 4IWRA 3QQ6A 1NERA 2LCVA 4FN3A 3SCGA 3KZ3A 2PUCA 1PRVA 4PU4C 1PRUA 3RZZA 4GQMA 4PU3C 4MCTA 3KXAA 2WIUB 3VK0A 1CJGA 2PUAA 4JCYA 1X2LA 2KEIA 2LYSA 4X4GA 1QP0A 3OMTA 4PU8A 1ZZ7A 3GBFA 2BNOA 2O38A 2L8NA 3F51A 1LCCA 2LYPA 4Z5CA 1R69A 1WETA 2BNMA
chains in the Genus database with same CATH superfamily
2MXDA 2R1JL 2PIJA 1RIOA 3NZLA 2XIUA 2LYRA 2IUOA 3GN5B 3UFDA 1QQBA 3TELA 3B7HA 1ADRA 3S8QA 4X4DA 2PXBA 1BDHA 2B5AA 4Z59A 2OFYA 1AU7A 3PE5A 3QOWA 2KEJA 2LYQA 1QQAA 3KJXA 3OKZA 2AXUA 3DNVB 2PUGA 1OCTC 1PERL 4YG4A 1DWKA 2MEZA 2O49A 3G5GA 3H5TA 1ZZBA 2ODRD 4EKGA 5K98B 2AW6A 4F8DA 4OBMA 2L1PA 3FYMA 5DRTA 2PXUA 1RZRD 3QYXA 2HINA 3BD1A 1QP4A 4YBAA 2PXLA 4J1WA 2ICPA 4FBIA 1O4XA 1EFAA 3OQOA 1RZSA 3SCHA 2JVLA 3TRBA 1JWLA 1XWRA 2LYLA 3IVPA 1HQ1A 1ZZ9A 2HCSA 3QQ6A 2PUCA 2XXQA 1PRVA 3UWPA 4PU3C 4MCTA 2PUAA 4ER7A 2LYSA 3OMTA 2BNOA 1LCCA 2PXQA 1NEQA 2PUEA 3LISA 1QB2A 2HSGA 1Y7YA 3SCFA 1RZRA 2AXVA 4ER5A 1VPWA 4EZIA 1DULA 2IVQA 3GN5A 1UXCA 2J7UA 4J1XA 1JFTA 1SQ8A 1ZUGA 4Z5HA 4WVLA 2H8RA 1LQCA 3LFPA 1JFSA 2JQEA 4X4EA 4X4CA 2AXZA 2XCJA 1JH9A 2JCGA 1X57A 4I8TA 1GT0C 4JCXA 1ZVVA 4O8BA 3R1FA 4NDWA 2XI8A 4YG1A 3FMYA 4Y42A 3BDNA 3ME5A 4OB4A 3A9ZA 4EKIA 2FJRA 4X4BA 3U3WA 3F6WA 3OQNA 4IVZA 2BJCA 1ZZ6A 2PUDA 2PXEA 5DT2A 2HCNA 4Z58A 4DE8A 1PNRA 3KZ3A 3RZZA 3OWQA 5DTRA 5GAGi 3KXAA 3VK0A 4JCYA 1X2LA 2KEIA 1MFQC 4X4GA 2PXTA 1QP0A 3TFLA 2L8NA 2LYPA 4Q2JA 1WETA 3TEPA 5DRYA 3QOXA 2AUWA 2GZUA 2KZ8A 2LLWA 3F52A 3CLCA 4ER0A 3OP9A 5DTQA 4MCXA 2IV1A 1Y9QA 1WIZA 2ICTA 1LLIA 2A6CA 4JQDA 2XXPA 1RPEL 5GAHi 3EUSA 3NROA 3NXHA 1ZZCA 5A7LA 2BNNA 2EF8A 4EK9A 4GHJA 4PU7A 1WH6A 1BDIA 1ZS4A 2CSFA 4YG7B 3G0TA 3DM5A 2V3CC 3BS3A 1QPZA 4I6RA 2WUSR 1S7EA 1OSLA 2IVBA 2XJ3A 2PUBA 3OQMA 3GZDA 4IA8A 3ZHMA 3SR4A 1POUA 3HZIB 3QF3A 3ZHIA 3JXDL 4IWRA 1NERA 2LCVA 3SCGA 4PU4C 3LQXA 4GQMA 2J7WA 2WIUB 2YBDA 4ER6A 3SX0A 1ZZ7A 2PXFA 3GBFA 2O38A 5DTMA 4Z5CA 3M9LA 2PXVA 1QP7A 1ZZ8A 2R63A 1B0NA 1U2ZA 2PPXA 1DW9A 3CECA 3PXPA 4I6TA 3MLFA 2PXPA 2KPJA 3L1PA 3A9XA 1IC8A 5JUWA 2D5VA 3GZCA 4X4IA 3VWSA 4Z5DA 2O4AA 4HRAA 3JXCL 1NW3A 2LYJA 2PXKA 3MEJA 2KEKA 1UTXA 1QZXA 5DSXA 2HFZA 3FYAA 3GZDC 1L1MA 2LLVA 2PUFA 2GRMA 2OR1L 1ZPQA 3NDBB 1UXDA 3G7DA 2PE5A 1LMB3 2AWIA 3KL4A 2GRLA 3ZKCA 4X4HA 1LCDA 1PRAA 3O9XA 3A9YA 2L49A 2LNMA 4ER3A 2MQKA 2CROA 4EQZA 2EWTA 2M4HA 2IU7A 3D1NI 2VEOA 4I6UA 4YARA 1HF0A 3CROL 2IVGA 3QWGA 2LYKA 1E3OC 3GUUA 3QFIA 1ZAYA 1R63A 4X4FA 1YSEA 3JXBC 2XSDC 2EBYA 1CQTA 1WH8A 3R09A 3ZPXA 4FN3A 1PRUA 1CJGA 2XXAA 2FFHA 4PU8A 2PXDA 3F51A 4DE9A 1R69A 2BNMA
chains in the Genus database with same CATH topology
2AUWA 2GZUA 1ZZ8A 1QP7A 2R1JL 2R63A 1NEQA 1B0NA 2KZ8A 2PIJA 1RIOA 2PUEA 2PPXA 3LISA 1DW9A 3CECA 3PXPA 2XIUA 4I6TA 2LYRA 2HSGA 3F52A 1Y7YA 3CLCA 3MLFA 2IUOA 3GN5B 3SCFA 1RZRA 3OP9A 2AXVA 3UFDA 1QQBA 3B7HA 1VPWA 1ADRA 2KPJA 3L1PA 4MCXA 1IC8A 2D5VA 3S8QA 2IVQA 3GN5A 1UXCA 4J1XA 4X4DA 2IV1A 1JFTA 4X4IA 1SQ8A 1Y9QA 1BDHA 4Z5DA 2O4AA 2B5AA 1WIZA 2ICTA 4Z59A 1ZUGA 2OFYA 3JXCL 1AU7A 1LLIA 2A6CA 4Z5HA 2LYJA 4JQDA 2H8RA 1LQCA 1RPEL 2KEJA 3EUSA 2LYQA 1QQAA 3LFPA 1JFSA 3KJXA 4X4EA 2KEKA 1UTXA 2AXUA 3DNVB 2PUGA 4X4CA 2AXZA 2XCJA 1JH9A 2JCGA 1OCTC 1PERL 1X57A 4I8TA 1GT0C 4JCXA 3FYAA 1ZVVA 1ZZCA 5A7LA 4O8BA 4YG4A 1L1MA 2BNNA 3R1FA 2PUFA 1DWKA 2MEZA 2EF8A 2O49A 2GRMA 4GHJA 3G5GA 1WH6A 4PU7A 3H5TA 4NDWA 1BDIA 2OR1L 1ZPQA 1ZZBA 1UXDA 3G7DA 2PE5A 1LMB3 5K98B 1ZS4A 2CSFA 2XI8A 4YG7B 2AW6A 2AWIA 4YG1A 3FMYA 4F8DA 2GRLA 3ZKCA 4X4HA 4Y42A 1LCDA 3BDNA 3BS3A 1PRAA 3O9XA 1QPZA 4OB4A 3FYMA 2L49A 4I6RA 2MQKA 2WUSR 2CROA 2FJRA 1RZRD 1S7EA 3QYXA 4X4BA 3U3WA 1OSLA 2EWTA 2HINA 3BD1A 3F6WA 2IVBA 1QP4A 2XJ3A 4YBAA 4J1WA 3OQNA 2PUBA 2IU7A 3D1NI 1HF0A 4I6UA 4YARA 2ICPA 3OQMA 3CROL 4FBIA 1O4XA 2IVGA 3QWGA 4IA8A 4IVZA 2LYKA 2BJCA 1EFAA 3OQOA 1RZSA 1E3OC 3ZHMA 3SCHA 1POUA 1ZZ6A 2JVLA 1ZAYA 1R63A 2PUDA 3TRBA 1JWLA 3HZIB 4X4FA 1YSEA 3QF3A 3JXBC 1XWRA 2LYLA 3ZHIA 3IVPA 2EBYA 4Z58A 2XSDC 1CQTA 1WH8A 1PNRA 3JXDL 1ZZ9A 4IWRA 3QQ6A 1NERA 2LCVA 4FN3A 3SCGA 3KZ3A 2PUCA 1PRVA 4PU4C 1PRUA 3RZZA 4GQMA 4PU3C 4MCTA 3KXAA 2WIUB 3VK0A 1CJGA 2PUAA 4JCYA 1X2LA 2KEIA 2LYSA 4X4GA 1QP0A 3OMTA 4PU8A 1ZZ7A 3GBFA 2BNOA 2O38A 2L8NA 3F51A 1LCCA 2LYPA 4Z5CA 1R69A 1WETA 2BNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AUW A;  2GZU A;  1ZZ8 A;  1QP7 A;  2R1J L;  2R63 A;  1NEQ A;  1B0N A;  2KZ8 A;  2PIJ A;  1RIO A;  2PUE A;  2PPX A;  3LIS A;  1DW9 A;  3CEC A;  3PXP A;  2XIU A;  4I6T A;  2LYR A;  2HSG A;  3F52 A;  1Y7Y A;  3CLC A;  3MLF A;  2IUO A;  3GN5 B;  3SCF A;  1RZR A;  3OP9 A;  2AXV A;  3UFD A;  1QQB A;  3B7H A;  1VPW A;  1ADR A;  2KPJ A;  3L1P A;  4MCX A;  1IC8 A;  2D5V A;  3S8Q A;  2IVQ A;  3GN5 A;  1UXC A;  4J1X A;  4X4D A;  2IV1 A;  1JFT A;  4X4I A;  1SQ8 A;  1Y9Q A;  1BDH A;  4Z5D A;  2O4A A;  2B5A A;  1WIZ A;  2ICT A;  4Z59 A;  1ZUG A;  2OFY A;  3JXC L;  1AU7 A;  1LLI A;  2A6C A;  4Z5H A;  2LYJ A;  4JQD A;  2H8R A;  1LQC A;  1RPE L;  2KEJ A;  3EUS A;  2LYQ A;  1QQA A;  3LFP A;  1JFS A;  3KJX A;  4X4E A;  2KEK A;  1UTX A;  2AXU A;  3DNV B;  2PUG A;  4X4C A;  2AXZ A;  2XCJ A;  1JH9 A;  2JCG A;  1OCT C;  1PER L;  1X57 A;  4I8T A;  1GT0 C;  4JCX A;  3FYA A;  1ZVV A;  1ZZC A;  5A7L A;  4O8B A;  4YG4 A;  1L1M A;  2BNN A;  3R1F A;  2PUF A;  1DWK A;  2MEZ A;  2EF8 A;  2O49 A;  2GRM A;  4GHJ A;  3G5G A;  1WH6 A;  4PU7 A;  3H5T A;  4NDW A;  1BDI A;  2OR1 L;  1ZPQ A;  1ZZB A;  1UXD A;  3G7D A;  2PE5 A;  1LMB 3;  5K98 B;  1ZS4 A;  2CSF A;  2XI8 A;  4YG7 B;  2AW6 A;  2AWI A;  4YG1 A;  3FMY A;  4F8D A;  2GRL A;  3ZKC A;  4X4H A;  4Y42 A;  1LCD A;  3BDN A;  3BS3 A;  1PRA A;  3O9X A;  1QPZ A;  4OB4 A;  3FYM A;  2L49 A;  4I6R A;  2MQK A;  2WUS R;  2CRO A;  2FJR A;  1RZR D;  1S7E A;  3QYX A;  4X4B A;  3U3W A;  1OSL A;  2EWT A;  2HIN A;  3BD1 A;  3F6W A;  2IVB A;  1QP4 A;  2XJ3 A;  4YBA A;  4J1W A;  3OQN A;  2PUB A;  2IU7 A;  3D1N I;  1HF0 A;  4I6U A;  4YAR A;  2ICP A;  3OQM A;  3CRO L;  4FBI A;  1O4X A;  2IVG A;  3QWG A;  4IA8 A;  4IVZ A;  2LYK A;  2BJC A;  1EFA A;  3OQO A;  1RZS A;  1E3O C;  3ZHM A;  3SCH A;  1POU A;  1ZZ6 A;  2JVL A;  1ZAY A;  1R63 A;  2PUD A;  3TRB A;  1JWL A;  3HZI B;  4X4F A;  1YSE A;  3QF3 A;  3JXB C;  1XWR A;  2LYL A;  3ZHI A;  3IVP A;  2EBY A;  4Z58 A;  2XSD C;  1CQT A;  1WH8 A;  1PNR A;  3JXD L;  1ZZ9 A;  4IWR A;  3QQ6 A;  1NER A;  2LCV A;  4FN3 A;  3SCG A;  3KZ3 A;  2PUC A;  1PRV A;  4PU4 C;  1PRU A;  3RZZ A;  4GQM A;  4PU3 C;  4MCT A;  3KXA A;  2WIU B;  3VK0 A;  1CJG A;  2PUA A;  4JCY A;  1X2L A;  2KEI A;  2LYS A;  4X4G A;  1QP0 A;  3OMT A;  4PU8 A;  1ZZ7 A;  3GBF A;  2BNO A;  2O38 A;  2L8N A;  3F51 A;  1LCC A;  2LYP A;  4Z5C A;  1R69 A;  1WET A;  2BNM A; 
#chains in the Genus database with same CATH topology
 2MXD A;  2R1J L;  2PIJ A;  1RIO A;  3NZL A;  2XIU A;  2LYR A;  2IUO A;  3GN5 B;  3UFD A;  1QQB A;  3TEL A;  3B7H A;  1ADR A;  3S8Q A;  4X4D A;  2PXB A;  1BDH A;  2B5A A;  4Z59 A;  2OFY A;  1AU7 A;  3PE5 A;  3QOW A;  2KEJ A;  2LYQ A;  1QQA A;  3KJX A;  3OKZ A;  2AXU A;  3DNV B;  2PUG A;  1OCT C;  1PER L;  4YG4 A;  1DWK A;  2MEZ A;  2O49 A;  3G5G A;  3H5T A;  1ZZB A;  2ODR D;  4EKG A;  5K98 B;  2AW6 A;  4F8D A;  4OBM A;  2L1P A;  3FYM A;  5DRT A;  2PXU A;  1RZR D;  3QYX A;  2HIN A;  3BD1 A;  1QP4 A;  4YBA A;  2PXL A;  4J1W A;  2ICP A;  4FBI A;  1O4X A;  1EFA A;  3OQO A;  1RZS A;  3SCH A;  2JVL A;  3TRB A;  1JWL A;  1XWR A;  2LYL A;  3IVP A;  1HQ1 A;  1ZZ9 A;  2HCS A;  3QQ6 A;  2PUC A;  2XXQ A;  1PRV A;  3UWP A;  4PU3 C;  4MCT A;  2PUA A;  4ER7 A;  2LYS A;  3OMT A;  2BNO A;  1LCC A;  2PXQ A;  1NEQ A;  2PUE A;  3LIS A;  1QB2 A;  2HSG A;  1Y7Y A;  3SCF A;  1RZR A;  2AXV A;  4ER5 A;  1VPW A;  4EZI A;  1DUL A;  2IVQ A;  3GN5 A;  1UXC A;  2J7U A;  4J1X A;  1JFT A;  1SQ8 A;  1ZUG A;  4Z5H A;  4WVL A;  2H8R A;  1LQC A;  3LFP A;  1JFS A;  2JQE A;  4X4E A;  4X4C A;  2AXZ A;  2XCJ A;  1JH9 A;  2JCG A;  1X57 A;  4I8T A;  1GT0 C;  4JCX A;  1ZVV A;  4O8B A;  3R1F A;  4NDW A;  2XI8 A;  4YG1 A;  3FMY A;  4Y42 A;  3BDN A;  3ME5 A;  4OB4 A;  3A9Z A;  4EKI A;  2FJR A;  4X4B A;  3U3W A;  3F6W A;  3OQN A;  4IVZ A;  2BJC A;  1ZZ6 A;  2PUD A;  2PXE A;  5DT2 A;  2HCN A;  4Z58 A;  4DE8 A;  1PNR A;  3KZ3 A;  3RZZ A;  3OWQ A;  5DTR A;  5GAG i;  3KXA A;  3VK0 A;  4JCY A;  1X2L A;  2KEI A;  1MFQ C;  4X4G A;  2PXT A;  1QP0 A;  3TFL A;  2L8N A;  2LYP A;  4Q2J A;  1WET A;  3TEP A;  5DRY A;  3QOX A;  2AUW A;  2GZU A;  2KZ8 A;  2LLW A;  3F52 A;  3CLC A;  4ER0 A;  3OP9 A;  5DTQ A;  4MCX A;  2IV1 A;  1Y9Q A;  1WIZ A;  2ICT A;  1LLI A;  2A6C A;  4JQD A;  2XXP A;  1RPE L;  5GAH i;  3EUS A;  3NRO A;  3NXH A;  1ZZC A;  5A7L A;  2BNN A;  2EF8 A;  4EK9 A;  4GHJ A;  4PU7 A;  1WH6 A;  1BDI A;  1ZS4 A;  2CSF A;  4YG7 B;  3G0T A;  3DM5 A;  2V3C C;  3BS3 A;  1QPZ A;  4I6R A;  2WUS R;  1S7E A;  1OSL A;  2IVB A;  2XJ3 A;  2PUB A;  3OQM A;  3GZD A;  4IA8 A;  3ZHM A;  3SR4 A;  1POU A;  3HZI B;  3QF3 A;  3ZHI A;  3JXD L;  4IWR A;  1NER A;  2LCV A;  3SCG A;  4PU4 C;  3LQX A;  4GQM A;  2J7W A;  2WIU B;  2YBD A;  4ER6 A;  3SX0 A;  1ZZ7 A;  2PXF A;  3GBF A;  2O38 A;  5DTM A;  4Z5C A;  3M9L A;  2PXV A;  1QP7 A;  1ZZ8 A;  2R63 A;  1B0N A;  1U2Z A;  2PPX A;  1DW9 A;  3CEC A;  3PXP A;  4I6T A;  3MLF A;  2PXP A;  2KPJ A;  3L1P A;  3A9X A;  1IC8 A;  5JUW A;  2D5V A;  3GZC A;  4X4I A;  3VWS A;  4Z5D A;  2O4A A;  4HRA A;  3JXC L;  1NW3 A;  2LYJ A;  2PXK A;  3MEJ A;  2KEK A;  1UTX A;  1QZX A;  5DSX A;  2HFZ A;  3FYA A;  3GZD C;  1L1M A;  2LLV A;  2PUF A;  2GRM A;  2OR1 L;  1ZPQ A;  3NDB B;  1UXD A;  3G7D A;  2PE5 A;  1LMB 3;  2AWI A;  3KL4 A;  2GRL A;  3ZKC A;  4X4H A;  1LCD A;  1PRA A;  3O9X A;  3A9Y A;  2L49 A;  2LNM A;  4ER3 A;  2MQK A;  2CRO A;  4EQZ A;  2EWT A;  2M4H A;  2IU7 A;  3D1N I;  2VEO A;  4I6U A;  4YAR A;  1HF0 A;  3CRO L;  2IVG A;  3QWG A;  2LYK A;  1E3O C;  3GUU A;  3QFI A;  1ZAY A;  1R63 A;  4X4F A;  1YSE A;  3JXB C;  2XSD C;  2EBY A;  1CQT A;  1WH8 A;  3R09 A;  3ZPX A;  4FN3 A;  1PRU A;  1CJG A;  2XXA A;  2FFH A;  4PU8 A;  2PXD A;  3F51 A;  4DE9 A;  1R69 A;  2BNM A; 
#chains in the Genus database with same CATH homology
 2AUW A;  2GZU A;  1ZZ8 A;  1QP7 A;  2R1J L;  2R63 A;  1NEQ A;  1B0N A;  2KZ8 A;  2PIJ A;  1RIO A;  2PUE A;  2PPX A;  3LIS A;  1DW9 A;  3CEC A;  3PXP A;  2XIU A;  4I6T A;  2LYR A;  2HSG A;  3F52 A;  1Y7Y A;  3CLC A;  3MLF A;  2IUO A;  3GN5 B;  3SCF A;  1RZR A;  3OP9 A;  2AXV A;  3UFD A;  1QQB A;  3B7H A;  1VPW A;  1ADR A;  2KPJ A;  3L1P A;  4MCX A;  1IC8 A;  2D5V A;  3S8Q A;  2IVQ A;  3GN5 A;  1UXC A;  4J1X A;  4X4D A;  2IV1 A;  1JFT A;  4X4I A;  1SQ8 A;  1Y9Q A;  1BDH A;  4Z5D A;  2O4A A;  2B5A A;  1WIZ A;  2ICT A;  4Z59 A;  1ZUG A;  2OFY A;  3JXC L;  1AU7 A;  1LLI A;  2A6C A;  4Z5H A;  2LYJ A;  4JQD A;  2H8R A;  1LQC A;  1RPE L;  2KEJ A;  3EUS A;  2LYQ A;  1QQA A;  3LFP A;  1JFS A;  3KJX A;  4X4E A;  2KEK A;  1UTX A;  2AXU A;  3DNV B;  2PUG A;  4X4C A;  2AXZ A;  2XCJ A;  1JH9 A;  2JCG A;  1OCT C;  1PER L;  1X57 A;  4I8T A;  1GT0 C;  4JCX A;  3FYA A;  1ZVV A;  1ZZC A;  5A7L A;  4O8B A;  4YG4 A;  1L1M A;  2BNN A;  3R1F A;  2PUF A;  1DWK A;  2MEZ A;  2EF8 A;  2O49 A;  2GRM A;  4GHJ A;  3G5G A;  1WH6 A;  4PU7 A;  3H5T A;  4NDW A;  1BDI A;  2OR1 L;  1ZPQ A;  1ZZB A;  1UXD A;  3G7D A;  2PE5 A;  1LMB 3;  5K98 B;  1ZS4 A;  2CSF A;  2XI8 A;  4YG7 B;  2AW6 A;  2AWI A;  4YG1 A;  3FMY A;  4F8D A;  2GRL A;  3ZKC A;  4X4H A;  4Y42 A;  1LCD A;  3BDN A;  3BS3 A;  1PRA A;  3O9X A;  1QPZ A;  4OB4 A;  3FYM A;  2L49 A;  4I6R A;  2MQK A;  2WUS R;  2CRO A;  2FJR A;  1RZR D;  1S7E A;  3QYX A;  4X4B A;  3U3W A;  1OSL A;  2EWT A;  2HIN A;  3BD1 A;  3F6W A;  2IVB A;  1QP4 A;  2XJ3 A;  4YBA A;  4J1W A;  3OQN A;  2PUB A;  2IU7 A;  3D1N I;  1HF0 A;  4I6U A;  4YAR A;  2ICP A;  3OQM A;  3CRO L;  4FBI A;  1O4X A;  2IVG A;  3QWG A;  4IA8 A;  4IVZ A;  2LYK A;  2BJC A;  1EFA A;  3OQO A;  1RZS A;  1E3O C;  3ZHM A;  3SCH A;  1POU A;  1ZZ6 A;  2JVL A;  1ZAY A;  1R63 A;  2PUD A;  3TRB A;  1JWL A;  3HZI B;  4X4F A;  1YSE A;  3QF3 A;  3JXB C;  1XWR A;  2LYL A;  3ZHI A;  3IVP A;  2EBY A;  4Z58 A;  2XSD C;  1CQT A;  1WH8 A;  1PNR A;  3JXD L;  1ZZ9 A;  4IWR A;  3QQ6 A;  1NER A;  2LCV A;  4FN3 A;  3SCG A;  3KZ3 A;  2PUC A;  1PRV A;  4PU4 C;  1PRU A;  3RZZ A;  4GQM A;  4PU3 C;  4MCT A;  3KXA A;  2WIU B;  3VK0 A;  1CJG A;  2PUA A;  4JCY A;  1X2L A;  2KEI A;  2LYS A;  4X4G A;  1QP0 A;  3OMT A;  4PU8 A;  1ZZ7 A;  3GBF A;  2BNO A;  2O38 A;  2L8N A;  3F51 A;  1LCC A;  2LYP A;  4Z5C A;  1R69 A;  1WET A;  2BNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...