4X4GA

Radiation damage to the nucleoprotein complex c.esp1396i: dose (dwd) 26.8 mgy
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
76
structure length
76
Chain Sequence
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLEVSDVVFFEMLIKEILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Radiation damage to nucleoprotein complexes in macromolecular crystallography.
pubmed doi rcsb
source organism Enterobacter sp. rfl1396
molecule tags Gene regulation
molecule keywords Regulatory protein
total genus 30
structure length 76
sequence length 76
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4x4gA00
2KEIA 1QP0A 2XSDC 3OQNA 1LLIA 3SCHA 4PU7A 2AXZA 4YG1A 2AUWA 1JFTA 1QQAA 4Z59A 2A6CA 1L1MA 1CQTA 1DWKA 3MLFA 3LFPA 3S8QA 1ZZ7A 4X4HA 1PRVA 3BS3A 2OR1L 3ZHIA 3BD1A 4YG4A 4J1WA 2XI8A 2L8NA 4J1XA 1LMB3 4Z5DA 2EBYA 2LYSA 2LYKA 3JXCL 1ZZBA 1WH8A 3OP9A 3FYAA 1ZZ8A 1IC8A 1GT0C 1R69A 3IVPA 3EUSA 4X4FA 3KXAA 3ZHMA 1ZZCA 3G7DA 3SCFA 4Y42A 1ZZ9A 4FN3A 4I6UA 4I6TA 3H5TA 2LYPA 3D1NI 2LCVA 1RPEL 1UXDA 5A7LA 4X4EA 3KJXA 1UXCA 5K98B 3DNVB 2AW6A 3R1FA 3ZKCA 1OCTC 1X2LA 2IVBA 2KPJA 2OFYA 2PIJA 4YARA 4X4BA 4GHJA 3BDNA 2PE5A 2PUFA 1ZVVA 2IVQA 4FBIA 4F8DA 1LQCA 1X57A 1LCCA 3CROL 3QWGA 1AU7A 3GN5A 1ZPQA 3CLCA 3LISA 4MCTA 1OSLA 2BNMA 2PUBA 3UFDA 2XIUA 2HSGA 2L49A 4O8BA 4Z5CA 2JVLA 1S7EA 1BDIA 2ICPA 1RIOA 2PUDA 1JWLA 1POUA 4I8TA 1Y7YA 2JCGA 1O4XA 2EF8A 4IWRA 1XWRA 3OMTA 2IUOA 3O9XA 1EFAA 3PXPA 1PRAA 1DW9A 4X4CA 1LCDA 1UTXA 1WIZA 4YBAA 2O49A 2HINA 2O38A 4GQMA 1QQBA 2BNNA 2CROA 1SQ8A 2XCJA 4X4GA 1QP4A 4YG7B 2PUAA 2PUGA 1VPWA 2KZ8A 2LYLA 2BJCA 4PU8A 4Z58A 1ZUGA 2IU7A 2D5VA 3F52A 2WIUB 3QF3A 3OQOA 4OB4A 2CSFA 2H8RA 1R63A 3U3WA 3QQ6A 1WETA 1PRUA 2R1JL 1BDHA 3F51A 2MEZA 4PU4C 4X4IA 1ZS4A 2LYJA 3SCGA 1NERA 2AXVA 4I6RA 3HZIB 1PNRA 1B0NA 3F6WA 1WH6A 2B5AA 1CJGA 2KEJA 2ICTA 2IV1A 1QP7A 3GN5B 3JXBC 3OQMA 2XJ3A 2KEKA 2PPXA 4IVZA 2PUCA 2O4AA 1RZSA 1HF0A 1NEQA 2R63A 4Z5HA 1RZRD 2MQKA 1JFSA 2PUEA 2GRLA 2GZUA 1JH9A 3G5GA 1ZAYA 2EWTA 3FYMA 3VK0A 4X4DA 2GRMA 2AWIA 3TRBA 4JCXA 2FJRA 3GBFA 4IA8A 1Y9QA 4MCXA 2WUSR 4PU3C 3L1PA 1PERL 1ADRA 1E3OC 3JXDL 3KZ3A 1ZZ6A 4NDWA 3RZZA 4JCYA 3B7HA 3FMYA 1RZRA 2BNOA 3QYXA 3CECA 4JQDA 2LYRA 2LYQA 2IVGA 1QPZA 1YSEA 2AXUA
chains in the Genus database with same CATH superfamily
2KEIA 4YG1A 3LQXA 1QQAA 1L1MA 3MLFA 1PRVA 4J1WA 2XI8A 4J1XA 2EBYA 2MXDA 3JXCL 1WH8A 3OP9A 2PXTA 2J7UA 3ZHMA 3SCFA 1ZZ9A 2LLWA 3H5TA 3D1NI 1RPEL 3DNVB 1OCTC 2IVBA 2KPJA 4X4BA 2PE5A 3PE5A 2IVQA 1LQCA 2PXEA 3CLCA 2PUBA 2ICPA 3ME5A 2PUDA 1POUA 4I8TA 2PXUA 2JCGA 1O4XA 2EF8A 1XWRA 4X4CA 3A9YA 1QQBA 2PUGA 1SQ8A 4X4GA 2LYLA 3G0TA 2BJCA 4Z58A 3QF3A 2J7WA 4Q2JA 1WETA 3F51A 4PU4C 1B0NA 2LNMA 2KEKA 4IVZA 2O4AA 1HF0A 2R63A 2MQKA 2EWTA 3VK0A 3TRBA 3GBFA 2WUSR 3SX0A 2ODRD 4PU3C 3JXDL 3KZ3A 3FMYA 3TFLA 2PXVA 4JQDA 2FFHA 2LYQA 1YSEA 2AXUA 1QP0A 3OQNA 3SCHA 4PU7A 3GZCA 1DWKA 3LFPA 3S8QA 3MEJA 2OR1L 3BD1A 4YG4A 2HFZA 4Z5DA 2LYSA 1ZZBA 3FYAA 1ZZ8A 3TEPA 1R69A 3NZLA 4X4FA 3KXAA 1ZZCA 4FN3A 4EZIA 2LYPA 2LCVA 2XXPA 4X4EA 3R1FA 2PIJA 3GUUA 3QWGA 3GN5A 3QOXA 2BNMA 3UFDA 2XIUA 2L49A 1RIOA 4IWRA 3O9XA 1EFAA 1PRAA 1UTXA 1WIZA 2CROA 5JUWA 2YBDA 2KZ8A 3A9XA 4PU8A 1QB2A 2PXDA 2PXLA 1ZUGA 2IU7A 5DRTA 5DRYA 2WIUB 4OB4A 2H8RA 3QQ6A 2MEZA 1CJGA 2ICTA 2IV1A 1QP7A 3GN5B 3VWSA 1JFSA 2XXAA 1MFQC 1ADRA 4ER3A 3QYXA 1LLIA 2AXZA 2V3CC 2A6CA 4X4HA 2L8NA 3QFIA 3QOWA 2JQEA 1IC8A 1GT0C 3IVPA 3EUSA 4Y42A 3A9ZA 4I6TA 1UXDA 5A7LA 2HCNA 5K98B 2AW6A 3ZKCA 1X2LA 2OFYA 3BDNA 2PXFA 1ZVVA 4EQZA 1X57A 1LCCA 1AU7A 1ZPQA 3LISA 4MCTA 5DTQA 4ER5A 5GAGi 1OSLA 2HSGA 2JVLA 1Y7YA 2PXKA 3OMTA 4EK9A 1DW9A 1LCDA 4YBAA 2O49A 2HINA 4GQMA 1QP4A 1VPWA 5DTMA 3OQOA 3NROA 1R63A 3U3WA 1DULA 4X4IA 1ZS4A 4I6RA 3HZIB 5GAHi 2B5AA 2KEJA 3OQMA 1RZSA 1NEQA 4Z5HA 3NXHA 2PUEA 2GRLA 3ZPXA 2GZUA 1JH9A 3FYMA 2AWIA 4IA8A 1Y9QA 1PERL 1E3OC 1ZZ6A 2LLVA 4JCYA 3SR4A 3B7HA 2PXPA 1RZRA 2BNOA 2L1PA 2LYRA 4EKGA 2IVGA 1QPZA 2XSDC 5DTRA 2AUWA 1JFTA 4Z59A 1CQTA 3OWQA 4ER0A 1ZZ7A 3BS3A 3ZHIA 3R09A 4ER7A 1LMB3 2LYKA 2HCSA 2PXQA 2XXQA 1HQ1A 3G7DA 4I6UA 5DSXA 3DM5A 3KJXA 1UXCA 4DE8A 1U2ZA 4YARA 4GHJA 2PUFA 4FBIA 2M4HA 4F8DA 2VEOA 3CROL 4OBMA 4ER6A 4O8BA 3KL4A 4Z5CA 1S7EA 1BDIA 1JWLA 3M9LA 3NDBB 2IUOA 3PXPA 2O38A 2BNNA 2XCJA 2PUAA 4YG7B 4DE9A 3TELA 3GZDC 4WVLA 2D5VA 3F52A 2PXBA 1QZXA 2CSFA 1PRUA 2R1JL 1BDHA 4HRAA 2LYJA 3SCGA 1NERA 2AXVA 1PNRA 3F6WA 1WH6A 3JXBC 4EKIA 2XJ3A 2PPXA 3UWPA 2PUCA 3GZDA 1RZRD 3OKZA 3G5GA 1ZAYA 4X4DA 2GRMA 4JCXA 2FJRA 4MCXA 1NW3A 3L1PA 4NDWA 3RZZA 3CECA 5DT2A
chains in the Genus database with same CATH topology
2KEIA 1QP0A 2XSDC 3OQNA 1LLIA 3SCHA 4PU7A 2AXZA 4YG1A 2AUWA 1JFTA 1QQAA 4Z59A 2A6CA 1L1MA 1CQTA 1DWKA 3MLFA 3LFPA 3S8QA 1ZZ7A 4X4HA 1PRVA 3BS3A 2OR1L 3ZHIA 3BD1A 4YG4A 4J1WA 2XI8A 2L8NA 4J1XA 1LMB3 4Z5DA 2EBYA 2LYSA 2LYKA 3JXCL 1ZZBA 1WH8A 3OP9A 3FYAA 1ZZ8A 1IC8A 1GT0C 1R69A 3IVPA 3EUSA 4X4FA 3KXAA 3ZHMA 1ZZCA 3G7DA 3SCFA 4Y42A 1ZZ9A 4FN3A 4I6UA 4I6TA 3H5TA 2LYPA 3D1NI 2LCVA 1RPEL 1UXDA 5A7LA 4X4EA 3KJXA 1UXCA 5K98B 3DNVB 2AW6A 3R1FA 3ZKCA 1OCTC 1X2LA 2IVBA 2KPJA 2OFYA 2PIJA 4YARA 4X4BA 4GHJA 3BDNA 2PE5A 2PUFA 1ZVVA 2IVQA 4FBIA 4F8DA 1LQCA 1X57A 1LCCA 3CROL 3QWGA 1AU7A 3GN5A 1ZPQA 3CLCA 3LISA 4MCTA 1OSLA 2BNMA 2PUBA 3UFDA 2XIUA 2HSGA 2L49A 4O8BA 4Z5CA 2JVLA 1S7EA 1BDIA 2ICPA 1RIOA 2PUDA 1JWLA 1POUA 4I8TA 1Y7YA 2JCGA 1O4XA 2EF8A 4IWRA 1XWRA 3OMTA 2IUOA 3O9XA 1EFAA 3PXPA 1PRAA 1DW9A 4X4CA 1LCDA 1UTXA 1WIZA 4YBAA 2O49A 2HINA 2O38A 4GQMA 1QQBA 2BNNA 2CROA 1SQ8A 2XCJA 4X4GA 1QP4A 4YG7B 2PUAA 2PUGA 1VPWA 2KZ8A 2LYLA 2BJCA 4PU8A 4Z58A 1ZUGA 2IU7A 2D5VA 3F52A 2WIUB 3QF3A 3OQOA 4OB4A 2CSFA 2H8RA 1R63A 3U3WA 3QQ6A 1WETA 1PRUA 2R1JL 1BDHA 3F51A 2MEZA 4PU4C 4X4IA 1ZS4A 2LYJA 3SCGA 1NERA 2AXVA 4I6RA 3HZIB 1PNRA 1B0NA 3F6WA 1WH6A 2B5AA 1CJGA 2KEJA 2ICTA 2IV1A 1QP7A 3GN5B 3JXBC 3OQMA 2XJ3A 2KEKA 2PPXA 4IVZA 2PUCA 2O4AA 1RZSA 1HF0A 1NEQA 2R63A 4Z5HA 1RZRD 2MQKA 1JFSA 2PUEA 2GRLA 2GZUA 1JH9A 3G5GA 1ZAYA 2EWTA 3FYMA 3VK0A 4X4DA 2GRMA 2AWIA 3TRBA 4JCXA 2FJRA 3GBFA 4IA8A 1Y9QA 4MCXA 2WUSR 4PU3C 3L1PA 1PERL 1ADRA 1E3OC 3JXDL 3KZ3A 1ZZ6A 4NDWA 3RZZA 4JCYA 3B7HA 3FMYA 1RZRA 2BNOA 3QYXA 3CECA 4JQDA 2LYRA 2LYQA 2IVGA 1QPZA 1YSEA 2AXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEI A;  1QP0 A;  2XSD C;  3OQN A;  1LLI A;  3SCH A;  4PU7 A;  2AXZ A;  4YG1 A;  2AUW A;  1JFT A;  1QQA A;  4Z59 A;  2A6C A;  1L1M A;  1CQT A;  1DWK A;  3MLF A;  3LFP A;  3S8Q A;  1ZZ7 A;  4X4H A;  1PRV A;  3BS3 A;  2OR1 L;  3ZHI A;  3BD1 A;  4YG4 A;  4J1W A;  2XI8 A;  2L8N A;  4J1X A;  1LMB 3;  4Z5D A;  2EBY A;  2LYS A;  2LYK A;  3JXC L;  1ZZB A;  1WH8 A;  3OP9 A;  3FYA A;  1ZZ8 A;  1IC8 A;  1GT0 C;  1R69 A;  3IVP A;  3EUS A;  4X4F A;  3KXA A;  3ZHM A;  1ZZC A;  3G7D A;  3SCF A;  4Y42 A;  1ZZ9 A;  4FN3 A;  4I6U A;  4I6T A;  3H5T A;  2LYP A;  3D1N I;  2LCV A;  1RPE L;  1UXD A;  5A7L A;  4X4E A;  3KJX A;  1UXC A;  5K98 B;  3DNV B;  2AW6 A;  3R1F A;  3ZKC A;  1OCT C;  1X2L A;  2IVB A;  2KPJ A;  2OFY A;  2PIJ A;  4YAR A;  4X4B A;  4GHJ A;  3BDN A;  2PE5 A;  2PUF A;  1ZVV A;  2IVQ A;  4FBI A;  4F8D A;  1LQC A;  1X57 A;  1LCC A;  3CRO L;  3QWG A;  1AU7 A;  3GN5 A;  1ZPQ A;  3CLC A;  3LIS A;  4MCT A;  1OSL A;  2BNM A;  2PUB A;  3UFD A;  2XIU A;  2HSG A;  2L49 A;  4O8B A;  4Z5C A;  2JVL A;  1S7E A;  1BDI A;  2ICP A;  1RIO A;  2PUD A;  1JWL A;  1POU A;  4I8T A;  1Y7Y A;  2JCG A;  1O4X A;  2EF8 A;  4IWR A;  1XWR A;  3OMT A;  2IUO A;  3O9X A;  1EFA A;  3PXP A;  1PRA A;  1DW9 A;  4X4C A;  1LCD A;  1UTX A;  1WIZ A;  4YBA A;  2O49 A;  2HIN A;  2O38 A;  4GQM A;  1QQB A;  2BNN A;  2CRO A;  1SQ8 A;  2XCJ A;  4X4G A;  1QP4 A;  4YG7 B;  2PUA A;  2PUG A;  1VPW A;  2KZ8 A;  2LYL A;  2BJC A;  4PU8 A;  4Z58 A;  1ZUG A;  2IU7 A;  2D5V A;  3F52 A;  2WIU B;  3QF3 A;  3OQO A;  4OB4 A;  2CSF A;  2H8R A;  1R63 A;  3U3W A;  3QQ6 A;  1WET A;  1PRU A;  2R1J L;  1BDH A;  3F51 A;  2MEZ A;  4PU4 C;  4X4I A;  1ZS4 A;  2LYJ A;  3SCG A;  1NER A;  2AXV A;  4I6R A;  3HZI B;  1PNR A;  1B0N A;  3F6W A;  1WH6 A;  2B5A A;  1CJG A;  2KEJ A;  2ICT A;  2IV1 A;  1QP7 A;  3GN5 B;  3JXB C;  3OQM A;  2XJ3 A;  2KEK A;  2PPX A;  4IVZ A;  2PUC A;  2O4A A;  1RZS A;  1HF0 A;  1NEQ A;  2R63 A;  4Z5H A;  1RZR D;  2MQK A;  1JFS A;  2PUE A;  2GRL A;  2GZU A;  1JH9 A;  3G5G A;  1ZAY A;  2EWT A;  3FYM A;  3VK0 A;  4X4D A;  2GRM A;  2AWI A;  3TRB A;  4JCX A;  2FJR A;  3GBF A;  4IA8 A;  1Y9Q A;  4MCX A;  2WUS R;  4PU3 C;  3L1P A;  1PER L;  1ADR A;  1E3O C;  3JXD L;  3KZ3 A;  1ZZ6 A;  4NDW A;  3RZZ A;  4JCY A;  3B7H A;  3FMY A;  1RZR A;  2BNO A;  3QYX A;  3CEC A;  4JQD A;  2LYR A;  2LYQ A;  2IVG A;  1QPZ A;  1YSE A;  2AXU A; 
#chains in the Genus database with same CATH topology
 2KEI A;  4YG1 A;  3LQX A;  1QQA A;  1L1M A;  3MLF A;  1PRV A;  4J1W A;  2XI8 A;  4J1X A;  2EBY A;  2MXD A;  3JXC L;  1WH8 A;  3OP9 A;  2PXT A;  2J7U A;  3ZHM A;  3SCF A;  1ZZ9 A;  2LLW A;  3H5T A;  3D1N I;  1RPE L;  3DNV B;  1OCT C;  2IVB A;  2KPJ A;  4X4B A;  2PE5 A;  3PE5 A;  2IVQ A;  1LQC A;  2PXE A;  3CLC A;  2PUB A;  2ICP A;  3ME5 A;  2PUD A;  1POU A;  4I8T A;  2PXU A;  2JCG A;  1O4X A;  2EF8 A;  1XWR A;  4X4C A;  3A9Y A;  1QQB A;  2PUG A;  1SQ8 A;  4X4G A;  2LYL A;  3G0T A;  2BJC A;  4Z58 A;  3QF3 A;  2J7W A;  4Q2J A;  1WET A;  3F51 A;  4PU4 C;  1B0N A;  2LNM A;  2KEK A;  4IVZ A;  2O4A A;  1HF0 A;  2R63 A;  2MQK A;  2EWT A;  3VK0 A;  3TRB A;  3GBF A;  2WUS R;  3SX0 A;  2ODR D;  4PU3 C;  3JXD L;  3KZ3 A;  3FMY A;  3TFL A;  2PXV A;  4JQD A;  2FFH A;  2LYQ A;  1YSE A;  2AXU A;  1QP0 A;  3OQN A;  3SCH A;  4PU7 A;  3GZC A;  1DWK A;  3LFP A;  3S8Q A;  3MEJ A;  2OR1 L;  3BD1 A;  4YG4 A;  2HFZ A;  4Z5D A;  2LYS A;  1ZZB A;  3FYA A;  1ZZ8 A;  3TEP A;  1R69 A;  3NZL A;  4X4F A;  3KXA A;  1ZZC A;  4FN3 A;  4EZI A;  2LYP A;  2LCV A;  2XXP A;  4X4E A;  3R1F A;  2PIJ A;  3GUU A;  3QWG A;  3GN5 A;  3QOX A;  2BNM A;  3UFD A;  2XIU A;  2L49 A;  1RIO A;  4IWR A;  3O9X A;  1EFA A;  1PRA A;  1UTX A;  1WIZ A;  2CRO A;  5JUW A;  2YBD A;  2KZ8 A;  3A9X A;  4PU8 A;  1QB2 A;  2PXD A;  2PXL A;  1ZUG A;  2IU7 A;  5DRT A;  5DRY A;  2WIU B;  4OB4 A;  2H8R A;  3QQ6 A;  2MEZ A;  1CJG A;  2ICT A;  2IV1 A;  1QP7 A;  3GN5 B;  3VWS A;  1JFS A;  2XXA A;  1MFQ C;  1ADR A;  4ER3 A;  3QYX A;  1LLI A;  2AXZ A;  2V3C C;  2A6C A;  4X4H A;  2L8N A;  3QFI A;  3QOW A;  2JQE A;  1IC8 A;  1GT0 C;  3IVP A;  3EUS A;  4Y42 A;  3A9Z A;  4I6T A;  1UXD A;  5A7L A;  2HCN A;  5K98 B;  2AW6 A;  3ZKC A;  1X2L A;  2OFY A;  3BDN A;  2PXF A;  1ZVV A;  4EQZ A;  1X57 A;  1LCC A;  1AU7 A;  1ZPQ A;  3LIS A;  4MCT A;  5DTQ A;  4ER5 A;  5GAG i;  1OSL A;  2HSG A;  2JVL A;  1Y7Y A;  2PXK A;  3OMT A;  4EK9 A;  1DW9 A;  1LCD A;  4YBA A;  2O49 A;  2HIN A;  4GQM A;  1QP4 A;  1VPW A;  5DTM A;  3OQO A;  3NRO A;  1R63 A;  3U3W A;  1DUL A;  4X4I A;  1ZS4 A;  4I6R A;  3HZI B;  5GAH i;  2B5A A;  2KEJ A;  3OQM A;  1RZS A;  1NEQ A;  4Z5H A;  3NXH A;  2PUE A;  2GRL A;  3ZPX A;  2GZU A;  1JH9 A;  3FYM A;  2AWI A;  4IA8 A;  1Y9Q A;  1PER L;  1E3O C;  1ZZ6 A;  2LLV A;  4JCY A;  3SR4 A;  3B7H A;  2PXP A;  1RZR A;  2BNO A;  2L1P A;  2LYR A;  4EKG A;  2IVG A;  1QPZ A;  2XSD C;  5DTR A;  2AUW A;  1JFT A;  4Z59 A;  1CQT A;  3OWQ A;  4ER0 A;  1ZZ7 A;  3BS3 A;  3ZHI A;  3R09 A;  4ER7 A;  1LMB 3;  2LYK A;  2HCS A;  2PXQ A;  2XXQ A;  1HQ1 A;  3G7D A;  4I6U A;  5DSX A;  3DM5 A;  3KJX A;  1UXC A;  4DE8 A;  1U2Z A;  4YAR A;  4GHJ A;  2PUF A;  4FBI A;  2M4H A;  4F8D A;  2VEO A;  3CRO L;  4OBM A;  4ER6 A;  4O8B A;  3KL4 A;  4Z5C A;  1S7E A;  1BDI A;  1JWL A;  3M9L A;  3NDB B;  2IUO A;  3PXP A;  2O38 A;  2BNN A;  2XCJ A;  2PUA A;  4YG7 B;  4DE9 A;  3TEL A;  3GZD C;  4WVL A;  2D5V A;  3F52 A;  2PXB A;  1QZX A;  2CSF A;  1PRU A;  2R1J L;  1BDH A;  4HRA A;  2LYJ A;  3SCG A;  1NER A;  2AXV A;  1PNR A;  3F6W A;  1WH6 A;  3JXB C;  4EKI A;  2XJ3 A;  2PPX A;  3UWP A;  2PUC A;  3GZD A;  1RZR D;  3OKZ A;  3G5G A;  1ZAY A;  4X4D A;  2GRM A;  4JCX A;  2FJR A;  4MCX A;  1NW3 A;  3L1P A;  4NDW A;  3RZZ A;  3CEC A;  5DT2 A; 
#chains in the Genus database with same CATH homology
 2KEI A;  1QP0 A;  2XSD C;  3OQN A;  1LLI A;  3SCH A;  4PU7 A;  2AXZ A;  4YG1 A;  2AUW A;  1JFT A;  1QQA A;  4Z59 A;  2A6C A;  1L1M A;  1CQT A;  1DWK A;  3MLF A;  3LFP A;  3S8Q A;  1ZZ7 A;  4X4H A;  1PRV A;  3BS3 A;  2OR1 L;  3ZHI A;  3BD1 A;  4YG4 A;  4J1W A;  2XI8 A;  2L8N A;  4J1X A;  1LMB 3;  4Z5D A;  2EBY A;  2LYS A;  2LYK A;  3JXC L;  1ZZB A;  1WH8 A;  3OP9 A;  3FYA A;  1ZZ8 A;  1IC8 A;  1GT0 C;  1R69 A;  3IVP A;  3EUS A;  4X4F A;  3KXA A;  3ZHM A;  1ZZC A;  3G7D A;  3SCF A;  4Y42 A;  1ZZ9 A;  4FN3 A;  4I6U A;  4I6T A;  3H5T A;  2LYP A;  3D1N I;  2LCV A;  1RPE L;  1UXD A;  5A7L A;  4X4E A;  3KJX A;  1UXC A;  5K98 B;  3DNV B;  2AW6 A;  3R1F A;  3ZKC A;  1OCT C;  1X2L A;  2IVB A;  2KPJ A;  2OFY A;  2PIJ A;  4YAR A;  4X4B A;  4GHJ A;  3BDN A;  2PE5 A;  2PUF A;  1ZVV A;  2IVQ A;  4FBI A;  4F8D A;  1LQC A;  1X57 A;  1LCC A;  3CRO L;  3QWG A;  1AU7 A;  3GN5 A;  1ZPQ A;  3CLC A;  3LIS A;  4MCT A;  1OSL A;  2BNM A;  2PUB A;  3UFD A;  2XIU A;  2HSG A;  2L49 A;  4O8B A;  4Z5C A;  2JVL A;  1S7E A;  1BDI A;  2ICP A;  1RIO A;  2PUD A;  1JWL A;  1POU A;  4I8T A;  1Y7Y A;  2JCG A;  1O4X A;  2EF8 A;  4IWR A;  1XWR A;  3OMT A;  2IUO A;  3O9X A;  1EFA A;  3PXP A;  1PRA A;  1DW9 A;  4X4C A;  1LCD A;  1UTX A;  1WIZ A;  4YBA A;  2O49 A;  2HIN A;  2O38 A;  4GQM A;  1QQB A;  2BNN A;  2CRO A;  1SQ8 A;  2XCJ A;  4X4G A;  1QP4 A;  4YG7 B;  2PUA A;  2PUG A;  1VPW A;  2KZ8 A;  2LYL A;  2BJC A;  4PU8 A;  4Z58 A;  1ZUG A;  2IU7 A;  2D5V A;  3F52 A;  2WIU B;  3QF3 A;  3OQO A;  4OB4 A;  2CSF A;  2H8R A;  1R63 A;  3U3W A;  3QQ6 A;  1WET A;  1PRU A;  2R1J L;  1BDH A;  3F51 A;  2MEZ A;  4PU4 C;  4X4I A;  1ZS4 A;  2LYJ A;  3SCG A;  1NER A;  2AXV A;  4I6R A;  3HZI B;  1PNR A;  1B0N A;  3F6W A;  1WH6 A;  2B5A A;  1CJG A;  2KEJ A;  2ICT A;  2IV1 A;  1QP7 A;  3GN5 B;  3JXB C;  3OQM A;  2XJ3 A;  2KEK A;  2PPX A;  4IVZ A;  2PUC A;  2O4A A;  1RZS A;  1HF0 A;  1NEQ A;  2R63 A;  4Z5H A;  1RZR D;  2MQK A;  1JFS A;  2PUE A;  2GRL A;  2GZU A;  1JH9 A;  3G5G A;  1ZAY A;  2EWT A;  3FYM A;  3VK0 A;  4X4D A;  2GRM A;  2AWI A;  3TRB A;  4JCX A;  2FJR A;  3GBF A;  4IA8 A;  1Y9Q A;  4MCX A;  2WUS R;  4PU3 C;  3L1P A;  1PER L;  1ADR A;  1E3O C;  3JXD L;  3KZ3 A;  1ZZ6 A;  4NDW A;  3RZZ A;  4JCY A;  3B7H A;  3FMY A;  1RZR A;  2BNO A;  3QYX A;  3CEC A;  4JQD A;  2LYR A;  2LYQ A;  2IVG A;  1QPZ A;  1YSE A;  2AXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...