4X4LA

Structure of human aldh1a1 with inhibitor cm037
Total Genus 186
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
186
sequence length
493
structure length
493
Chain Sequence
b'LPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLSDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Retinal dehydrogenase 1
publication title Characterization of Two Distinct Structural Classes of Selective Aldehyde Dehydrogenase 1A1 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 186
structure length 493
sequence length 493
ec nomenclature ec 1.2.1.36: Retinal dehydrogenase.
pdb deposition date 2014-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00171 Aldedh Aldehyde dehydrogenase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.309.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 2 Aldehyde Dehydrogenase; Chain A, domain 2 4x4lA02
3.40.605.10 Alpha Beta 3-Layer(aba) Sandwich Aldehyde Dehydrogenase; Chain A, domain 1 Aldehyde Dehydrogenase; Chain A, domain 1 4x4lA01
5EYUA 4ZVXA 1UXNA 1A4ZA 1UXVA 4I1WA 5KLKA 3SZ9A 4GHKA 1O02A 4I3WA 2BJAA 4QGKA 2ONOA 3N82A 4JZ6A 4GO4A 4GO0A 2O2RA 2ESDA 5L2OA 4I2RA 4LH1A 1BPWA 4NMKA 1UZBA 4NEAA 4PXLB 4IHIA 3V4CA 2IY6A 4WP7A 1UXUA 5ABMA 2J5NA 3RHLA 3V9HA 4X2QA 3K2WA 4MPYA 4PXLA 5DIBA 2EJ6A 1CW3A 1QI1A 2O2QA 5EEBA 4QN2A 1BXSA 4WJ9A 3VZ1A 4QF6A 4QETA 5J6BA 1AD3A 4FR8A 4LIHA 4I3XA 4IYMA 5DRUA 1BI9A 2WMEA 3R31A 2JG7A 3INLA 4OE5A 1AG8A 3QANA 3RHMA 5A2DA 1ZUMA 4O6RA 2W8OA 4JBEA 4OE4A 2HG2A 3RHRA 4I9BA 4GO2A 3SZAA 2OPXA 4H73A 2WOXA 3RHQA 4FQFA 4A0MA 4F3XA 4QJEB 1O9JA 5KJ5A 1QI6A 4ITAA 5KLLA 5L2MA 2EJLA 4PZ2A 3ETFA 4I26A 4OE6A 4QJEA 4YWEA 3RHJA 2ONNA 3ZQAA 3RHOA 1O04A 2EITA 2EIWA 4WPNA 4KNAA 3V9IA 3VZ0A 5EUYA 1UXQA 2VROA 3V9JA 4I3TA 5KLNA 2Y52A 3IWJA 3JU8A 4OE2A 4QTOA 5EXFA 4NPIA 1T90A 5AC0A 4V3FA 4I3UA 3RJLA 4GO3A 4ZWLA 3EFVA 5A2DC 1NZXA 3VZ3A 4K57A 4CBBA 3N81A 4YWVA 4X0TA 1UXPA 5A2DD 1UXTA 1UXRA 2EHQA 3VZ2A 2D4EA 3RHHA 2EHUA 2ONPA 3N80A 3PRLA 3EK1A 2BJKA 3N83A 5F2CA 1WNDA 5L2NA 4LGZA 1O20A 4ZXUA 5KLOA 4ZZ7A 4V37A 5JRYA 2IMPA 5DBVA 3V9GA 1NZZA 5EK6A 4Q92A 4LH3A 3RHDA 2BHPA 3ROSA 3SZBA 1EYYA 1WNBA 4X4LA 3R64A 4V3FC 1A4SA 5J78A 5AC1A 4E3XA 4IT9A 3JZ4A 4I8QA 5KLMA 3IWKA 2VLEA 4L2OA 4PXNA 5EKCA 1O01A 4CAZA 2XDRA 2Y53A 2H5GA 3RH9A 4ITBA 3U4JA 2W8RA 2WMEC 4ZVWA 4DNGA 4E4GA 1NZWA 2J40A 2ONMA 3PQAA 1EUHA 3V9LA 4I3VA 3TY7A 1VLUA 4LH2A 3K9DA 4KWGA 4IDMA 4L1OA 4I8PA 3I44A 4NS3A 2W8NA 2Y51A 4IDSA 4NU9A 4GNZA 5AC2A 4LEMA 4YWUA 1O05A 2EUHA 4LH0A 1EZ0A 4OHTA 4QYJA 2BHQA 2W8PA 4I25A 4H80A 4OUBA 4NMJA 4JDCA 2ID2A 2J6LA 3MY7A 5L13A 5EZ4A 5J7IA 4ZULA 4KWFA 5FHZA 3INJA 3B4WA 2O2PA 2QE0A 4WB9A 4ZUKA 1O00A 2Y5DA 4O5HA 2ILUA 4OU2A 4C3SA 4OGDA 1KY8A 2EIIA 4U3WA 4DALA 2EJDA 4MPBA 3V9KA 2W8QA 5KF0A 4X0UA 4H7NA 4ZVYA 3RHPA
chains in the Genus database with same CATH superfamily
5EYUA 4ZVXA 1UXNA 1A4ZA 1UXVA 4I1WA 5KLKA 3SZ9A 4GHKA 1O02A 4I3WA 2BJAA 4QGKA 2ONOA 3N82A 4JZ6A 4GO4A 4GO0A 2O2RA 2ESDA 5L2OA 4I2RA 4LH1A 1BPWA 4NMKA 1UZBA 4NEAA 4PXLB 4IHIA 3V4CA 2IY6A 4WP7A 1UXUA 5ABMA 2J5NA 3RHLA 3V9HA 4X2QA 3K2WA 4MPYA 4PXLA 5DIBA 2EJ6A 1CW3A 1QI1A 2O2QA 5EEBA 4QN2A 1BXSA 4WJ9A 3VZ1A 4QF6A 4QETA 5J6BA 1AD3A 4FR8A 4LIHA 4I3XA 4IYMA 5DRUA 1BI9A 2WMEA 3R31A 2JG7A 3INLA 4OE5A 1AG8A 3QANA 3RHMA 5A2DA 1ZUMA 4O6RA 2W8OA 4JBEA 4OE4A 2HG2A 3RHRA 4I9BA 4GO2A 3SZAA 2OPXA 4H73A 2WOXA 3RHQA 4FQFA 4A0MA 4F3XA 4QJEB 1O9JA 5KJ5A 1QI6A 4ITAA 5KLLA 5L2MA 2EJLA 4PZ2A 3ETFA 4I26A 4OE6A 4QJEA 4YWEA 3RHJA 2ONNA 3ZQAA 3RHOA 1O04A 2EITA 2EIWA 4WPNA 4KNAA 3V9IA 3VZ0A 5EUYA 1UXQA 2VROA 3V9JA 4I3TA 5KLNA 2Y52A 3IWJA 3JU8A 4OE2A 4QTOA 5EXFA 4NPIA 1T90A 5AC0A 4V3FA 4I3UA 3RJLA 4GO3A 4ZWLA 3EFVA 5A2DC 1NZXA 3VZ3A 4K57A 4CBBA 3N81A 4YWVA 4X0TA 1UXPA 5A2DD 1UXTA 1UXRA 2EHQA 3VZ2A 2D4EA 3RHHA 2EHUA 2ONPA 3N80A 3PRLA 3EK1A 2BJKA 3N83A 5F2CA 1WNDA 5L2NA 4LGZA 1O20A 4ZXUA 5KLOA 4ZZ7A 4V37A 5JRYA 2IMPA 5DBVA 3V9GA 1NZZA 5EK6A 4Q92A 4LH3A 3RHDA 2BHPA 3ROSA 3SZBA 1EYYA 1WNBA 4X4LA 3R64A 4V3FC 1A4SA 5J78A 5AC1A 4E3XA 4IT9A 3JZ4A 4I8QA 5KLMA 3IWKA 2VLEA 4L2OA 4PXNA 5EKCA 1O01A 4CAZA 2XDRA 2Y53A 2H5GA 3RH9A 4ITBA 3U4JA 2W8RA 2WMEC 4ZVWA 4DNGA 4E4GA 1NZWA 2J40A 2ONMA 3PQAA 1EUHA 3V9LA 4I3VA 3TY7A 1VLUA 4LH2A 3K9DA 4KWGA 4IDMA 4L1OA 4I8PA 3I44A 4NS3A 2W8NA 2Y51A 4IDSA 4NU9A 4GNZA 5AC2A 4LEMA 4YWUA 1O05A 2EUHA 4LH0A 1EZ0A 4OHTA 4QYJA 2BHQA 2W8PA 4I25A 4H80A 4OUBA 4NMJA 4JDCA 2ID2A 2J6LA 3MY7A 5L13A 5EZ4A 5J7IA 4ZULA 4KWFA 5FHZA 3INJA 3B4WA 2O2PA 2QE0A 4WB9A 4ZUKA 1O00A 2Y5DA 4O5HA 2ILUA 4OU2A 4C3SA 4OGDA 1KY8A 2EIIA 4U3WA 4DALA 2EJDA 4MPBA 3V9KA 2W8QA 5KF0A 4X0UA 4H7NA 4ZVYA 3RHPA
chains in the Genus database with same CATH topology
5EYUA 4ZVXA 1UXNA 1A4ZA 1UXVA 4I1WA 5KLKA 3SZ9A 4GHKA 1O02A 4I3WA 2BJAA 4QGKA 2ONOA 3N82A 4JZ6A 4GO4A 4GO0A 2O2RA 2ESDA 5L2OA 4I2RA 4LH1A 1BPWA 4NMKA 1UZBA 4NEAA 4PXLB 4IHIA 3V4CA 2IY6A 4WP7A 1UXUA 5ABMA 2J5NA 3RHLA 3V9HA 4X2QA 3K2WA 4MPYA 4PXLA 5DIBA 2EJ6A 1CW3A 1QI1A 2O2QA 5EEBA 4QN2A 1BXSA 4WJ9A 3VZ1A 4QF6A 4QETA 5J6BA 1AD3A 4FR8A 4LIHA 4I3XA 4IYMA 5DRUA 1BI9A 2WMEA 3R31A 2JG7A 3INLA 4OE5A 1AG8A 3QANA 3RHMA 5A2DA 1ZUMA 4O6RA 2W8OA 4JBEA 4OE4A 2HG2A 3RHRA 4I9BA 4GO2A 3SZAA 2OPXA 4H73A 2WOXA 3RHQA 4FQFA 4A0MA 4F3XA 4QJEB 1O9JA 5KJ5A 1QI6A 4ITAA 5KLLA 5L2MA 2EJLA 4PZ2A 3ETFA 4I26A 4OE6A 4QJEA 4YWEA 3RHJA 2ONNA 3ZQAA 3RHOA 1O04A 2EITA 2EIWA 4WPNA 4KNAA 3V9IA 3VZ0A 5EUYA 1UXQA 2VROA 3V9JA 4I3TA 5KLNA 2Y52A 3IWJA 3JU8A 4OE2A 4QTOA 5EXFA 4NPIA 1T90A 5AC0A 4V3FA 4I3UA 3RJLA 4GO3A 4ZWLA 3EFVA 5A2DC 1NZXA 3VZ3A 4K57A 4CBBA 3N81A 4YWVA 4X0TA 1UXPA 5A2DD 1UXTA 1UXRA 2EHQA 3VZ2A 2D4EA 3RHHA 2EHUA 2ONPA 3N80A 3PRLA 3EK1A 2BJKA 3N83A 5F2CA 1WNDA 5L2NA 4LGZA 1O20A 4ZXUA 5KLOA 4ZZ7A 4V37A 5JRYA 2IMPA 5DBVA 3V9GA 1NZZA 5EK6A 4Q92A 4LH3A 3RHDA 2BHPA 3ROSA 3SZBA 1EYYA 1WNBA 4X4LA 3R64A 4V3FC 1A4SA 5J78A 5AC1A 4E3XA 4IT9A 3JZ4A 4I8QA 5KLMA 3IWKA 2VLEA 4L2OA 4PXNA 5EKCA 1O01A 4CAZA 2XDRA 2Y53A 2H5GA 3RH9A 4ITBA 3U4JA 2W8RA 2WMEC 4ZVWA 4DNGA 4E4GA 1NZWA 2J40A 2ONMA 3PQAA 1EUHA 3V9LA 4I3VA 3TY7A 1VLUA 4LH2A 3K9DA 4KWGA 4IDMA 4L1OA 4I8PA 3I44A 4NS3A 2W8NA 2Y51A 4IDSA 4NU9A 4GNZA 5AC2A 4LEMA 4YWUA 1O05A 2EUHA 4LH0A 1EZ0A 4OHTA 4QYJA 2BHQA 2W8PA 4I25A 4H80A 4OUBA 4NMJA 4JDCA 2ID2A 2J6LA 3MY7A 5L13A 5EZ4A 5J7IA 4ZULA 4KWFA 5FHZA 3INJA 3B4WA 2O2PA 2QE0A 4WB9A 4ZUKA 1O00A 2Y5DA 4O5HA 2ILUA 4OU2A 4C3SA 4OGDA 1KY8A 2EIIA 4U3WA 4DALA 2EJDA 4MPBA 3V9KA 2W8QA 5KF0A 4X0UA 4H7NA 4ZVYA 3RHPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EYU A;  4ZVX A;  1UXN A;  1A4Z A;  1UXV A;  4I1W A;  5KLK A;  3SZ9 A;  4GHK A;  1O02 A;  4I3W A;  2BJA A;  4QGK A;  2ONO A;  3N82 A;  4JZ6 A;  4GO4 A;  4GO0 A;  2O2R A;  2ESD A;  5L2O A;  4I2R A;  4LH1 A;  1BPW A;  4NMK A;  1UZB A;  4NEA A;  4PXL B;  4IHI A;  3V4C A;  2IY6 A;  4WP7 A;  1UXU A;  5ABM A;  2J5N A;  3RHL A;  3V9H A;  4X2Q A;  3K2W A;  4MPY A;  4PXL A;  5DIB A;  2EJ6 A;  1CW3 A;  1QI1 A;  2O2Q A;  5EEB A;  4QN2 A;  1BXS A;  4WJ9 A;  3VZ1 A;  4QF6 A;  4QET A;  5J6B A;  1AD3 A;  4FR8 A;  4LIH A;  4I3X A;  4IYM A;  5DRU A;  1BI9 A;  2WME A;  3R31 A;  2JG7 A;  3INL A;  4OE5 A;  1AG8 A;  3QAN A;  3RHM A;  5A2D A;  1ZUM A;  4O6R A;  2W8O A;  4JBE A;  4OE4 A;  2HG2 A;  3RHR A;  4I9B A;  4GO2 A;  3SZA A;  2OPX A;  4H73 A;  2WOX A;  3RHQ A;  4FQF A;  4A0M A;  4F3X A;  4QJE B;  1O9J A;  5KJ5 A;  1QI6 A;  4ITA A;  5KLL A;  5L2M A;  2EJL A;  4PZ2 A;  3ETF A;  4I26 A;  4OE6 A;  4QJE A;  4YWE A;  3RHJ A;  2ONN A;  3ZQA A;  3RHO A;  1O04 A;  2EIT A;  2EIW A;  4WPN A;  4KNA A;  3V9I A;  3VZ0 A;  5EUY A;  1UXQ A;  2VRO A;  3V9J A;  4I3T A;  5KLN A;  2Y52 A;  3IWJ A;  3JU8 A;  4OE2 A;  4QTO A;  5EXF A;  4NPI A;  1T90 A;  5AC0 A;  4V3F A;  4I3U A;  3RJL A;  4GO3 A;  4ZWL A;  3EFV A;  5A2D C;  1NZX A;  3VZ3 A;  4K57 A;  4CBB A;  3N81 A;  4YWV A;  4X0T A;  1UXP A;  5A2D D;  1UXT A;  1UXR A;  2EHQ A;  3VZ2 A;  2D4E A;  3RHH A;  2EHU A;  2ONP A;  3N80 A;  3PRL A;  3EK1 A;  2BJK A;  3N83 A;  5F2C A;  1WND A;  5L2N A;  4LGZ A;  1O20 A;  4ZXU A;  5KLO A;  4ZZ7 A;  4V37 A;  5JRY A;  2IMP A;  5DBV A;  3V9G A;  1NZZ A;  5EK6 A;  4Q92 A;  4LH3 A;  3RHD A;  2BHP A;  3ROS A;  3SZB A;  1EYY A;  1WNB A;  4X4L A;  3R64 A;  4V3F C;  1A4S A;  5J78 A;  5AC1 A;  4E3X A;  4IT9 A;  3JZ4 A;  4I8Q A;  5KLM A;  3IWK A;  2VLE A;  4L2O A;  4PXN A;  5EKC A;  1O01 A;  4CAZ A;  2XDR A;  2Y53 A;  2H5G A;  3RH9 A;  4ITB A;  3U4J A;  2W8R A;  2WME C;  4ZVW A;  4DNG A;  4E4G A;  1NZW A;  2J40 A;  2ONM A;  3PQA A;  1EUH A;  3V9L A;  4I3V A;  3TY7 A;  1VLU A;  4LH2 A;  3K9D A;  4KWG A;  4IDM A;  4L1O A;  4I8P A;  3I44 A;  4NS3 A;  2W8N A;  2Y51 A;  4IDS A;  4NU9 A;  4GNZ A;  5AC2 A;  4LEM A;  4YWU A;  1O05 A;  2EUH A;  4LH0 A;  1EZ0 A;  4OHT A;  4QYJ A;  2BHQ A;  2W8P A;  4I25 A;  4H80 A;  4OUB A;  4NMJ A;  4JDC A;  2ID2 A;  2J6L A;  3MY7 A;  5L13 A;  5EZ4 A;  5J7I A;  4ZUL A;  4KWF A;  5FHZ A;  3INJ A;  3B4W A;  2O2P A;  2QE0 A;  4WB9 A;  4ZUK A;  1O00 A;  2Y5D A;  4O5H A;  2ILU A;  4OU2 A;  4C3S A;  4OGD A;  1KY8 A;  2EII A;  4U3W A;  4DAL A;  2EJD A;  4MPB A;  3V9K A;  2W8Q A;  5KF0 A;  4X0U A;  4H7N A;  4ZVY A;  3RHP A; 
#chains in the Genus database with same CATH topology
 5EYU A;  4ZVX A;  1UXN A;  1A4Z A;  1UXV A;  4I1W A;  5KLK A;  3SZ9 A;  4GHK A;  1O02 A;  4I3W A;  2BJA A;  4QGK A;  2ONO A;  3N82 A;  4JZ6 A;  4GO4 A;  4GO0 A;  2O2R A;  2ESD A;  5L2O A;  4I2R A;  4LH1 A;  1BPW A;  4NMK A;  1UZB A;  4NEA A;  4PXL B;  4IHI A;  3V4C A;  2IY6 A;  4WP7 A;  1UXU A;  5ABM A;  2J5N A;  3RHL A;  3V9H A;  4X2Q A;  3K2W A;  4MPY A;  4PXL A;  5DIB A;  2EJ6 A;  1CW3 A;  1QI1 A;  2O2Q A;  5EEB A;  4QN2 A;  1BXS A;  4WJ9 A;  3VZ1 A;  4QF6 A;  4QET A;  5J6B A;  1AD3 A;  4FR8 A;  4LIH A;  4I3X A;  4IYM A;  5DRU A;  1BI9 A;  2WME A;  3R31 A;  2JG7 A;  3INL A;  4OE5 A;  1AG8 A;  3QAN A;  3RHM A;  5A2D A;  1ZUM A;  4O6R A;  2W8O A;  4JBE A;  4OE4 A;  2HG2 A;  3RHR A;  4I9B A;  4GO2 A;  3SZA A;  2OPX A;  4H73 A;  2WOX A;  3RHQ A;  4FQF A;  4A0M A;  4F3X A;  4QJE B;  1O9J A;  5KJ5 A;  1QI6 A;  4ITA A;  5KLL A;  5L2M A;  2EJL A;  4PZ2 A;  3ETF A;  4I26 A;  4OE6 A;  4QJE A;  4YWE A;  3RHJ A;  2ONN A;  3ZQA A;  3RHO A;  1O04 A;  2EIT A;  2EIW A;  4WPN A;  4KNA A;  3V9I A;  3VZ0 A;  5EUY A;  1UXQ A;  2VRO A;  3V9J A;  4I3T A;  5KLN A;  2Y52 A;  3IWJ A;  3JU8 A;  4OE2 A;  4QTO A;  5EXF A;  4NPI A;  1T90 A;  5AC0 A;  4V3F A;  4I3U A;  3RJL A;  4GO3 A;  4ZWL A;  3EFV A;  5A2D C;  1NZX A;  3VZ3 A;  4K57 A;  4CBB A;  3N81 A;  4YWV A;  4X0T A;  1UXP A;  5A2D D;  1UXT A;  1UXR A;  2EHQ A;  3VZ2 A;  2D4E A;  3RHH A;  2EHU A;  2ONP A;  3N80 A;  3PRL A;  3EK1 A;  2BJK A;  3N83 A;  5F2C A;  1WND A;  5L2N A;  4LGZ A;  1O20 A;  4ZXU A;  5KLO A;  4ZZ7 A;  4V37 A;  5JRY A;  2IMP A;  5DBV A;  3V9G A;  1NZZ A;  5EK6 A;  4Q92 A;  4LH3 A;  3RHD A;  2BHP A;  3ROS A;  3SZB A;  1EYY A;  1WNB A;  4X4L A;  3R64 A;  4V3F C;  1A4S A;  5J78 A;  5AC1 A;  4E3X A;  4IT9 A;  3JZ4 A;  4I8Q A;  5KLM A;  3IWK A;  2VLE A;  4L2O A;  4PXN A;  5EKC A;  1O01 A;  4CAZ A;  2XDR A;  2Y53 A;  2H5G A;  3RH9 A;  4ITB A;  3U4J A;  2W8R A;  2WME C;  4ZVW A;  4DNG A;  4E4G A;  1NZW A;  2J40 A;  2ONM A;  3PQA A;  1EUH A;  3V9L A;  4I3V A;  3TY7 A;  1VLU A;  4LH2 A;  3K9D A;  4KWG A;  4IDM A;  4L1O A;  4I8P A;  3I44 A;  4NS3 A;  2W8N A;  2Y51 A;  4IDS A;  4NU9 A;  4GNZ A;  5AC2 A;  4LEM A;  4YWU A;  1O05 A;  2EUH A;  4LH0 A;  1EZ0 A;  4OHT A;  4QYJ A;  2BHQ A;  2W8P A;  4I25 A;  4H80 A;  4OUB A;  4NMJ A;  4JDC A;  2ID2 A;  2J6L A;  3MY7 A;  5L13 A;  5EZ4 A;  5J7I A;  4ZUL A;  4KWF A;  5FHZ A;  3INJ A;  3B4W A;  2O2P A;  2QE0 A;  4WB9 A;  4ZUK A;  1O00 A;  2Y5D A;  4O5H A;  2ILU A;  4OU2 A;  4C3S A;  4OGD A;  1KY8 A;  2EII A;  4U3W A;  4DAL A;  2EJD A;  4MPB A;  3V9K A;  2W8Q A;  5KF0 A;  4X0U A;  4H7N A;  4ZVY A;  3RHP A; 
#chains in the Genus database with same CATH homology
 5EYU A;  4ZVX A;  1UXN A;  1A4Z A;  1UXV A;  4I1W A;  5KLK A;  3SZ9 A;  4GHK A;  1O02 A;  4I3W A;  2BJA A;  4QGK A;  2ONO A;  3N82 A;  4JZ6 A;  4GO4 A;  4GO0 A;  2O2R A;  2ESD A;  5L2O A;  4I2R A;  4LH1 A;  1BPW A;  4NMK A;  1UZB A;  4NEA A;  4PXL B;  4IHI A;  3V4C A;  2IY6 A;  4WP7 A;  1UXU A;  5ABM A;  2J5N A;  3RHL A;  3V9H A;  4X2Q A;  3K2W A;  4MPY A;  4PXL A;  5DIB A;  2EJ6 A;  1CW3 A;  1QI1 A;  2O2Q A;  5EEB A;  4QN2 A;  1BXS A;  4WJ9 A;  3VZ1 A;  4QF6 A;  4QET A;  5J6B A;  1AD3 A;  4FR8 A;  4LIH A;  4I3X A;  4IYM A;  5DRU A;  1BI9 A;  2WME A;  3R31 A;  2JG7 A;  3INL A;  4OE5 A;  1AG8 A;  3QAN A;  3RHM A;  5A2D A;  1ZUM A;  4O6R A;  2W8O A;  4JBE A;  4OE4 A;  2HG2 A;  3RHR A;  4I9B A;  4GO2 A;  3SZA A;  2OPX A;  4H73 A;  2WOX A;  3RHQ A;  4FQF A;  4A0M A;  4F3X A;  4QJE B;  1O9J A;  5KJ5 A;  1QI6 A;  4ITA A;  5KLL A;  5L2M A;  2EJL A;  4PZ2 A;  3ETF A;  4I26 A;  4OE6 A;  4QJE A;  4YWE A;  3RHJ A;  2ONN A;  3ZQA A;  3RHO A;  1O04 A;  2EIT A;  2EIW A;  4WPN A;  4KNA A;  3V9I A;  3VZ0 A;  5EUY A;  1UXQ A;  2VRO A;  3V9J A;  4I3T A;  5KLN A;  2Y52 A;  3IWJ A;  3JU8 A;  4OE2 A;  4QTO A;  5EXF A;  4NPI A;  1T90 A;  5AC0 A;  4V3F A;  4I3U A;  3RJL A;  4GO3 A;  4ZWL A;  3EFV A;  5A2D C;  1NZX A;  3VZ3 A;  4K57 A;  4CBB A;  3N81 A;  4YWV A;  4X0T A;  1UXP A;  5A2D D;  1UXT A;  1UXR A;  2EHQ A;  3VZ2 A;  2D4E A;  3RHH A;  2EHU A;  2ONP A;  3N80 A;  3PRL A;  3EK1 A;  2BJK A;  3N83 A;  5F2C A;  1WND A;  5L2N A;  4LGZ A;  1O20 A;  4ZXU A;  5KLO A;  4ZZ7 A;  4V37 A;  5JRY A;  2IMP A;  5DBV A;  3V9G A;  1NZZ A;  5EK6 A;  4Q92 A;  4LH3 A;  3RHD A;  2BHP A;  3ROS A;  3SZB A;  1EYY A;  1WNB A;  4X4L A;  3R64 A;  4V3F C;  1A4S A;  5J78 A;  5AC1 A;  4E3X A;  4IT9 A;  3JZ4 A;  4I8Q A;  5KLM A;  3IWK A;  2VLE A;  4L2O A;  4PXN A;  5EKC A;  1O01 A;  4CAZ A;  2XDR A;  2Y53 A;  2H5G A;  3RH9 A;  4ITB A;  3U4J A;  2W8R A;  2WME C;  4ZVW A;  4DNG A;  4E4G A;  1NZW A;  2J40 A;  2ONM A;  3PQA A;  1EUH A;  3V9L A;  4I3V A;  3TY7 A;  1VLU A;  4LH2 A;  3K9D A;  4KWG A;  4IDM A;  4L1O A;  4I8P A;  3I44 A;  4NS3 A;  2W8N A;  2Y51 A;  4IDS A;  4NU9 A;  4GNZ A;  5AC2 A;  4LEM A;  4YWU A;  1O05 A;  2EUH A;  4LH0 A;  1EZ0 A;  4OHT A;  4QYJ A;  2BHQ A;  2W8P A;  4I25 A;  4H80 A;  4OUB A;  4NMJ A;  4JDC A;  2ID2 A;  2J6L A;  3MY7 A;  5L13 A;  5EZ4 A;  5J7I A;  4ZUL A;  4KWF A;  5FHZ A;  3INJ A;  3B4W A;  2O2P A;  2QE0 A;  4WB9 A;  4ZUK A;  1O00 A;  2Y5D A;  4O5H A;  2ILU A;  4OU2 A;  4C3S A;  4OGD A;  1KY8 A;  2EII A;  4U3W A;  4DAL A;  2EJD A;  4MPB A;  3V9K A;  2W8Q A;  5KF0 A;  4X0U A;  4H7N A;  4ZVY A;  3RHP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...