4X4ZA

Retrofitting antibodies with stabilizing mutations. herceptin vl mutant f53d.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
IQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASDLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retrofitting antibodies with stabilizing mutations
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Herceptin VL domain with F53D mutation
total genus 25
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x4zA00
4UV7L 2APWA 3W82A 4WEBH 5IK3B 4NO3A 5DRXB 5KSAB 1NAMA 2CKBB 1D5MB 3BH9A 3QQ9C 5JPMA 1KCUL 3CSBA 4HK3J 3IDGA 4U1HB 3L3HB 1JJUA 2F54B 1QYGL 3KPRB 5DJZB 2ZCHH 4Y16B 5A2IH 1U58B 4TVSa 3ZHKA 2HTKD 1FGNH 1DJSA 4LSTH 3WJLC 1KGCE 2VDPH 4HCRH 3DYOA 4XGZA 5DRNB 4JJ5B 5F1SA 1U0QA 3OKOA 5D7KE 1D6EB 2QHRL 4QWWD 3SE3C 3RA7H 1NUFA 5BZWB 4OCSH 4D2NA 5L9DH 2DD8H 3BJLA 4PJ5B 4YHNA 3EO1A 4IHOA 5F88A 2PUQT 1WQVT 2NY5L 5JO5B 4L8BB 5HDQL 4QRPB 3DV6B 1TDQA 4X7TA 2XG4A 1YQVH 1M7DB 2BNQB 3IXAB 2IQAB 1JGUL 3WFDL 2R2CA 4AH2B 3IFNH 1IC7L 4FXLA 4L9LA 3QJFB 4X9IA 2QLVB 4KVNL 5EZOL 2X7LA 3S37L 1HYSD 3RWHA 1X5HA 5LCVH 3HLAB 4NBZB 1U3ZA 3FT3B 3LCYA 3RGVB 2DLIA 3CC5B 3RX8A 3EO9L 3NCJL 1NCDH 3L7FA 3IAPA 4L5FH 1YEJL 3K0WA 2NY2C 2BK8A 3HNTH 5DFVC 4EN3B 4X4ZA 4JY5H 3VXOB 1UQSA 3O6KL 3NGBC 2QJDA 1P7QB 1YY8A 5DRNA 3GSXB 3V4UL 1CD1B 5GRVK 1H15A 4KKCC 4HUWA 5A16B 4P9ML 3E0GA 5IJKC 3BRGC 5FO7A 1ZLSL 4O2CB 5I1CL 3MGOB 4JO3L 5D7LB 3TNNA 2X70B 4KTDH 5F3BA 1UWXK 3TLRA 1VSCA 3PWPE 4GW1B 4LIQE 2IADB 3T3ME 3DUSA 1EGJL 2BVOB 4JG0H 4PJHF 4YC2B 1S5HA 3UYRH 1DVFD 5C8JB 3LH2H 5EO1A 1MI5B 4JM2B 5HYQA 1WBYB 2FLBT 3FKUS 5FYJH 4U1JB 3BZ4A 5K9KB 2J8UF 5E2UL 4F9PA 2XQBH 3S88H 1R3LA 3EJZC 4N9GA 3I3EA 5D1XD 3C6SA 5JW4M 2ARJA 4LP5A 2HVJB 3MCKB 3FT3A 3RGVA 1JZ2A 4X99A 4DUXA 3U7WL 3PGCA 1MH5B 1FZKA 1JNLH 3R06B 4MS8C 5FYKU 5M7QA 4N90D 4HPYL 4M6OH 5DRWB 1HINL 2R23B 4R7DA 1H3GA 4ERSH 2OK0L 1MRDL 1N6VA 4EI6A 3HAEH 3PGFH 4PJAB 4TQEL 4YHIB 3VFPB 3DV6A 2EO9A 2VXUL 3VRIA 3O4OB 4MSWB 2J8UA 5BQ7B 5I30L 3K46A 3P73A 4MAYA 3W2DH 4OZHF 1GAFL 1H15B 5DD1H 2DN7A 3DURB 4XC1H 1ADQL 4JRXE 4UUJB 5FGCE 5ICXB 3D87B 1Q8MA 4PPTA 3H9SD 4IMKA 4R4ND 1OOAA 5I74C 1EO5A 1U8HB 3WIIL 1RUQH 3JV4A 2FB4H 1L9MA 3MJ9A 3CH1A 1AQKH 4H8WL 4LIQH 5FECA 2D2OA 2NZIA 1AXTL 3DVNA 4R2GC 4JM2A 5HYQB 1YMMA 5DMJB 5DUBA 5ILTH 1U8NB 4HH9A 4H5SB 2ARJQ 2X89D 1JGVL 4U1GB 5F7FA 1QBAA 4H1LG 2NY6B 4D9LL 4I5BB 4PJXB 5EU6B 4Y1AA 3HZKA 1F3JB 3CVIL 3UTTB 4P3DB 1J05B 1TJGH 4XNZB 3LOWA 3GK8L 1J0JA 4HUWB 4G8IB 3ISWA 4N0CD 5C0RH 1WFTA 5TE7L 1AKJA 1BMGA 5EU4B 2BERA 4EI5C 1Z6JT 2Y36H 3RVXC 1TQBB 2YD3A 2XG5A 4MZ3A 2HH0L 3TNNB 4PTTB 1G7LB 4KJPC 5L6YL 3RRQA 3WNMA 4AT6A 1G6VK 3O45B 1J86A 3D18B 2OXHA 3VXSA 2D4FA 1DBBH 1JHLH 1QD0A 3OSKA 2ZUSA 3PXJA 3TWCH 1GC1H 4A2LA 4OZFH 4JKPH 1TLKA 5CSZB 3HFMH 7FABL 5CMAA 3O11A 1S3KL 3C2AH 3TT3L 3QNXA 1ZHNB 2J1KA 3I75A 2OTWA 5DMGC 3M1BA 1YUHB 3R0NA 3TCLA 5HYSB 3NZ8B 1BQHB 1TZIA 3BVNA 3ES6B 2Y4SA 4MDJA 2WBJB 4NHUA 4LNRA 2WW8A 3EOAA 3DJ9A 5DDHB 4PV9A 5F7DA 3P30L 1IZJA 1HSAA 1FN4A 1KTLA 4RRPG 1K85A 3G6JF 5CSGA 2Q20A 5ICZA 1AO7A 3VGGA 2MNUA 1JRHL 3W5NA 1T0MB 1UXSB 1JWSA 32C2B 4PJIE 1QSED 3BIKB 4HKBA 3G6AB 4MZ2A 4R2GB 2ERJB 3CAFA 4GRLC 1R6VA 4MD4B 2NX5D 4YZFF 4H1LA 4UOJA 5MENA 3UDWC 3QFJA 4P2QA 4ZSOE 3RTQB 4YR6B 4X6CE 3THML 1NBZA 2WIIA 1MCPL 1KPRB 2J6EL 4WUUB 2UVEA 1MAKA 5T3ZH 3Q1SH 4NBXB 3L7EB 2BDNL 2HWZL 4ZUWB 4HW6A 2QR0B 5IFAH 1ZKAA 4P4KD 4WO4C 1FLRL 3OKEA 4QGTA 4X6CA 1U93A 3F62A 5J1AA 4Y89A 2P7TB 4JKLA 4NSKB 4MA1C 3QUZD 3NA4A 2VLLA 1HHGB 3HC3H 2H6PA 1DBML 3OKYA 4JO4H 3X17A 3HI1B 3KPOA 4ISVA 2YN5A 5HHOD 4XPGH 4EVNA 3MR9B 4HWBL 5HI3C 4KC3B 3MXVH 3OKMB 4UINL 4LMQI 5D9SB 2MQCA 1UT9A 2VZ1A 5HGAB 2D03L 4TSCL 3T3PE 5F9DC 1U8KA 4FQPA 4OLEA 1AO7E 1LEGB 3EZ8A 4LLVB 4YDLC 4PJ7F 4G8GE 3V79C 4R7NA 4BFGA 3O3AB 2P5WD 1Q0YL 5E00A 5DJAB 3IU4L 5KVDH 4PJFF 4R4NC 2DQFA 5H94A 4U31A 3GHEH 4L3EA 5GHWL 1AP2B 1MRCH 3QWRD 4NWTL 4FQHB 4J3XA 5J9PB 1XR9B 2C5DC 1RSFA 2MOVA 2A6DA 3BW9B 3TYFA 3DNKA 3ES6A 5DEGB 4HJGB 2ATKB 1PSKH 2GTZB 5E2WH 3PNWA 3VGFA 2FSEB 2NW2B 4QEGA 1MLCB 4XCYB 5GGSY 5D2LE 3V6OC 2FR4B 5FKAB 1BFOB 3PF2A 1F4XL 1NKOA 2NX5B 1VFOA 3BP4A 1WJ3A 1G7MA 1NKRA 3GGWB 3R0MA 4PJ5E 4JPIA 3LIZH 5E56A 2K9UA 1TCRA 4P5TB 1LE5A 2VSDA 1J12A 4UQ3B 1FC1A 2EYTA 1KT2B 2D0GA 1H0DA 2EDEA 4GOSA 1IGFH 2E7LA 3B2UC 1LO2L 5CJBA 5KVDL 4HK0A 3V6ZA 1SMAA 3KPSA 4HUMB 4P9HL 2AQ1A 2ID5A 4L4TB 3PP4L 2NZ9D 2OTWB 3OAUH 4GG8B 5SWZA 4GLRI 3VA6A 5JNYA 2FHFA 4OGYL 1HQ4B 4LQFH 2KDGA 1F8TL 4E0RB 4OT1L 2VDOL 3D85A 1A6ZB 3MJ7A 3QPXH 4ONHA 1UQSB 1HHGA 5ESVA 5KVFH 2I9LB 3I6KA 3BZDA 3CFKA 4OBRA 1AIFB 4ZFGH 1CN4A 2Q8AL 4XNMA 2CLRB 4WFED 2N1KA 2YUXA 4ZFFB 4WV1C 2ICWA 5EZOH 1ND0A 2A73A 1OAYL 2NY1D 5C9JA 3BDBA 3TBWB 3DUSB 5IV2A 4NRYA 3O3AA 1QHPA 4HIJB 3NACL 2ZPKL 3GJFB 3MV7A 4HWEL 4ENED 4GJTB 4QHNB 3W0WA 2VC2L 1RV6X 1B0GA 4TTDD 1FG2B 4R96B 4ZS6C 1HI6A 1P7HL 4EDXB 2YUVA 3H9SE 1HHHB 1UCBH 1KJMB 1IQDA 2OI9B 1OVZA 1HHJB 4JZOA 4KKBD 2DMBA 4ODVL 4YO0B 3U0TB 3K80A 4OCLC 4KK6D 3PGCB 3QI9D 2L7UA 4UTAH 3BYTA 25C8L 2B1HH 2ENSA 1MQ8A 3CFBA 1SY6A 1TIUA 1IEHA 2GSIA 4PS4L 3TBVA 1KJVB 5E8DH 1AGFB 1MLBB 2WV3A 1BREA 3L3OB 3UTQB 1MFBL 4U0RB 1N0XH 4UQ3A 4QGYA 4ZQKA 2CLZA 3G5YA 4P5KA 5CJOH 3MLWH 5T3ZD 2AXFB 1KIRB 1OP5H 5F6IB 3EYQC 4RGNC 1GIGL 2ZG1A 2WUBH 4GW1A 4IOFC 5DHYB 3QI9A 5CILH 5DD3L 5SWQA 1A3QA 5J0BA 1TZHB 2DLFH 2GK2A 4X7SL 5IB2A 2ZWLT 3LDBC 1ORQB 4RMWA 1Q1JL 1WISA 4KRPD 5ERWA 4FQ2H 3QO0A 2RFXB 4NN5B 5EU7C 3JVGA 1WWWX 3TO4B 4HGWB 1V7NL 5DWUH 2XWBA 1NANI 5HYFA 4G6JH 3REVA 1XF5B 3I50H 4E0RA 4ETQA 4RAHA 1DVFB 4NN7C 2Z93B 3QNYA 5DK0B 2W65A 1KJMA 3PGFL 4JZNA 5CBAA 5I8CB 1V7MH 5CLTA 5DI8B 5D7LD 5E6IC 4UT6H 5D6CA 4FZEL 1CD0A 5DJYB 4FP8H 2XTJD 2O5YL 2RCSH 4P2RE 5EN2B 2G2RB 1NEZB 3S97C 3UZVB 4NJAL 3E3QC 4F7PB 2C1OA 4DGYL 4PRIB 3VE0A 2AK4E 2R0LL 4NQXA 4QRTB 4PLJC 4KJWC 3QXAA 4LSQL 4APQB 2C7UA 1CXKA 1PYWB 5I1GL 2EICA 1ZT7B 1I3UA 5HYJA 1QSEB 4LRNH 1T21A 3DVGA 3LQAC 1KBGL 4X6DA 3PQYB 1RUQL 5FV2A 3KNBB 3FO1B 2V17L 1HHJA 5C08A 1K6QL 3HR6A 5GS2D 3T2OA 5HDLA 2F54A 1VPOH 4PJ8A 2VXTH 3CX5K 1AC6A 3WFHB 1AH1A 1WFNA 4QHKJ 2NCMA 5IMMB 3VXNA 3KYAA 5C07D 5J6GB 4LCCA 4KRNA 2J4WL 4WU5A 3MRBA 2UZIH 1XIWD 3I6GB 3VFOA 1CDJA 1NGWB 4G43A 2F74A 4FHBD 3RWDB 4RBPH 3SCMA 2X40A 1KIQB 4RRPA 1CTOA 2FO4B 5E7BA 1MFCL 1RUML 2VE6B 4NQSB 4XPAH 2DBJA 2A6JA 2X1XR 2VXQH 1IVLA 2PCPA 3PIQB 3QDMA 4LSPL 3G6AA 1MOEA 1QBLH 4K94C 3C09C 3O3BB 5F96H 2C1PA 2RQ8A 3C8KB 4OV5B 4HIHB 5HHNA 4M5ZH 4M7JH 3GSNB 5A3IC 4PJXF 4PJ5D 4N0UE 1OT2A 4R6UA 5IOPA 1JNNH 4TVPH 3L3GA 1F4YH 4X98B 2MSPA 5SWSD 1CBVH 1A3RH 1CR9L 1HN1A 2VKWA 4GRLB 1T21B 3U2SB 3FN0L 4LASL 3FOMB 3EUUA 1CL7I 3CH8A 3T0EB 2CUIA 3FQXA 5DMIH 4LEXH 3L3HA 1GH7A 3CNKA 3Q3GA 3U7WH 4R97B 4KKLD 3TN0A 2ORBL 4XWGL 4JVUA 5FKPB 4GKSB 4QF1B 1RK1A 2XPGA 4MMZC 3MUHL 2ZZUT 3STZB 4QNPF 3IAGC 4HC1L 3WO4B 4Y4KD 5AZ2H 1KG0A 5E03A 3IU3B 3BD3A 5B3JF 5JIPA 3QHFL 1W72A 3MRNA 5IKCB 5KSAD 1MUJB 1UC6A 1WEJL 4F37F 4ZDHB 5MEOA 2IBGA 1U91A 2FX9L 4JFFE 4QXGH 3ZYIA 5EC1A 3O4LB 4HWZB 5IB2B 3X13A 4OLZH 3DVGB 1JNNL 2X41A 1B3JA 3D48R 5EB9A 2C1PB 3EDKA 3M45A 1AXTH 1EK3A 1BM3H 3MLZH 2Q8BL 3RY5A 5JORB 4NNYB 1G6RH 2FZ3A 3TEUA 4UOW1 1EO8H 3RKDD 5ILTL 4FFYH 1A7RL 4HUVB 3QIWB 2VNCA 4POYA 3BGFB 4J6RL 4NCC1 4XMPL 5IM7B 2R69L 5T1LA 4OFVA 2A1WL 4F3FB 2E3VA 2E7BA 2PYEE 1H3TA 1NCCL 3HHRB 5C0AA 1NMCB 5F1OB 3VFOB 1CK0L 3BD4A 2YPKB 4KY1H 4LGRB 3HI5H 2IPUK 5JDJA 3O2DL 4OCXL 4PR5B 3QQ3A 4LVHC 3D0LB 3X3FL 1HNGA 2XT1B 3MGTA 2GY5A 4U7MA 4Z7VB 5T1KA 5EG6C 3MMEB 2Y5TA 4WW2B 4KVCL 3HCVB 3IJSB 4QY8A 1Z9LA 5IVZB 4FZEH 3L5JA 5LXGH 4OLVL 1T5WA 2DLHA 4X7EC 4J3TA 3BIAX 3D0VB 1S5HB 1S3KH 4ELMF 1DUYA 4JRXA 3QYCA 1SEBA 1J1OH 4PP2B 1MRFL 5IVXE 5HYIA 2V9TA 3DXAB 1KPVA 5GSVA 1FYTB 3ZKMD 3FN3A 3T1FB 1DUZA 3NTCH 5J9PA 1T0NB 5CIPB 4GAFB 2GYSA 3S35L 3GBML 4QXUL 3NZHH 4N0YH 3CXDH 3SDDA 4MD5A 3MO1A 1DN2A 2DJSA 2YA0A 3MJ8A 1DLHA 3RWEA 3TJHD 2WLYA 1VA9A 4P5MA 1B2WH 3NVQA 1RU9L 5KG9A 5MEND 2R2EA 3SDCA 5FHBH 3JV5A 4BK4A 1QRNB 4KXZI 3LKOB 5HVWA 3PWUB 4JKWA 1HXYB 1SHMA 1I8KB 1M71A 1UJ3B 4HXBL 2OP4L 3MRPB 3P73B 2CSPA 3O41A 1HINH 2GAZB 1JWMB 4WRLA 1KJ2B 5JDSA 3VWKA 3W11D 1AGCB 2H9GB 4HIEA 4W81A 4GBXA 3MV7B 2BY2A 2MTPA 3ZE2F 2NY2B 2H1PH 1KN2H 4MXVF 1VEMA 4LEOA 2EDNA 3ULSB 3GKWH 1EHLH 3VG0H 3BH9B 3CK0L 3HPJA 1NGPL 5I16B 4Y4HA 3SE3A 4I9WD 2DLEA 3H3KA 4PY7B 1BEYH 4C4KO 4A6YB 4TUKL 4I48B 4NZRL 3DLQR 4K3EL 3ECBB 4XWOC 1VERA 4WO4B 3OF6A 3IDIA 2JELL 4QRPE 5HVHB 1JUFA 1KLUA 3LKQA 3SDDB 5JQ6L 3VFSA 3CLFH 2EYSA 3IFPB 3DYPA 1XGPB 1RZKL 4OLYH 1V3LA 1F3DH 1XCTB 4OQ1A 4KDTC 3EOAB 1ZHKB 2MWCA 1PLGL 3SJVA 2H2SD 1MHEB 1MCOH 1Q9WA 1X5FA 5ANME 1RJYB 3KLAB 1ND0B 2A73B 3MNWB 4N8VG 5D1QB 5E70A 2YEZB 4ODTH 3K4DA 3HG1A 4PGDA 3FB6B 5J3HD 2VABA 2BJMH 2XWTA 1QYGH 1T0PB 4UDUB 5BVPL 3BDYH 1OM3L 1JWMA 1CFNB 1XZ0B 1NCTA 4MLSA 1RJZB 4QCIA 5FA4A 4Y19B 2XZQL 1CQYA 4Y4FA 4UILL 4RIRB 3EIFA 4B7LA 4ZUVA 2W60B 4PRHB 1EJOL 2Y25A 3QUKB 1LEKA 4HT1H 4LCYB 5JPNB 5FHAH 1P1ZA 3B83A 3ARYA 3WD5H 1D5ZA 2NXZC 3HG1D 4HS8L 1JTOA 1MHCA 4MX7B 1PY4A 3OGCA 1UXWB 3BKML 1PKOA 4YHPB 2EZ0C 4NSKA 1DLFH 5EN2A 5KSUB 5AUMB 3DIFB 4PRIA 3QIBC 4HUXA 5FUCC 1MI5E 4KDWA 3IDXH 3B3IA 4YUEH 4PRIE 4FFVD 4LPTA 4YDIH 1E6JL 1EEZA 1BJ1J 4UB0H 5DC9B 5BCAA 2QQQA 3MGOA 4OZFA 4N0UA 4D9QD 1YEGL 5HHQA 8FABB 2WUBL 1J0ZA 1EBAA 4YFEA 3ALWA 4P2RD 3TN0C 1WITA 3FZUC 3REWA 4YR6A 3LEXA 2XTJE 5DJCB 1IAIH 4NN6C 2ADGB 1OF2A 4KTDL 2IAND 2BFVL 2VDRL 4NP4H 1FO0A 3PABA 5FCSH 3G08A 2FEEL 1N5YH 3TYFB 1J1PH 1KTKE 4HPOL 3WIFA 1S7XB 2FRGP 4LAQL 1EUUA 2OMNA 1OTSD 3NTCL 3EYFA 3W0WD 3IF1B 2CDEB 1VKXB 4DAGL 5B4MC 1UM4H 1FL6A 4JB9H 5LJYH 5FO7B 4LVOC 3EGSA 1ZGLP 4NQDA 4J3VA 5EZIL 3O41B 1FL3A 3SGJC 1AD9A 2L0DA 5D7JC 2X4SA 3TA3B 3OPZL 4Q9CA 2Z8RA 5MEPB 3RUGE 3G04B 3UCRA 3ZTJG 4ACPA 2FBJL 3D9AL 4OCNC 3OKDA 3K8LA 1CE1L 3MRQA 4N0UB 3JV4B 4DKFH 4EOWH 2G5RA 4TUJA 3CH1B 4P48A 4DZBB 3O6FB 3QDJB 1YEFL 1KTDB 5L0QC 3HA0A 4FXKB 1ZVSB 4WUKH 1I1YA 4ZAKA 1OTTD 3BZEB 1ADQA 2ZCKH 2ICWI 3O3DB 1F4WL 1A1NB 3QIBB 3PE9A 1IT9H 4Y5XA 1NUNB 1UXWA 1HZHH 5CP7B 5H2BB 3T0ED 4R97C 3WFCL 3WS3A 1U3HA 4HIXH 3ARDC 1A02N 4XVJL 2VDLH 3MLUH 3VWJC 3RIAF 2CLRA 1S7QA 5AAMA 3RL2B 1BWMA 2BSTB 1QSVA 3DV4A 5GS0L 2RGSA 1WC7B 4HMCA 2FJGB 4GT7A 5I1JL 1D6VH 2G60L 3O0RL 3D39D 3LZFL 4ZD3L 5IWLC 5I0ZA 3HRZB 1RZKC 5EOCH 2GJ6A 3U9UB 1QBML 1TJIL 2W0KA 2I9TB 4Z7QE 3SGJA 1TQCB 2OX5A 4MXQD 3RVTC 5GRZA 4FA8A 4MQ7B 5ID1A 1JYNA 3TIEA 3W0WE 5HHVL 1QNZH 4W6XB 2J8UE 3DX9B 4BQCA 3K8MA 3G9VA 4PTUB 4KMTL 4MX7A 1KENH 2AI0L 3ZT7A 1J88A 5FA3B 4YHPA 4MCYB 3UBXB 4HFWB 5L6YH 3F7QA 3MXWH 1PW3A 1RUPL 2CIIA 1A9EA 4JO3H 4OF7A 5CUSH 1GZPB 1UVQB 4ZSOB 2JF1A 4K23H 2AXHA 5CAYB 5MHSE 1U41A 3MRFA 3FMGL 2CK0L 4JFYA 3TWCL 4KRPC 1M4KA 1I8IB 1I3GH 4KHXL 5ICZB 4BFBD 1WWCA 5KVFL 2WWMC 1C8PA 5EU5B 4WFHD 3MUZ1 3JWOC 2IF7A 3LKSA 4YHZH 2GFBA 1OCWL 4V1DA 2X1WL 4YDLB 1A6UH 1IAOA 1YEDB 3HUJF 3HZVA 2H32B 1NFDB 3QIWA 4PV8B 3HTLX 4IMKC 4KUZL 4HD9A 3NGBB 3RY6A 1ZANH 3IKCB 5DQJA 5IW1A 3SOBH 5DQDH 4NJ9H 1PX4A 1ZHNA 2R2HB 3W5MA 4XBGB 3BMVA 1NMAH 2WUCH 4JZNB 4Z7OE 3WFEH 1J10A 3N06B 2CKBL 4KVCH 3TT1L 3BXNA 4E41B 4NKIH 1UKQA 3K4AA 4M7LT 4PJ5A 4XZUA 4YFLI 1IGCH 5GS1C 2E7HA 4PLNC 1AO7B 1DBJL 4KRPB 1JPGA 4MJIB 3TYGL 4Z7VA 2UV3A 1XT5A 4CBPA 2FX8L 4XMKL 1RUAL 3O45A 2FJGA 1VHPA 1L6ZA 3HE6B 4O02H 1VENA 4OIIL 2CIIB 5TPWL 1KEGH 4HCRA 3AY4C 1V3JA 3NFPA 3VFRB 2B8OT 1F42A 1KCRH 2DBLL 2VIRB 4G80B 4GUPA 1YN6B 2EYRA 4L4VB 4NM8H 1OP5K 3RWHB 3BT2H 1HKLH 4G8GB 1OQXA 4JPWH 1CICD 3I75B 3CSPA 4WU7B 4WW2F 3SKUD 1UYWL 4OI9A 3OPZH 1RIUL 2OXGA 1ZVSA 3VXRA 3BUYB 4JANA 1QLRA 5T5FL 4PJ8C 3D9AH 2YD1A 1ED3A 3IYLW 4N0FB 1MEXH 2AK1L 3QWOB 2OTUB 1N2RA 4XP1H 3DGCR 5GXBB 3B9KA 4C55A 2Y6SD 3GJFH 3ARWA 3HB3D 1H3WM 1P7QD 5K93A 3R4DA 1DBJH 3UJJH 1KPUA 3SKJH 1OAXL 5TQ2L 2X44D 2X4NA 3IGAB 1HOCA 3O9WA 1CI5A 3O6FC 3Q5OA 3MR9A 4ESKA 3KYMB 3SQOL 1LWRA 4MMXC 1FE8L 4KRMB 4JREC 3QUML 2NY0B 1TPXB 4M1DL 4QHUA 3UO1L 3C6LA 4FMKA 5D5ME 4WNQA 3KXFA 3MLZL 1S7WA 4N1CA 5KOMC 4DK3A 2F19L 2JCCA 4NJAH 4XRCA 1ZT4B 3RI5K 5IMOA 5D5MA 2UVFA 3N85L 4LLVA 1IRAY 3ARZA 3HE7B 4JFOA 5ESAA 1DR9A 3PQYA 4F58L 1LEIA 2ZNWA 4UV4H 1L7TL 3TVMB 4K94L 5TDNA 3MROB 3VXUE 2QQLL 4CVWA 3ARTA 4NNPH 1BZQK 1KBGH 1D5ZB 4UZGA 3SDXF 2EE3A 4WO4A 3RVVD 3RDTA 5E08L 1CXHA 1OARL 1EIBA 2O93L 2Y72A 3ARPA 1TPXC 4K7PX 4P46C 1BD2E 5HYJE 5IFHH 1MCCA 3PNWB 3L5IA 5HJ3B 4DKDC 2XZCH 1OAZH 4P9HC 5D6DA 1J8HA 3ULVH 5D93B 3A0OA 5DJ0B 1BF8A 2AEIT 5ICXA 2VIRA 1DQDH 4XAWL 3S96A 1U8MA 2F54E 2ZP0T 1EVTC 1OB1A 2FLRT 2OK0H 1Z3GL 2DM7A 2F8OA 3ZE0F 2FX7H 2B2XL 3ALPA 1GGIL 3PDOB 2APFA 4KKCD 3S8WA 4EDWL 5A1AA 3LEXB 1MWAA 4PJFB 3OAYH 5BV7C 1FZOA 2F5AL 2VL4A 5EH1A 1QRND 1SJVA 4XMLH 4ZTPL 4JFOB 5ESAB 4EDXA 2V7NB 5JNYB 5IB3A 4IOIA 3LQZB 4CUCA 4OCYH 2ZSWA 4FABH 1I3VA 1XGYL 2ZCLL 5FV1L 3STZA 3HNSL 1OAZL 2DI7A 3V5DB 3S4SB 1AXIB 5IBUG 2XN9D 3NFSH 2HT3D 2P5WB 5F89A 1INDH 4L8SC 4X9FA 4XNQB 1WTLA 2JJVA 2DOCA 2YKLL 2ZKHL 3QIUA 2X42A 3RZCC 2JE8A 1X6LA 4RZCB 1JZ8A 3NFPB 3W9DA 2YUWA 2BY3A 1FC2D 4U7KA 4U6YA 5IMKA 4IDJH 4X80L 2OL3H 4N9OB 3AVEA 5HHOB 1LE9B 3CZFA 4HEME 4OI8A 1KV3A 4PJBF 2D3VA 2P8MB 4HZLA 3U7YH 3LMJH 1MPAH 2ZCHL 3GHEL 1NGPH 2AJVH 3REWB 3QUYA 2BCKA 4XMLL 4JO2L 3ZKMC 5DGRA 3Q6FB 3HZYB 5EFIB 4APQC 1HK6A 2X05A 4PJFA 3RVUD 1TTFA 4F7EA 5HI3D 4YPGA 5I19L 4RCAA 3H9HB 4KHTL 1ZLUK 5I1IH 3DMMA 4PJHA 4LLQA 2P8LA 5CP7A 5EO0A 4JM2D 5CHNA 3EYFB 4P3DA 1A7PH 4XX1G 2X4PA 4ZNEA 1MLBA 1BD2D 1MEXL 4YJZL 4ELMA 4JGMA 3U30B 3TH2T 3RAJH 3D1MC 3ARSA 2GSIB 1XCQA 1D5IL 4Y1AD 5IQ7L 5J57B 1WZMA 4ZTOL 4WHYG 1AC0A 2ITDB 4X5WB 4WW2A 1RZGB 2J88L 5EU7E 3T4YB 1V7ML 4KVNH 2ITCA 4U1IA 4OTXH 1NMBH 5SX4I 1FGVH 3FQRB 3RVUC 3TFKD 1FIGL 1FVEB 3AS1A 1RK0A 4PGBA 3QUXC 5KVGH 2V6HA 1TQCC 3GEWB 4WWID 1O7VA 1JMZA 3FONA 4Q9QH 4LLYA 4WI4A 3H42L 1R3HA 2W9LA 4OGYH 1FFNA 3LAFA 3IDGB 2J2ZA 1I7UA 3BWAA 3ZTNH 2AW2A 3U0WH 4OAWB 3V52L 2IFFH 5B38B 1JZ4A 3VGEA 5J56B 1IC5L 5C07E 1SYVB 3VFVA 4FOMA 5K33A 9CGTA 3MV9D 3H0TB 1I9JL 5MP6L 4WI3A 2Y23A 4LRIA 3MV8D 2DQJH 4X6EB 2V7HB 5FYLL 1BBDH 4L8CB 4XNQA 5I8CA 5KZCD 5INDA 3LQAL 3ARGC 2Z31B 3CGTA 4PBVC 3SJVB 4B41A 3GMLA 3V7AE 4HWUA 1A4JA 2IAMC 1U8LA 2HLFD 1QUNA 1AI1H 4XVJH 2Z92A 2DQTH 2CIKA 3CZJA 3FQTA 3TNMB 3QFDB 3QCUH 3NAAH 3MOBL 1FORL 3CXHK 1X5XA 3PIQA 3MRMA 2HFGL 5I75C 4I0PA 3O3BA 2W0FB 2AK4D 1TVHA 3UPCA 3UX9B 1QSEA 2A74A 1HQRA 3HC4L 1D7FA 4KQ3H 3FFCD 4NP4L 1AR2A 3OJ2C 4BH8B 1NAKH 4LL9A 2ZUWA 5ACLA 1EEYA 1QA9B 4RFNC 2EXWC 1QPPA 2VLME 4OD2A 3S34L 2IH1A 2R1YB 1P4LB 1T1XB 1DANU 1NMCC 4K8RL 4QXTA 5CZXD 5JXED 4LHUA 3HKFA 4HDIA 1GPOH 1QSFD 1Q9OA 3OR7A 2APXA 25C8H 2B1HL 5DRWA 1BEYL 3IFLH 4LHUG 1A6WH 1A8JH 3K3QA 3QEUB 2Z35B 3U46B 1P7KB 1A7OL 3BP4B 4NC0B 1ZHKA 4QTIH 4RWYH 1FAKT 3SO5A 1N0XL 3IFOB 1FAIL 3W39A 1CGTA 4ZXBD 4Y5VC 4V2BA 2HT4C 3R8QA 2X5PA 4K2UL 1C12B 4ZDHA 1AQKL 4H8WH 1U2CA 5FAAA 4U6HB 3BOVA 1EEZB 3O2DA 5BJTA 3B43A 3QI9C 1FVCA 3P3YA 5LG1A 5IHLB 4OGAD 4JCMA 2YPLD 1LO0H 3EDJA 2IPTL 2WNGA 2JB6B 3AMKA 2LU3A 5H94B 1ACYH 2ZJSL 5SWZB 1JGUH 1A6UL 3BWAB 3TN0B 1IQWL 3IFNL 4QRSA 4TSAH 2ILLA 1MJ8L 3U2SA 1JGLH 4PJHB 4XHJC 3CSGA 2YZ1A 4JGUA 5IIEB 1ZA6A 3GI9H 4BKLB 5ENWB 4KKLC 2GI7A 2HH0H 1B0WA 3DROB 4WENB 5D7JA 1HCVA 4OZIF 2EEBA 4XZUB 4JY4A 1DCLA 1Z0MA 3WSQH 2R4SL 3DX8B 1AD0A 2PYFB 1QP1A 2D31A 3GMOB 4IRSC 2O5XH 1I7ZB 4HGMA 4OT1H 5C08D 2A6JB 1H8NA 3FQTB 3M8OH 1MCDA 4C83A 4NM8L 1CFVL 2P42B 3WHXB 3HE6C 2ITCB 1D5XA 3WFBH 2LU4A 4J8RA 4HAGA 5FYJL 3VI4E 1S7WB 1RIVH 4NQVA 4GUPB 3PG2A 1DDHA 4PJ9B 5T5FH 2GK0A 1DN0B 4ODXB 5HSFA 4BM7A 4WTZG 3HZMA 2AK1H 5F7YC 1XGTA 1FVCB 4U7SA 3UTPE 1EEYB 1QA9A 4XVUC 5IVNA 4WFGE 5FYJE 4XAKD 5FM8A 3VU2A 5INCB 4LDOB 1UYWH 4CKVX 1KIUA 5GZNC 1AQDB 4YBLB 1C5BL 3SDCC 4P57B 1QRNE 1ZVHA 3QUXA 4Q9QL 1A22B 4B53A 2YK1L 4V1DD 5T33H 2VXUH 1UA6L 1FRGH 1P7KA 5T1KB 4HKJA 5DD1L 4M9OA 2X4RB 3S35H 3ZDZF 2E9JA 5D1ZA 2GW5A 1OAXH 3DHMA 5GSRB 5DGQA 3AAZB 4JLRA 2P46B 1IZKA 3TO4C 5IFAL 4KJWD 2DQJL 1J1OL 5H37G 3I85A 1X7QA 4X6FA 2I5YL 43CAB 2BSRB 3D0VA 5D7IE 2ZNXA 3FO2A 4ZFOB 1T2QH 5F7MC 4J8RB 1SY6H 4PYHA 4ZO9A 1A4KB 1BZ7A 2A0LD 4G9FD 4MNQE 5C0CB 2HFTA 5CEYB 2BSSA 3EFDL 3KYKH 2GJ6B 3BKYL 1JGVH 4UBDD 4XBPB 2BSED 4KI5E 5DRXA 4Z0XB 3U9UA 5KSAA 4KI5D 3K8KA 4HZAA 4LLMB 3L1OL 4Y5VB 5L2KA 4GW5A 4Q6IC 1IQDB 1EAPB 2AV1A 4X7SH 3SKMA 1DLHB 1QFWL 3MROA 1RVFL 3C5SA 1UH4A 1CE1H 3B6SB 2QADD 5F9WC 2VJXA 4GS7C 3AREB 3MODH 4K7FB 3VWJD 1MFAL 1U93B 5C6TL 4HX1B 5CJQH 4XWGH 3QEUA 1K3ZA 1YEEH 2NY7H 1JGDB 3MA7B 2FDBP 1FGNL 1KACB 5IB4A 2YC1A 4QKXB 4UI2A 1HWGB 4TYUA 1HSAB 5IW6B 1J8HB 1BPVA 2P5WE 3B4NA 4JY6B 4QHMB 4D0CA 2CLZB 4P5KB 1NBVH 1VESA 4KDTA 3PDDA 1SJXA 2V5MA 2BC4A 4GBXB 3ARDB 3QQ4B 1G7HA 3PGDB 4OZ4A 4XAWH 3C60A 1M7DA 3U6RA 1A6PA 3GNML 3PL6B 5IHUH 4M02A 4XAKE 5K9QG 3QFJB 4P2QB 3L5XL 1AE6L 1CGVA 5JHDE 3DETC 4YGVA 1C5DA 4ETQB 1PG7W 1KF9B 5DURD 5IR1B 3CC5A 4YHYC 5IROC 5L0QB 1QBMH 1EX0A 1G9NH 4GQ9H 5KSAC 3MPCA 2AEQH 4JJHA 5C2BH 3EYOA 3BH8B 4G43B 4LSVL 4DK6A 5MEQB 3CU1A 1T66C 3J7HA 1XF4B 3FT2B 4HLJA 5I75B 1XF2B 2R23A 1ZLVK 4NRXB 3HG1E 3QDGE 2CQVA 1IFHH 1D5XB 5B8CB 1P9MA 2WWKT 3NIDE 4U6XA 4NQCE 1KFAH 1EJ6A 2M8XA 5D9SA 4JM4L 5EBWB 2EYTB 3CMGA 4PG2A 3PP4H 1QSEE 3DBXB 1JPFA 5HY9A 3JWOL 3GMNB 1ZEAL 3FO0H 1JPSH 5DJ8A 4Y4FB 5DLML 3MYZA 2EH8H 4XB7A 4HJJH 5AYQA 3C60B 2N56A 5E95B 2VDOH 4A6YA 3PWVA 5C0DA 1VEPA 3H9ZA 4GLRH 5ACZB 3EO0A 3ZT5A 5GGQH 1UB6A 4NDMA 5GRUH 5E8OB 4CMHB 1OAKL 2LAAA 1OW0A 1KNOA 3P11H 3Q1SL 3LEYL 5DO2D 4QNPE 4K7PY 4Y8DC 3QG6A 1EXUA 3IRPX 4IRJB 2V9QA 4MJ6B 2FGZA 5C07A 3MNVA 4CVZA 1BIHA 3KLAA 1CFQA 4CJ0A 1D9KC 1CG9B 3F7VB 2WQRA 3SDYH 3K2UH 2DYPD 2EO1A 3U82B 4ZFFA 5T3XL 1LO3L 5EC1B 3O9WC 4OZGF 2AJXH 1KEMH 2IWGA 3BPNB 2W59A 2X4TB 4Z7UE 3BEWA 1QSFB 3D18A 4GH7B 4QRQB 5KSBE 1YNKL 3ARBC 2BSSB 4J4PC 4UT7L 3RUGB 4E42B 2VMFA 4I77H 5HDOA 1U8HA 5IF0A 1BQUA 2IPKB 4RIRA 1TETH 4P23A 3GMNA 3ARBA 2ATPA 4AY0A 1N6QL 3MOQA 1EH9A 4M8VA 3BUYA 2FBOJ 4YGAB 4OAWA 3WDIA 1PZ5B 4YQXH 4S11A 1SJHA 3EYOB 5MEQA 3T04D 5BZDB 5D7IF 4GRLD 3VH8B 1JF5A 1CL7L 2NMSA 4LHQB 1U3JA 2YXMA 3CFKB 2AVGA 4CU8A 1GCFA 1FFOA 3BESR 3P2TA 3PHQB 1YECL 5AYUH 3RIFF 4HS3B 4KY1L 4AG4L 3MRCB 3GI8H 1CG9A 1NCNA 4PJ7E 2V2TA 5D6DC 2LFGA 5EBMA 1SYSB 4R90H 2VISB 1TZHA 4HFUH 2ESVB 4GKNA 5MEPA 1P9MC 2K1MA 1L6XA 1N64L 2BVPA 4PG2C 4JFED 1UB6B 4NDMB 4OLVH 3O3DA 4YWGL 1SBSL 4QO1A 3AM8A 3QNXB 4OD2B 1S9WA 2E7MA 5GQBA 5ESQA 3IFLL 2BHZA 3LS5L 3QNYB 1ROWA 1JP5A 3VFGH 1FAIH 1Q9KB 1G9EA 4DFHA 2EDWA 2CXGA 2H45A 4DGIL 3UPRA 4K2UH 3WCYA 1T3FA 5J11C 2P5ED 2CDFA 4P2CG 4XPFL 2YZ8A 2H2SC 3F65A 4X7CC 2BVUA 5IUSA 5ELIA 1PG7H 3OWEA 4U2ZA 5IQ9A 2HJFA 3E3QE 3H6JA 5HHPA 5EOCL 3QNZA 3G9AB 1NFDE 1FFOB 4BSJA 4OUUB 1UEYA 4MA1B 4X9GA 5I1AB 1CDHA 2V5SA 4HBCH 5JHLH 5D7LA 5I71C 3WUWA 4OLXH 3WN5A 1E0OB 2R0WL 1T7VA 3AXLA 1U2HA 3ULSA 4BJLA 5JZ7C 2VWEE 4FXKA 4NQDD 4YE4L 1GSMA 2W0LA 2CUMA 1MHHA 4O58H 3EO0B 4G8GD 1TQBC 2XTJC 4PV8A 2QQNL 2QKIA 1A1NA 3QIBA 4QHLB 3AC0A 2B2XH 1F97A 4JRXD 4GXVL 4LVHB 3ZHDA 4F33A 4Z78A 2CDGA 2OR7A 5K9JH 3OR6A 3QG7H 2BZDA 3BKJL 1JF6A 1FZJB 3D25B 3GSVB 4LVOB 3DROA 3OL2A 1I7RA 2FWOA 2BY1A 4LSTL 4PG9B 3WKMH 3DMMC 5FA3A 3ET9F 3MRFB 4HMDA 2VZUA 1KLFA 1A7QH 2OJZL 1A7NH 1CQKA 3QIUB 4OBSA 4PJAA 4YHIA 3RBSA 1ZLVH 1F4YL 1S9XA 1XGRB 5D71L 1X6NA 3U9PL 3FOLB 2FCBA 3DURA 1BVKB 3OG6B 3VFRA 1L9NA 4M6MH 1E4WH 1ERNA 1ZMYA 3KPQB 3OJDA 2GFBB 4LSDA 1UENA 2A6IA 1IAOB 1YEDA 1KCSL 4ZXBA 2GT9A 3QDMD 3SKMB 4LCYA 5JPNA 3X12A 3STLA 1R24A 2KQNA 2LVCA 5FF6B 4WI2A 3X3GH 3BN9C 3IDYC 5ID0B 1JZ6A 2GUOB 4QTHA 1BVLA 2GITB 4JFEE 4NQCD 5CEZH 5D1ZC 3QWOA 1T3FB 3K4ZA 1Y6NR 3B9KB 1LO4L 2N4IA 4J6RH 3WBDA 5DVNA 3CFCH 3NOIA 4OZGB 2LE9A 3MRNB 2VOTA 2YUZA 4ZS6D 4R4BB 5DD6A 1I1AC 1K9TA 2BY0A 2Z31A 4KQ4L 1M6OA 3FO9A 4NHCL 4NKOB 3ZKQD 5D1QA 2NXZB 3RNQB 4WI7A 1FYTE 1G6RL 5KOVC 4XNZC 3VMPA 4I2XB 4KK5D 3CDGA 5KANI 3P9MA 4RX4D 3RU8L 5I1GH 5FCUH 1IM9A 1AY1H 5JORA 4RMTA 5D96C 2VN7A 4G5ZL 2FIRT 2ARJB 2VDNH 5BVJB 1R3HB 5HPOA 5T5NG 1N2RB 2DQGH 3ARED 3ZKSD 3LRSA 2H2PD 5CGYC 4H26B 3OR6B 1IAKB 3TVMA 1RZ8A 4L9DA 4ERSL 3U0TA 4L4TD 4WHYH 2AJUL 1B4RA 1JHTB 2Q6WA 1EUTA 4FQIH 1MELA 3BE1L 1FL6B 1X5IA 1T04B 5EIQA 1JTPA 2P24B 4NHCH 4L8CA 1BLNB 4B50A 3B3IB 2MCPH 4P49A 4RMRA 4NUJA 2D7MA 4JHWL 2VZ3A 1CFTA 4EZMA 3GSWA 4OCMC 1M6OB 3FO9B 4MWFB 4S1RL 3VFWB 2HRPH 1OCWH 2LTQB 4NQCB 5DMYA 1GYAA 4BSVB 5C0NC 3VXPA 4PJ9C 5F7KC 1CDCA 1R5VA 4M93C 1CLZH 3JTTA 5EU6D 4D0BB 4O2FA 2E9WA 4WHTA 5EWIH 3PJSA 4X4YA 5IBUB 4FQQB 4LVNC 1JGEA 3QO0B 3WUWG 1GZQB 3NCYS 1E4XI 5T1KD 3JV6B 1C5DB 3U4AA 4QHLA 5JR1L 1FG2A 5DJ6B 3IVKA 1ZSDB 15C8H 1AR1C 2HKHH 1CR9H 3B2VH 1LO5A 4DCQB 1CF8H 3G5VB 3B9EA 1AXSA 3MO1B 3QXUA 2P45B 3EBAA 2ICEA 1CFSB 1IBGL 3UTTA 4NPYB 2E9IA 2B5IC 3PHOA 2XKNB 2P8PA 1RUKL 5CWSA 2FJFA 4R4BA 4Z6AT 4FNLL 5DJYA 1XF2A 2EDJA 4HLZG 5DRZB 2R0KL 4OD1L 3BZFB 4N90E 2VL5A 3GBLA 3WYRA 4Y19E 2AV7A 3ARQA 2FX8H 2WM0A 4ODUB 4CNIA 4X6CF 2KH2B 1KC5L 3OKMA 4UNVA 1A6VH 4X4MA 2I25N 5HHOE 4BZ1H 1EHAA 3LPWA 1KLGB 5BOZG 3FAXA 4DWHA 2HT2C 2V2XA 5IMLA 2DJUA 1S7UA 4PFEA 4Q2ZA 3MV01 4JQXA 2BMKA 1C5CH 4O2FB 2AGJH 4C59B 1G0XA 5JIIA 4JKPL 4ZUWA 2BJML 2H3NA 2BOBA 3NZ8A 4ZPTA 4XTRC 5HDBE 3GKZA 1JI2A 5CKAA 5I73C 3TZVC 3FQNB 5E5MB 2I60H 3N1MC 4YPGB 5GGRY 5F8RC 5J6GA 5EULV 4NFDA 3BPOC 5JMRA 3KLHD 2YWYA 4DZ8B 3QA3A 4ZAKD 1U95A 2LABA 5C08E 1NLDH 2H8PB 2HFFA 4L3ED 1JF1B 2WWKO 2PYFA 4ONFL 3DGGA 4GAJL 3RPIB 1PX3A 2P5EB 4XVTH 2J4WH 3QULA 4NGHL 3SQOH 5E6ZA 3LKRA 3WNKA 1IKFH 1PFCA 5I2IA 1VGEH 4Y19D 4GXUM 4K71C 3VXQA 1I8MA 5HI4D 2J5LC 4U1MA 4ZYKB 2CMRL 3HRZA 4TOYH 5E8EA 4FQ1L 2Q8AH 3VFUB 5K59F 3B5GA 1I75A 4PY8I 1CDYA 2F19H 2MJWA 3BW9A 5F1NB 4Z7WE 1J8HD 3D39A 3V0WH 5A2JH 1DQTA 5ANMA 2QSVA 4R0LA 3MJ6A 1FGVL 1P5VA 5GGTH 4KJPD 5HVGB 3D39E 2QR0A 4RFNB 4PGJA 4JE4B 5FCUL 4CVXA 1ZA3A 3L3DA 1AFVL 1DEDA 5EUOB 3ULUH 1CVRA 2B4CC 3O2VH 4X6DF 3T0BA 1ITCA 4ZTOH 1SQ2N 4ONFH 1YEHH 2XQYG 3GSXA 5EOCJ 1LP9E 1A9EB 2EE6A 3KPLA 3H7BB 3QQ9D 5ESVB 4XC3L 1OGTB 4WVRA 5SV4A 3NPSC 1I1RA 3NACH 4RMUA 3MRCA 3OKLA 1KCVL 5J1TC 3T2QA 3RZCA 3TT1H 1TCMA 5MHSD 2EE2A 1D5BA 2D7NA 1LGVA 4X8JB 2ZOLB 3LEVL 3ARGB 1I7TA 3FO2B 3PL6A 3T0WA 2DQFB 3QBTB 1I4FB 2PN5A 4K7PL 1H5BA 4KMQA 4IEFB 4XPBH 5JXEC 1MY7A 4AQOA 1VFAA 4GRWE 2HAZA 3SDAB 3B8YA 5CJOL 4V1DE 3MV8B 2DBLH 3VRJB 1F11A 5MERB 1BOGA 4OCSL 1N59A 3FQWA 1AFVH 2DIAA 3IU4H 1A47A 4J4PA 4CDHA 1I7UB 1B6UA 4PJXA 1FFPA 1RZJH 2G5BA 3NN8A 2IGFL 2WIMA 1R3IL 3D3VE 5JW4N 3OZ9H 5DD5L 4EOWL 1MCRA 3D85B 4K7FA 3QISA 4P46D 2AJYL 2OJEA 3N9GL 3TA3D 1ULVA 3A6CL 2VUOA 3LS4H 4DGIH 1G7IA 5F9OL 3PV7A 3VXMB 5MI0B 4AJ0A 2DTML 4M61A 1MIMH 3HNSH 1G7LA 5F9AC 2Z35A 4EI5A 2EDLA 1FBIH 4JFFB 1U8OA 4X80H 4UUJA 1VADB 1NLBH 3O4LE 2BC4B 3GJFA 3L3OA 1HIMH 2XZQH 3UAJD 4HK0B 1KB5H 2FL5A 3CD4A 3EYSL 3ARDA 3EHBD 4QHNA 4NCDA 5D5MF 3W0WB 3DO7B 4G6JL 4PJHE 4KFZC 5C9JB 1S9VA 1YEJH 4Z7WF 1MAML 4KKAC 2V2WB 2VLJE 5FDWB 2R0WH 2RJMA 1SVZA 4LSQH 5IGXH 1DBBL 1KC5H 4K9EH 2R39A 4LBEA 1GPOL 1EEUA 2V9RA 1FO0B 3PABB 4YE4H 5F70A 4FN0A 5I76A 3SHSA 3UYRL 1A7RH 4FFYL 2KPNA 1A7OH 1YYML 4JG1H 5E2TL 1YN7B 4XGZB 3S98A 3RKPA 1I7RB 2FWOB 4F58H 3IGAA 1FFPB 3WIHA 2HFFB 1UB5B 5GS0H 1K6QH 3BWUC 5F7DB 4GO6B 3BPCB 2E9BA 4X5XB 1OAYH 2VLKD 1FZMB 2ADFH 4LAJH 4NNPL 4PUBL 4Z18A 4DKAA 2VXTL 1OLLA 3VXSE 1BJ1H 4UTBH 5JLZB 4XCNA 4M1GH 1P2CB 1RQ5A 4Y4KA 4I3GA 1L0YA 1AD9B 2Y6SC 1B2WL 2OZ4H 2VXVL 1A21A 4LVNB 5F9JA 4FQXB 4X7TB 3MTRA 3BAEH 1I7TB 1MF2L 2ADJA 1MAMH 3WSQL 4QXWA 1JPTL 1F3DJ 2P44B 4L29B 4XCEB 3ZZ1A 1NBZB 1FNGB 1QNZL 5FYKL 1EHNA 2IPKA 1A0QH 3DXAE 2E5EA 3NIFE 4MQ7A 5KVGL 1GGUA 4YXLH 4DZBA 1YMHB 3WJJA 1BFVL 3GBNL 2E7CA 1MRDH 3KNBA 4U1KA 1U9KA 2CRIA 1DP0A 1CDGA 2VLMD 3OAYK 1UADC 4HUUB 1KN4L 4EUPG 1AQDA 1A9BA 3I9GH 1BBDL 3OKEB 4KQ4H 1YNTA 3MJ8B 2PKDA 4IS6A 5ENWA 2RR3A 1TJHL 5KTEH 1MCQA 3CX2A 5F96L 3SOBL 1QFWM 1SBBA 3UC0L 4NQXB 3RDTD 5FYLH 1XF3A 1OD7A 3FFCB 3VDAA 3L3KA 1KELL 1L7IH 1U36A 4GG6F 3OXRA 2GJJA 5TFSL 1JPTH 2PTTA 3WDHA 5B8CC 1IE5A 4GSDH 1CXEA 4PJBA 3WHXA 1KJ3H 2ICCA 4I9WE 1MCWM 2Y36L 4D9LH 3WV0A 1YJDC 4A6YL 5ICYB 1P69B 2ZCKL 4RFOH 2X9YA 1VACA 4Y4KC 4HSQA 3CDFA 4PJFE 3HZYA 5EFIA 3MCLL 5D2NB 2GJ6E 4IOSD 3RX7A 5BVJA 1BZ9A 4HJ0D 3TVMC 3MCG1 2YSSB 4A2MA 3FB5A 2CO6B 3WFEL 2V5YA 4DKFL 1UZ6F 2R29L 3MJGX 4I77L 1V7NH 4PRHA 5FO9A 3QUYC 3VFNB 1X9QA 1T1YA 2NY2D 1YDPA 2NY6C 1ZVYA 5I18H 3I3DA 3SCMB 3TPUA 3ROLB 1Q9KA 1Q0XL 3UBXA 1QFUH 2VITA 4QOKB 2DQIL 3T1WA 1VEOA 3JXAA 2DKSA 1JGDA 1XR8A 1JFQH 1NGWA 1GC1L 1OGAD 1X7QB 5TFSH 4J3UA 1RZFL 4ZUUB 3VFPA 1CLZL 1VADA 3VRIB 4G8EA 3MV9B 4FQXA 4K71B 2NQCA 2WAHA 4UDTB 4KJYA 3TBTA 2FGWL 4PP1C 1TVBA 2DDQH 4OUUA 4BQBA 4X0KB 2IBZY 2R8SH 1J1XH 2E8ZA 2DYPA 3KR3L 1FBIL 3D3VA 5I8EB 1XGUA 2F53A 4ODTL 3SKOB 3EFFA 1WBYA 1HHIA 3MBEA 1I9RH 3MUY1 4XXDB 5C0CA 1HIML 4L4JA 1KENL 2AI0H 3E6HA 1R3LB 4N9GB 5EBLB 4LLMA 4PJ9D 1F5WA 4FQXD 2NR6C 5IM7A 1TITA 4PD4K 4Q6IB 5CINH 4UAOC 5LGKA 3SGEH 4IRSA 3V0AC 5CUSL 5DK2A 4Y1AB 4Y4HD 1WWBX 5FM4A 5CEXB 4WJ5A 4DTGL 4QF1A 5DJ2B 4RGOH 2CDEA 3GI9L 4G8IA 1TZGH 3L3KB 4R7DB 1IM9D 4YBLC 1K8IB 5LXGL 2FECI 3KGRA 4LAQH 4YHZL 3C09B 1K4CA 1OARH 1S7RB 3MXWL 3BKMH 3A67H 4X6BB 1XFPA 4U1IB 1BD2A 4D3CL 2ADFL 3CJJA 5T3ZL 5EBGA 3X14B 2HKFL 4UV4L 3O9WD 3C5ZA 2ADIB 4Y5VA 2XA8H 3OHXA 1AKJD 1ZTXH 5HXMA 2D7QA 4ZG1A 3ARFD 2CRZA 4P4RA 1T20B 2XRAH 4NO0D 4YHKH 4IJ3B 2UWEB 5C0GB 4ZPTB 1CGYA 1RU9H 1T1XA 3G6DL 1JPSL 1U8JA 5T1LB 2XZCL 4KQ3L 4IIQB 4Q9BA 2JIXD 5EU6A 2YRLA 1BWWA 4MDJB 4IS6B 4O58L 5IHZA 2X4UB 2VLRA 3KXFE 3CIQA 3I6KB 3U79A 5B4MD 3WJJC 5LAXB 2OMBA 4LPVA 5I8KL 1UA6H 1N3NA 3D85D 5A2KH 5IJVB 3C6LC 3EHBC 1LP9B 2BVQA 1C12A 4HGKC 3UJIL 3CLEH 1S7QB 4DGVL 3VI3F 1T0MA 1UXSA 2NY5C 4S0TD 3JV0A 3BIKA 3C2SA 4RGNE 5DD0H 4MAUL 4MB3A 5EWIL 3OGOE 3LDBB 2MKLC 2A9ML 2CR3A 3GJEB 2VZSA 4AQ1B 3PDOA 3MJ9H 2VLRD 5ISZB 1T5XA 3T4AA 2JCCE 3WKNA 1A3LL 1CDBA 4XCFH 1F6LL 1PDKA 5DD3H 1MSPA 2MCG1 3BT2L 1YNKH 3QXWA 2Y7QB 1RFDL 3RGHA 1KTDA 3M1BB 3O2DH 4OCXH 5CBEA 1YDPB 5E1HB 3WNNA 5DK2B 1QKZL 3C87A 3GSNL 3P30H 5K9OA 1YEKL 3LIZL 3MFGB 1UJ3C 5IFJB 1WBZA 1JHTA 3KAAA 2Q6WB 4KGLA 1P53A 1NCCH 3NIGF 2YA2A 3MREB 2FH6A 5KS9A 3H7BA 5E8PB 5TQ2H 4Z7NE 4KHTH 5I1IL 1G9MH 4IRJC 4JY5L 3VXME 5DJDA 4Y2DA 4FP8L 1QSFA 2WBJC 4QRQA 1WIUA 4PD4J 2YPVL 1JZ5A 32C2A 2EC9T 2P43B 1A14H 3OF6D 5DHYA 1NGYA 3EOBA 1DN0A 1PBYA 1CXLA 3IJHA 1ZGLM 1WZLA 4PJCB 3BP7B 5GGSB 1GGCL 3VD4A 3SE8H 2W07A 5FK9A 1AP2A 1CL7H 3DUUA 3NIDF 3DVFA 4KROB 4OIAA 1J5OH 3WXVH 3IVKB 2OLDA 3P40A 2Q3ZA 3WE6B 4YXHL 5AG9A 1M05B 1MIML 4J12A 4P5TD 4F7CA 3EYUL 1XAUA 5BMFL 4KJQD 3C9NA 3MLTB 2NW2A 1ES0B 4IMLA 4GAJH 3D2UB 2P7TA 4GG6B 3O8XC 3ALXA 4XVTL 1L0XA 2D03H 4JN2A 1XH3A 3QCVL 1VGEL 5JTWA 1C16B 1CDIA 1CICB 4HPYH 2ITDA 4X5WA 4WV1B 5T1DH 4NNXB 2VABB 3QIUC 4MSWA 1H3XA 2H9GA 3C5ZC 4HIEB 1ZLWH 5BQ7A 1CFTB 4O2CA 4U6YB 2BOCA 3QAZC 2FL5B 5TE6H 2IAMB 2VLJA 3UEZA 2J3SA 5AD0A 1KT2A 1A4KA 1BZ7B 2JB5L 5SX4H 1T7YA 4W4OC 3CSYA 1RIHH 4OUOA 1NGYB 4JRYD 4LCCC 5C6PB 3K74B 5L8LB 4MDIA 3MRDB 5IVXA 3SGKC 2AXGA 3U36A 4KK9C 2H32A 2DI8A 4M5ZL 2WBKA 4M7JL 3JV6A 1LEKB 4FMFA 1MCSA 1MCJA 1OF2B 4OLXL 5I74B 3W11C 2AABL 3NCEB 1DQQB 3N1GC 4M7KH 4EXKA 4JGJA 4BUHA 4HH9B 1INDL 5T3ZE 2HVJA 1F4XH 2ATKA 1JZ7A 1MCOL 4WFGD 3MJ7B 3HMWL 3UTPD 4MNHB 5HI5D 4DZ8A 2GKIA 4HIIB 3HAEG 5HGDB 4XPTL 1PSKL 5L2JB 3UPRB 5BXFA 1NGXB 5IEKA 4FQLL 5IB5B 3MNWA 3PHSA 4Z95L 5CZVL 1T1ZB 3DRTB 5DRZA 4RISH 3GHBH 4WI6A 2OL3B 4X6FB 3KJ4C 3QQ4A 3GMRA 3EOBB 1CLCA 2HTLC 4GS7B 3SY0A 4AIZA 5J11B 4JKKA 4NRYB 3BP7A 5GGSA 4L9LC 4AM0B 5LVEA 1XGRA 1T5XB 4P46A 3WLBB 5C09B 3D2UD 5I1AA 1YN6A 2EYRB 4L4VA 1WCBA 2OR9H 1PY9A 1Z5LB 4NZTL 3S34H 2R9HD 4BUGA 5FHAL 4CAGA 3T8XB 3BSZH 3WEXB 3FOMA 1QBBA 3MRJA 3VXTB 4K8RH 5T5NF 2Z4QB 4NRZB 4JAMB 4JO1L 5I15L 1P1ZB 4X9BA 3IDJA 3WFCH 3AB0C 5E2VH 3QJHB 4ZD3H 3RL1A 4JFPB 4LRNL 1JHKH 5L88L 7FABH 3IXTA 3MLUL 3T08A 3UTZA 4C54A 3NABH 4FTVE 3SDDC 4JFEB 2BX5A 2IQ9H 3EGSB 3JUYA 5D7IA 4WHDA 4NZJA 5J6HA 1IL1A 4JY6A 1KJVA 1VKXA 4KROD 1KUMA 2QADC 3OXRB 3UC0H 3L5WA 3Q5TA 3U0PB 5EZJA 5F93C 5FEBA 5DQ9A 3MV9E 4F9LA 3X13B 4DOHE 4NO3B 3CFCL 4ZYKA 3MRQB 4JPKH 4I0PB 4LARH 4NZTH 5DHVA 3ELAT 1OP3H 2BFVH 2NY3B 1IGML 3QDHA 3MUGA 3TIDA 4PLKC 5DJCA 3U0WL 4K23L 5D7KD 2OTPA 2GT9B 2FHBA 1J9CT 4MD0B 4G6FB 5JIKA 3RWIB 1P6AB 5M94B 4N5EC 4MA3B 3FQWB 1MRFH 4JZOB 4F2MA 2IH1B 4WGWB 43C9A 4EIZC 2DD8L 3R1GL 1E4KC 4H25B 3MSPA 1AY1L 5CEXA 4LHUB 4OSUL 4RBPK 1XF4A 1P84J 4ZPVA 4MJ6A 1NCWL 2DQEH 1CGWA 5IG7B 3QZWA 1MNUH 1PZUB 4NHUB 2YA1A 1Q0XH 2MPAH 1XR8B 1ZHBA 3B9KD 5HD8D 4HQQL 2DQHH 1AGFA 3QRGH 3MV7D 1P7QA 1RURH 4QWWC 4JQVA 2CLVA 5IT2H 1CD1A 1ACZA 2CKBH 4JFQA 3RHWK 5HHXH 5E0QA 1NAKL 2DYPB 3KPTA 4M6AA 5DS8B 5HHOA 4POZD 4HMEA 3WEXA 3IDYB 5F7WC 2AXGB 3QDAA 4OB5L 3VD3A 4L5FL 3GBNH 2DLFL 1SEQH 4QXGL 1X5AA 3MUGB 3TIDB 2OL3L 1QRKA 2DWEA 3HC0A 3N1PC 1SJHB 1BOGB 3LMJL 1EGJH 2QEJA 2QL1A 3DI3B 1TZGL 4LLWB 4TNWF 2XZZA 3BMWA 5GHWH 2FD6L 2DQCL 4PP1D 3ARFB 1NDGB 4IRZH 3UTSE 3FHQA 4LLQB 3SO3B 1TJHH 1TNMA 4GFTB 2BNRA 2C3GA 3DXAD 5L2JA 2R2BA 3P4OB 4HKJB 1INQA 4CN6A 4M7KL 2PNDA 3E2HC 3L9RB 3P4LA 5JO5A 3OTTA 1EZVY 1SY6L 2IEPA 1I8KA 2Q3AA 1GGTA 2C3WA 4R26L 3TT3H 2EIZB 3DSNA 1ACYL 2ZJSH 1Y6KR 2W9DH 4G8FA 1PYWA 3ZKXB 4JDTL 1QVOA 3LD8B 5C09A 1IM9B 5FUOH 1IGIH 2B20A 4AG4H 4LU5L 5TQ0H 3HZMB 3PWPA 2ZUVA 3Q2CA 3JTTB 3P0GB 1K4DB 2MQ0A 3U4EA 3HPJB 5DQJB 1FL5B 2IAMD 4HXAH 5CEZD 2VH5H 4HBQA 5BVPH 4U1SB 5GRXG 5GRYA 3V95A 2Z0BA 4H25A 4NKQB 3T65A 2A6DB 1JWUB 2DTSA 3WIIH 1NAML 1RUPH 1H8SA 1QFUL 3G5VA 5IESH 3SCMC 1Q9LA 3OGCB 1H3PL 2P8LB 3FMGH 3QDGD 4Z7UA 4LSPH 4HUKB 1MFDL 3PUCA 3VD7A 4Z76B 1KPUB 4OF6A 3VMNA 1FZMA 1MQKL 5EZLB 4EBQL 2GCYA 3QPXL 2BVQB 4ALAH 4ZUSA 2VDQL 2EIDA 5KJRL 5IJKA 2R0ZL 4G42A 2PTVA 4XCFL 2EE9A 3VWJA 4M7ZC 3CXDL 4HJ0C 4UDUA 2ED8A 4YUEL 3P0YL 4QOKD 4U1JA 4WNQB 4PRNB 2ENYA 3RGVD 2ORBH 3HMXA 2F5BL 1OWRM 3NAAL 3GSQB 3QUMB 3LV3B 5E08H 4RDQG 5JW3H 5FHBL 4HV8B 2DRUA 1CLYH 1ZAGA 1SVCP 4R0LB 1WBXB 3ZE1E 2JCCF 4YDVB 1A1OA 4XPHH 3ZSTA 1KN2L 4HXBH 1YMME 3BH8A 2UYLB 4LF3A 4J3OC 3C9NB 3DWTA 1I8LA 3SBWC 2EDTA 2IPUG 2YN3A 3C5ZD 3HRPA 4CMMB 3VCLB 1X5ZA 4Z77B 1RZIA 1MCLA 5SWSB 2MCPL 4YC2C 1N0LA 2SEBA 2QADB 3VXQB 1ZLUH 1IGTA 1NSNH 4ZUUA 1KGCD 4G6AD 1U8LB 3O3EA 2D0FA 2OQJA 2Y07H 2CK2A 3MC0A 3G5ZA 4M4PA 2P5EA 4I3RH 4XNYH 5C0AD 4P2OB 3CMOL 4WWKB 3VJ6A 3P0YH 2LAGB 4XP9H 3UTTD 2DLTA 2XKUA 3K81A 4WUUE 1I1FA 1YY9D 1MVFA 3TPKA 1D5MA 1K4DA 4OIBA 4PB0L 5JPMB 5TDOA 2XNAA 3HI6L 4OZFG 4TNWK 4Y2DC 1G0YR 4KK8C 3U9PH 4G9FE 4JQXC 1BM3L 1EGJA 5IR1A 4JFHD 2YD7A 4QLRA 3V4PH 1DTUA 1LNUB 4E5XA 2MHAA 1R5WA 1RUKH 5HHME 1TETL 5ADPH 5KAQG 3SE9L 5IIEA 3RWEB 3KJ4B 4YDVA 4PJ7B 1NH6A 1A1MB 1LO3H 1BBJA 3MYJA 4JQIL 3QULB 2JJTC 3GSOB 3MNVB 4CVZB 2ESVE 4CMMA 5D2LA 1E27B 4MXWL 1HILA 4ZFZA 1CGXA 2BSTA 3AU1A 1U8MB 3ILPB 4F7PA 2ZUUA 4RGMB 4G8EB 1LO4H 1MIEH 3C08L 3ETBF 2B0SH 4BFIA 1AE6H 3Q6GH 3IXAA 1BVKA 1MCPH 3HR5A 3CSYB 4NO2A 3O81A 4ZFOL 3GSQA 2ADIA 3VGAB 1MREH 2VDMH 1A6VL 1W8OA 3BGMB 4C4KT 2Z9TA 3DARA 3LRSB 5L2KE 5D2LF 3L7FB 3ZYZA 2HA1A 3V5HB 1F6FB 3FRUB 2ERJC 4JFDB 1NCUA 1WAAF 5LGJB 4MD5B 2IJ0C 3VCLA 1E6JH 4UB0L 2VO5A 4S1DC 1T4KA 4BKLA 1VB9A 2XA3A 4EKXA 2UZXB 2CUHA 1W0WB 4PREA 5L8JB 4YWGH 4L1DA 4HWEH 2W91A 3W9DB 4Y5YA 2X10A 1KIQA 5E8NB 3PXHA 4OF8A 5F3BB 1JK8B 4ODSH 4EUPB 1RY7B 4I2XE 1KJ2A 3ILPA 3BPOB 1RHHB 3V9FA 1FVDA 5E00B 1TCRB 4P5TA 1LE5B 3NMEA 2PO6B 1XGQB 1SBSH 2Z91A 5I73B 2CMRH 5A2FA 3NCFB 5E94B 2G9HB 3MACL 2P8MA 5J12C 2FX7L 3QWQB 4I3SL 2H1PL 3QIWC 4YBQC 2QBWA 1WBXA 3FRPA 4KH2A 3PL6C 1T6VN 1NGQH 4LIQL 4CGTA 4GG8A 1A3RL 4KUCD 4HC1A 3O8XB 4L3CA 4R3SB 1OW0C 4PBXA 4P2YA 3VH8A 3CFEA 1RJCA 1YEHL 3P9LA 4MCYA 2DQTL 4B7IA 4KWUA 2X4UA 2JKXA 3LN5B 4M1CD 5GRJL 2VTFA 2X89A 4QRRB 5CHNB 4EI6B 4K3DH 5FUZL 3AU1B 2JELH 3K2MC 1P2CA 4Y4KB 4HLZH 4HBCL 1WAAE 5JHLL 1PQZB 4JVPA 4PREB 4OLYL 1NPUA 5D2NE 1U8KB 5JLZA 1IEAB 1H0DB 5GS0D 2V2TB 3VWKC 2NY4B 3P4NB 5KSBA 3OKNB 4WHTB 4O2EA 4HIHA 2UY7A 3DX6B 1KEGL 4UT9L 1M7IB 4GBXC 4XNYL 4MA8H 1NUGA 1FNGA 5DEZA 4TNVF 4Z0XA 4R9HA 1GC1C 1YY9C 4OZGE 1CT8A 4TULL 4U4BA 5D71H 5DVKA 5JW4Q 1H9VA 5C0FB 2FYYA 1J7VR 2AP2A 3TESA 4ZUTB 3WE6A 3HMWH 4I0PD 4OM0L 1ZLSH 2QQKL 2YBRA 3ARFA 2V7HA 4RFOL 1RZ7L 3BFOA 2R1XB 1IAMA 1YYLH 1JPST 1MWAH 3PWNB 3RWJA 3FFCA 2VZTA 1WTGT 1EFQA 3WIHL 4GSDL 2NXZD 1FNLA 3OQ3B 4XP4L 5E8NA 4QOKE 1QKZH 3JWDC 2VITB 1TVDA 4QHUB 4UIMA 1YEEL 2HJFB 2JK5B 6FABH 1OAUL 3GMPB 3HNVL 3RAJL 2BVEA 4IM8A 4OJFL 2FEDC 5AYUL 2W0FA 2VQUA 5EBWA 3BQUB 5E94A 1IEAA 1EBPA 5DJ8B 1N5YL 5IGXL 3F6IA 12E8H 5E2VL 3VXRB 2FIKB 2YS4A 2FJHA 3MLWL 4FFVC 5C71A 4UU9B 5CP3H 1UCTA 1YQVL 1P4LA 4MB5A 2HP4A 4APQD 1U58A 3SGKA 2A6KA 1H5BC 5B21A 1FJ1B 5C0FA 5CIPH 1W0WA 2HN7B 1GOFA 4LFHD 4QRRA 5E6YA 2FD6H 5GIRA 4PLOB 2W65B 4Y1AE 1HOCB 1YYMH 4JG1L 4WTWA 1NC2A 4PGEB 3EYVB 4WFFD 4ZMAT 2CPCA 1WUNT 2AEQL 5J13C 3DRQA 4IJ3C 4LSVH 2P5EE 1FLRH 1FDLH 1AJ7H 3RZCB 5E4EB 4XPFH 3T0VA 3PWUA 4MNGE 2Y5TB 2Q76B 1EPFA 3B9DA 4LEXL 4UIMB 3HC4H 1ZANL 5AEAA 4Z7QF 3WN5C 2IANA 3MQIA 3FCTA 1XMWA 3QCUL 5AWNH 4JDVB 1WAAA 4WCYH 1F3RB 2OS7A 1A2YB 4GXVH 3SDAA 2VKXA 2LTQC 3HE7A 4DGYH 1DDHB 2XN9B 5D70L 1S9YB 4JRXB 2A6IB 5FGCB 3CVIH 2AJZB 3JZ7A 5IESL 2W9EL 2X1QA 2R1YA 5DLMH 4J3SA 1T1YB 1N5AB 4IRSB 2Y9RT 1WCQA 1RZ8B 5EBLA 2HJLA 2XFXA 4PJAE 4YFDB 3O4LD 3CFBB 2I26N 2EDQA 4WIQA 5I1EL 3DX8A 4EN3A 4Z77A 4JJ5A 4M43L 1QLFB 3H3PH 3IFOA 1KXQE 1I1AB 3MLXH 1S7RA 1HZHL 1O5DT 5KG9B 1CDUA 4XHQA 5C86A 4HHAA 4PJXE 5ISZE 1IBGH 1K8IA 2I24N 3SE4A 1MFAH 3BP6B 3HB3C 3U0PA 1WWAX 3ZL4L 1I85C 3MLVH 5KSBB 2CRYA 1A7NL 4ZNEE 1S9VB 1BAFH 1X5GA 2BNRD 2X4QB 3OAZK 4N68A 3EJZD 4AH2A 4BYHA 2KUTA 4WI5A 2FJHB 3GI8L 1NBVL 4D94A 4U6TA 4K8RD 3W2DL 3X11B 4LCWE 1XIWC 4ZUTA 4MA3A 3H9HA 3QUMH 4JCLA 3QJHA 4H26A 3LY6A 4G6KL 2FB4L 4UNTA 1YPZE 3E2HB 3ZDZE 1FNSL 4H20L 3RZWA 1OD9A 3VW3H 3VG9C 2D31B 3GMOA 3WS6A 1LD9A 4GAGL 3K7UA 3MYJB 3BUTA 5SWSA 2HRLA 2VB5A 3MBED 2VLLB 3CMOH 4OFDA 2Z31C 4G6FD 1XCQB 3BX7C 5HYJD 3D69A 1ZHBB 4C56D 2PCPB 3VFGL 1CU4L 5TE4H 2DQIH 3GB7A 1BX2A 2PO6C 3LB6D 1N3NB 5A3ID 1DE4A 5B22A 1MUJA 1JMXA 1ZT7A 3N0PB 3V0VB 2PXYA 4N8CH 4YAQB 2CK0H 4XCEA 5C3TA 4U1LB 2CJUH 4D8PA 3WUWB 3KPSB 3E6FB 1RFDH 2PYEB 3I02B 3UZEA 2FIKA 5KBNC 3E8UH 4ODHH 1RIVL 4U1GC 5HDBF 4PB0H 1KYOJ 1MF2H 3UZQA 4HEPG 4MD0A 1MCWW 4JPKL 4LARL 4PJ8B 4XVSH 1QLEL 4OKVB 1WICA 5IEHA 4G5ZH 5HPMA 1DBMH 5L2KB 4NKMA 1IGJB 3QUYD 3VW3L 1F58H 5DVMA 3MXVL 2PXYD 3A6BH 3MOAH 5LAXA 4P9MH 1S7TB 2I07A 4AEIH 1CE6A 3QH3A 1LMKA 1JF1A 2DF3A 2R69H 5K9JL 5I1DB 4H0HB 4DVRH 1CFBA 1R3KA 3FT2A 1FFQA 4NKIL 1A5FL 4DUWA 4ONGL 1C7TA 3BKJH 1F6AA 4NN6B 4BELD 3F5WA 5E6IA 4PJBB 1P5UA 3KPNB 2ADJB 3WKML 2O5ZH 2VLKA 2XV6B 5H37H 2JIXA 5BRZE 35C8L 3INUL 4CU7A 4IDLA 4MCZB 2AJSL 3V6ZB 15C8L 1ORSB 2A1WH 4LPCA 3OKDB 2ZOKA 3TV3L 4X6DE 1JRHH 2K3TA 1CK0H 2GJZA 1E6OL 5BRZD 2NXYB 3B6SA 3HE6D 3I3BA 4G6ML 1WF5A 2JB5H 5DUBB 4XP5L 1UZ8A 1WBZB 4HWBA 2A77L 3MLTA 4MJID 2VR4A 4CN4A 4BQ9A 1FPTH 1IC1A 3W9EB 5GISL 5CD3B 1KOAA 1Z2KA 4PJGF 5EIIB 1K3IA 2YWZA 5F6HI 4L8SB 1UWXH 5CJQL 3MV9A 5GS2H 5I1KH 1RZJL 3RJQB 4JRYB 4MJ5A 2VLJB 4NKOA 2Q86B 5HVHC 3BEVB 5DTFB 3LKNA 4EIGB 3TM6A 1IILE 3UO1H 4O4YL 1F8TH 4MD4A 1OLZA 3O6LH 4FQLH 3VFUA 1Q94B 2CH8A 3T77A 1CYGA 1VFUA 2AABH 4MS8D 3ME0A 1D6VL 4G6MH 2W9DL 5I1HH 1N7ML 2BHYA 4KZEH 4MAYC 5ADOH 2XICA 1XF5A 3MRDA 3BP5A 2GJZB 4LCWA 3GK8H 5FOJA 1AGBB 5F9OH 5FO8B 1JWUA 1PZ5A 5SV3A 2NZ9C 5EDXA 3PL6D 5BW7A 3QAZB 4NO5B 1T1ZA 3DRTA 1KNOB 1BFSA 5KSVB 1V5JA 5HJ3A 3V2AR 1K8DA 1IL1B 4WHCA 4FQIL 4K3EH 4M62H 5JDSB 2E7LC 2B1AL 3RA7L 4L4TE 3GFUA 1E4JA 4TSBH 2GTWB 4PRHE 2BRQA 3VXPB 4ZTPH 3JUZA 3MUJA 3DX6A 3Q0HA 4LSRL 1SM3L 1RHFA 1WK0A 3LS5H 4OFPA 3TO4A 1BFTA 4FQQA 4WO4D 5EO1B 4PY7A 2X7LB 1F11B 5MERA 3LEYH 4FQHA 3KLSA 5FA4B 4JM2F 4I18A 4LCUA 4J2XA 2F5BH 4KGJA 2VLRB 3GRWA 3MRBB 5ESQB 4MXQC 4WJ5B 4LOUD 4OCRH 5DI8A 3TBSB 4U49A 4EQ2A 4OM0H 2JJSC 5EU3B 3PHOB 1OAUH 3GIVB 3KPRE 4CW1A 4UILH 4X5XA 1N4XL 5I9QC 1DQLL 1E4KA 3F8UB 4AEFA 1HXYA 3O2VL 3V6OE 2P24A 4M62L 1Q9WB 1EFXA 4XCNB 1YY8B 2NX5A 3HNTL 4JEGB 4PJEF 4XP4H 3B2UD 4J3WA 2VISA 5FYKH 5DA0B 2C3XA 4KROC 3I50L 2DQEL 5T3XH 3FQRA 4JRWA 5KTEL 5JXAH 1NCBL 1LDSA 4LEOB 3UBXG 4OCWH 1R5VB 1ZS8A 2VZVA 4LOUC 5H35B 3Q48A 3UTSB 2Z8VC 1QO3A 4KV5F 1T2QL 3BDXA 2FEDD 2AJVL 2CGRH 5ALCH 4RWYL 2DIJA 4U6VH 5C0EA 3N9GH 1I9IH 5SX5H 4GKSA 4M48L 3IKCA 2YXFA 1LO0L 4H5SA 5I9QB 2GHWB 4W70A 1FDLL 1Q72L 1BECA 1F90L 4NPYA 1S7XA 4XPGL 4NBYB 4FFWD 2DM4A 1IJ9A 2D7TH 4NYLA 3NCYP 5GSRA 1UCBL 1LP9A 1NFDF 2OR8A 1KB5A 2XXMB 1JL8A 4PRAB 3QFDA 3LKNB 3S5LB 2HYMA 4MNQA 1OAQH 1G7HB 1MJ8H 1EVUA 2XWTB 4Y4FD 4XNXH 3UJTH 2BXZA 1G7PA 4FXGB 5CEYA 4CJ1A 2JCCB 3L6FB 3EJYC 1UJTA 4RFEB 2XACC 1FO0H 4LGPB 4NQDE 1Y0LA 1RI8A 5IBLD 1S9WB 1OT1A 43C9B 4WU7A 3RVVC 3LN9A 2EIBA 4LCWB 1G7JA 2CR6A 3GSUA 4ZO7A 3MLRH 5C0IA 3LB6C 5DYOA 4JFDA 3TH4T 1MHCB 4PJDE 5L2KD 1YNTB 1J87A 1ES0A 1RZFH 4IMLB 2B4CL 4G3YH 2OSLA 3H8NA 3S35X 4CRPA 4PR5A 1QTYT 3UTOA 1YEFH 5F21B 4OM1H 4H0GA 5ITBL 6FABL 1FNEB 1S5IH 3HUJA 1OGTA 1FN4B 3O6MH 1G0DA 4KJYB 2EXYD 5BO1L 3KPSD 3PQYE 3BE1H 1KCLA 3G5YB 1OHQA 4OZ4B 4LRIC 2Y5EA 4FQJL 3SDCD 4AT6B 3BQUC 2OCFD 1T1WA 3MBXL 2CKBA 5IV2B 3CFJA 4PJCE 4HIJA 3IRZA 1SEBB 1OPGL 3UTSA 1FORH 4I2XA 2E6JA 4H1LH 2XTLA 5IMOB 3MFFB 4U1HA 4CADA 1FIEA 1HQRB 1G7PB 4C58B 5AZ2L 3RTQA 1G7QB 2VR5A 4I4WA 4LSSH 3D39B 5CMAB 2PR4L 3WIFB 1EMTL 5IW3A 5CD5C 3LZFH 3L3IB 4L8DB 4K7PH 3GM8A 5CLWA 3O8XA 2W0PA 2HT3C 5I6XB 1HYRC 1TJIH 4IOIB 4PG9A 2VQTA 4PJDA 2GJ6D 3ARXA 1B90A 3BN3B 5F1KC 1UM5L 2UYLA 5KSBF 2XYCA 2DQHL 2DB8A 3D0LA 3KPRD 2OJEB 1OAKH 3TO2A 3WO3B 3RL2A 3GO1L 3M17A 5EU6E 3V8CA 4JPWL 4U6XB 1F02I 2OM5A 3KPNA 4KMTH 5AZEH 4HQQH 3TFKC 1DQLH 4Y16D 1AGCA 1H3UA 3OJDB 2G75B 3RNKB 2L4OA 1JTTA 3OB8A 3P0VH 3O8XD 3DO7A 4ODXA 2VAAA 3TF7C 1Y0LB 1PKQE 1QO3B 4GRWB 1N8ZB 1I4FA 5IB1A 5MENB 4OFIA 4V1DB 3MV8E 3LEVH 4XXDA 1MJ7L 2ZUQC 3IKKA 5E5UB 5I18L 1GZQA 4F15B 4F7TA 5ID0A 5JXAL 4OF0A 1SJEB 1T22A 2GITA 5FIEA 3GJFK 4DVBB 4DW2H 4M43H 3RTQC 3NN8B 4KU1A 2I27N 4KUCF 3HI6H 3MLPA 3QWRA 3U4BH 4HJGA 1ZWIA 3CDYA 3HE7C 3OB0H 3UJIH 3I2CL 5FYJD 4JQVC 4PJEB 2EKJA 3ZKXC 1ETZB 2J8HA 3RWDA 1NCAH 5CEZL 4YPJA 3BI9X 4L4VE 4GRMB 5E2TH 4Y4FC 4F7MA 3VFTA 4JLRB 4OF3A 5DQ9B 4DJMA 5J12B 1HH6A 4RDQF 4ZFZB 4ONOA 3QUXD 2VLKB 2C3VA 5JOPE 1FYTD 1ODAA 2ESVA 1CFVH 2BP3A 1SMOA 5C0JB 2AERT 3QPQC 2IANB 4WWKA 1U92B 3ZDXF 1O7SA 3HMXH 1FVEA 3S4SG 1NCDL 3RWFA 3RZCD 3RWIA 5HGHB 3JWDL 4DN4L 3V6FB 2QSCH 3QUZA 4D0BA 1KFAL 4DN3L 5F3HB 3LPGA 4XNXL 4AEHH 1VFBA 3ARUA 3O4OC 4MXVE 4L8DA 4RGND 1N8ZA 4GG6E 1AHWA 4S1SH 5C0IB 3IDMA 4LBEB 4YHYB 4PRPE 4U1KB 2VXSL 1DQML 1H3PH 5K9OB 3QUXB 3BN9D 1HQ4A 2APVA 4WGVB 2EDFA 1BVZA 5SWZD 1W72L 3SEPA 3VG9B 4G9FA 2RAMA 3ROOB 3VRLE 4U05A 1IKFL 4OFKA 2P48B 5LGHH 1IC5H 1MIEL 1NFIA 1YC7A 3C08H 3L3JB 2YC1B 4ALAL 5AUMA 3QA3B 5GJTH 3VXRD 4NUJB 2YPLE 2FJFB 4HUXB 3G5ZB 5GISH 4GAYB 5EORL 2Z8WC 1ZLWK 1AR1D 2D7PA 1KCKA 3CK0H 2ZUQB 2F58H 2AAVA 4TNVK 4JFHE 3QIWD 4YBQD 2ICWB 2D9QB 3BISA 4I1NB 4NFCA 4YLQT 2XKSA 5JR1H 1HXMB 2X4OB 1CGSL 1JGEB 4ODUA 5FECB 1NL0L 2IG2H 3B2VL 3FT4A 4OLUH 3F7PC 3ORJA 5JA9A 3DVNB 4XBPA 1U92A 1ZE3C 4S1SL 4XT1C 3WNPA 3ARDD 4N0FA 4YHOH 4AENB 4M8QB 3X11A 5JOFA 2VXSH 3VRLF 5AG8A 1HI6B 3T0EC 1U8PB 5C0AE 3LKPB 1ZGLA 2P8PB 2JJWA 2YRPA 4XC3H 4TVPD 4NKDB 1RAMA 3ARGD 4XPAL 3FQNA 5E5MA 4DVRL 3IS0X 1T89C 3WL9B 4TPRH 3UXFA 3SPVB 1IT9L 3U7YL 3QQNA 3VFTB 2Y07L 4M93B 4LCIH 1Y18B 1QQDA 3HE6A 4I0CC 1YC8A 4LHUD 5I1EH 1R3IH 4Y2DB 3GB7B 3QZWG 4WV1A 3W39B 4YDJA 3N85H 3FB7B 3SGDI 4F8TA 4HS6B 4TVPL 3UP1A 3BP6A 5F7EH 4YQXL 1JPFB 4HT1L 1JYVA 4LMQE 3U6RB 2YMXH 3GM0A 2X1PA 5DMIL 2DTMH 2Y1VA 2RHEA 4OZIA 1MFEL 2PYEA 1PKQA 1EO7A 2D4DA 3GSNH 1G9NL 2O26U 4KJQC 3VD5A 3NBNA 1KPVB 4U3CA 2QKIB 4CVXB 1LQSR 2HFEB 1P4IL 1VFAB 3V7AG 1J1XL 5EUOA 2D0HA 3TCLB 5A2LH 5EIVA 3HE7D 3VXUD 1MAJA 3P9WB 5J89A 3FFDB 2WQ8A 3O2WL 3MLYH 4LSUL 4W4NA 1CLOH 5DK0A 1ETZA 3GIZL 4OZGA 2R1XA 2UUDK 4Y5YB 2MQ3A 4OCRL 2FATL 4NQTA 1FNHA 1XH3B 3MGTB 4N8VB 1QRNA 4URTB 3AUVA 3D5OF 3VXMA 1BJ8A 1QZ1A 1JVKA 2OR9L 2ZUTA 4QY8B 1IC7H 4LVEA 4LDLB 3MA9L 1MWAL 2EDYA 1CIDA 1HYSC 1TVBB 4LCWD 2IFFL 1T2XA 3GSRB 1J1PL 3IB4A 5LQBH 4X0KA 4HS6A 5JA8B 4HF5H 1J5OL 5HGHA 3G6JB 1R3JB 3RX5A 4UIKH 1LE9A 5BV7L 1MCHA 5KJRH 3JWOH 1NEUA 5DHVH 2OZ4L 1XGTB 2VXVH 1HEZB 4LQ1A 4PJIF 5C09D 2EECA 2EKSA 3MZTA 4HV8A 3LKPA 3ULVF 2YBRB 4HJJL 1I1YB 1ZA3B 2CJUL 4ZAKB 2WSKA 4UOW0 3CFEB 5KW9H 2X1OA 4H88H 3T0XA 5BW7C 1HHKB 3NFSL 1IGMH 2DL9A 1E4XL 1MFBH 5GGTL 3QCVH 3S4SA 4F7EB 4L4VD 2ZKHH 3FQUB 4NN5C 5TF0A 2P1YA 5I8OH 5KN5B 4O9HH 2J5LB 3TO4D 1XGPA 2XY2A 4LLDA 2FBJH 3P11L 2WUCL 2A9NH 1G6RA 3TCXA 4Z5RB 2R2EB 4PRAA 1A7BA 3J8F7 3F7VA 1CICC 3T0AA 4P99A 3QXDB 4AIOA 4MWFA 5DWUL 1K4CB 1WC7A 3O6KH 3HS0B 2VE6A 1OB1B 2Q86A 5A40E 4HS8H 3CZFB 1IM3A 4BQ6A 3TJEH 1FYHB 2ICES 2Y06L 1KCVH 4S10A 1UM6H 5EORH 4YK4C 5DJAA 1QFWI 3L6FA 4AK1A 4F80A 3SGEI 2H26B 1JYXA 5I19H 3LV3A 1DFBL 3I6LD 2IFGA 1RULL 4FFZH 3G6JA 3LN4A 4RAVB 3EDDA 5FYKD 5BS0A 5GGUA 4DCQA 3T3PF 3FB8A 4WDIB 1RPQA 4XBEH 2F53D 3Q3GB 4M6ML