4X4ZA

Retrofitting antibodies with stabilizing mutations. herceptin vl mutant f53d.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
b'IQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASDLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Herceptin VL domain with F53D mutation
publication title Retrofitting antibodies with stabilizing mutations
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x4zA00
4X4XA 1NCCL 2NY6B 1DDHA 1DSFH 1HXYB 1I3VA 5C0BD 4FQHA 1AGDA 1T7WA 4L3EA 3WKMH 1XF3B 2IADB 4R0LB 1I9IH 2VDML 1UC6A 2IF7A 4Z77B 4WWKA 3CH1B 5F71A 3O6ML 3BXNA 4U1KB 2CLRA 4YDKL 2L7UA 4BQBA 2HVKA 4ZUVB 4YUEL 4O5LH 2A6KA 3BGFC 4XBGB 4GRWF 2UUDK 3IDUA 3JWOC 2A6IA 1T1YB 3BQUD 1RK1A 2Y25A 4CN6A 4W6WB 1YMHA 2Q76B 1IBGL 1IAOA 4ZUTB 1S5IL 4QCIA 4OZGA 3GMNB 2VLKA 4JZJA 3FN0L 2A1WL 4QHUB 4NO2B 3DIFA 5KTEH 3T0AA 3FFCE 2B1AL 1UWXK 5ID0A 1QA9A 2BNRB 4PJ8B 3CLFL 3BW9A 2OL3A 1UQSB 1DP0A 4MJID 4FXGA 3E2HC 4JRYB 4CKVX 4KC3B 4JRXE 3EOBB 5SX4I 2LE9A 1IFHL 3KPRA 3GO1H 1FBIH 2LU7A 3BPLC 1OTUC 4PJHF 4KQ3H 5TF0A 1AO7B 1FLRH 2C3WA 3ARBD 3GSRA 4JFQB 3QUZC 2XTJC 5FKPB 4XMLH 1KPVA 3G9AB 5TJWK 4OZIF 4M7LT 5FYKH 3C60A 5KVEH 1J7VR 3THML 4KZDH 3PP4L 5T3XE 4Y89A 1DCLA 3MRLA 4KK8D 3WFZA 2WWMD 1JPSL 1MI5D 2VIRB 4K9EC 5E6ID 1KG0A 3W2DH 4FFVC 1KLUB 3WFBL 5IK3B 1VFUA 1ZHBA 2VRAA 6CGTA 1VERA 3QNYA 3V8OA 3JV4A 3REWA 3OKKA 3PHOA 5ETUB 2B7DT 2GJ6E 4XNMB 3B9DA 3MMEB 4WIQA 3IJYB 1HHJA 5DZNA 2WUBH 5IJKA 5L6YL 3BKCH 1F2QA 1UYWL 4KJPD 4WI6A 1BVLB 1ZHNA 4LSRH 2P1YA 3HUJE 1DL7H 1N4XH 1MLCA 1MH5B 2WUCL 3OL2A 3SBWC 3KYAA 4D0DB 3J7HA 4OB5L 3QNXB 5C8JA 1FN4B 3TJEH 1VHPA 5IW6B 2XZZA 2X70A 4PRHD 1OB1A 2OJZL 3TP4A 3QISA 1FVCB 4IHOB 2AGJH 2DJSA 1CR9H 4QNPE 2FBOJ 4PB0L 1PKOA 3WLWD 1QG3A 3HLAB 1CD9B 1MHPH 3FB7B 3SDAC 2A6DB 3VD7A 2C7UA 2MHAB 1J0IA 4L8CA 3GMPA 2NR6C 1OSZB 1LDPL 2WSKA 4ONFL 5ABDE 1XIWA 2BVOB 4ORZC 1T5WA 3IRPX 2ZUXA 4K7PH 2H6PB 4Y1AB 1ZAGA 2V5YA 3ARGC 4XVUC 5E8DL 3RL2B 3TPKA 3ZTJG 1KIRB 2XXCB 4R4NC 2NW2B 2YN5A 3MJGX 4BFEA 4POZD 1UKQA 1MVUA 2J12B 4A6YH 1NMAH 1QTYT 4P5TC 3DBXA 2ZPKL 3DI2B 1I9JL 3S96A 4ERSL 4G6FB 1UM4L 2J8UE 3F6IA 4HC1L 1JGVH 2FD6H 1DEEA 5CD3A 3BKYH 1J11A 1ACYH 3DX7B 4EDWH 3IRZA 2Y6SD 2IAMC 2DMCA 1O7VA 1T7XA 2V17L 3P77A 4U6YA 8FABB 5HI5D 3RBGA 4DZ8A 4Z7VF 4YAQB 3BEVA 3PWVA 4NQEE 1LEIB 3M17A 5IVXE 5MEPB 3T2NL 5D1ZD 1XR8B 5C2BH 3UTSE 3TO4C 4NFCA 5INCA 5F7LB 2EEDA 3EYVB 3MJ7B 4K94H 1CK0L 4O02L 3CPLA 3GGWA 1CGSL 1FNAA 4ZOCA 3AB0B 5I17A 4OFVA 1IC7H 4ZS7L 2WIMA 3QUYA 4YHIA 3CSPA 5HYFA 3VGDA 3MJ6A 2CXKA 2A83A 1RU9L 3WKML 1CFTA 1ZA3B 1I9IL 5DVOA 5EBLA 2M1KA 4PJGB 4P2RA 3X3GL 1PD6A 3M8OH 4HJGB 2OXGA 4JFEE 4M7KH 1XGTB 2DBLH 4L4TE 5ADPH 3S4SB 4PRNA 1YN7A 2VTFA 3BMVA 3DNKA 4O5LL 2YHGA 3VFMB 3B9KA 1JIBA 3KG5A 4ONHA 5FA4A 1TZIB 4YDVB 5F1NA 1E28A 2KL6A 3KPMB 5DJCB 2P45B 3ZTNL 1X4YA 5C0CB 1U9KA 2CDEB 5MEOA 4TNWF 4U33A 5GJSL 2DF3A 1AD9A 3IDJA 5IVOA 1T89C 4PR5A 4MD4B 3BRGC 3O9WC 2WBJB 3UYPA 1QSZA 5GS2D 2CO7B 1FJ1B 2P5WB 4HZLB 3ELAT 3O41A 1DQLH 2D0HA 3QFJA 5C0JB 3C5SA 1ED3B 1S78D 3H9HB 1G7MB 3BUYA 1FNGB 3CVHB 5IMMB 3I02A 1A3RL 2EEBA 3U79A 4DCQB 1MJJA 1AR2A 3H3BC 1VGKA 2XY2A 5A2KH 4HGKC 2VABA 5T3XL 3BGFB 3KPNB 4F9PC 2AV7A 1G84A 3MLXH 3MLVL 5HHOD 1GXEA 1BD2D 3HG1A 1CDGA 3JZ7A 3P0VH 1QR1B 1MJ7L 1GAFH 4I2XB 3CXDH 2W0FB 4ZFOB 2Y5TA 2DWDA 4ZXBC 1F11B 2G2RB 4WTZG 4KFZC 4YWGL 4HF5L 5I1KL 1JHKH 1ZT1B 2EDXA 4JRYE 4APQC 3VXMA 1IT9L 3PABA 1NDMB 4M43H 1ZLUH 4LNVA 4LEOA 5C08A 5KS9B 1AO7E 4JZNA 4QRSB 1LP9A 3VXOB 1MLBB 4NFDA 3IAPA 5KN5B 4BUGA 2DQHH 4LBEB 4MQXC 2W0PA 4G80A 3QH3A 2Y7QB 3FQNA 4QGTA 1J5OH 2QTEA 3WIIH 1FZMA 4HD9A 3BKCL 5BOZG 4O2FA 2GUOA 3BPLB 4FZEH 3V5DA 1DL7L 1KCVH 3NIGF 3TWCL 2VXTH 3QUZB 2XTJB 2DQEH 4HK0B 4Y5XC 1GGTA 3BO8B 3K8MA 4AEIH 5FO9B 4R4BA 3P30H 1KGCE 3BN3B 1IC5L 5GS0L 1DVFC 3FQTA 5C09B 4TNWK 4HUUA 4HDIB 1PGRB 5EBWA 3D25B 2BSRA 1KCUL 5J6HB 3ZE2F 2RCSL 5SWSD 1ZWIA 3IKKA 4PJCA 1H3GA 4XP1H 4BH8B 5D7SH 4U1NA 5DD0H 1MHPL 3P4OB 3W39B 2FB4H 1I8IA 2YN3A 5LGHH 3WHE1 2D3VA 3V0AC 4QF1A 5D1QA 5TDNA 4H26A 2E9BA 3FQWA 4GLRH 5LWYL 4LF3B 1ZEAL 2V5TA 4P57B 4KROC 3UZQA 1PG7X 2ZSWB 1NEZG 5I2IB 3CGTA 2CLZB 3MLZL 1I1RA 1KXTB 3PQYA 4OGZA 5D7KD 3IXTB 1PX3A 5DFWH 4NHCH 1EERB 1QBBA 3FO2A 1F6AA 3DVGB 5IESL 2FD6L 1UZ6E 5TQ2H 4FQXD 3BKYL 5FGSA 2QR0A 3O6LL 1ACYL 2W1NA 3RTQC 1U3HD 5DK3A 2IC2A 2IH3B 4HIXH 3NCYS 2K7QA 4Y1AE 2V2WA 4NQXB 5E94A 4F7TA 3T0XA 4MX7A 1XF2A 5C0AD 3SDAB 2HMIC 1PVHA 3DSFH 5I30H 2OTUA 2Y4SA 4LCWB 3OF6A 1FYTA 3KS0H 3MGAA 2AJVL 1W0VA 1EVUA 1LWRA 1II4E 4Y0GA 1EBAA 1S9YB 2DLFL 4K94L 1U8IB 3LQMA 1VFOA 3ARGB 4Q9RL 1LO2L 3OKYA 3UO1L 3I50L 2KQNA 3REVA 1G0DA 2QQKH 4PJIB 1KNOA 2FJHB 2X89A 4GMTH 1NC4A 3LS5H 4HKXB 5F1IA 3QEHB 4WWKC 1DBBH 4WFGE 3T3MF 3M8OL 3MCLH 4M7KL 4YBQD 4P46A 5EN2A 2L0DA 3ZDYE 3U4BL 5EWIL 2ADFL 5E5UB 4AJ0A 5IR1A 4ZPVB 1OD9A 1DN2A 2PYEA 4OD3H 5D5MB 2BSSA 3VWKC 3G04B 3T0VA 2WINB 4UNUA 1FH5H 3TO4B 3MC0A 3RX8A 3KAAA 3WFHA 5JW5A 2ERJC 3RWFB 5JW4N 1JYVA 4PJGE 3S36L 1CIDA 5D7IB 4DTGH 2GYSA 5L7XH 1EGJH 2OI9C 4H5SB 2Y36H 4X0KB 3OJ2C 1DQLL 3DURB 2R0KH 4NQSA 4RSVA 5AZ2L 2NYYD 1Q0YL 1FNFA 1G1CA 2VLLB 4K7PY 3ZLQC 1UM6L 4EDXA 4M7LL 2HKHL 5MEQA 4R3SA 2HWZL 4KGLA 5C0CE 5I1JL 1FP5A 4YR6A 1A4JB 5E99H 3W11C 1UGNA 3MRMB 4PLJC 4XBEL 1E6OL 3CNKA 4O2EB 4F33A 4CBPA 3C60C 1EPFA 1F2XK 1MNUL 3ZE0F 4NJ9H 1GAFL 2P5WE 4U0RC 4X6DF 3V52H 4P3DB 4JB9L 1I7UA 4R8WL 2VLRB 5C6PB 2E6PA 1T03L 4HWEL 4TUJA 4NO3B 5D96C 5ENWA 3AMKA 3U46B 3W5MA 1Z5LA 4J3XA 1AJ7L 2X4QA 3O9WB 4HHAB 3JWOH 4IOSD 3UPAA 3W0WE 4M5YL 5T1LA 4YIQB 3MA9H 2DQHL 1JPGB 4X4ME 5IJKC 2D4DA 1A6VH 3H42L 5DC9B 5EZLB 1H15B 3FFCD 4I2XE 3WIIL 1DLFL 4DAGH 1KTLB 4FZEL 2VQTA 5ALCL 3AAZA 1X5LA 1P4BL 1YEJH 3OGCB 2DQEL 4YGVA 2BVEA 3X11B 3KXFB 3EYFB 3MTRA 3GIZL 4JRXD 3SY0A 1NANI 3WUWG 1INQA 4OZHB 3VRLF 5ID1A 4NNXA 5KS9E 1G9MC 1U8NA 4YBLC 1S9XB 1ORQB 3QQ3A 3EW3B 3WDJA 5I1AA 4ZXBB 4MNQB 4NUJB 2AAVA 4EBQL 2J4WL 4APQB 4F7MA 3MBED 5LGJB 4JO2H 4Q6YA 1H3WM 4S1RH 4HWUA 5KZCB 2JKXA 5T3XD 5DD0L 1IM9B 4D3CH 3RHWF 5M7QA 3DV6B 2YD4A 3LHPH 1CGXA 3C8DA 5FECB 2XTJE 1XIWC 3VI4E 2EDHA 1T4KA 4HBCH 4X5WB 3CFIC 4I0KA 3T3PF 5IMKB 5JIIA 5C09E 3OKMB 3WUZA 1BIIA 3QZWA 4K9EH 1ADQH 5D6CA 4OGYH 1UWEL 1I8MA 4U2ZA 1OVZA 5DVMA 2GJ6D 3QIUA 1ZLWH 4BKLB 1GGBH 1S7RA 4NJAH 3CZFA 3CX2A 4LCUB 3RDTD 4WHDA 1DVFB 5E2WH 4NHCL 1JGLH 5TQ2L 1WWAX 3DUUA 2F54B 2D0GA 3UDWC 1TVBA 4U6HA 1W8NA 2Z93B 2X4TA 4CADA 3FO9B 1YEKH 5GGUB 4R2GD 5ESVB 4WDIA 2PTVA 4U6XA 3DYOA 3JVGC 5GS0D 2GAZB 1FL6B 4ZUUB 5I30L 2AXGA 4P3WA 2ZUWA 4LPCA 2BVYA 1BQHG 3X12A 1MVFA 2L4OA 2HJKA 2NY7H 4PP1D 1KPUB 4DGYL 1T0NA 2R1WB 2NZIA 4IOIA 4LLYA 1Y6KR 4LKCA 4KROB 3QUYC 4R26H 1OARH 3RVVC 1TTUA 3QEUB 5HHMB 4GMTL 3T1FB 3EYOB 5DYOA 2ZG2A 1J0JA 5GGQH 5DJ0A 2BDNL 1OAYH 1U2HA 4LCWE 4RFEA 3RTQB 5TPWL 2VDLL 2VDKL 1J0YA 3RHWK 3B9KC 3SE3A 1R5WB 4HUVB 5JW3H 4GW5A 4GG6F 1NSNH 1WAAA 4FMKA 4OD3L 1P9MA 5CMAA 1P7QA 5DUPL 2CDFB 3FJTA 4PJIE 5EO0B 1JZ8A 2R9HD 3DGGB 4I8DA 4P59H 1LO0H 2ATPB 2YD3A 1QLFA 2YA1A 4YZFF 5JDJA 5JMOC 5C6TH 3UC0L 1K6QH 4NQED 1S7TA 2R69L 4WNQA 4EI5A 4FXLA 4MJ4A 5IGXH 1DDHB 4QRTA 5GRJL 3UTSD 5F6HJ 4Z8FH 4FQHB 1JFQH 4QHNA 1AGDB 1FL3A 4L3EB 3VXUA 4BZ1L 3EOYG 5D5ME 4WWKB 5EOCJ 4F2MA 2CMRH 4OIIH 3BXNB 4R7DA 2CLRB 4PV8A 5DXWA 4FABH 2HVKB 3C9NA 4ZFFA 2A6KB 3V4UH 5E99L 2FGZA 4AQOA 4G8IB 2A6IB 4FFWD 1R5VA 1L7IL 4LPUA 5JXEA 1C08A 2V9RA 5DSCA 3B8SA 1T1WA 4NZUL 1RK1B 3JTSA 4K55A 3VWKB 1YMHB 2BY2A 4JFED 1IGML 4KUCF 4L4TD 4I18A 3CVHL 4QCIB 1A7RL 4HLZH 4OZGB 3V52L 2VLKB 5K33A 4ENED 3WBDA 1A9EA 3ZE1F 1XZ0A 5K59F 2ERJB 2E7BA 1EDQA 5E6YA 3DIFB 5AYQA 4KVCH 3O2VL 3TVMD 5ID0B 1QA9B 2NY6D 3JWOL 1RI8A 1GGIH 2OI9B 2XG5A 3BW9B 4X7TB 4AT6A 4ZG1A 1T1XA 3MRCA 4FXGB 3WFDL 4JQIH 5GGVH 5IHZA 3GRWH 3MA9L 4WV1C 4XC1H 1DANT 2VAJA 2EYRA 5HHXL 4ZFOL 1M1SA 3D2UB 3NOIA 5DGQA 2VLJA 4YPGA 4EQ3A 4DAGL 3GSRB 2P4AB 2VLRE 5CKGA 2HN7A 4GT7A 1KPVB 2G60L 2Q8BL 5EOTA 1TXKA 5HGHA 4KK5C 4Q58C 3C60B 2DOCA 1RZ7L 4UT7L 1KEML 3S3PA 3M07A 4GKOA 4KI5C 4P4RA 2X1XR 4Y16B 3A6OA 5I8KL 1QPXA 1FVDA 2YOCA 3ILPA 1KG0B 3WLBA 5AZEH 4OLVH 5D96B 2BVTA 2R0WH 4P9MH 3CSYA 1T2QL 1ZHBB 3QDAA 1SHMA 1FE8H 3QNYB 5CP7A 1TIUA 3JV4B 3REWB 2NY5C 1RFDL 4QXTA 2C9AA 1GZQA 4M93C 3LIZL 4GW1A 1WZ1L 4JRYD 3K0WA 5CZXD 5I71C 1G7PA 4OZHE 1A3QA 1ZHNB 4K9EL 2XA3A 1EK3A 1MLCB 4OCRH 3WS6A 1AO7D 3S37L 2VL5A 4MNQE 3VI3E 1JNLH 3ZKQD 2ZKHL 5JXAH 2EDKA 3BFOA 4OIAA 4TULL 2X70B 4NUGL 5E2WL 5CJQH 1V3LA 4YBLB 4B7IA 3JV0A 4Y2OA 1P69B 1NAKH 4KI1A 3VDAA 4PS4H 2P8PA 1WWWX 1KGCD 1X9QA 2IALB 3MV8A 3T04D 5IOPA 5CINH 2YXFA 4JM2B 4XCNA 5I15H 4F58L 1WFOA 1A9BA 2EDWA 2ED9A 4I77L 4WU5A 4N0CC 2C7UB 5E00A 4L8CB 3GMPB 1J0ZA 1I1CA 5FM5O 1XIWB 1T5WB 1AD0A 4YHZH 2Q7YA 3V4VL 2NY7L 4X4YA 1ZMYA 2IPTL 2AQ2A 2QSCH 4J3OC 5CEZH 1NCBL 2F54E 1A8JH 3S3JA 3VGAC 5JOFA 4Z95H 3DBXB 3GM8A 1CGVA 3S96B 4GRMA 3QDJA 4OGAC 2D7NA 15C8H 1DEEB 3E8UL 5CD3B 2VZTA 1LILA 2N4IA 3BWAA 4S1QL 3O3EA 2CRYA 2XPGA 3P77B 3A6BL 4U6YB 4Y5VA 1NCWL 1KB9J 3NMEA 1FPTL 3FAWA 2AERT 3JWDC 5I66A 1SYSA 2WQ8A 4ZS6D 3BEVB 3PWVB 3OJMB 3M17B 4YLQT 1RUPH 3W9EB 1IJ9A 2V2XA 5EPMA 1GVIA 4M9PA 3LAFA 4ZOBA 5INCB 1N6QL 5HHME 4TVSa 1PAMA 3HI6H 4P59L 3EBAA 4Y1AD 3CPLB 2QSTA 3OAUL 4Z18A 4OF7A 5I17B 3QUKA 4ZSOA 1NAMA 3RWHA 1ROWA 2ORBH 2HT4D 4LCYA 3QUYB 4QEGA 5KJRH 1OCWH 5F3HA 4Z8FL 4YHOH 1GL4B 4FN0A 5JO5B 2A83B 1J87A 2A0LD 4G6FD 1F8TH 1CFTB 3MUHL 5EBLB 3VW3L 4P3CL 4P2RB 5GHWL 4OIIL 4M4PA 3UPRB 2V2TA 3MRGA 5MERA 4PRNB 1YN7B 4FABL 2ADJA 3BVNA 4MS8D 1RIUH 3B9KB 5EO9B 2VXSH 1N8ZA 4JKKA 3X3FL 4ONHB 4WFGD 3RVWC 5FA4B 3W9DA 3CDFA 5F1NB 1E28B 4K2UH 1A6WH 1HHGA 4HS3A 2GJZA 5DJDA 1I75A 4EIGB 1Z6JT 5MEOB 4L3EE 2CRZA 1AD9B 2EIZA 3IDJB 5B8CA 3GSWA 4PR5B 1CDUA 2OM5A 1SEQH 4OFPA 1RUKH 4G6AC 4P2QA 1HINL 1ZLUK 4LLWA 4EVNA 1AXTH 1QFWM 3O41B 3QFJB 3BKJL 3SO5A 1P7HL 3C5SB 5B4MD 3GHBL 5IMLA 1NBYA 1QP1A 3BUYB 1GHFL 2HJLA 3HE6A 2ED7A 2ZUYA 5DD3H 4D9RD 1MJJB 1EEZA 2XXMB 4HKBA 3VXNA 3R1GL 3BJ91 3NCJH 4RWHA 4OZGE 2FO4A 2VLKE 5E2TL 4KKBC 2CKBH 2VABB 4G8FA 4HIJA 2W9DL 2AV7B 3U83A 4LMQI 1EEYA 4FNLH 2OL3H 3HG1B 1N59A 1H3PL 3ZYJA 3EHBC 5KSBF 3ARUA 4MNHA 3V6OA 5C0CD 5DRWA 2Y5TB 2DWDB 4Y8AA 3GKWL 3OAYK 5I1CH 4LLMA 1KUMA 1KFAL 3AY4A 4UZGA 5IFHL 2XZQH 3EDEA 1KJ3H 2F5AL 5AZEL 2XNAA 4OLVL 5SX4H 3PABB 2WBJD 1NCAH 4LEOB 4P9ML 1NFIA 1EJOH 3FONA 1X5ZA 5C08B 1FE8L 2VC2H 4W6XB 4MJ5A 4L4VA 2B0SH 2P5WD 1I1FA 4JZNB 1LP9B 3NPZB 3BUTA 1N0XH 3ARDA 2A9MH 5L2KA 4LHUG 1OP3K 1OPGL 4WV1B 4G80B 3QH3B 1MAKA 3FQNB 4FP8L 4P5MB 2O93L 1FZMB 4O2FB 2GUOB 7FABL 3STZA 2HG5B 3V5DB 3RNKA 1ZSDA 3SDXB 3W0WD 2ADGA 3QIUC 2EDTA 4OCRL 4M5ZL 3A6CH 5BVPH 1NGPH 4Z7WA 1PQZA 4MCYA 3FQTB 1SJHA 1MRCL 1EFXA 4HUUB 4HXBL 4UAOC 3MROA 5D72H 5CJXA 2P46B 3NZHL 4X7SL 2XQYG 3V4PH 3MACH 2FATL 4CVXB 3ROOB 1JP5A 1KJMB 2FEEL 1YJDH 5FM4A 1IZJA 2H9GA 1MCPH 1ZWIB 1CBVH 4PJCB 4PS4L 4U1NB 5CINL 5JIPA 4TNVF 4RAHA 1JHLL 4U05A 2XZAH 4WUUA 1CLCA 5IVZA 1I8IB 3U9UA 1N5YL 4QF1B 4KH2A 5TDNB 43CAA 1EAJA 4C59B 4LEXH 4M93B 2ZJSL 3FQWB 1MIMH 1I7ZA 4YHZL 1AGBA 25C8H 3K1KC 3MXVL 5I71B 3BDBA 3DUHA 2DQGH 1OTUD 4OCSH 5ITBH 4X99B 2AJUH 5CEZL 3QUZD 2XTJD 1CLYL 3MUZ1 1LK3H 4RX4A 4ELMF 5F97E 5LXGL 4D9LL 5GGVY 5C09D 3MGTA 3NTCH 1F6AB 1ZTXL 4LASH 3IFNL 3RA7H 4TQEH 1SEBB 4I9WE 5CUSH 4LLVA 4PJ5B 2CH8A 3SE3C 2V2WB 4PGDA 5ACLA 1KSRA 4URTB 3PGCA 4FFVD 3ZMRA 1XF2B 1P9MC 1J1OL 2ITCA 5JORA 3T3PE 2OTUB 5J12C 2CO6B 4Q0XL 3PWPB 1FYTB 6FABL 3K4ZA 3U7WH 1W0VB 1EZVX 2UVEA 4NKDA 4NRXA 3HI6L 2Y1VA 1AFVH 4DJMA 4O9HH 1E6JL 4OKDA 3SKJH 3IF1A 1A7BA 3REVB 4EI5C 1J1PH 1DQML 1RJCA 5B39G 3V6ZA 4BQ9A 2BHUA 1NC4B 2VL4A 5F1IB 3VGAB 5KJRL 5D2LF 1BAFH 5KVFL 1WQVT 4NQUA 4YHOL 1T66C 3K74B 4AK1A 2WQRA 1T83A 2YBRA 3CFBA 3V0VA 5I18H 1NFDE 1QQDA 3ZKXC 3QUMA 3B5HA 4WI2A 2MMXA 1OWWA 2APVA 5EN2B 1N64H 1RIUL 2QQLL 1JNNH 2FLBT 5JXEC 3SDAD 1FORH 5L8LB 3BZEA 1SM3H 2BSSB 1P53A 4I18C 4LCWD 3KYNA 1FIGL 1QFUH 5DWUL 3WFHB 5JW5B 3EZ8A 3L5WA 3ARGD 3ARVA 4R4ND 4P2RE 4Z7OF 1SEQL 3DX6B 4BSWB 4R7NA 1BHGA 1D9KA 5C7XH 3IS1X 2CSPA 2EE6A 2IANA 3S8WA 3QHFL 4EDXB 2OJEA 4KU1A 1ACZA 1F6LL 5GGRY 3B2VL 5MEQB 4R3SB 5DD3L 2PXYA 1HYRC 2EE3A 4YR6B 2F58H 5E03A 3ZKND 3D87B 3PNWA 4F33B 2CUHA 4S0SD 4IIQA 7CGTA 3EUUA 4OTXH 2RQ8A 1I4FB 5IIEA 1VFMA 3ZZ1A 1DR9A 1MOEA 2BSTA 1QFWL 1XEDA 1I7UB 3QFJE 3TO4D 1M7XA 1D5IH 4TUJB 3A67H 1S3KH 5ENWB 2YA0A 4LK4A 3VDCA 1KJ3L 1Z5LB 2V5RA 4DGIL 3D9AH 1EJOL 1R3KA 2ICWJ 1ND0A 5HYEA 4DEPC 4JDZA 2A77H 4HWBA 5CCKH 1JNJA 1N0XL 5EU6A 2BJML 5L8JB 3CU7A 4X6CB 2ZSVB 5D8JH 1ZVHA 3OBAA 1DFBH 4Q9BA 2DLGA 3WS6C 3O45A 1KCRH 2CJUH 3AAZB 3O6FA 1MPAL 2BOCA 2P49B 4NNPH 4YGVB 3GHEH 1ZLWK 1YNLH 3SY0B 2JIXA 5BVPL 1NL0L 1NGPL 2YPVH 3ZE1E 1REIA 4QRQA 5C08E 5ID1B 2ZCHH 5IT2L 1U8NB 1FIEA 1HKLH 4PGJA 2BNQA 3QQ3B 4OSUL 3ARWA 2YUXA 2VLRD 4HIHA 3V4PL 1OSPL 1X5YA 4F7MB 3QWRA 5CJOH 4HUNB 4GS7C 5C3TA 3O9WD 1DBML 1C5CH 1SY6H 1Y18A 3SDXE 3MLYL 1Z0MA 3VXSA 1VKXA 1T4KB 3EOTH 4S0TD 1G9ML 3T8XA 1H8OA 5DGRA 1ZOXA 1MIML 2R2BA 3WNNA 1FV1A 1F4YH 1BIIB 1D6EA 2GK2A 3QZWB 2DDQH 2Q86A 5D6CB 1P5UA 1KENH 4J4PA 4G6KL 1I8MB 1T20A 4XWGH 3QIUB 1QBML 4KI5E 4OCNC 3FTGA 1QR4A 2JTDA 4NBXB 3DJ9A 3ARZA 1KULA 2AK1H 3I6LD 1S7RB 5JIHA 1ORSA 2YD1A 4G5ZL 2HFEA 3LH2H 1HDMA 4BJLA 3AS1A 4UAOB 3QG6B 2B39A 2HH0H 3MRNA 5CAYB 3DUUB 1K8IA 4ZXBD 4MNQD 2AQ3A 1TZHA 1TVBB 4U6HB 3S35H 4XP4H 4CADB 4APQD 4Y5VC 3D85A 2VDQL 5KZCD 1JWUA 1IM9D 4WDIB 4U6XB 4PJDE 4GRLC 5DHVA 2VKXA 4BFIA 3VGHA 3KPSA 4NOFA 3BWUC 3X12B 4MJIA 4M7JL 3HMXA 2HJKB 1NPUA 4S10A 1AFVL 1T0NB 5IF0A 3P9MA 4LLYB 3RPIB 4LKCB 5FOBA 3GKZA 4G7VL 4IMKA 4C55A 3ARBA 2ARWA 5DD5H 4PJ5E 4OJFH 1KTDA 1KJVA 5ELIA 4WW1A 5F96H 4K7FA 5ANME 5DJ0B 3K3QA 2ICWI 1I9EA 4RFEB 3PWPE 4AIXA 4RMTA 4ONOA 2F54D 4XNYH 3TNNA 4MD5A 1EO8L 5KSAD 3NFNA 3MNZB 3UJTH 3L6FA 4M61B 3HCVA 1CVSC 2Q3ZA 5CEZD 1JNNL 4GW5B 1F5WA 5IM7A 4JY4B 1P7QB 4MLIA 4OGXH 3LS4H 1BIHA 3I6KB 4H8WH 5J12B 5JHLL 4O58H 3NFSL 2VR9A 3ABZA 2DMBA 1UXSA 5B8CC 2B2XH 1DBKL 4U7MA 1UXWA 4Q7DA 4WNQB 4L3CA 4KROD 4EI5B 2JJSA 3H0TA 4OF8A 5KBNC 1TVHA 2YEZA 3N1FC 2YSSA 4QRTB 3X13A 4QHNB 3OKNA 2DL9A 5HHMD 1FL3B 2MPAL 1L0YA 2ADIA 3VXUB 2YWYA 3HE6C 3LD8B 4F2MB 2BVQA 4PRHA 2R23A 4R7DB 4PV8B 4B5EA 1G7LA 3ZKXB 3RTQD 3R06A 2XG4A 4BK5A 3C9NB 2Z8WC 4NO0A 4ZFFB 1S9WA 5EOQL 4X6BA 1R5VB 3G6JF 4NP4L 1NLBH 1O0VA 5DSCB 5TE7H 1T1WB 5IG7A 1NMCC 1SMOA 3JTSB 1UACH 4OCWH 3V6OC 2JJTA 4XRCA 4I18B 1QOKA 1YUHA 2RAMA 1RQ5A 1P84J 3AY4C 1A6PA 1A9EB 3QDGA 1XZ0B 1VGEL 4LL9A 5EZIL 1MF2H 3LEXB 3D9AL 4AT6B 4QYOB 3U9PL 1T1XB 1B90A 1JRHL 3MRCB 4L3ED 5CCKL 4HUWA 2FYYA 5IHZB 4DFIA 4TTDC 2NW3A 2EYRB 3P2TA 4WWKD 5I16A 1WZKA 4YPGB 3DMMA 3LV3A 4LCIH 4XPTL 3S36X 3UZVB 3TIEA 5EOTB 5HGHB 4J6RH 4YO0B 4JGJA 3FQRA 1YNLL 3ALWA 5CJXC 4U1GC 2MCPH 2YPVL 1E4WL 3VWKD 1TETH 4JLRA 5EORH 3C8HA 4NT6A 5D1ZA 5HGAA 4P4RB 2VLKD 3ILPB 1FVDB 4NQCA 1OM3H 4X6CE 3WLBB 3CDGA 3CSYB 4ODTL 5CP7B 1UENA 5LBSH 1U8KA 4YDJA 3LQZB 4DEPB 4YH6A 5DD6A 4GW1B 4XH2B 1ZLSL 3NZ8A 1NANH 3PWLA 1G7PB 4D94A 3D2UD 1N7ML 1V05A 4K3DL 3G5XA 2VL5B 1Z2KA 3W11D 2X4NB 3BD5A 4PLJD 4MXVF 2AK1L 5I9QC 4BZ2H 2NY5L 5T1KA 3VG0L 4KTDL 1IC4L 3SHSA 5I0ZA 4G6ML 5HI3D 4M9OA 4Y16D 1ZV5A 3QCUH 4HIIA 3T1WA 1GC1C 3AS3A 1E27A 2X10A 1YECL 2P8PB 5IOPB 5F7WC 3MV8B 5GSVA 4GS7B 4XCNB 4OF6A 5FM8A 1A9BB 2XWJB 4WU5B 5E00B 2F8XC 5JIKA 2JB6A 1XH3A 1ZKAA 4ZOEA 3OKEA 3O11A 4GW4A 4YX2H 4CGTA 5IV2A 3ULVH 1OAKL 3TNMA 4X4YB 3VCLA 2BHZA 2A9NH 4M1DL 4MCZA 2EICA 5HYSG 4EI6B 2QKIA 4WJ5A 1ZLVH 5JOFB 1J10A 2BNUA 1PDKA 4KVNH 4Z7UA 3WXWH 4GRMB 3QDJB 3RJDA 1T83C 3NCBB 5MI0C 3KYMB 2ARJA 2HRLA 4MJ2A 4OD1L 4TSBL 1YEHH 2R29H 3BWAB 3KPQA 5DUML 3ZDXF 2EDYA 4KQ4L 2GSGA 4XNYL 1JMZA 3O3EB 2XPGB 2EH7H 4NNYA 3IFOA 4JM2D 3DVNA 1H0DA 5I66B 1SYSB 1BQUA 4IEFB 5AEAA 1CIUA 3FKUS 1GIGL 2NZ9C 4C58B 4I9WD 4GRLB 1HOCB 5EPMB 2V2XB 1ZT4B 4DOHE 1XIWD 4O58L 1HHIA 1CDYA 2J5LC 4PTTA 2P5EE 4J12A 1CFVH 1RMFH 4ELME 1PLGH 3QUKB 4ZSOB 1NAMB 3EYSH 5DRNA 1FYHB 1C7TA 3JWDL 5FO8A 1E4XL 3NABH 3KPTA 3KVQA 3V9FA 1WAAE 3GFUA 5JHDA 2DQJH 1QHPA 2V2TB 2PXYC 5MERB 3WIHH 2J6EH 1K2DB 2ADJB 2H2SC 3BVNB 4L8DA 3KJ4C 1CLZH 5SWSA 3X17A 3EO1A 1N8ZB 4IIQC 1NLBL 4S11A 4Z7NE 1D5MB 3W9DB 1U41A 3KHOA 4NKOA 4OFYA 2I60H 5BZWA 1HHGB 4OLUH 1QPPA 4HS3B 3IDMA 1EMTH 1MHHB 3LQAH 2H1PH 4RIRA 1CDBA 1QSEA 3VXUE 5B8CB 3GSWB 4AL8H 5DMKA 2Q8AL 5D2LE 2LFGA 1ZT7A 4UDUA 4IOFC 4P2QB 3UP1A 1V8HA 4EVNB 1S7VA 1RJZA 1X7QA 4PB9H 3RVVD 2FX8H 2AXJA 4HMCA 5T1DL 3FRPG 1G7JA 3C08L 3K46A 5JR1H 1NLDH 3MV7A 1ZA6A 5IMLB 2D4FA 1NBYB 4XPBH 2FRGP 3HE6B 4DUXA 2FCBA 4N0UA 4P2RD 1YC7A 4XPHH 1V7ML 1EEZB 3VXNB 2G9HA 2KUTA 1WT5A 4FQXA 4HKBB 4MWFA 2WMPA 1UWGH 3QXDA 2P24A 4FQLH 3O6FC 2MSPA 4G8FB 4NQDA 4HIJB 4H1LA 3B9KD 1MREL 1PKQB 3OKDA 1EEYB 3VRJB 1N59B 1NMCB 3PGFL 2JB5L 4WEBH 4MNHB 4BQCA 5BJTA 5DRWB 4J2XA 4UT9L 3JWNC 4LLMB 1JWSB 3K2UL 2LQRA 2XNAB 4XP5L 2D7TH 1A1OB 1NFIB 3FONB 4MJ5B 5AAMA 1I1FB 3QFJD 4LFHG 4N0YH 3U0TA 1FRGL 5EUOB 3U7YH 5C9KA 5L2KB 2JK5B 1FGVH 3RVUC 1KOAA 5HVFB 1FQ9C 1BBDH 5IEKA 1T7ZA 4J4PC 1FGNH 3STZB 2JF1A 3KYKL 1ZSDB 2ADGB 3Q6FA 4WUKH 4OCXH 1KTRL 4JPIA 3BSZH 5GRVK 5J89A 1KN2H 4WI7A 3E6FA 2JCCA 5I1GL 1PQZB 3HG1D 2GEEA 4MCYB 2R1YA 4MNGB 4S2SB 3MROB 2ZZUT 3TBVA 2DN7A 4UILH 5J0BA 4HC1A 1U92A 2OP4H 2H9GB 5BCAA 3FRUA 4F9LA 4JM4H 5AUMA 4DWHA 1NGZB 4IS6A 2A38A 4WUUB 3QULA 5C08D 1L0QA 5IVZB 2RBLA 3QRFM 3C09C 3ZL4L 2WW8A 1AC0A 1IGFH 1B0WA 4OZFA 1AQKH 1E4KA 3HKFA 3NA9H 1BQSA 3H9ZA 1AGBB 3QXVA 5HHNA 3WD5L 5HD8C 5E2VH 9CGTA 2WK2A 2VYRE 4IMKC 1RZ8A 4PJBF 3ARBC 1IKNC 1CVRA 4XP6H 2VXVH 1CFSA 1DBAL 1XGRA 3L3HB 4KK5D 5EOCH 5C6WH 3MV8E 4JFOA 5I9QB 2KKQA 3MGTB 4WGVB 1J9CT 4RGMC 5FYLH 1YDPB 2Z31A 4KI5D 4LLVB 3IDNA 4MA7L 2DAVA 3S37X 2R0ZH 3PGCB 1RZFH 4LSPL 4NRZA 5JORB 4ZUWA 4ONGL 1MJUH 3WO4C 1M05B 2FIKA 3SJVE 4NKDB 4NRXB 2VO5A 3QDJE 4M48H 2MCG1 2GFBA 1CFVL 3WN5A 3IF1B 5EIVA 2E8ZA 5HI4C 1UH4A 2XKNA 3EYSL 4JQVA 5I19L 3V6ZB 3KNBA 2AJSH 4JRXA 2YBRB 1KN4H 4FRWA 5MI0B 5I74C 1QQDB 3GJFA 3QHTC 1I1AA 1TPXC 4UIKH 3QUMB 5KVDH 1NGYB 4PJ5D 1NAMH 1NUDA 1YYLL 4PP2B 4KZEH 3GSQA 3V7AG 3MBEA 5CLWA 5T1MB 3UJIH 4ZSOE 2VITA 3BZEB 1P2CA 4N0CD 2JJTC 4YK4C 2CK0L 4OLUL 3CU1A 2VB5A 1FYTD 3OF6D 3PWPD 3T2OA 2R2HA 4C54A 4DFHA 1VADA 3PGDB 3L5WB 2J5LB 1N6VA 1ZXQA 1CDCA 3VGBA 5I1HL 2A74B 5DJ8B 1C5BL 4P4KA 2VXUH 4FG6C 2I9TA 1VPOH 2VDNH 4F7EA 4R7NB 3SDYH 3FT4A 4KTYA 2GJ6A 1IE5A 3LRGA 1NC4D 4D8PA 5A40E 3O4LA 5E4EB 4PJ7F 3RVTC 3ZKMC 2IANB 1SYVA 3MO1A 3RDTA 2OJEB 4XPBL 1R3HA 2PCPA 4OGAD 2XIDA 4KWUA 3HUJA 3DMMC 3L5XL 2PXYB 2DM2A 2CGRL 3GSXA 5EULV 5F9AC 1UWGL 3KGRA 35C8L 3MRFA 3PNWB 2X9XA 3ME0A 3KJ4B 5E2JA 4FXKA 4IIQB 5HI5C 5GZOD 3WHXA 1PG7H 5TF1H 3LMJH 5AG9A 1EH9A 4P2QE 2YRZA 3QCVH 1IGTB 2BSTB 5D1ZC 3T77A 3AU1A 1GZPB 1NC2A 4PLKC 2GK0B 4KMTH 4HS8L 1SVCP 5KVMC 4YHMH 3I75A 3OHXA 5H35A 1MRFL 1W72A 3IU4H 1T5XB 3S5LA 2UY7A 3MODL 1ND0B 2IBZX 1MAMH 5F7DA 4JDZB 4I13B 1YA5A 5L0QC 5DQDH 3KR3H 3LN5A 3EYUH 1PKQE 5T3ZH 4GAFB 3V6OE 5CSZA 3O45B 4UV4L 2FWOA 4LVEA 3H7BA 3O6FB 4WUKL 2BOCB 5FGCE 3CZJA 4K23L 4KDVA 4I1NB 1I9RL 3OPZH 3VJ6B 1LO3L 3SDDA 1KN2L 2J8UA 2JIXB 4L9LA 1DN0A 1JK8A 2E7CA 3RVWD 3HZVA 4QRQB 3UAJC 5JQ6H 1CLOH 1F13A 4UILL 2BNQB 3GBNH 2NQCA 4ZTOL 3NCMA 3QJFA 5EUOE 1D5BA 5L2KE 3KPLB 5FHBH 3Q6GH 2VQ1A 5HDOA 4JFYA 4PJFB 3GI9L 4JM4L 4K3EH 4G6AD 2Q6WA 4G6JH 2B4CH 4ELKA 4WEUD 2FHBA 1WEJH 4ETYA 4Q9QL 2AEQH 2HFGL 3UTPE 3VXSB 1VKXB 2HTLD 2XACC 5F89B 3DUSA 3NA9L 3T8XB 2I27N 2R2BB 4QHMA 1FV1B 4MNGE 1D6EB 3ILQC 2DM7A 1JPTL 1MEXH 1K8DA 4JHWL 4I3GA 5LCVL 4NM4H 1T20B 3OWEA 2Z91A 3FTGB 5I8CA 4KKBD 3P4MA 2DQUL 2VJXA 4XP6L 1ORSB 2R0LH 4IMLA 2PW2A 5EOCL 4Z78A 4XPGL 5C0DA 4AG4L 1HDMB 4WUUE 4DZBA 5DD1L 2UWEF 3EHBD 4HKZA 4ODVL 2NXZC 3L1OH 1TZHB 1A7PL 4HGWB 2EIBA 4YDIH 4CRPA 5B38A 3D85B 2B1HH 4U1HB 1MFEH 1OAQL 1JWUB 2X9WA 4N0FA 3TVMA 3INUL 4IRJA 5IW1A 3BE1H 1KPRA 3AVEA 3KJ6L 4GG8A 4P49A 3H6JA 2EDNA 4BFIB 3C09B 1J1XL 3KPSB 2CR3A 1QKZL 1TJGL 2R4SH 4MJIB 2NPLX 3MLUL 2IADA 5C86A 4DN3H 3P9MB 3HB3C 3QO0B 1HQRA 4U1KA 1YEEH 5FOBB 4YHYC 1Q72L 4V2BA 4DKAA 4KMLB 3QIUD 2DIJA 3LSOA 3PF2A 2H2PC 1KTDB 4ZPTA 3F5WA 1KJVB 1VEPA 2HKFL 4L5FL 1T1YA 4K7FB 3PHQA 3C2AL 3OV6A 2YKLL 4KXZH 1KN4L 2DLTA 2J3SA 4RGMB 1CYGA 2ICEA 1DQQA 4UIKL 1BQLH 3TNNB 4MD5B 2UZIL 3NFNB 4NO2A 1ZANH 3L6FB 2VR4A 5HDQL 3HCVB 4NKIH 3F7RA 5DK0A 2XQBL 2J88H 5IM7B 3WNOA 1R3JA 5C0IB 3GBML 3WO4B 3TLRA 4JRYA 1UXSB 2VERN 4MXWL 2B5IC 2E27H 3EOBA 1P4IL 1U93B 2JELH 5CEYA 3WNPA 1UXWB 2VXUL 3H0TB 1L6ZA 1TVHB 1UCBH 2YSSB 1KCSH 4RMRA 2OK0H 1H3UA 4JFQA 3WL9A 3OKNB 3L9RA 4WFHE 2P5ED 2D9CA 1QLRB 5KANI 1H8SA 4CNIB 3W82A 2BVQB 4PRHB 2R23B 2ENYA 4FQXC 3ECBB 2YUVA 4J3SA 5I74B 1G7LB 1TPXB 2EDEA 3R06B 4NZRL 4XCCL 1HXMA 3L7FA 1G6VK 3CUPB 1QLEH 4NO0B 1ZHKA 1NH6A 4JPVH 4X6BB 3TT1L 2VZVA 3ULVF 4RGOH 1CDJA 4GXVH 5IQ7H 2NY3C 1OAXH 5IG7B 1J05B 5TF1L 5B3JE 4QGYA 1P7QD 3LKOA 4XRCB 5ETUA 2R1XA 2AKRA 1JN6A 3F7PC 3QDGB 2G5BA 3TYFA 2IANE 5H94A 3HNVL 4KMTL 1PX4A 4OZ4B 4QTIL 4YHML 2YUWA 3PWUA 3QG7H 1BVLA 3OSKA 4EI5D 4KKAD 3U30C 3M1BA 4AM0B 1BMGA 1XGUA 5A43C 1MAML 4H20H 4CW1A 4KK9C 4ZUSA 5IFAH 5DQDL 4HUWB 4QOKB 2FYYB 3HRZB 1T66D 3VXUD 4GLRI 4PG2A 1K9TA 2NW3B 4NN7C 4P2CG 5FM5M 2XKUA 1IM3B 2P8LA 5I16B 2EEAA 1VFBA 3DMMB 3LV3B 1YNKH 3RUGA 3WFEH 3TIEB 1S5HA 5F1OB 1A47A 3FQRB 3OPZL 3FMGH 1U58B 4E42A 4MB5A 4JLRB 4HT1H 3U4AA 1CGWA 4NT6B 1CLOL 5HGAB 1MFDH 1UFUA 3ARYA 4NQCB 3MXWH 4JAMB 4F9LC 2F5BL 3CDGB 4M62H 3UZEA 4UTAL 3UPCA 5CSBA 2NW2A 3DX9A 1TTGA 1IILE 3UYRL 4MQSB 5IB3A 4NO5B 1U8KB 4YDJB 2EKSA 3VD5A 5L0QB 4D0BA 1B4JH 4YQXH 5DD6B 1E4KC 4PD4K 3NZ8B 5ILTL 5BVJA 3PWLB 3QPXL 2LAGB 4Z7QF 1EHXA 3UMTA 4Q9CA 2BNQE 1UA6L 1XAUA 1C1EH 1HSBA 2BSED 2X09A 2XRAH 1ZLVK 4JHAH 4PJ9B 4ZD3L 2KBGA 4ODSL 4TVPE 5T1KB 4PJFE 2ZCLL 1LEIA 4KAQL 5CSGA 4PYGA 12E8L 3L3DA 3GIVA 2Z31C 3UBXA 2DD8L 3STLA 4HIIB 2DL2A 3VXSE 1E27B 3L1OL 3WXVL 2J1KA 5GSVB 1PZUB 2AJXL 1BWMA 3RJQB 1RJLB 4CU7A 2Y07H 2FDBP 2DQDH 5DK2A 1X5AA 2JB6B 1XH3B 3U1SH 3OKEB 1INDL 3O11B 4M3JA 5IJVB 1YPZB 3MJ9H 4NSKA 2Q87A 5IV2B 3TNMB 2C3VA 3DYMA 1J18A 4XCEA 3VCLB 3WN5C 4PJGA 1GC1L 1FO0A 4MCZB 3T0WA 4JQVC 2QKIB 5GRXG 4WJ5B 3VA2C 2BNUB 1YNTB 1YY8A 2MQCA 3AM8A 2M2DA 4HUKB 5DHVH 3BIAX 3HMXH 2ARJB 3KPMA 1CGTA 2H45A 1I1AC 5EFIA 3RU8H 3IGAA 3V6FA 3KPQB 1CE6A 2NXZB 1UM5L 2HJFA 3BN9C 4ZYKA 2GSGB 1URLA 4HQQH 1OAUL 1QNZL 3MV8D 1ZANL 1JF5A 1DANU 4NNYB 5DTFA 3B9EA 3DVNB 3O2WL 5F8QC 1UG9A 5HTSA 5BV7C 4HZLA 3ULUC 3VFWA 3VWJD 2GHWB 3SE8H 3ZYOA 3DTXA 2DTMH 4TUKL 1WWCA 4U6VH 4PTTB 3CVHA 3EYQD 3PL6A 3QUML 4P4KC 4UV7H 5DRNB 1F3DJ 4YHYB 2NTFA 3W0WA 3E6HA 5IW3A 1KCSL 3G6AA 1HN1A 2YK1L 5FO8B 4RFOH 4X4MA 3QFDA 2DLEA 3RDTC 3QDJD 3GZKA 1BX2A 3OZ9L 4J3UA 2VN4A 5JHDB 4I2XA 5DQJA 1F11A 2BRQA 4JDTH 1QLEL 1TTFA 3FZUC 3GNMH 3HPJA 3EO1B 4R2GC 4LQFH 4KV5E 4PJAB 5BZWB 1B6UA 1MFCL 2GSIA 4GQ9H 3UROR 1G9EA 1G9NC 4GRLD 4AH2A 1MFAH 4MGXA 1T6VN 3SKMA 1AGFB 4MDIA 4XP9H 4Z76A 3EO9L 4RIRB 2QEJA 4PP1C 1QSEB 3B5TA 2DQCL 2Y7QA 2HFTA 2B5IB 5TE6L 4UNVA 1S7VB 1RJZB 1TJHH 1X7QB 3O0RL 5FO9A 2X9YA 1A7QL 1G7JB 4H20L 4NKMB 5IFAL 3MV7B 3RAJH 2EO9A 4N0UB 2ZWLT 4OZIA 1ZS8A 4XTRC 2G9HB 3CAFA 3QXDB 4QXWA 2QHRH 2O5YH 1TFHA 1YNKL 4GUPA 4NQDB 5HXMA 5I0DA 3QDGE 5J6HA 3WFEL 3SDDC 2EO1A 3OKDB 2NY3B 3QEGH 4L9LC 5CLTA 4FTVA 3HI5H 1OTTC 4HWBL 4O4YH 4EUPA 5L9DH 1RZGA 2GITB 1CD1A 2IG2L 4OFIA 4OD2A 1A6UL 3AXLB 3MOBH 1MFBH 1MFDL 3HNTH 5BO1H 4MA1C 1XGQA 3O4OC 2PF6A 4QOKE 3MXWL 5BRZA 4RAUA 4WGWB 4M6NH 4OV5A 4NZJA 4P2QD 3BRDA 1P7KA 3T0EA 2YMXL 2OBGA 3U30B 3U0TB 5GGSA 4XXDA 5EH1A 1ZHLA 3B43A 3IXTA 3HE6D 5CZVL 32C2B 3BZ4A 4NN7B 5DC4B 2YRLA 4XNZB 2YD5A 5IEKB 5GJTL 3ZT5A 4Y2DA 3Q6FB 4RGNB 3MBXH 4JPIB 5ACMA 4RRPG 4CDHA 3E6FB 2JCCB 5F6IC 3S88H 5IHUH 5IBTH 3TBVB 5J1SC 1LE5A 1OW0A 3QEQB 5GRYA 1U92B 1WFTA 4C83A 4ENEC 3MZTA 3R8QA 2CUMA 3OR6A 4JJHA 3TH3T 1S9YA 1U8IA 3FRUB 4HPOH 3OG6B 3PDOB 1KB5H 2CXGA 1IVLA 3PP3H 4IRJC 4IS6B 3K4DA 3V95A 1BEYL 2OLDA 3AMLA 3ZDZF 2Y07L 4JG0L 2FJHA 4QRRE 5L2KD 5CEXA 2ID5A 3U1SL 1M7DB 2OR9H 4TTDD 5HHNB 2E6QA 2BC4B 1XGYL 3SE9L 5DVNA 4W81A 1IGYA 2VDRH 3UTPD 2N7BA 4OLYH 4JFOB 2GY7B 4ZPVA 3QCTL 5E2UH 2Z31B 4Z7VA 1LEGB 3N9GH 4PJXB 2IFFL 1OTSC 2VH5H 5HDBE 3VMPA 3OXSA 1YPZE 2D2OA 4BELD 4U1LA 4WUUD 4NRZB 1R0AL 3FQUA 3VFUA 4ZUWB 1KELL 4MMZC 4ZO8A 4KPHL 2FIKB 3SKNA 2VDMH 1GOHA 4JFPB 1R3IL 2GFBB 3O6MH 3WN5B 4IRZL 4YDKH 2XKNB 4YUEH 4E0RA 1BFSA 1MCKA 5IBUB 3KNBB 4M6AA 4RX4D 1IGIH 3KPOA 2FGWH 1OP5H 1P4LA 2IJ0C 4IRSB 4Z7WF 3MX0A 3GJFB 4MA8L 1I1AB 1S5IH 2R8SL 3FN0H 2A1WH 1UADC 1JZ4A 3GSQB 2W38A 1OGAB 2VQUA 2BVPA 4ODXA 4W4OA 3O2DL 5E95B 2HRPL 1Q1JL 2B1AH 5GRUH 3O9WA 2VITB 4LQFL 1P2CB 2WANA 3CLFH 2EDJA 5BV7B 3IFLL 4IDJL 2DICA 1VADB 2H32H 4PBWD 2A73B 1IFHH 1R3LA 2VNCA 3ZSTA 5JHDE 4P4KB 1T2JA 4CDGC 1EV2E 4N8VG 1JGDA 1FAIH 2GJ6B 3AREC 3SDCC 1BM3L 4D8PB 2X41A 1N0LA 3O4LB 4OLZL 5HHVL 4PG2C 1SYVB 3MO1B 3THMH 4ZOAA 2SEBA 3PP4H 3RDTB 4ZFZA 2PCPB 2VDOL 4PJAE 5M95B 5E7FA 1JPSH 2APTA 2R39A 3RQ3A 1ORQA 3L3KA 4ZXBA 5JUEL 2QHRL 1LO4H 2O5YL 3L7EA 4OFKA 3MRFB 4U1JA 1QSEE 4WFHD 4FXKB 3WFBH 4YE4L 3WHXB 4JN1L 3LVEA 4R2GB 1IM9A 4GFTB 3HI5L 3DV6A 3T77B 1RUAH 5CGMA 2FEEI 1NC2B 1JCKA 2WAHA 3MV7E 5T5NF 5L6YH 3HS0A 1HSAA 3K2MC 4NFBA 3IVKB 5HYIA 3OHXB 1BBJA 1CFBA 4N0UE 4M6NL 4H1LH 5H35B 1HEZA 4N5UA 1W72B 2AJYL 2HT4C 3S5LB 2WUCH 3VU2A 5F7DB 2DLIA 4NQDE 4OB5H 4OLXL 4Y19A 5E5RB 3RWEA 5C0GA 3LN5B 2IAND 3VH8A 3D5OF 4CN1A 2YPKA 3PUCA 3NH7H 5JLZA 2AJZA 5C1MB 1KACB 2DWEB 5CSZB 1S7XA 1CN4A 1UKSA 1RIVL 2PXYD 2APWA 2FWOB 3H7BB 4QXGL 4ODWA 2H2SD 2UYLA 4MS8C 1RUQH 4PB0H 4PYHA 2Z93A 1JWMA 4WW2A 5KSAA 2AABL 3FO9A 3SDDB 2J8UB 4L9LB 1KIQA 1DN0B 1JK8B 5EU3A 3HZVB 5F9DC 4BH7A 4PJEB 5ESVA 5FYJE 3O81A 1O7SA 4ZUUA 1BPVA 4AIOA 3DRTA 2W92A 2C3XA 1LDPH 3QJFB 2AEPL 1D5BB 4MA1B 3H3PL 4JO4H 2MOVA 1KPUA 1OQXA 2VQ1B 4JFYB 4IOFD 3MLPA 2K1MA 2Q6WB 2N7AA 1DQTA 4ELKB 3HI1B 4RGNE 3QDMB 4XHQA 5B4MC 2ZPKH 1I9JH 4ERSH 4HC1H 3IXAB 3DUSB 4QHMB 4Q74A 5HHPA 3BH9A 3JUZA 5H2BA 4YFEA 4HUXA 3DWTA 2HAZA 3QEQE 2JJWA 1RK0A 3O6FD 2Z91B 3IB4A 3OJDA 5I8CB 1JF1A 4H25A 3P4MB 5C07A 3AM8C 2V17H 1R5WA 2JIXD 2JJVA 2PW2B 3ESVF 4Z78B 1G0YR 5C0DB 5F6IB 4OZFH 3T65A 4XVSH 3FB8B 4HKZB 3T2NH 3MNWA 2W59A 4XC3L 5EO0A 2BNQD 2OZ4A 2ATKB 3V7MA 1WFUA 3N9GL 1CK0H 3U48A 1CGSH 3QWRD 4WY7L 5B38B 5BZDA 4N0FB 4IRJB 5IW1B 1KPRB 4GG8B 2BY1A 4RMVA 1FL5A 3FHAA 3RZCA 3VXSD 1RU9H 4PUBL 3WNLA 3RVUD 3PL6C 4OCYL 1HH6B 3X3GH 2EXWC 1HQRB 4J4PD 3HAEA 43C9A 3TYGL 4PJXE 3LSOB 4IJ3C 4C56B 1K4DB 4ZPTB 4G8IA 3F5WB 3GMQB 1OOAA 1IGIL 2FGWL 2NTSP 2GQHA 3PHQB 5CIPA 2EH8H 5FOJA 5CJ5A 3WSQL 2OTWB 3VWKA 3ZTNH 4EXKA 2ICEB 1DQQB 3VE0A 3TH4T 1OD7A 2R2CA 5GJSH 2I25N 2Y23A 4WI4A 4XB7A 1IEBB 1JF6A 3D85D 5DK0B 4LLUA 5LAXA 5ALBH 3QQNA 5GRUL 4IM8A 1QYGL 4N8CH 2NY4D 5C2UB 1QFWI 1R3JB 1MCWM 3P0YL 5JDSB 1L4IA 4X7TA 3KPSD 4L1DA 2XFXA 4G8EA 4P23A 2QJDA 3I6GB 2O5XH 4JJ5A 1A3RH 5I73C 5HD8D 5CEYB 2GT9A 3F58H 3H3KA 3D2UA 2FLRT 1LGVA 2P43B 3WL9B 5T3XH 1FAIL 3L9RB 3QIWA 2AJ3A 3MRPA 1OGAE 3MLVH 1N5AA 1FZJA 1CTOA 1MJ7H 1U8MA 3GDBA 4YWGH 1HXMB 3L7FB 1LD9B 4HF5H 5E5MA 5I1KH 4Y16A 3ULUE 1OL0A 1ZHKB 4I0CC 3VFOA 4ZTPL 4DVRL 1LO4L 1IT9H 2F19L 4QWWC 4KJYA 4MZ3A 2QADB 5E08L 2IWGA 3R8BB 3VXTA 3CIQA 2XKSA 5SWQB 4L29A 5IB2B 4KHXH 3LKOB 3NIFE 2R1XB 2IMNA 3QR2A 2AKRB 1LEKA 3S4SG 3DROB 1RUAL 5F88A 3O4LE 1JN6B 2G5BB 5DLMH 2YZ1A 5EIQA 3TYFB 5H94B 2WBKA 3PWUB 3D6GA 4GJTB 2DRUA 4EJ1C 3T0EC 5HI4D 3TWCH 2E7MA 3M1BB 1D3CA 3AREB 1XGUB 4X7EC 3SDCB 4CW1B 4ZUSB 2VOTA 1B4RA 5CFHA 1IC5H 5GS0H 4GXUN 5E8PA 1FNHA 1QACA 3NH7L 2P8LB 4UTBL 4Y2DC 1VFBB 1BOYA 3MPCA 4AIZA 2DQIL 2MQ0A 4UINL 4LAQL 4NO0D 4HSQA 4KMQA 1KCUH 5IMOA 3RUGB 2RCSH 1W72H 1CE1L 2FJGA 1ODAA 1RUQL 1MCNA 1S5HB 2IALA 1FAKT 4Q2ZB 4WO4A 1KT2A 4JM2A 4E42B 1EIBA 1CTNA 1YZZA 5IQ9B 1OW0C 3BAEL 4TSAL 1CZ8H 1TJIL 4NC1C 4U2YA 2DI8A 3QDGD 2AVGA 4JO4L 5LWYH 1ZEAH 4X6EA 3QI9A 5F1SA 4W4NA 4FG6D 3DX9B 1HQ4A 4HGMA 5IB3B 2EKSB 3TIDA 5HY9A 3MLZH 3GK8L 4WI8A 4FQ2H 4D0BB 4QOKD 5DZOA 3RVTD 3VD9A 3ZKMD 3U36A 1YN6A 5BVJB 5SX5K 5IESH 4LU5H 3D69A 4PJEE 4HFUH 3O6LH 4QLRA 2YUZA 4X83A 3DMMD 5DO2C 3ZKNC 3V2AR 1HSBB 3WE6A 3UDWA 5EC1A 3O3DA 1S9KC 3CMOH 5ERWB 1NFDA 4XVSL 3EJJX 3L3DB 3JVGA 3GIVB 3UBXB 5J6GA 2AJVH 3W9EA 3STLB 3QDME 4MAUL 4NQCD 1F4HA 4KKCD 3NIDE 4PLKD 2DLFH 2NY1C 1QSFA 4Q9RH 5LJYH 1LO2H 3UO1H 3I50H 4UB0L 2LVCA 3G6DL 4TTGA 2DKUA 2RGSA 5DK2B 3P40A 3VFGL 1NBQA 2IH1A 3MA7A 5JO5A 3RIFF 2Y06L 4NSKB 5FV1L 4HCRL 4V2CB 2C3VB 4XCEB 4XCFL 1KEGL 1D6VH 1FO0B 3UPRA 3OKOA 1R24A 5DJ2A 4LP5A 3CFJA 1YY8B 5EWIH 2ADFH 3U4BH 4PJ9D 2NNAA 5EO9A 3TO2A 1YYML 5T1KD 4FS0A 5DJYA 2EH8L 2IMMA 3UAJD 5EFIB 2EZ0C 1A14H 1AHWA 4GG6A 2BCKA 3IGAB 4MXQC 3V6FB 1CE6B 2HJFB 1Y6NR 4ZYKB 4O00A 4OM1L 3GJEA 4W4OC 4JHBA 4HEME 5GISL 5DTFB 3S36H 5CBEB 2WP3O 5GS1A 5ALBL 4N8CL 1SVZA 3ALXA 5E1HB 2DM4A 2CLVA 3N1MC 3VFWB 3IU3A 1NJ9A 5AZ2H 3DTXB 4C56E 1Q0YH 5HBBA 3C6LA 4I5BA 1UM6H 5CBAB 1JYWA 4M7LH 3PL6B 1TCMA 2HKHH 2O5XL 3C6SA 2QSQA 5INDA 4RA0C 3RPKA 5F44A 2HWZH 1F4AA 4UT6L 3ILQD 3F58L 5I1JH 4M00A 3MLSL 2NTFB 2UZXB 3W0WB 3E6HB 1LMKA 3SGEH 4P0DA 4XBEH 1E6OH 1JRHI 3G6AB 2P7TB 4IJ3B 1MCWW 4N1HB 3KYOB 3QFDB 5BV7L 4UBDC 3ULUL 1BX2B 1MNUH 4GRWB 4CVUA 2RIKA 3B2UC 4L4JA 5DQJB 2BOBA 4JB9H 4R8WH 1KIPA 2NXZD 3BPOC 1T03H 4HWEH 3U0PA 5FUCC 4A6YA 1EUTA 5HGGS 3HPJB 3RWJA 3IJSA 1J0KA 1AJ7H 3EJZC 3HE7C 3UTOA 5DT1H 3RIFK 3MLRL 2GSIB 4HK3J 4M5YH 2OCFD 1F97A 4AH2B 4KHXL 5DUBA 3ZKSD 4QHKJ 3SKMB 1I1YA 4KY1H 4MDIB 3TT3H 4Z76B 1KLGA 4WV1A 5DLML 5ADOL 3H42H 2XWTA 1RJYA 3NCCB 2AI0H 4P5MA 5TH2A 3HB3D 5I73B 1DLFH 2FH8A 2HG5A 3SDXA 5ALCH 8CGTA 1KYOJ 4TSCL 1P4BH 4PJHB 5AYUL 1AGCB 5IKCA 2H2PD 3GIZH 5T33L 1G9NL 1X5KA 4QRUA 3MR9A 4Z7UF 4YDLC 5HGBA 5JHDD 4OZIB 5HYJE 1ZS8B 4KUZH 3T09A 2X1OA 4UIMA 2AP2A 3CXHJ 4CL7A 1DJSA 2J8OA 4CVXA 3TGXA 3DPBA 4WW2C 4GUPB 3ROOA 3RY4A 5KSAC 1KJMA 2J4WH 4EBQH 1W72L 4RMWA 5CP3H 2ZOKB 1CXHA 3VXPA 2Z0BA 1YY9D 4FTVB 4OFYD 4HLZG 3H8NA 4EUPB 1RZGB 4N1CA 1CD1B 4OD2B 4YXLL 3EAKA 3ARFD 1RZKC 1CZ8L 1XGQB 1HIML 4N68A 1QSED 5BRZB 4RAUB 5A2JH 4OV5B 1UWEH 1P7KB 4PJDA 3T0EB 3PP3K 4X99A 3WIFB 5GGSB 2VZSA 3RUGE 4XXDB 2V5MA 1ZHLB 2D7OA 4NC2B 5KW9H 4S1DC 3MV7D 1HWHB 4FQ2L 4DUVA 3MV9A 3BZ4B 1VFAB 1RVFL 2X7LB 4Y4KA 5CJBA 4LU5L 4HFUL 1GGCL 4RAVB 4Y2DB 1SEBA 3CD4A 5GGTA 1MQ8A 5FF6B 1FDLL 4NQDD 4PJ5A 4C57C 2K7PA 5I75C 2X1WL 2NY3D 4TPRL 5DEGA 5ANMA 2W9LA 4XX1G 3CMOL 1FG2A 4JO1L 1LE5B 4QTHA 3PWPA 1I3UA 4C83B 3BGMB 3OR6B 1QRKA 1QO3A 1A5FL 3GMLA 3KLAA 4DGYH 3P4NA 1X44A 1EFQA 1JHTA 3WDHA 1IQWL 4LVHC 5GSRA 1LHZA 3RZCC 1RD6A 4U1IB 5I1IL 4J1UA 5CEXB 4KK9D 5J11C 1U8JA 2FHCA 3PXJA 2BDNH 2YPLA 3MZGB 2C4FT 4G3YL 2KZWA 1D6VL 1WZMA 4QHKI 5TPWH 2VDLH 4OT1L 1BJ1J 3WFCL 2VDKH 1IGYB 4RNRA 4RGND 1B88A 1E4XI 5E9DB 1WBXA 2YZ8A 4PRIA 4NPYB 1IAIM 3QRGH 4CU8A 2VZ3A 5DA4A 5L88L 5DUPH 5DA0B 2VZ1A 2ZUVA 3QEQD 4Z7VB 2WBWB 3TN0B 1A14L 1RSFA 2NY1B 1NUNB 5F7MC 3UC0H 3OXSB 5H37H 2C1PB 4DUWA 2R69H 4U1LB 3BESR 3DX6A 3ZT7A 4BSWA 3TZVA 3FQUB 5GRJH 3SGJA 3VFUB 1Q0XL 1CWVA 2ESVA 3MRJA 2AV1A 4P23C 1L9MA 3QPQC 1R5IA 3SKNB 3VFRA 4BZ1H 4PGZA 4J3WA 2Y5EA 4UQ2A 3T08A 1BFOB 4E0RB 4BUHA 1S9VA 3BKML 1LNUB 3QIWC 4JR9L 4P9HC 3KPOB 3LKSA 1IGCL 1L7IH 1I3GL 1P4LB 3FO0L 1FHGA 4NZUH 1H8NA 2E8YA 1QRNE 2HTKC 1IC1A 1I4FA 1M6OA 1PFCA 1IGMH 1SBSL 2Z31D 3CVHH 5HI3C 1A7RH 4M3KB 4Y16C 3EDJA 2BK8A 4ZO6A 4PRAA 5FO7A 3EIFA 2BVPB 4ODXB 1EHAA 1VACA 2VE6A 1ZGLA 3O2VH 1X5FA 4KTEL 2XOTA 2WV3A 5DT1L 2QQNL 2XY1A 1ES0A 3GM0A 3STBA 3WFDH 4KY1L 3HFML 3PV7A 3TT3L 4X6CA 3OX8A 5HHXH 1R3LB 2ZSVA 2O61A 4GRWE 2AI0L 4LSUL 2VLME 4X5XB 1BVZA 1C16B 1JGDB 4JG1L 1FFPA 2G60H 2YWZA 5ICXB 4MD0B 2Q8BH 2W9EL 4FQ1L 3B6SA 1OWRM 4XAWL 3QBTB 1RZ7H 4UT7H 2SEBB 1KEMH 4IRSD 4ZFZB 1Y0LA 5M94B 3RBSA 2P48B 1I1AD 1PEWA 3Q5TA 4KUZL 3LN4A 3EJYC 3L3KB 5I8KH 3E0GA 5KSBA 3BN9D 3V8CA 3BPOB 1CF8L 3L7EB 4U1JB 1OGAD 2FX7L 4KJQC 4WO4C 2V6HA 4JM2C 1T2QH 1Z9SA 3UCRA 5C0BE 3HE7B 5TDPB 2QQQA 5IUSA 1RFDH 2CQVA 2FBJL 2X1PA 3V7AE 5I1LA 3ULUD 2BERA 3VFVA 4WHYH 4PJHE 4ODHH 3LIZH 1WZ1H 5D71H 3BEWA 4JQXA 3BP5A 1H3XA 3C5JA 1HSAB 1FG9C 3HS0B 1IL1A 3QI9C 4X7CC 3O3AA 3Q48A 4P4KD 1BBJB 1B2WL 4FQQB 4OZIE 1HEZB 3G5YA 1Z3GL 5I8OL 3WCYA 3S37H 4K3JL 3LPGA 3MRRA 4Y19B 3RWEB 4EUPH 2ZKHH 3O4LD 5C0GB 3SGDH 3VH8B 5KW9L 2YPKB 4TULH 3BP6A 5EA0L 5JLZB 4DKFL 4JO3L 2AJZB 1MIEH 4FTVE 2ITDA 4NUGH 4YDLB 5KOMC 4U3XA 5ICYB 5C0FA 3QG6A 1JBJA 1S7XB 2F8OA 2PUQT 4LARL 4X9GA 1I85A 4HXAL 3C8KB 4ODWB 4WW2B 2UYLB 3FZUD 5KSAB 1JWMB 1RHFA 5BRZE 4U7KA 4F58H 1KIQB 4I77H 3DVFA 5DMIL 5EU3B 4LPTA 3H9SA 4BH7B 3GBLA 3T0EE 1DBJL 4JFXA 3DRTB 1YEFL 4Q6IA 4XHJC 5DFTA 1NC2D 4M6OL 3V4VH 2RFXA 2IPTH 4XI5C 3S34L 4LNRB 3RPIA 4H88L 1QBAA 1NCBH 2W65B 4QT5A 2P5EA 4LSSL 3E8UH 4ELMA 5E8NB 5HHPB 3BH9B 3TV3L 1F3DH 5H2BB 3L3OA 4XTRD 4HUXB 4F57L 2R15A 1AI1L 1U8LA 4M6ML 3HUJF 1YEGH 2KPNA 1RK0B 4S1QH 3OJDB 4HKJA 3D18A 1JF1B 4NC1E 2BVUA 4H25B 5C07B 3MNZA 3A6BH 1ZE3C 4M61A 5I75B 1NCWH 3SDDD 1FPTH 3P11L 3CLEL 3T65B 1OTTD 3QRGL 1A7OL 3SN6N 5FCUL 4JY4A 4YXKL 3MNWB 1AHWC 3I6KA 4CN4A 1N6QH 4Y5YA 2EDRA 1FO0L 3OAUH 4QNPF 3F7VA 3WJJA 5BZDB 3KWWB 2APXA 5ICZA 5GS1C 1IAKA 4JFDA 2YD9A 4LVHB 3HC4L 1FL5B 3RZCB 1XCTB 1BP3B 3QDMD 1MCBA 3DX8B 2PR4L 5E9DE 3C6LC 4WENB 3IS0X 5J11B 4HH9A 4YJZL 4R97B 3VW3H 4P3CH 1IAIL 5GHWH 5D2LA 1L7TH 4HULB 5DHXB 3KPPA 3HAEB 4Z7VE 5E4IA 43C9B 1A64A 1F4WL 3MRDA 3E3QC 3TH2T 3X3FH 4LDLB 3Q2CA 5CIPB 1K85A 1SBBA 2P8MB 5TDOA 1A1MA 1ADQA 1RV6X 1TDQA 4DGVL 3VE0B 3LPWA 4AEEA 2HT3C 3JV6A 4K71C 4LLUB 5LAXB 3VDBA 3QNZA 1HINH 4IRJD 3LEXA 4HMEA 3OKLA 3K80A 3BRFA 4GBXA 3DO3A 3SGKA 3BKJH 1CD8A 5IVXF 5GQBA 4QYOA 2DM3A 4I0PA 1LE9A 2XFXB 3GHBH 4G8EB 1KLFA 4P23B 1GHFH 4GKNB 4JJ5B 2GT9B 3R1GH 1DQJA 3TA3A 4F8TA 5DEFA 5E2TH 1HK6A 4R4FL 2W9DH 3QIWB 2AJ3B 4C56D 4KHTL 3MRPB 1RZIB 5CZKA 4HX1B 1N5AB 1RHHA 2XWBB 4YO0A 1FZJB 4I4WA 1H3PH 4LCCA 4ZO9A 5F9JA 1U8MB 3TPUB 1QBLL 3GKWH 3TJHC 4O2CA 5E5MB 5I6XC 1KFAH 1OTSD 3VFOB 5IFHH 1XMWA 4X6DB 2R56L 2F5AH 4NDMA 5EBMA 4I48B 4KJYB 4ACPA 1PBYA 1LO5A 3IDGA 4X98A 3FB6A 3VXTB 4L29B 1G1YA 1JZ2A 3MUY1 4JKPL 1U95A 3LQZA 4NHUB 1LEKB 1OPGH 5F88B 1YEIH 2D7MA 4ODHL 4XH2A 5D71L 1WCQA 4FP8H 4WTZA 4G7YL 7FABH 2W07A 1MCSA 4XMKL 1TITA 4M5ZH 5JOPE 4YBHA 2X4NA 4F3FA 2D03L 5F7EL 5FUCE 2W0LA 5E8PB 1GH7A 1MRCH 4HXBH 4Y4KC 4B50A 2FSEB 1MIEL 3MRIA 3NZHH 4X7SH 1KCKA 5C0RH 5F6HI 1CXKA 4AIZB 2FATH 5IMOB 4GKZA 4OLWH 4AZ8A 3PDDA 3WNKA 2FJGB 4WO4B 4FA8A 1KT2B 2QADD 1JHLH 5D9SA 2VXQL 2XWJA 1CICA 3R0NA 3HR6A 1N5YH 5I76B 2XZCH 4RFNC 3VWJA 1RIHL 4KRPC 2IQ9L 4Y19E 2ZJSH 5E70A 1OLZA 3NIGE 3F7YA 1RY7B 3QP3A 1WISA 3GMMA 3MXVH 4X6EB 3QI9B 4E5XA 1HQ4B 1X4XA 3S3SA 4HG4J 5C70A 4EI6A 1CLYH 3GSOA 1BGXL 5FK9A 3ARED 4NZTL 3SDCD 3TIDB 5HY9B 5LXGH 3SJVA 5GPRA 4LLDA 4D9LH 2JE8A 3U36B 1FNLA 1YN6B 5DI8A 3UXFA 3F12B 1ZTXH 3IFNH 4XVJH 3ZE2E 5AAWA 3D69B 3KYMA 4MQ7B 5D1XA 2UY6A 4O51A 4JFHE 1U6AL 1YEGL 3WE6B 1PY9A 1DQDL 3K8LA 4XNUH 5EC1B 3O3DB 5GZOC 4HFWA 1NEZA 2GTWB 1G6RL 1J1OH 1NFDB 3Q1SL 4Q0XH 5A3IC 6FABH 1MQKL 4GRLA 1HOCA 5J6GB 4PV9B 1ZT4A 4PRDA 2OS7A 3QO1A 4A2MA 4ZAKD 1Q9LA 1QSFB 1TNMA 3IDIA 1E6JH 4ZNEA 4CAGA 3RVXC 4MVBC 3V6BR 1DQMH 3TEUA 4DK3A 3TZVC 3IDXH 5AD0A 3SGJC 4OFDA 1GCFA 1F90L 5K9JH 1BF2A 5C07E 2IH1B 3MA7B 5KVFH 4S1SL 3CK0L 3U4EA 1UT9A 4M02A 4ODUA 1L7TL 3OKOB 1R24B 1A6TA 1EBPA 5JTWA 5DJ2B 1K2DA 4GOSA 1X5XA 5D70H 3CFJB 2QQLH 2NNAB 3UJJL 4OBSA 3TO2B 4LFHD 3EGSA 4ZODA 1D5MA 3QDHA 5EZOL 4TN9A 3FO1B 5DJYB 5IFJA 5AG8A 1K3ZA 1U0QA 2LU3A 2HLAA 4QRPB 4MA3B 1AHWB 4GG6B 2BCKB 1FIGH 4L3AA 3PXHA 2ILLA 4JVWA 5DWUH 3D48R 3VGFA 1MHHA 1GRWA 3HAEH 1J8HE 3GJEB 4HAFA 5LQBL 5GS1B 4LLQA 1MCHA 3ARQA 5DR5L 4ZFGH 2I5YL 5D7KE 2CLVB 3T3ME 5CIPH 1U36A 1WF5A 5HVHC 1CU4H 3IU3B 1NJ9B 4OUUA 3BISA 2HTLC 3HHRB 3C6LB 3QHFH 3FT2A 4I5BB 3LY6A 5D6DC 3W81A 3B2VH 3C6SB 5INDB 1XF5A 4NQTA 3EDDA 1D5ZA 3PG2A 1NBZB 1OGTB 4JCMA 1PKQA 1WTGT 4XPAL 3VRJA 4I3RL 1QVOB 5GGRA 3PIQA 2BOBB 1QFWH 1NCDH 1KIPB 1C12A 3KLDA 3H9YA 5FGRA 2ZUQC 5BOPA 3B5GA 1JWSA 3U0PB 4RISH 4A6YB 3RWJB 3IJSB 4K71B 3ZDYF 4DGIH 2BRRL 2H8PB 3OR7A 1T2XA 1A1OA 5B21A 3MYZA 3BHBA 5DUBB 1UZ8B 3FCTA 2V9TA 5EUOA 1I1YB 3NVQA 2BJMH 4JQXC 2JK5A 1KLGB 1YEIL 3CX5J 3PL6D 3NAAL 2XWTB 1RJYB 5HVWA 5TH2B 3HC0A 2FX9H 2EXWD 3QQ9D 2GCYA 2Z4QB 5ECJE 3VFTB 4PJGF 2DKSA 1MPAH 3ZE0E 2Q20A 5DF0A 4B53A 1WFNA 1A7NL 4LGRB 4JN2A 4MAYA 4NCC1 4NM8H 5FGBA 5IKCB 4X6DE 1JTPA 4NRYA 1BZ9A 1NL0H 4QRUB 3MR9B 1A2YA 4MNGA 5HGBB 2WWKO 5IT2H 1W0YT 4S2SA 2HA1A 3MJ8A 1AXIB 1DEDA 4QXUL 4OSUH 5C0RL 4UIMB 2MWCA 5BMFH 1I85C 4OIBA 1OSPH 5I6XB 3QA3A 4FQJL 5FUOL 4OLWL 3VXPB 1DBMH 4X8JB 2IBZY 1NGZA 4JRWA 3MLYH 2GY5A 1Q9KA 5EU4A 2IQAA 4YC2C 3G9VA 2XZCL 4Q6IC 3WUWA 1YQVL 3RWIB 1BJMA 1G9MH 4EIZC 5FHAH 4G6KH 3CDYA 4PJDB 1QBMH 2AK4A 3NPSC 3B83A 2OX5A 3VRLE 3UTTB 5FDYA 1CL7L 3L3HA 4NCC2 4G5ZH 3MV9B 4JEGB 3CFEA 5E0QA 4Y4KB 4P2OB 1RZKL 4MSWA 4XVJL 3N1PC 1YDPA 2FJFA 3MCG1 2VSDA 5EIIB 3BDYL 3J8F7 3LB6C 5T5FH 2VDQH 4QWWD 2ARJQ 1HCVA 4XNUL 5DEGB 5ANMB 4FTVD 3N06B 1FG2B 4KXZI 2IBBA 1BREA 1AE6L 4HS6B 4QTHB 5KS9F 4RFNB 4XCYB 1KV3A 4Y5YC 4WHTA 4M7JH 4KRPB 1NBVL 1M05A 3V5HA 4EOWL 2CKBA 1QO3B 3GMLB 3KLAB 5BRZD 3WJJC 3P4NB 4R6UA 2C3GA 3SCMC 1JHTB 1T80A 4MZ2A 5GSRB 5A2IH 3T0ED 4G7VH 3IDXL 4KKAC 4LVOC 2RJMA 4J1UB 5K9JL 4XNXL 3WO3B 1U8JB 2EC8A 3LD8C 2OZ4L 3VI4F 1T1ZA 1IKFL 3VD3A 1BQHA 1KIUA 1SJXA 1BOGA 2YPLB 3L95A 4LSVL 5GRZA 2L7JA 4HJ0C 1KF9B 4Y2DD 3HPLA 5JA8B 4PTUA 2O5ZL 4X7FC 1NGYA 4RNRB 1EO8H 1CCZA 4PP2A 4HJJH 5D70L 1QSFE 1WBXB 2VDPL 4PRIB 1O5DT 1U8OA 5FYKE 5T1MA 4Y4FA 3B3IA 5TGBA 1INEH 3QZWG 3AFLA 5JHLH 3DXAE 1JTOA 4AENA 3NFSH 3P9LA 4GMSL 4JFZL 4HV8A 3PGDA 1JNHB 3EO0A 2DMKA 1FZKA 1IRAY 4GAYA 1DBKH 3VXRA 2A74A 5DJ8A 4J7RA 1HE7A 4GBXC 3SGKC 1T04A 3TZVB 4XVTL 4ZFGL 1WCBA 2ESVB 4I0PC 1CU4L 2MPAH 3MRJB 2AV1B 3KDMB 5FCSH 1FC2D 1R5IB 5CHNA 3VFRB 2X4OB 4M1GL 1A4KA 3LEVH 1KC5L 3MOQA 4UQ2B 3T0DA 4DN4L 4QRPE 3TA3C 5D7LA 4F80A 1I3RB 4JFFB 4GG6E 1S9VB 5DO2D 5EOQH 4XMPH 4DW2L 3NFPA 3LKSB 4NP4H 5E9DD 2K3TA 4LCCC 2FIRT 1M6OB 1I7TA 4YZFE 1IGTA 1WTLA 4OBRA 3TN0D 1NCDL 1GZPA 3GI8L 2MFNA 3ROLB 4PRAB 1NMBL 1VGEH 2NY1D 2GK0A 5FO7B 2VISB 4RISL 5TE4L 1VACB 2VE6B 1ZGLB 1TNNA 5EZIH 2ZUSA 3SQOH 3DYPA 3VFSA 2IGFH 4P9HL 1T5XA 5BS0A 1ES0B 3U9PH 5HVHB 1JRHH 2AEWA 4PJIF 3E3QE 4YHNA 3BP7A 3OX8B 1MCDA 5HGDA 2O61B 2CDGA 2VKWA 1U3YA 2FX9L 4OQ1A 3ISWA 1JUFA 2QV2A 5EU5A 4XPTH 1FFPB 5FYJU 4Z9KB 4TUOA 4NM8L 5JW4M 3VJ6A 3B6SB 4OM0L 1VEMA 4WI5A 1E4WH 1Y0LB 3TBTA 5K59E 5D5MF 3ALPA 2EZ0D 3O3BA 3LN4B 1C5DA 4MXQD 2YD8A 5KSBB 2ZUQB 5BMFL 5GZND 3KPLA 1JGEA 1U3ZA 1OLLA 4RQQA 1OT2A 4XB8A 4ETQA 5IEHA 4ODTH 4PJFA 1CICC 1WGOA 5I1LB 5D7IF 3ZSSA 3VWJC 3CFKA 3VFVB 4JDVB 4DQOH 1BVKA 1F4XL 3BEWB 1ZLSH 3BP5B 5F89A 1BWWA 3BIKB 3C5JB 3EYQC 3QAZC 1IL1B 3G08B 3O3AB 4HMDA 3KHQA 1DSFL 1N7MH 3G5YB 5FHAL 2HT2C 4K3DH 3G5VB 3MRRB 2NY5H 3VG0H 3BP6B 4UBDD 4KTDH 2ITDB 1IC4H 5D1XC 3B2UD 4HWZA 4G6MH 2AXFA 5C0FB 4OF3A 4EKXA 1Z0NA 5JOPD 1YECH 4HGWA 1XT5A 3WDIA 3MNVA 4LRNH 1GPOH 5T5FL 1ETZA 3D39B 5J9PB 4U1HA 2F53A 3EJZD 3HE7D 1JJUA 3H9SB 1OT1A 4LKXA 1HCFX 3TM6A 4JFXB 1X4ZA 4YC2B 4Q6IB 5FA3A 3UTTE 4HH8A 5KTEL 1JTTA 3BT2H 1MRDH 3MV9E 1OAKH 2RFXB 5DJZA 5GGTH 5DFVC 4M1DH 3QO0A 4G43B 4JZOB 1YEDA 5ESQA 3HRPA 3NPSB 2Z8VC 1IKNA 1CQKA 2EYSA 2ZG3A 4Y19D 4DOHB 3ESUF 4QT5B 4PJBA 3GO1L 1FBIL 2P5EB 1MHCA 4PLNC 4KQ3L 4ELMB 4DKEH 1FLRL 2PETA 3L3OB 4OD1H 1BF8A 4TSBH 4XMLL 3K1DA 4FFYH 4OZHF 5DUMH 1U8LB 4KQ4H 4LPWA 4HKJB 3D18B 5FYKL 4XT1C 5KVEL 1MY5A 4HJJL 4KZDL 2BNRE 3VI3F 1PYWA 1GIGH 1UJTA 1FFRA 1PZ5B 1INEL 1B9ZA 1F00I 4JFHD 3BD3A 3W2DL 4Y5YB 5C0IA 1T22A 2CIKB 3F7VB 2XN9A 3BPCA 2YPLE 1U93A 2PKDA 1NGXB 2XA8H 3SCMB 5ICZB 5HHQB 5IHBA 1UCTA 1IAKB 4JFDB 1GOFA 1NCUA 2YD7A 1K5NB 2WP3T 4BYHA 3E2HB 3O2DA 4LVOB 1UJ3A 2WUBL 5D2NC 3JWDH 1E4XH 4S1DD 5FV2A 1OHQA 4LSRL 4HH9B 1QLRA 4PRIE 4LRIA 1N4XL 4JVPA 1HILA 4CNIA 5D2LB 3LEVL 3ECBA 4MMXC 2K9UA 4B7LA 3KPPB 1SY6A 5J4MA 3CUPA 3MRDB 2C26A 5GS3A 3TJEL 5C07D 1WV7T 4XMPL 3WV0A 2RR3A 3CDCA 4WW2F 4KDTA 3OAYH 3F8UB 2AGJL 3PDGA 1Y6MR 1J05A 4M8QB 1CR9L 5TDOB 1A1MB 5C0NC 1KXQE 2V5SA 3VD4A 4GH7B 1ZGLM 2I9LA 2ESVE 2D31A 4KGJA 3NN8A 3C5ZC 1I8KA 3JV6B 3WS3A 2RHEA 2Q8AH 2CIIA 4OZ4A 1OP3H 3QNZB 4PGEA 3SQOL 3OKLB 5JPNA 1XGPA 2IGFL 4GBXB 4JFFE 3RZCD 4NQVA 4K7PL 4AM0A 2BXYA 5T1DH 4I0PB 3C08H 1E4JA 3GMRA 1LE9B 1ZVSA 4QOKA 1J8HD 1N3NA 3HRZA 3N50A 2C1OB 4W68A 1QD0A 5F21B 1IM3A 1V7MH 4IBLT 3RGVA 4PJ7A 1DQJB 3DI3B 2X40A 3TA3B 4A6YL 1NMAL 5DEFB 2WIIB 3RWDA 4MAYC 1MREH 5FGBC 1JGVL 4PGBB 4JPKH 1RHHB 4I4WB 1MSPA 1U91B 3PGFH 4LCCB 2JB5H 1U58A 1S7SA 3PWNA 5F9JB 4EDWL 4UT9H 4O2CB 2VR5A 2DYPB 2BY3A 3LRSA 2JLLA 1A0QH 3K2UH 2PO6A 4NDMB 5L2JA 4JAMA 3C2SA 4XP5H 5EBMB 1IZKA 3IDGB 1LO5B 4X98B 2GI7A 3FB6B 5C2BL 4GO6B 3D3VA 5DMYA 4NO5A 1E0OB 1FRGH 1U95B 5DJXB 1V3MA 4P23D 4DQOL 1AY1H 3QPQD 1WVZA 1YMMA 1FCGA 1IC7L 4ODBD 3T4AA 3KYKH 4P5TB 4FQIH 4OQTA 2NLJA 5KSBE 4QRRA 3QIWD 2IFGA 2PTTB 4F3FB 4MYWB 4PJ9A 5I1GH 4L8SA 2DBLL 2HTKD 5ADPL 4LHUA 2OR8A 4D0CB 1BJ1H 3MRIB 2IAMB 1DLHB 3EDFA 3LZFH 4GKZB 4LOUC 5E6ZA 4OZGF 1OQOA