4X4ZA

Retrofitting antibodies with stabilizing mutations. herceptin vl mutant f53d.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
b'IQMTQSPSSLSASVGDRVTITCRASQDVNTAVAWYQQKPGKAPKLLIYSASDLYSGVPSRFSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Herceptin VL domain with F53D mutation
molecule tags Immune system
source organism Homo sapiens
publication title Retrofitting antibodies with stabilizing mutations
rcsb
total genus 25
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4x4zA00
4I8DA 2MTPA 1MIEH 1HSAB 3MLRL 5EU3A 5I18H 5K59F 3GSVA 2JE8A 1F4YL 2W0LA 1MFNA 3MOAH 4FFYL 3DROA 1NFIB 2VDKH 3SDAC 5I76B 1QFUL 3K81A 5BRZB 2VH5H 1OF2A 4WU7B 1X5IA 3OMZA 5DD1L 4M00A 3ZKXB 1UKSA 2AK1H 5EZLA 3HNSL 1RUML 1AC0A 4KTYA 4PUBL 5TF1H 1EERB 5SWQB 3CX5K 3HNSH 3OAZH 1U8OB 1A7OL 3ABZA 1TZGL 4FQIH 3S5LA 1DVFD 4F7PA 4A6YL 5HHOB 3QZWB 3TNMB 1T0NB 3S3JA 4DKDC 1MCOH 2CK0L 4UQ2A 3VDBA 4ZNEE 1QO3A 3GSQB 3QO1B 1S9XA 3VXQB 3PP3H 3BQUC 4GBXD 2XWBB 4Y19A 3CIQA 3TF7C 2YA0A 4QRRB 4DFHA 3QH3B 5I1LA 1UB6A 1URLA 3MUY1 4L8BB 3MGOB 1BWWA 3X17A 4MCZA 2VNCA 3I6LE 1M05B 2AP2A 4P3WA 1S7UA 4ZDHA 5JHDE 4P9HL 5F7NC 2P5EB 5FYLD 4M62L 4NO3A 5H8DA 1G7HA 4L4VE 4AT6A 3BQUD 4GBXC 1LP9F 2HT3C 2OJZL 5LGJA 3MNZB 2CDEB 4WI7A 4NFBA 5T1KB 4K9EL 1S3KL 2G2RA 1HHHA 3CSBA 2VLJE 3I2CH 4WFFD 1K2DA 3IKCA 4XC1H 5IM7B 5TPWH 1GGIH 1UVQA 3S8WA 4NN5B 4R7NB 4OLWH 4HWUA 4GKNB 5IB3A 5CEZL 2QEJA 4NJ9L 5F6HJ 1XR9B 2J4WL 2NX5A 3CDFA 3WFDL 4K94H 4OZGA 4OCMC 3ZYOA 4G8EA 1OGAD 2H3NB 4BSWB 1A5FH 3P3YA 4MNQE 1BIIA 1X5XA 4ENEC 5GRUH 5MEQB 2YK1H 5DWUL 4C59B 1IKNC 4ESKA 3MODL 2AJYL 4MSWA 2P43B 1NAKH 4M4PA 1PW3A 3ZTJG 1GRWA 1T21B 1OP9A 4L9LC 1FIEA 3TBWB 1FV1A 3M1BB 4JQXC 3FOLA 3GJEB 2I60H 1E6JH 4GAYA 1JFQL 2I07A 1HI6B 4TUKH 3TC9A 4XAWL 3BE1L 5K9JH 3P73A 3OB8A 4HBCL 4ELKB 5CJXA 4JPKH 1YEFL 1YMME 4MDJB 5F88A 3TZVB 4QF1A 3CU1A 3HI1A 3V4VH 4WJ5B 2PYEB 5HHQA 1YY8A 1FFOA 2HKHL 5HHOE 2CGRH 3KYNA 1BZQK 5IFAH 4J2XA 5E8DL 3MCLL 3MJ8A 5H35B 3DUUA 4P23B 2HTLD 4PJGF 4R96A 1VFOA 2KDGA 3C09B 3MJ9L 2YUXA 2LAAA 3U4EB 2W07A 1F3RB 2YC1A 3MRQA 4M03A 2D9QB 4UT7H 2X9YA 2HFFB 2Q6WA 1L0YA 1S9VA 5DI8B 4CDHA 3GFUA 2AJSH 5EBMB 3DMMD 1RULH 2ARJQ 5CHNA 2BY0A 2VN4A 4PJBB 3LD8B 5GGSA 2DRUA 5EC1B 1CGWA 1EEUA 3K1KC 1ZHLA 1N4XH 1SMOA 4FS0A 3F58H 5C09E 3VFMA 1DQMH 4DGIH 1B90A 1JMZA 1YPZB 1TXKA 4UI2A 3LS4H 3HUJF 4IRSA 5GGRY 4OZGF 3GSNH 2PTVA 4AYFA 3H7LA 1P5UA 3PWLA 3RHWK 4BK5A 5IEKA 3K2MC 3PWVA 4HH9B 4TVPE 4PJ8D 5A16A 3LKQB 4RZCA 1YEIH 3V6FB 3RTQD 1AKJD 2J8UF 5HBBA 2EYRA 2DTML 4I3SL 4H0HB 4OD1H 5FKPA 3F58L 1DUZA 1YNLL 2R0KL 3QDAA 5HHXH 1KFAH 3KPMB 3ZT7A 5E00B 4AM0A 3QUXD 4TTGA 3MRDB 1MCPH 3Q1SH 3GO1L 2VL5A 3PP4H 1XCQA 3RWCB 3O6FD 4RX4D 1OAQL 2ITDA 3GEWB 4RIRB 3PHOB 2IQAB 4QRPB 2AQ2A 5DHXB 3AS0A 4FABH 4J1UB 4NNXA 4ZO8A 1ONQB 4V2BA 1HIML 4EQ3A 1N64L 3V6ZA 2X4RB 3GSXB 3JWOL 4M5ZL 5DS8B 4Y1AD 4ZUVB 2NYYD 5DO2C 3QDHA 5GGVY 1XGUA 5CEZH 4Y5XC 2WBJA 4DUXA 4DN4L 4HPOH 1UZ8A 1TCRB 2ERJC 4G6ML 4J3VA 1MJ8L 1FNSH 2P44B 3QHFH 4J3UA 1OM3L 5KAQF 4KDTC 4G9DA 1BZ7A 3TCLA 1Q0XH 3BDYL 1KN4H 4RFEB 4WFED 1A64A 2JJTA 3BP4B 4ETQA 5AAWA 4DN4H 4Z8FL 2Y25A 1OGTB 1EGJH 4DCQB 5JDJA 1OSZB 1YEGH 2NY5L 4PJIE 3NFSL 3WO3B 1IGIL 1VHPA 2GHWB 4LHUD 3QCVH 3IFPA 5FYKL 1FNGA 1T0PB 1T1ZB 4UIKH 3W5MA 4MMXC 1K6QH 5EBWA 4KC3B 4XPGL 4P2CG 3ULVL 4BKLA 2OXGA 1NGYB 1C1EL 2X44D 3DX9B 4OB5H 4ZYKA 4CN4A 1DEEA 4BM7A 4X7TB 3EJJX 3K46A 2P8PB 1X5FA 3FQNB 3ARWA 1ZGLM 3HTLX 3HFMH 3HKFA 4Y2OA 1WJ3A 4C56B 4N1CA 1XF4B 3ZT6A 1OAXL 3RVUD 4D94A 2D0FA 3QDGB 1CXIA 4OCWL 1B9ZA 3SDCB 3MV8E 25C8H 2X70B 1HXYA 3C6SA 5E7BA 4ELMB 3Q6FA 3L9RA 2ZSWB 1NMAL 5J3HC 1WVZA 2VH5L 5DD1H 1DUYA 5JQHC 2D0HA 1KIPA 3DGCR 5ESVB 1MH5B 1NDGA 2R1WA 1JWSA 2VERN 2DWDB 4KXZI 3WL9B 5J1TC 4N1EA 4QTHA 2WLYA 1KJ2H 1T22A 2XFXB 1RURL 2WWMC 4RMSA 1JF1B 4ODVH 1U8HA 2DJSA 3OJVC 1K85A 3QG6B 3P0VH 3SJVE 3ARDB 5HDLA 1U3HB 4M9PA 3VFWB 3H0TB 2VXQL 3LPWA 4XCCH 2A1WL 3VE0B 4PIRF 5SWSD 1FC1A 2HFTA 1Z0NA 1JTTA 2EDNA 3IDYB 4K9EC 1S78C 5HPMA 3V0AC 2RCSL 1FZJA 3MRLA 4HIEA 1GJIA 3GSNB 3BFOA 1P7KB 4IRZH 4A6YH 5EU6E 3E0GA 2OTWB 5IQ9B 1JWUA 3SQOL 5J9PB 2FX7L 1I7TA 3TT1L 3VW3H 3SE4C 2Q86A 1RZGA 3H3BC 5C1MB 4XNXH 1RZJL 3LIZH 2XWJA 5FUCC 4W6XB 5GGSY 4LGRB 4MGXA 5GGTL 3PWJA 3MXWL 3L5WB 1F4XL 3B2VL 3BKCH 2VZOA 1ZWIB 3B43A 4U1JA 4N9GB 1OGAA 1HILA 5E5MB 4I18C 1PKQE 1P4LB 1IGYA 3HC0A 2OR9H 3CDCA 4MX7A 2HMID 5JIPA 1I9JL 1WZKA 4ZFOA 4Q9CA 3E3QE 1XT5A 3DWTA 3BGMB 2NCMA 5CP7B 2BNQA 2BJMH 1WC7A 5F1IA 1K5NA 2NY1D 1MI5A 3ARFA 4LLWA 1RSFA 1AXSB 1CLCA 3JBG7 4OTXH 1XCTB 4G5ZH 4LPYA 4NC1E 1C16A 4PRIE 1SY6H 1DBAL 1LO3L 4P46D 3H9ZA 5J13C 3W81A 4CVZA 4IOIA 4JG1H 3V0VA 1QFWH 4P99A 3C8HA 1NSNL 2VLLB 3EO0B 4KHXH 1A14H 4OSUL 5GZOD 2YD6A 4K07A 5EPMA 3OJDB 3QAZC 4APQD 2XPGA 3MSPA 4YNYB 4YWGL 1FC2D 1FORL 2HRPL 3U83A 4U1IB 3BPNB 1OGAE 4U05A 4ZUSB 2WZPD 4Z77B 3W0WA 3ESUF 1T89A 4KJWC 2VLRB 2HP4A 3T8XB 4DZ8A 2I5YL 2DL2A 1Q0YH 3IT8D 1FFPA 1T5WB 4JFFA 4L9LB 5IBLC 5FF6A 3KJ6L 1MAMH 4D0DA 1M7IA 1SVZA 2MCPH 3VD3A 3TYFA 1DSFL 1JN6B 2HVJA 3M17B 3PG2A 3QNZA 3TFKC 4UOW1 3VFRA 3BZEB 2VMFA 1NCDH 2D2OA 4LCWE 5C0CA 1Z9OA 1PY4A 3Q6GH 1N3NA 5EO0B 3ELAT 2YXMA 5AWNH 4HS6A 5SWSB 5DMGD 5L6YL 1UJTA 2AQ1A 2ZPKL 1BD2D 3V5HB 4PGBB 4GRLC 1QBML 3B2VH 1QSFA 2B5IB 1L0QA 5DJZA 1AKJA 3OWEA 1KYOJ 4LSPH 3GSOB 2WBJC 3LQAH 4PPTA 5DT1L 3S3PA 2CR3A 1H3UA 5EIQA 1KTKE 1ZGLB 3HPLA 3UC0L 3QUXA 5D2NB 3S36X 3NIGE 2VJXA 3TBSB 4XNXL 5HHNA 1J0ZA 1RUMH 5IFJA 5DJ6A 2XQYK 3ZYZA 1MY7A 3EOAA 4RFOH 1DL7H 4B41A 1BM3H 1CBVL 3OAZK 2X4TA 3BPCA 1CBVH 4LEOA 3ULUH 3KLDA 2EO1A 3WS3A 3EAKA 2NY4B 1Y0LA 3BOVA 5CSBA 4NQEA 4R0LA 4NQSB 2IQ9H 4M7JH 1VGKA 1GGTA 3IJYB 2IQ9L 5C0AA 2AW2A 3B9DA 5SX5K 4GJTB 1RURH 4FG6C 2I25N 2WBJD 3NH7L 3VMOA 2F15A 4U1NB 4ZQKA 5ALBL 4X8JA 5EH1A 4MNHA 4YPGA 1QZ1A 5D93B 1XF2A 4LMQI 4YE4L 1AH1A 3T08A 4HJJH 4MQ7B 1F6LL 3PWPD 2FCBA 1H3PH 4Y4KB 4Z7NE 4JREC 1E4KC 4LGSB 1NGWA 2XWTB 1FDLL 1SBBA 4LCIH 5C0IA 2AXFB 5ANME 3DGGA 4M6OH 1VFUA 3P2TA 2FH6A 3PQYB 1TTFA 1J0KA 5CJ8A 5FUOH 3V0WH 4Z95H 4XCNB 4YIQB 1A7PL 2VLKD 5B38A 3F6IA 4JLRA 3ARTA 1DBJL 1Q72H 4JFQA 4OFDA 4N68A 4E42A 2UUDH 5AWNL 4QHNA 2KL6A 1X5KA 3MR9B 4FTVA 4UIKL 3K8MA 1WCBA 3MV8D 5E2TH 1IGIH 1TQCC 2DLEA 4M4RA 1DSFH 5IESH 1KN4L 3PGCB 5DJAA 1KTDB 3BP7B 1C12B 3HUJB 1BQHA 5F96H 4ZAKC 3LKNB 1ZLWH 3MBEB 5D7SH 4NWUH 4QRRE 5FK9B 4OFIA 4ZOAA 1IM9B 3D39E 5IK3A 2Y7QB 3GBNL 1QFOA 3CNKA 2XA3A 4J3OC 4UTAH 4FXGA 4Z76A 3BYTA 3T0VA 5IMLB 2VDML 1NUNB 4F7EA 3P77B 4OLUL 3S4SB 1ZVHA 2EEBA 5D6DA 3O3EA 4OIIL 1BQLH 3RPIA 4OCYH 1WT5C 4YHOL 3OKKB 2YUVA 2NY3D 1KJ2L 3RUGE 1GL4B 5FA3B 4HFWA 4NC1C 1OAKH 2OM5A 4G3YL 4G8GE 2IBGA 1T3FB 4U6VH 2ERJB 4JY4B 3O9WA 1BVKB 4Z7VF 2CUMA 3SDYL 5MERB 2IAMC 35C8H 2H32A 3NA9L 3C6LD 4HSQA 1MCPL 5CGTA 1MRDH 5F71A 1VADA 2XN9B 3HC3H 3U2SA 2A77L 2PTTB 4OZGE 3DETC 4LASL 3GMNA 4KUZH 5K9OB 2VZ3A 1U92B 5I73B 5F9DC 4V1DB 3D18A 5I30H 3NFNB 3N0PB 5F7DB 4BZ1H 1R6VA 4YDVA 3PNWB 5C0NC 4PJHA 3BEVB 4XB8A 4LSRH 3LKPB 1YQVL 2P8LB 1FNHA 3F65A 4LSQL 3TA3B 4PY8I 5FHAL 3ROOB 1JHKH 4RA3A 1M7DB 4BUHA 3H9HB 4JN1H 5F44A 5FM8A 1YEGL 3D9AL 1TVDA 1QRKA 4YFLI 1FL5A 2H2SC 1LNUB 1FLRL 1KELH 2ATKA 3UDWA 1V7MH 3GDBA 1IE5A 1U8NB 2HT3D 1Z5LB 4XCEB 5ADOH 4U0RC 5INDA 1KPUB 4PRDB 3V8OA 4NPYB 1UWXK 1QQDA 4NUJB 3OZ9H 2CKBL 2YBRB 4ODTL 3QP3A 3CGTA 4APQA 5EZOH 5F89A 2YHGA 4GKSA 4DVRL 3HCVA 2C3VA 5BRZE 1OY3B 2GFBA 4YHML 4JFOA 3DX6A 3KYOB 3W0WD 5IHZA 3THML 3BKJL 1HEZA 1CK0L 2P5ED 2V5SA 2IH1A 5KVEL 4LCWB 3RWHB 3R06A 4XH2B 4RAVB 1D6VH 5CSZA 5I75C 4OQTA 1JGEA 3BRDA 1MLCB 1JGLL 5CBAB 2UYLB 2W9DH 4YFDB 1G6RA 2Z93A 4DN3H 3CLEH 5EUOE 3IDYC 1A22B 1JFQH 1VFBA 4YHYC 3GJFK 5GRVL 2BY1A 4AIZB 3CXHK 4NKDB 3MJ7B 4P2OD 4EEEA 1LEGB 4JEGB 5E2TL 1SYVA 1MCWM 2R2EA 1NGPL 2HFEA 1I7ZB 4TUJA 2XZAH 2IAMB 4KGJA 4L3CB 1G1YA 1T89C 3MLWL 5DTFA 1RQ5A 1B2WH 2ZUQB 4Y4HA 1K4CB 3FQTB 1I8MA 3MUGA 4L8CB 3CSGA 1QSFD 1EHXA 2A6IA 5IB5B 4RGOL 4NNYB 1EFQA 3TH3T 3FRUB 3O3AB 3PL6B 1G7QA 3BH8B 1MCDA 3ARYA 5DVLA 1ZLWK 2E7HA 4DZBB 5CFHA 5JDSA 1IZKA 4GW4A 2ESVB 4UB0H 4TRPL 3AC0A 3L3GB 1GOHA 5HGDA 4M9OA 4FQHB 1QVOB 2OSLA 3IFLH 1FG2A 1TVBA 2QL1A 1U6AH 2FH8A 1S7TA 3MRPB 5C0AD 3HE6C 4PRBB 4JO1L 1LEKB 2DTMH 5D1ZD 5J7CC 1BOGA 3CFKB 3EFFA 1C8PA 2HT4D 1A1MB 4PJXF 1T6WA 2D7PA 3L7EA 2I26N 1IC1A 1VERA 1S7WB 4X4YA 5L2JB 4GQPH 4PJFE 3RVWD 4XP9L 3QI9A 1FLRH 1KELL 4MYWB 2AV1A 4WNQB 5ESAB 4OT1H 3MCKB 4HGMA 4FQCL 5I0ZA 3QO0B 4HUWA 3FOMA 4LASH 2Y5EA 5EORL 5AG9A 4IRSC 1TZGH 5I1KL 5E9DA 1HQRB 2WIIA 4GLRI 5EA0L 1NEZB 2VDMH 2I60L 5DJCA 3IXAA 1SJEB 4I3SH 5E7FA 4LOUD 3REVB 3T3PE 2VWEC 3ZKXC 1U58B 4MDIA 4JRYB 4S1RH 3A6BH 3ZZ1A 4XPBH 4BQ6A 4S1QH 4LLDB 2A9MH 4WTWA 5A3IC 5HY9A 5BV7B 3MRBB 3H7BA 1A6TA 4XPFL 4PYGA 2MKWA 3U6RB 1NCBH 4O02H 1W72B 3OSKA 2JIXA 1A3LH 5D7IB 3QUZD 4ONGH 3EJYC 3M45A 3WO4C 2ESVD 3LSOB 4LIQL 4P4RA 4BQCA 3SKNB 3CFEA 1RI8A 1XR8A 3O4LD 3O9WC 4RMWA 3B5GA 3DO7A 5C0EA 1JYXA 2DM7A 1FJ1A 3W9EB 2FL5B 5DMYA 2IWGA 2W0FB 2DQFA 3RJDA 3WFBL 3A67H 1E4XL 5ERWA 4QXUL 4NO0D 2OJZH 4F9PC 5BJTA 5E08H 1MIML 1RZIA 3I3EA 3WIHA 2EE9A 4NT6A 2NY6D 4Y7MA 2QQKH 3HAEA 3QWRA 1PEZA 4PJEF 4HW6A 4LAJH 1RIHH 1W0WB 1UA6L 3DJ9A 4XPAL 3TJHD 4B0MM 3UTTA 3KPPB 4KV5E 2O5YH 2DDQL 5ADPL 5BOZG 4ERSH 1CDUA 5C0AE 3HLAB 2N56A 1NAMB 3O8XD 5CLTA 2IGFH 1QLFB 1AO7A 3QHTC 4KAQH 3KLAB 2X4OB 3WFDH 1BBDH 2ARJA 3M8OL 1B6DA 5AZEH 5C7XH 4NO5B 1CLOL 3PJSB 4RX4A 3HPJA 3OR7A 2W59A 3WKML 3WE6B 3W82A 1TCMA 4F3FA 2AXJA 4X5WA 5IBLD 2SEBA 3RVTD 2IC2A 4HIXH 5AEAA 4YXHH 1XGRA 1QFUH 5KJRL 1LK2B 4KTEH 1MVUB 4DQOH 1WK0A 4XMLL 3LN5A 5F1NB 4U1LB 3BIAX 1S9YA 1P7QA 4AEHL 1IGCH 5EU6D 4XNQB 2Q7NA 4F57L 4G43B 1A9BB 3E6FB 3GHEL 4H20L 5C2UB 5L8JB 4ZO7A 1ZHBA 1NCWH 1W8OA 1MELA 1S7VB 3HMXA 4YE4H 3UTOA 4WDIB 3V2AR 1XGQB 3DBXA 1J0IA 1IAIM 3Q0HA 4NC0B 4OUOA 2Z92A 1OD9A 3V5KB 4Z78B 4HUXB 1GGUA 1N6QH 2ZUXA 1OL0A 1JYNA 4HPYH 1RUPL 3MREA 4LP5A 4MA8H 3MBXH 4ONOA 3OKDA 1HDMA 1LWRA 5D5MA 5FYLL 3TH4T 1F8TH 2E7MA 1KCVH 1YECH 3LDBC 3E1F1 3VI3E 3QUML 1H3WM 4NQCD 3RP1A 5M94B 4FFWD 2DLHA 3B9EA 2Y5TA 2VQUA 4X7FC 3WIFA 5IVOA 1TZIB 3N85L 4Y8AA 4GAJL 3A6BL 5I8KL 4KROC 4XMPH 3QUMH 5T1MA 2ENSA 4XGZA 1MF2L 4IMLB 4P5TC 3SDDC 2ZCKH 3ZYJA 3CUPA 1KIQA 2JB5L 4XPHL 2XA8H 4ZTOL 1CDIA 4XMKH 4JQVC 5FO8A 1EFXA 1JPFB 4YLQT 2P5WB 4F7TB 2VDOL 4OZIB 1IAII 1ETZB 3ARDD 5CUSH 5AD0B 5D5ME 3MRJA 3ARFC 1LO0L 1ZA3B 2XZZA 4N0CC 1HQ4B 1NCAL 4GAGL 5KVFH 3QUYB 2H2PC 5D9SA 4MNQD 1KNOA 4YWGH 3G5XB 3KR3H 3MV7E 4LSTL 3REWB 4WUKL 5C8JB 2R4SH 2HRPH 3I50L 1YDPB 4UUJB 4XPFH 1KXQE 4GQ9H 3QQ4A 4U49A 3UTQB 2APTA 4D0CB 1H9VA 2DQHL 4ZS7H 1KPVB 3EGSB 4WW2C 4I5BB 1H5BB 4Y1AE 1VGEL 5BXFA 4CNIB 3BP6A 3HE7D 3SE8L 3DNKA 3AROA 3OG6B 4CW1B 1MLBA 3HA0A 3VG9C 2C1OA 3C5ZB 2XKSA 1KIUA 3ARZA 3UYRH 1X6NA 4ZFZB 2R23B 1TMCB 4LLMA 1H0DA 1IGMH 1JZ6A 1D5XA 1BVLB 3DRTB 4MD0A 4LNRA 2R8SH 1V7NL 3ARBB 3WLBA 4JRWA 4Y5YC 1XGPB 5T3XD 2GSGB 2ICCA 3KAAA 2BNQD 2DJUA 3E8UH 4NZUH 3FCTB 1YEHL 5HGAB 5GGTH 3D87B 4HBQA 3VWJD 2CRMA 1EXUB 3CD4A 4G42B 2VLME 5E9DD 1KG0A 3U1SL 1BQHG 5T1LA 3UTPE 4Y16A 4HUVA 1P4BH 5MP6L 5E2UL 4G80A 1I7RB 5SWQA 2P42B 5C71A 3QA3A 5C0ND 1QLRB 2FX7H 2NW2A 2D0GA 3ARVA 1MNUH 3GNMH 1MCQA 1WGOA 2VSDA 1ZOXA 3RZCA 1EHLL 3GJFB 4WV1B 3QZWA 1QD0A 2XXCB 3G6DH 1KGCD 2DMBA 1UADC 4OF6A 2I9TA 3KXFE 4FOMA 5DD3H 3QUYD 3I02A 4NKMA 5FGCB 3V52L 3P0VL 1Z9SA 1CZ8H 1MFAL 4HAFA 4DVRH 3WN5B 1PQZA 4NN6B 5DURD 3T2PA 5HYJA 2WUBL 4Z5RA 2ADGA 3RWJB 1NFDF 2NZ9C 5E8PB 1ZGLP 4RAUA 4K71B 3IYLW 3DUSB 1E4XI 4E41E 4K7FA 3QHZH 3OX8B 2DAVA 1QSEA 4OFYD 5DA4A 2EDDA 4ZDHB 3QEUA 1MHCB 4MA3A 4TQEH 2YN3A 5D7JB 1OB1A 3AAZB 4G9FA 1WISA 5IR1A 5D2NE 5EUOA 2VXQH 3WIIH 1MQ8A 4PP2B 3C2AH 4Z18A 2HFGH 2NY7H 3CVHH 4Y88A 5F1KC 2G2RB 5DMIL 1BD2B 1ZT7B 1QEWA 1NBVH 2APWA 4PS4L 2AXGB 1JP5A 2FJHA 3FFCA 5HI4C 1EEYA 4U4BA 3VGGA 1S7RB 4LVNC 4YBHA 4NHUA 1G7PB 4PY8J 3B6SB 3KXFB 5FGCE 3TYGH 4FHBD 2DQTH 4ZUWA 1LK3L 1K8DB 5C08D 3HE6B 5IW3A 1KJMB 3O8XA 3BE1H 2HLAA 2FO4B 3BHBA 3ARED 4TUOA 4ZAKB 2AJXH 2DM4A 3MQIA 1HSBB 4BSVA 5IB2A 32C2B 3ZKQD 1MCIA 2UUDK 3IFLL 1UENA 4HKBB 2VWEE 4HGWA 1CD1B 1NGQH 4LEXL 1E0OB 3VGFA 5HDOA 4LSSH 3SDXF 4E41A 4O5LH 1DLHA 4J3XA 5CMAB 4IRJB 5HDQH 4I2XB 3WYRA 3G04A 3K0WA 3M1BA 1FV1B 1X9QA 2EKSA 3GJEA 4QRTA 4N0RA 1I8IB 5DK2B 1S7SA 2I07B 2V5TA 5FECA 1Q1JL 4QRSB 4S11A 1BFVL 4OLVH 5ETUB 3P73B 3ULSB 4F58L 2FDBP 4NQXB 3K4DA 4N0UB 4Z7WE 2F74B 3S7GA 3GK8H 5T1KD 2YPKA 3VI4F 5EZIH 5EULV 1Q9LA 3EIFA 3VXRB 1DCLA 4JJ5A 4LFHD 3EYUH 1CFBA 5AYUH 4QXTA 1T03L 4KKLD 1VGEH 2XZCH 3KPSB 1NLDH 1F02I 5H35A 4H1LG 4U3XA 5ANMA 5C0JA 4HLJA 4NN6C 4IOFD 4P9HC 1TFHA 4JFPB 3FB8B 3PWPA 1DE4B 4GFTB 3J8F7 1FPTH 3MRQB 4W68A 1IRAY 1Q9KA 4Q9RL 1R5WA 1P6AB 1WBXA 2J88L 2DLFL 1AFVH 5KANG 5CEXB 5FYJU 4JKMA 1A6AA 1T7ZA 2Z4QA 3FZUC 3MLVL 4LPVA 1F6AB 1MHPL 5J57B 1HZHL 5I9QB 5C3LD 4JRYD 2O93L 1TLKA 1HYSD 5DJ0A 3MMEA 5CZXD 4D9QD 4G8FB 2VDNH 5D1QD 3SY0B 1BLNA 4BYHA 1NLBH 2P7TA 3EZJB 4LCIL 5I6XB 2D9CA 4HT1H 2O5ZL 3C2AL 1VEPA 2B0SL 4QHUA 5DO2D 4M6AA 4KKCC 5TE7L 1CD8A 2VKWA 1CDYA 2C1PA 3HG1E 1JZ2A 4JFXB 3T3PF 4MHHG 2A83B 4OQ1A 5TH2A 4FQLH 2VR9A 5E2WL 4AM0B 1B4JL 4BFBD 5DD5H 3MRDA 4KI5E 1FFNA 2ATPB 2VL5B 3CJJA 1JCKA 2FGWL 43CAB 1CFSB 5DHYB 1O7VA 2ITDB 3BUTA 3O3UN 2ZOLA 3RWIA 1MCWW 1NGZB 4TUKL 1ZS8B 1S7XA 3C60A 1WIPA 5HYEA 4YAQB 2ADIA 1P4IL 1ONQA 3ZSSA 4DW2H 2X4RA 1CGXA 1IBGL 4KVNL 1AGFB 4C56E 3MV11 3ES6B 4FZEL 4TNVK 2Y06L 3TT3L 1D9KD 1IC7H 4X6FB 3PGFL 4FXKB 3LRHA 2F5AH 4CL7A 1EJOL 1KLGA 3D69B 4YPJA 1QRND 3CSYB 1HHIB 3D25B 3O9WD 1JPST 3OKLB 1ACYL 3R1GL 2MOVA 5EUKB 4GRWH 4P2QB 3EOBB 1F58L 5JW5A 2J8UB 4JHWL 4G8GD 1Y18A 1RJYA 4UBDC 3W2DH 3IU4L 4G9DB 1R3JA 1KGCE 4Q6IC 1BZ7B 3DI3B 4GRMB 4LLYA 1ND0A 1IAOA 3MYZA 3ZL4L 2ICES 5K93A 3F6LA 4OF0A 2IFGA 1S5HB 2MCG1 3RNKA 2NY6B 1ACZA 3BSZH 4FFVC 1NKOA 1S7QA 1A6ZA 1ZLVH 3W39A 1JUFB 2LVEA 1FNGB 2HJFB 5E9DE 2AJ3A 3WNMA 4QHMA 1NAMH 2NTFA 1MFDL 5H94A 1FAKT 1IT9L 2AAVA 2EDYA 2K3TA 3I9GL 4OZHB 3NZHH 2HTLC 3PIQA 3O41B 4I3GA 3SGEH 4F7MA 3M8OH 5T1LD 1MOEA 3OF6D 3VG0L 2VDQH 5C6TH 3MACH 4C56A 5EOTA 3BGAA 4ODXB 2C3WA 4AG4L 5FYJH 3ARGD 2DN7A 4CJ0A 4ZSOE 3MLUH 1UM6L 3CX2A 5DJ8B 4F8TA 4L8SC 3FAWA 3LEXA 1BM3L 4RDQG 4U1MA 4U6TA 2XG4A 5I66B 1OAUH 4S0TD 5DEGA 3TBYB 4L29B 1AE6H 3VXOA 1BBJA 4FXLA 2QQNH 5E99H 5I16A 3T4YB 4QLRA 4F37F 3SDAB 5IIEB 1NMBL 3FQRB 4MVBD 2XY2A 4UDUA 2FZ3A 4F9LA 3W9DB 1I4FA 4X4XB 4MXQD 4XT1C 5E6ZA 1JVKA 1QSED 3T1WA 4HV8B 3KDMB 3DRQB 2Z91A 5KBNC 1M6OB 3QG7L 4MB4A 4LQFL 3MOQA 1SY6L 2V17L 4Y4KD 1TJIL 1RJCA 4P2OA 5IF0B 3QEGL 2BNUB 5CD3B 3SJVB 4XPHH 2CLRA 1IFHL 5IGXH 4A2LA 4K8RH 4JFYA 4AENB 3FFCD 4MA8L 2P47B 3TM6A 4KJYB 5LVEA 1HNGA 4K2UL 4XBGB 1J8KA 4URTB 2EDWA 3UPRA 3C5ZC 4WWKA 2BP3A 2LTQC 3O2DL 5KVMC 2EECA 5C08A 2W0PA 3OG4B 5CEYB 5FFLA 5E8NB 2UZIH 1N59A 1WQVT 4GXVH 3AREA 4FQJL 4ZPTA 5TQ2H 4NBXB 2YN5A 3FTGA 1QSFE 4G6JL 5F6IB 3BWAB 4Y5YB 2F54B 5IB1B 2DQEL 3QQ3A 3DVNA 2BCKB 1JNNL 1CQYA 4ZFFA 5BS0B 1KT2A 1FORH 2NY3B 4CADB 3GMOB 3ZYIA 3QEHA 2AK4B 4M6ML 4S2SA 4E41D 4NRXB 2RR3A 4DGYL 3FO1A 4LPWA 1G9NC 1ITBB 1GZPA 5DUBA 3C6LB 1XCTA 4OM1L 3KYAA 1IAIL 3CVIH 4R26H 1NFDB 4G6KH 2MFNA 4JM2A 1NSNH 4PJDF 4P9MH 3QFJA 2GUOB 3MACL 2NY4D 5GHWH 1LHZA 1YEKH 2D31B 2VDPH 4GUPA 3O3DB 5IHLB 3EO0A 2B1AL 3VCLA 8FABB 4D9RE 3OHXA 2E9WA 1FH5L 1F2XK 2X41A 4X7CC 3CVHA 4RMUA 4CVWA 3QUZB 1MEXL 4FQPA 4TULL 3L7FB 3KPTA 2D03H 2OL3L 1R3KA 5ACMA 1ZV5A 1EO8L 2DKUA 2VZUA 1UA6H 4XPAH 1BFOB 2P49B 1LE5A 3ECBA 3P4NB 3TIEB 1NBYA 1WUNT 2R69H 3WSQH 4L9LA 5DR5L 5MEND 4GMSH 4BELD 4D0DB 1JZ5A 5I71C 4UDTA 2W65B 3MGTA 1I3GL 1YEEL 1DQLH 4M6NL 3IDIB 3VD9A 3SDAD 4K23L 3NABH 3U46A 5CJXC 1MI5E 5EC2B 5D1XA 4X5XB 3SE9H 5D1QA 4HS6B 3RX5A 2J3SA 2WINA 1CE6A 2YSSB 4W6YB 2FSEA 2R0ZH 4Y4HC 2V9TA 1IAKA 4RMRA 4WENB 2X9WA 3LZFH 2A74A 1CN4A 3DROB 5E24E 4OLEA 5TE6L 2QJDA 1EBAA 1I8KA 2BHYA 2H8PB 5EOCH 3HR5A 3S37X 3P0YL 1ED3A 5IMKA 1QBAA 4WHTB 4YXLL 2EDBA 3MXVL 3DX8B 5DJXA 5TDNB 2LFGA 4JB9H 5B4MD 5HHPA 5HHOA 3EDJA 4LQ1A 1YUHB 4BQBA 1FYTB 1AP2B 4Z7VB 5BVJB 2RCSH 5CSGA 3GMMA 3QEQA 5JORB 5D2LE 1S9XB 2H26B 4MA7H 4O9HL 3VXQA 2IMNA 4MCYB 4DVBB 5C0DA 3U7YL 2ZJSL 5I1DA 4YHZH 5FYJE 3T0EB 4ZO9A 3BVNB 4WEBL 1NFDE 5I1LB 4JANA 5J6GA 3BO8B 4BH7B 5BO1L 1VGKB 4ZPVB 1TJIH 2J8HA 2P5WE 4DEPB 3IJYA 3HS0B 4Z7NF 5I6XC 1AO7D 1T2QL 4ORGA 1OAQH 1X3DA 4UV4L 4OI7A 2BERA 4HKXA 4Y5VB 1A9EB 1T5XB 1IEBB 2R56L 5C70A 3MNZA 4MXWL 3VD5A 3UO1H 5C92A 5ITBH 4OM0L 3CFBB 2NZ9D 4G8GA 3D39D 4GLRH 3SKMB 1YN6A 4PRNB 1N8ZA 4HG4K 5FV1L 4BFGA 2V6HA 3IKCB 1EGJL 2OL3B 4NKQB 4DJMA 3O0RH 4LARL 2CRIA 3OKOA 2QR0A 3L3DB 4EI6B 1RJZB 5CILL 4GKOA 3AREC 3N50A 4MMZC 2DB8A 1MHEB 3DGGB 1P2CB 4KY1L 1TNNA 2OK0H 1U3HC 4DKAA 1Z0MA 4U1SA 4S1DD 2X4NA 4XCNA 5GS1C 3RU8L 4Y5XB 1HCFX 1D9KC 1YN7A 4LSUL 1VEMA 5EU6A 2YD9A 1RY7B 5E95B 5FO9A 5M95B 4PV8A 4IS6B 3B8YA 4KWUA 3SDXE 1XH3B 3OJ2C 3O4OC 4XI5C 1JV5B 4XVSH 4Y2DC 1UCBH 4X7DC 1HHKB 1UB5A 1B2WL 2X4SB 2DMCA 3MLYL 4QWWD 2PR4L 2F8OA 4UV7H 3BP7A 3KPRE 5CBEB 2GK0B 4OCYL 4UV7L 4U6YB 3L5XL 1WF5A 4F2MA 4JPVH 4I18B 2YWYA 5FGBA 2GTZA 2WBKA 2XKUA 2A0LC 3FQUA 4PJ8B 4KKAD 3VXUE 4Z7WF 4X0KB 5IFAL 4X9BA 3RUGF 3TZVA 4PTUB 1S5IH 3VI4E 3HI1B 2EYTA 2HKHH 1LDSA 4I3RL 4F58H 3S9DB 3MNVA 4XC3L 5CP3H 4A6YA 1MCJA 1U8IA 2NTSP 1I9RH 3QXTA 4PJ7B 3K2UL 3RWEB 4MAUH 1A1OA 1P1ZB 3G9AB 4PJEB 4HLZG 2GY5A 5T5FL 12E8L 1T20A 1XMWA 5J89A 1VESA 4Z0XA 1AO7E 2YUWA 1RU9L 1R3HB 4S0SD 3WXVL 5EBMA 2GJ6D 4OCSH 3ZKSD 2HWZH 1YNLH 5A3ID 4J23A 1WTGT 4X6BA 3W0WE 4NQDE 1IQWH 2XN9A 4R6UA 1MJ8H 2BY3A 4Y19B 4YHPA 4WY7H 2OS7A 2JJTC 3RY6C 3QWOB 1U9KA 3QHZL 2V2XA 4QY8A 3UTSE 3GSWB 4ZFOL 3PWPE 3SKJL 3U9UB 4YDKL 3DYOA 4X99B 3P30H 3LV3B 4EUPA 1IL1A 3BN9D 3P30L 2EH7L 4YQXH 2D7TH 1YMHA 4LCCA 2RBLA 5J06A 4QRUB 1D9KB 1GOGA 1UZ6F 2CDEA 4RGNB 3WNNA 1RV6X 3RTQC 3ROOA 5FOBA 2A2QT 2OI9B 2XKNB 1SYSB 1HHHB 4MA1C 2ED7A 5ISZB 3TVMB 4K3HA 4FRWA 5A40E 5IM7A 2FEDD 4JM2D 3ARUA 1NEZG 3E3QC 3Q5OA 5C2BH 4QOKE 2DQUH 3AB0C 1HZHH 1KB5B 4OBRA 2DM2A 4ODWB 2WWKT 3C8KA 1F3DH 2N4IA 2YPLE 3MRRB 5F1SA 1PKQA 4LSRL 4MLSA 3U7WL 3EYFB 2JTDA 1E4WH 3B9KA 5IVXB 3WFCH 2ZSVB 3QRGL 5IJKA 1YNKL 1T1WA 3A0OA 4FQXA 2Q8AL 1UZ8B 2OMBA 4X4MA 5GSRB 2NY3C 3IAGC 4RBPH 3FB6A 4K3JH 2BNQE 4MXVF 1JGEB 4BZ2L 4Y16D 5DMKB 2AEPL 4JDTH 3WUZA 3MA7B 2GJZA 4MXWH 5ITBL 4HK0A 1T4KA 1DBKL 3P4MA 4WFHE 4Y0GA 1R24B 4ZUUB 2V7HB 1AGEA 1QHPA 1CGTA 2NLJB 5MENB 1CDBA 3BEWB 2R2EB 3BZDA 3QIWB 3RWDA 4RMVA 5HDBF 4IIQA 3L3JA 2WLZA 4KTDL 3KYNB 5HDQL 3IDMA 4ZAKD 4X9GA 4AK1A 2R4SL 3ARXA 4O2EB 4OLUH 1K4CA 5CCKL 1U91B 3QIBA 4OCLC 4OBSA 2YC1B 3QXAB 3ROLA 3SPVA 3VRJA 3PL6A 2F53A 1ADQA 2BXZA 3TIDB 1WWWX 4JPWL 1S9VB 4WI9A 1EHNA 1NC2B 5DRNA 3SE3A 4HKZA 2I5YH 4G9FD 4CAGA 1L7TH 3C6SB 1CTOA 4KY1H 3IDJB 3RKPA 4POZD 2FX8L 3LB6D 4GQ9L 3VXNA 3MRGA 4Q9QH 3KPLA 4ZD3H 3VA6A 3C6LC 1AGDA 1S9KC 3QIWD 5GS0L 1A3QA 2F8XC 5IBUG 2VLKB 5E8OA 5ELIA 1MAKA 4I9WD 3QPXL 4F7CA 3SDDB 4J3WA 5I2IB 3KPRB 3LKQA 4NJAL 1BX2A 4G7VH 4JFDB 2VDKL 1UEYA 3K8KA 4NRZA 3H0TA 3QXDB 4XXCA 4XCYA 2KPNA 4EUPH 1FNLA 4GAJH 3RWGA 3ARBC 5J8OA 3UJIH 4OLWL 3T1FA 5JA8B 2OR7A 1U3ZA 5JOEA 3LRSA 5FYLH 2ZCKL 3MLSL 1NCTA 5T3XE 3X3GL 1N6QL 4UT9L 1Q9WB 4NQCB 2X89D 4P4KC 2VUYA 3MO1A 1QG3A 4PFEA 4GXUM 4PLNC 3S3SA 3T2NL 1EHAA 3C9NB 3QXWA 3PWUA 3DSNA 1IGYB 5I19H 5ABDE 5H2BA 4DAGH 2V2TA 4OD2B 4MJID 1ORSB 3U7AA 1TCRA 3BQUB 2MKLC 2EZ0C 4OD3L 5K9KB 4Y5VC 2BDNL 2YA2A 4JQIH 3VH8G 3LPFA 3ZHDA 4P23C 4LHUB 3CZFA 5FYLE 1RUAH 2CMRL 3ULUF 1AY1H 1RK0A 2AEQL 4OQTH 3L3IA 1HYRC 1O0VA 4KRNA 4LU5L 1CFNA 5IOPA 4HGKC 3DO7B 1ZVSB 1KOAA 5C07B 4DCQA 5D7JD 3BUYB 1P84J 2CLVB 2FL5A 4D0BA 1KIRA 1FZMA 2IANE 4U3HA 3BW9A 4P57B 4BFIA 3K74B 1T1ZA 2IADB 3QI9C 1BAFH 4WFHD 3RFZC 4JO2L 1F6FB 4KU1A 5ACZA 2XPGB 3D0VA 5HD8C 1NGYA 4ZYKB 5C0GB 1KCRL 3HI5L 5T5NG 2ZUYA 4KDVA 4NHCL 1R3IH 2N7BA 2APXA 2X05A 4ERSL 3VXTB 2VOTA 4M43L 3OKEA 1W0WA 2EXWD 4GMTL 2R29L 4H8WC 2VLRA 3T8XA 1CICD 4UAOB 3VH8B 3BSZL 5EIIA 2RHEA 4LHUG 3T4AB 2B4CC 1XZ0A 3QDME 3NCYP 3VD7A 1NANH 1A6WL 1AO7B 3IXTB 3WHE1 1CDGA 4NSKA 2JKXA 2J5LC 4JO3H 3WCYA 4QXUH 3OAYK 3V4UH 3VXPA 3M17A 1IGFL 4MWFA 4X6CB 2XN9D 5FYJL 1F11A 3X12B 1N3NB 5C6TL 1G9MH 1VFAA 5L2KB 2XFXA 4TNWK 5EWIL 1MUJA 3GUTB 1AR1D 4JCMA 4QKXB 2BSTA 1RUQL 5BZWA 5I1HH 3O6LL 4NO2B 2R2HA 5CINH 4Q9QL 5KSUA 3HE6D 3L95B 2EDLA 4RFNC 3UTZB 5HPMB 3QDMD 2FX8H 5FM4A 4YHYB 4KI1A 1BF8A 1P7KA 2AJUL 5KS9A 3QUXB 2CDFA 5DJDA 5FCSH 2OTWA 5IQ9A 3S88L 1ZSDA 5IV2A 1UJ3A 1CFTA 3BPOB 3GKZA 1AC6A 2GAZA 2CKBA 5GGUB 2AEIT 1ZHBB 4IDLA 4CMHC 3BKCL 3CCHA 5DVOA 3FKUS 1JHTB 2Z92B 4M61B 3VWJC 2FATL 4EBQH 3DV4A 3QDJA 2Q76A 1PAMA 2UY7A 3U4BL 3PE9A 3P11L 1Z3GL 1L0XA 5TDPA 1BGXL 4D2NA 4EI5B 1EEQA 5B39A 2VABA 1HKFA 1RUPH 4HWEH 4XRCB 3CC5B 2VZTA 4I48B 5A43C 4MJ4A 1NLBL 2UVEA 3IJHA 3NCCB 3GIZH 1G7IA 1BHGA 4M7ZC 5DFVD 1WC7B 5I8EB 1TVHA 4NWTL 1MI5B 4LLWB 3VDCA 1D5IH 2YA1A 1AQDA 3GIVB 3RUGA 3ZDZF 1LDPH 2XYCA 1XAUA 1NGXB 3G08A 3GZKA 5JHDA 1KCUH 3C5ZD 4YO0A 5D2LB 4OV5A 4ONHB 4MJIB 4FFZH 3U0TB 1FYTE 1CLZH 4I77H 1JNHA 2FIKA 4UINL 5EPMB 1JYWA 5TE7H 4S10A 4TNWF 3OKYA 4NCDA 4YNYA 2FHBA 3TCXA 4NUGH 1LQSR 4NKIH 4MAYA 1P69B 4XPTH 2GEEA 5CJQH 1ZTXL 1A7BA 5GIRA 4FTVB 2W91A 3X13A 3QT2A 2XTJE 1WIOA 1MJ7L 2C7UB 4P5MB 2ZG3A 3NN8B 5LAXA 2BSSB 3F12A 3IETB 3DPBA 3ARDC 3X14B 2Z8VC 5FF6B 1FCCA 1C1EH 4PBWD 5B3JE 2OCFD 2BOCB 2RFXB 2DMKA 3G5ZB 3UTQA 3GSRB 4YUEH 4KJWD 2NXZC 2R0WL 5D96B 3FT2A 3LKNA 4KMTH 1KEGH 2VDLL 3MC0A 3ULUC 4CU8A 3ME0A 3HFML 2FYYB 3MUHL 5C3TA 5KSVA 1SEQH 1KBGL 4ACPA 3QIWC 2HN7A 2WWKO 2H1PL 1A1NA 1E27A 4C83A 3BIKA 4X9FA 5IMLA 1I9IL 3S5LG 4WW1A 2CIKA 3RDTC 2R23A 1DFBH 2PR4H 3DIFA 3GSOA 3WO4B 4LNRB 3QULA 2HJLA 4BH8A 5LGHL 1KB5H 3G6JB 4PGDB 2O61B 3FQWB 1YYMH 3RRQA 4CVXA 2AJZA 3OAYH 4MD5A 5FB8B 3CFJB 3MGAA 3MRFB 1UXSB 1YY9C 3G5VA 5AUMB 5E6IA 4PJFA 5EZOL 5HGAA 3MV7B 1BVKA 2XTJB 4O02L 1T0MA 2L4OA 4WHYH 2XNAB 2AJYH 2X1WL 4XCFL 3TN0D 5T1LB 2OX5A 3VGDA 1X4ZA 3DURA 1I9RL 2X89A 3HZYA 3WXWL 1FO0B 5EBGA 1UB6B 3GRWA 4CVUA 1QLRA 2A9NH 5F3BA 5F1OB 4MCZB 2APVA 5GZNC 4P2RB 4C4KT 4KFZC 5J6HA 3RKDC 4QXGL 1N0LA 4I13B 5AAMA 3D85B 3TESA 4NZTH 1IC4H 5I74C 4U1NA 3L6FA 3OZ9L 4ODTH 2O26U 4FQQA 4YZFE 5HJ3A 4YPGB 3UBXG 2F53E 3LKSA 4NM4H 5E4EB 4PRIB 5BQ7B 5GRJL 4K94C 1DVFA 1NC4B 1MJUH 1UVQB 3LS5H 1MQKL 4N1HB 4P9HH 1ZHNB 5CILH 5DD0L 4YBQC 1BGXH 2LAGB 3O0RL 5C0BB 3EO9H 5D7JA 1ZT4A 1N6VA 4R90H 3WDHA 1EIBA 1G7LA 1QBLH 3LH2H 3UZQA 5FOJA 4PJ9D 3BKMH 5C9JB 3FONB 1QSEE 1U8JA 1A21A 2YPVH 2K1MA 5JR1L 2YXFA 5ID0B 4WFFE 5DC4B 3NACL 3TYGL 1QPXA 2X40A 3G6AA 4ELMF 1KSRA 4Z0BL 3JV6A 1AQKL 5TGBB 1QHOA 4I0PC 1LE9B 1SBSH 5I17A 1QRNB 1MLCA 1N26A 2E7BA 4P5TA 4PUBH 5TF1L 1V5JA 4LMQE 1H8OA 1VFBB 2PO6C 3GBNH 3CFDA 3TPUB 1KEMH 3O6KH 4NQDB 5F8RC 1N5AB 4PJ5D 1S9WA 1NCCL 5FK9A 3SJVD 4HWZA 4QWWC 3KYKH 3T0ED 4HEPG 4YBLB 3OBAA 3NGBB 4JAMA 4QF1B 5JQ6H 4WO4C 4YDJA 1YY8B 4EDWH 3GGWA 5C07D 4RRPG 1KLUA 4XNMB 5B3NA 1YC7A 4QTIH 1I1FA 5KSAD 3SCMD 3LN4A 3V4UL 4WUUB 4FN0A 1I8IA 3FQTA 4L8CA 5DQJB 4IMKA 5I76A 1CXEA 3U4EA 3KPOB 2QSCL 1N0XH 2IPTH 3VGBA 1SEBA 2F5BH 3HG1D 2BNRA 4CUCA 3WFHA 4IIQC 3TNMA 3RIAF 1A6VH 1QOKA 5EOCL 4E0RA 1EV2E 4F37K 1HINH 1OCWL 1DBMH 3QEQE 3D39A 3L3GA 1P4BL 3GSQA 1QO3B 1ZHLB 2VXTL 4MLIA 1I1YA 1RAMA 1JYVA 5TDOA 2DS4A 2JLLA 5IVXF 5I1EH 4QRRA 4HX1B 1CT8B 3QCTL 3KVQA 1KJ2A 2JB5H 3E8UL 4HH9A 2LE9A 2Y23A 4JREB 3V9FA 5K9OA 3MRPA 5IVNA 5F6IC 3QUMA 4IHOA 4JHAL 4V1DA 3TO2B 4P2QE 2EYRB 1MWAL 1WWCA 4AMKH 3FB5B 1E28A 2DQDH 5ALBH 4YHIB 2L7UA 1AIFB 2DD8H 5J1AA 3B2UC 5KVDL 1EAPB 1QACA 4NJ9H 1ZHKB 3QUXC 3NAAH 1UGNA 2ZOKA 1H5BC 1RK1A 3RDTA 4R7NA 1LNUA 4G6JH 1F8TL 3NCYS 3FN0H 4PRHB 1INDH 2ZKHH 4F8QA 3RI5F 3GKWH 1TQCB 2X4PA 4K8RC 4NYLA 3VXUA 2PYFB 5HYQA 2DLIA 4Q74A 3SGKC 3HC4L 2CH8A 4DOHE 1L6ZA 4JFXA 3O2DH 4OZGB 3UROR 4M6MH 1OW0A 1QQDB 3LDBB 3CSPA 4Z7WA 1HOCA 2XG5A 4ZTOH 2ZCHH 2Q8BH 3U9PH 4K2UH 1EAJA 1J05A 5E8EB 4GBXB 3TZVD 2VLJA 4XWGH 4PJAA 4GRWB 4PRID 3RTQA 4J4PA 4KHTL 5EO1A 5LCVL 1G0DA 2VO5A 1D5IL 1KXTB 2GSIB 1W72A 4KROD 4NHCH 2CLZA 3MNWB 1OLLA 5TF0A 2UWEB 3T77B 1W0VA 4GAYB 1F42A 4NQEE 1JMXA 3ES6A 2XXMB 3O6FA 1CICB 3G6JF 3HI6L 4YXHL 4JFFE 3KNBB 4H88H 1D6EB 2ARWA 4LLQB 3MJ7A 2DQEH 4HS3B 2MJWA 4XP6H 1M7XA 2V7NA 4H88L 2L7JA 5D93C 1SM3L 3QQ9C 1NJ9A 3T0XA 2BMKB 4TTDD 1FFOB 1ORQA 1OP3H 5DLMH 3I75A 5DT1H 2ZCLL 4UNVA 5HHMB 5E94A 4LKCB 4HXAL 4NT6B 4OLZL 3SOBH 2D7NA 1X5ZA 1IGTB 1K9TA 4OLYH 3RVTC 3BKYH 4NQTA 3OB0H 4XVUC 4AG4H 3BH8A 4KPHH 3HNTH 1JUFA 4I4WB 3F7YB 1U8LA 3RVVD 3DLQR 2QKIB 4TYUA 3MYJB 1KJVA 4HDIA 4LSTH 5IMMA 3NZHL 1U95A 3QNYB 4NRYB 2VIRA 1XF3A 5GGSB 5KJRH 2DI7A 5KW9L 1JPTH 2NXZB 5D96C 4H5SB 4WU5A 4OKVB 4N8CL 4JZOB 1KENH 1INEH 4WUUD 3EYVB 3ZE1E 2MQCA 1KN2H 1BWMA 1IILE 2RGSA 4CN6A 4H20H 1MHHB 4EOWH 4PR5A 3FN0L 1JF1A 3CXDH 4JPWH 4OCXL 2FNBA 4XP1L 3QBTB 4TSCH 4PLOB 3STZA 2BFVL 1JPTL 5ICYA 3VGEA 4G6AC 1MVUA 3LEXB 1NAML 5KVDH 4JVUA 4K55A 1P7QB 2CO7B 3GMRA 4GW5B 4L29A 4P46B 2ID5A 1OCWH 4NNPH 4OCNC 5SX4H 1BBJB 4NBZB 1EX0A 3CDYA 4LLAA 4RMQA 3UTSD 4N90E 5E5RB 4U7MA 4JHAH 3VJ6A 1XCQB 3QO0A 2R4RH 4HUWB 1HNFA 4UILL 4YGVB 1NUDA 3E2HB 4NDMB 4EDXA 4W4NA 4XP4L 2WIIB 1XGQA 2ZUWA 1XF5B 3KDMA 5GGQL 3IDGB 4FMFA 3AVEA 4Z78A 1J1XH 3EZ8A 4Z7OF 1RHHB 4HUUB 1F58H 3GSXA 5DS8A 3MBXL 1CFVL 1IARB 1ZT1B 3SQOH 1UACL 1IKNA 5BCAA 5BVPH 1EJOH 3E6HA 2F5BL 1MRFH 5CZXC 4QOKD 5HY9B 4JFED 1I3UA 1UQSA 3RGVA 3H7BB 4JR9L 1W72H 3D3VB 4PTTA 2X4UA 3O3BB 3VWKB 3CZJA 3CDGB 4KRPC 5C08B 5BZDB 2JJUA 5JOPD 1C16B 3TO4D 1JWMA 4P5TD 1CL7H 2F53D 3BP4A 3A67L 4PJDE 4IMLA 5F6HI 4PJXA 4JHBA 1OGTA 4HF5L 2ICWJ 4DKFH 2VUOA 3I85A 1NCCH 1AD0B 4LL9A 1JGVH 4L4VB 3QFDB 4DGVH 3IFNL 3GMQA 4O58L 5CWSA 2IALB 4LF3B 4LBEA 4MHHI 1YPZF 4U6XA 2VXSL 1UXWB 4HWNA 4HC1H 3CK0H 4LVHC 1WWBX 4Y19E 3IU3A 3HN3A 3NCJH 3UP1A 3SCMA 1DEEB 3KHOA 5D1ZC 2AV7B 4AH2B 1RZFL 5FO7A 2QSQA 3EO1B 4OCRH 5EN2B 2OTPA 4Z7UB 4HCRL 4JKPL 1INQB 4PJIA 4ODUB 4I0PB 1NAMA 3ARFD 2E5EA 2R2CA 1T83A 1OPGH 4JO4H 1VACA 5EZJB 1QFWI 3SDCA 5FUZL 4KK8D 4JO1H 4LDLB 1E6OH 3MLVH 2HWZL 5D4QA 4N8PA 3Q3GA 2XT1B 2J88H 1I7UA 4HT1L 4U6HB 3ESVF 4XBPB 5C0CB 3SEPA 4P4KA 4QTHB 2X1QA 3KHQA 5I1AB 4JZNA 1D5MB 2DYPA 1T7YA 3IDNA 4L3EA 2B7DT 3KPQB 3V7AE 1ULVA 5F7FA 2IANA 4KQ4L 1T1XB 5DJZB 3CAFA 4X7SH 1X44A 1IKFH 1HK6A 4HWBL 3UBXI 3H42H 5KN5A 3QHFL 5D2NA 2Z35A 3TBSA 4X5XA 2JF1A 4JFFD 1JWUB 5IFJB 3FJTA 4PG9A 5K9QG 3N9GH 4O51A 4HWBH 3OR6B 2XWJB 1XFPA 3FO9B 1PZ5B 3H42L 4W81A 3KJ4C 1X5GA 3QDGD 1E4KA 2B8OT 4LLVA 3HNVL 4HUXA 2BVQA 4HUNB 3MV9D 2NY0C 5DVNA 4OCSL 4K7PL 4R0LB 1NCNA 1MJJA 1T2JA 3ILPA 4XWOC 4MX7B 3MV01 2LABA 2NY6C 2F58H 5K33A 4LLUB 3BP5B 4XP5H 1YUHA 3MXWH 3IGAB 2AQ3A 3BISA 2YRPA 4WO4B 3JWOH 5JOFB 3IF1A 3QDMB 1FZKA 3NTCH 3EDKA 1IC5H 1W2KT 4FNLH 4TN9A 1NBZA 4QHLA 4LAQL 1N5YH 5E8PA 2WQ8A 3QRGH 4XGZB 3VFPA 4E9LA 3VXSB 3EJYD 2Q8AH 4H1LB 5L88L 3ZKMD 1P9MC 2PO6D 4KVNH 5EFIA 1T04B 1KIQB 1R3LB 2EYSA 4ORGB 1OB1B 1FAIL 1HXMA 3AAZA 1I9EA 2OTUB 1OP5K 4QTIL 1EFXB 1JPFA 4LRNL 4N9OB 2AJXL 2IH3B 3OJDA 4YIQA 3CVHL 1OWRM 4BK4A 4XVJH 3GBML 4XNYH 4YHLH 4S1DC 2AXGA 5C2BL 4O2FA 2ORBH 3KWWB 4U1KA 5DURB 3QJHA 4U2ZA 1NDMA 2X4QA 5FM5M 2OL3A 1AR2A 3BZ4B 3MRJB 5E6YA 5ITFA 3IFOA 4JRYE 3F5WB 4X6DA 5CJQL 4EI6A 3UZVB 3THMH 3KXFA 4OFPA 1Z9MA 1K8DA 1TJGL 3HE6A 1U8QB 5B8CA 4U1SB 4HHAA 4QRPD 5JO5B 4PV9B 5JXED 5MEPB 1X7QB 1FSKC 4GRWE 1KPVA 3EGSA 1M4KA 3GHBL 3QJFA 3JUZA 1UT9A 3Q2CA 3OQ3B 3EUUA 3EYSH 4J12A 3IJSB 1I3GH 1YEEH 3NIDE 5DK2A 2CK2A 3QDJD 4OUUA 4UBDD 5EOQL 1RU9H 2NY5H 5F9OL 1BPVA 1O7SA 2EXWC 4Q9RH 1X4YA 2XQYG 3RX8A 4G3YH 1G7JA 3U30B 1FPTL 1ZGLA 2HTKD 4Z9KB 1I1RA 4L5FL 3LD8C 4PTUA 3S37H 2HKFH 5E1AB 4RBPK 3T2QA 3UTSA 1E4JA 2XTJC 3FCTA 3RBSA 4WEBH 5F9JA 2WNGA 1DQJB 5K9QI 2VLRE 1BEYL 3EOYG 3JTSB 3QO1A 3BKJH 3UX9B 2B2XL 1ZLSH 2F58L 3UBXA 1PG7W 2B5IC 4NQSA 5CEXA 3O2VH 3QWQB 1NPUA 1QA9A 2JCCB 2BC4B 5C0AB 5GRVK 3T0DA 5GXBB 4WV1A 2LU4A 1HIMH 1QR4A 1BFSA 5F7DA 3IDXH 3ET9F 4QOKA 5D7LD 3BH9A 3CH1A 4JFEA 1S3KH 4X6DF 4X9HA 2B1HH 1BREA 1XF2B 43C9B 4OZHF 5DDHA 2BHUA 1EZVY 4G8FA 1YY9D 1RZ7L 1JNNH 3H9HA 3EFDL 4ZXBD 3MOBH 4WI6A 2M26A 4N8VA 3RL1A 3QUYC 2XI9A 4HCRA 2NY4C 1GAFL 2FEDC 4OZ4B 3S98A 4IDJL 2I9LA 1U8PB 1XR9A 4M7KH 1U36A 1KPUA 4PRDA 5I71B 3SOBL 2NNAA 4G8EB 3MLXL 4K8RD 4GH7B 4WW2A 4WI3A 1OSPL 4JLRB 1NL0L 3HZKA 2XTLA 2ATPA 2GFBB 5DHYA 2YUZA 2LTQB 2N1KA 2RJMA 5JPMB 3QNXA 3G9VA 4JFZL 5E2VL 3ULUD 5BMFL 1A3RH 4UU9A 3OKMA 1P6FA 3GSUA 3HZMA 1OPGL 2AEQH 4OQTL 3PGDA 5KSBB 2AJVL 1R3IL 1JHLL 4Z95L 4X80L 3DV6B 3G6JE 3R0MA 1JGVL 4L1DA 1DN0B 2BOBA 1CR9H 4R7DA 4OD3H 3AS2A 4PY7B 2AGJL 2HJKB 4HF5H 3SGEI 3WV0A 2EZ0D 3EYOB 3VFVB 5GS1A 3MLRH 2YPLB 3F7QA 4XWGL 5BMFH 3L1OL 1DBBL 1U3YA 3CK0L 1EJ6A 5HDBE 3E2HC 4QT5A 5LWYH 1RJYB 3MFFB 3NCJL 4TNVF 2FR4A 3G04B 5DHVA 5GGRA 5DTFB 4GRMA 1A6UL 3MA7A 3V4PH 4AEIL 3ZE0F 4XHJC 5C6PB 1A6UH 4HK0B 4ZO6A 3L5JA 5BRZA 3BESR 4GRLD 2YZ1A 3MXVH 4Y4FA 4HIXL 2FWOA 5IROA 4BQ8A 4JB9L 4NQXA 4HZLB 1G7QB 4ZS6C 1RZKL 5EO9A 3S96B 4DEPC 5MP6H 1E6JL 3JVGA 3SGDI 4ONFL 3S5LB 4IIQB 3L3HA 5FIEA 3V5DB 4QXTB 2ADJA 1F4HA 2G75B 4XZUB 4XMLH 4JE4B 4CRPA 3NFPB 5IT2H 2DIJA 4O2EA 4Y4KC 4D8PB 3FQXA 3D6GA 1LP9E 1X4XA 3BZFA 3BXNA 1RVFL 3JWDL 4F7MB 2GCYA 1J7VR 3MROA 2CJUH 4HXBH 3NZ8A 1G9ML 1QVOA 1JZ4A 3GHEH 3IDUA 2KQNA 4KK6D 1TVBB 3AXLA 4JRXD 5HYFA 2YRZA 2Z4QB 1DQDH 3CPLB 1J1XL 2DLGA 5DJ8A 1S7UB 3CFIC 5JPNA 4W4OC 4AEHH 3WSQL 2BRRH 2V17H 2VR5A 3LQAL 3FO2B 4RA0C 3QG7H 3VD4A 1HH6B 5HVFB 1HKLL 5LXGH 2P8LA 1EMTL 1L9MA 1A4JB 4PJGB 3QUKB 5E8OB 3WJLA 1U41A 3RWCA 4F7CB 2YD7A 3SDDA 4PJBF 1TZHA 5I1GH 4RRPA 4LHJB 5ID1B 1TPXC 2PO6A 2P1YA 1LEIB 1HKLH 2L0DA 3DRQA 4G7YL 4LCUA 3SKOA 3VMPA 3VXMB 5J56B 2YD3A 2NX5B 1P9MA 2C1PB 2YZ8A 4NPYA 4MQXD 2H3NA 3WDJA 5IQ7H 4GAGH 4R4BB 2GT9A 4PJ5A 1AHWB 5IW6A 3SJVA 3UTPD 3MV7D 5CJOH 5TQ0L 4EOWL 3BWUC 1GPOL 2DQCL 4MSWB 1K4DA 4JDVB 1KCSL 4DWHA 4EDWL 1IM3A 3GBLA 3OJMB 5KSAA 2DWEB 4O4YH 2YOCA 3P0GB 2FJGA 4CKVX 4Q2ZB 3MRNB 2MQ3A 4PP1D 3TBWA 1T2XA 3O6KL 5D7IA 2ZP0T 2J2ZA 4PJGE 1YJDC 3DYMA 4E5XB 1A4KB 3JV4A 1VSCA 3HG1A 1AQKH 5IB1A 3KPNB 3P9LA 4CMMB 5IW1A 1KCRH 5LJYH 5F88B 1TTUA 1OP5H 1JTOA 3ZL4H 1E4WL 4TPRL 4OLXH 1C08B 3T65B 5BW7C 1GZPB 4FTVE 1AI1L 5EU5A 4QRRD 1WAAE 4C57C 6FABL 5H37G 4XP6L 3X11B 4YR6B 5IB5A 3U48A 1DR9A 1SM3H 3HE7C 4IMKC 3BUYA 4D0BB 5L0QB 1FVCA 3OAUH 4AL8H 1XF4A 4HUKB 4RQQA 2MCPL 3D3VE 3OHXB 2Y6SD 1O5DT 3D48R 5EU3B 4NOFA 2R39A 3N1FC 5E2JA 2VDNL 2QV2A 3TO4B 3LEYH 3QUZA 4L3AA 2R2BA 5IMOA 4FA8A 2ESVA 1PLGH 4GW4B 1S78D 2ICWI 2NTFB 3Q6FB 4YXKH 4JVPA 2APFA 4YC2B 2C4FU 4B50A 2IG2H 5C08E 2UZYB 2GK2A 4QRQB 4UOJA 1JWSB 5EZLB 4ODVL 1K6QL 3TVMC 3G5YA 1S8DA 3SKJH 3WUWB 2EE6A 2ZUQC 1U8OA 2DQJH 2YWZA 1ZANL 3WIHH 2PXYD 5KANI 1OTSD 2DIAA 1XGYH 1YMMB 4H1LH 4TVSa 4Y2DD 3CFKA 3FMGL 2HT2D 1DUZB 3D3VD 2OJEA 1DDHA 2F19H 2VLMD 2EO9A 3VXOB 4FG6D 5D1QB 5F7KC 4X98B 4WVRA 5ESAA 4DUVA 2HG5A 5I16B 3N9GL 1A9BA 2Y36H 3OGCA 4MJ5B 1U93B 2Z31D 3FQRA 4PRPD 1LO2H 2VR4A 4M1CD 3UJTL 2LVCA 2BY2A 2B1HL 2J6EA 1KB5L 4MD4B 3WXWH 4WY7L 4AT6B 1A6VL 3FRPG 3PWJB 5DJCB 5IHBA 3WUWG 4MAUL 4LGPB 3V6ZB 3HUJE 4U1JB 1NGPH 2A38A 4WHTA 1UKQA 1JE6A 2XZAL 5D5MB 3MJ6A 1WCQA 4MJIE 2X10A 1K2DB 5I8OH 1RFDH 4M7LL 1PSKL 4ZFOB 4AENA 3DXAB 1MIMH 4UOW0 1ZLVK 2J8UE 1E4XH 3LQZB 2PETA 1P7QD 2BVPA 3I84A 1KCKA 3R1GH 4M61A 1FVEB 4LAQH 1N5YL 2NXYB 2QADD 1B0WA 3DV4B 1BJ1J 5T1MB 4BH7A 4XPGH 3U0PB 5T3XH 4ISVB 2GTWB 1XR8B 5FYKH 4F33A 4I48A 2KBGA 2GYSA 4RGNC 1QTYT 5GPRA 4G8IA 2DJ4A 5TFSH 3VFTB 3GMOA 3NCBB 2EC9T 2PW2B 1L7IL 1OAYH 2WSKA 2AS5M 3U79A 1N8ZB 1RJLB 1P7HL 4Z0BH 5HYJE 5CJ5A 3NACH 4GRLA 5DYOA 3WIHL 5CIPB 1NMAH 5J12C 2VRAA 4MDJA 8FABA 3D0LA 2AEPH 4JDTL 4XXDA 5CP3A 1BEYH 3MJ9H 3KLAA 5DD6B 3RU8H 1HXYB 1M7IB 3OXSB 5B3JF 1CL7L 1YN7B 4ZUTA 5TJWK 1TJGH 2MSPA 4APQC 4J4PC 3NVQA 4MAYB 4PJDB 2CDGA 1G9MC 3K1DA 2P24A 2PXYB 3PDDA 4GRWF 1G0XA 1JGDA 2GJ6B 5D7IE 1OT1A 3WS6A 3WJJA 1J11A 1C7TA 4XXCC 3MRMA 2G5RA 1G1CA 1HHKA 1UB5B 1FE8H 3IETA 1K8IB 3NIDF 4L4JA 4POYA 3ARDA 4Y19D 5CBEA 4YHZL 1FLTX 3EYSL 4LLMB 5MENE 5ICXA 2EEDA 4U1LA 5ENWA 1MFEL 2VISA 4MNQA 3WXVH 2A6KB 1A0QH 1HH9B 4U1HA 5CEZE 3BD4A 1A1NB 5HHVH 3E6FA 3OAUL 3QCUH 4OFKA 2VZ1A 2VAAB 2A74B 5MEOB 3K2UH 4G42A 4KDTA 3R8QA 3T3ME 3PWNB 4IBLT 6FABH 4M48H 4NGHH 3L5WA 2WMPA 4PB0L 3SGJA 4HK3N 1OGAB 1RULL 4M5ZH 5FB8A 4L8DA 4EUPG 4JM4L 2DQCH 2AABH 2NX5D 5ILTL 3MV7A 5LBSH 3I2CL 1BFTA 5FGRA 1L7IH 3HNVH 4KKBD 4K9EH 4ZQKB 3EHBD 5TE6H 1GGCH 3HZYB 3DMMB 5IJVB 4LRIC 1YJDL 4P59L 2WV3A 3GO1H 4O5LL 3RWJA 1CE1L 5I8OL 1QP1A 5L88H 5LGHH 2V2XB 1W72L 5JUEL 4ZPVA 5IKCB 5J12B 3VWJA 3ULVC 5KTEL 2WBJB 1QR1B 2VLLA 4ZXBB 5GRUL 4RNRA 2EH8H 3OKNA 1AXIB 1KTRL 4LCCB 1U8MA 1DBJH 4GW1B 5IEHA 4XI5D 3P40A 3N85H 4PBXA 2CRZA 4XNZB 4RWHA 4PJ9C 2JCCE 1TQBC 4GMSL 1ZTXH 1JNJA 1DQQB 4OV6F 5HTSA 1ZA3A 4ELME 4LCWD 2W0KA 3QUYA 5HHMD 1G7PA 4L3ED 3IFPB 3JUYA 4M8QB 3PQYD 3B9VA 1GCFA 5HYJD 4EN3A 3C8KB 5EU4A 3DECA 2X4NB 3EYFA 5JLZB 5D6CB 4RFNB 5HYSA 2BX5A 2D7QA 2ZSVA 1JN6A 2HVJB 2P8PA 3AU1B 4JKPH 1JIBA 4AIOA 2ZG2A 3TFKD 4CU6A 2E7CA 4OGXL 5CZKA 2PTUA 2R1XB 4LHQB 1CGYA 1HSAA 2EDEA 4WGVB 4LP4A 4FP8H 4KQ4H 4XVUD 3DX7A 4PRHD 3QDGA 2EKSB 3LB6C 4WEMB 3N1QC 3VWKC 5DSCB 4KI5D 2OK0L 4KRPB 3LEYL 2GK0A 1YEFH 5D2NC 3MV9A 1T4KB 1MNUL 4KRMB 5KG9B 4F2MB 5ETUA 5KVGL 3RA7L 3OKKA 1IM9D 4CGTA 4PJ8A 2E9IA 4DKFL 2A77H 2A6JA 4HFWB 5F7LB 1Q9LB 3VXRA 4ZOCA 3T0WA 1WWAX 3MFGB 4F7PB 5MHSE 3NA9H 5E2UH 3KLHC 3NBNA 3P4LA 1CFQA 3F7PC 1ZE3C 3PV6B 3U1SH 4D9QE 3BKYL 4NN5C 4NZUL 2D7MA 1A1OB 4UILH 1FL6B 4Y16B 3V4PL 3FRPA 5CS7A 5L6YH 4G80B 4M3JA 1B0RA 1C5CH 3VRJB 4NO0B 3KYMA 1V7NH 1PY9A 1BF2A 2P45B 1SEBB 3ZDYE 4L8BA 4NJAH 3AFLA 1IGJB 3HR6A 4HQQH 2QHRH 2AK1L 3F62A 3UTTE 1IEHA 2CIIB 4LPXA 1CG9A 4DUWA 2LU7A 4OCXH 3S88H 5T1KA 3RPKA 1M7DA 4YFEA 3SY0A 3I6KB 4G7VL 3HC0B 2H2SD 2VE6A 5T3ZD 1Q9OB 3O11B 1KJ3L 2J6EH 2BSRA 1BX2B 1NGWB 5DEFB 3TO2A 5IB3B 1GZQB 1WBYB 1YEDA 1OARH 1CWVA 2EDKA 3FHQA 3NPZB 3H9SA 4NZRH 1II4E 2X5PA 2X2YA 2WUCL 4YHIA 1PD6A 3QYCA 4BSWA 3IKKA 4N0UE 5DUMH 4EKXA 1BD2E 5MEQA 1KJ3H 2VAJA 1DANU 1MRFL 5CJOL 1ZT7A 1WFTA 5D1ZB 5BVPL 3P9MA 2FJHB 4E42B 1JPGA 3BDXA 3GKWL 4I9WE 4U33A 1IAIH 3CVIL 1T66C 2IFFL 1Q9WA 4MB5A 4WGWB 3V8CA 3K4ZA 1J0HA 4OTXL 3ZTNH 4NZRL 1ES0A 2NXYC 1ZA6B 4TUOB 15C8H 5T1DH 4Z77A 4ZUSA 4M7ZB 4X6FA 1JZ8A 4OZFA 1UH2A 5IB2B 2VLJB 4KTDH 5DFVC 1FHGA 4K3JL 3UPCA 4IOSD 5SX4I 1N7MH 2EDJA 5J3HD 4QYOB 1T5WA 4JO2H 3HI5H 4HXAH 3MNWA 4LPCA 5D71H 4LHUA 1NCUA 4FXGB 2BXYA 1SJXA 5CGYD 3B3IB 1FVDA 4YDLC 4Y16C 1WAAF 3L3IB 2VN7A 4HJGB 2VDPL 5F7WC 1ERNA 5JXAL 3FT4A 1MCBA 2BVOA 2ICWB 4ZUUA 3EYQD 2V7NB 4N0UA 3ZO0A 3FO0H 3IVKA 2AK4E 2H6PB 3KYKL 1LP9B 5DI8A 5D7LA 9CGTA 1UM5H 3SQBA 5SWSA 3DXAD 5EBLB 2CMRH 2FX9L 2FIRT 2H32B 1BZ9A 1QSFB 1WBZB 2EIZB 3FT3B 1VADB 2AVGA 2NY2B 3MLSH 3U2SB 3RAJH 2PW1A 4F15C 1Z6JT 2PTTA 1PX4A 3TT1H 4FMKA 3VW3L 4KKAC 2Q3AA 3PABA 3N06B 5HHVL 1G6RH 3PWLB 1WBXB 1NC2A 1F3DJ 5JMRA 4PRBA 3V6FA 2ZCLH 1AGBB 3WEXA 4AEIH 2X4TB 1J18A 1A1MA 4U1MB 3BEVA 4KJQD 2XWBA 2ILLA 1IQWL 5I8CB 2MNUA 4JZOA 5E00A 2JJSC 1BLNB 2XZQL 3BAEL 3MCKA 5L2KA 4PR5B 1EO5A 1KPRA 2VQ1A 4NP4H 1I1AA 5I1CL 5I2IA 5FXCH 4JFDA 4M1GL 4NRZB 2QBWA 4J1UA 3PL6C 2FBJH 3IXAB 4OJFH 4PJ8C 4YHKL 2NY2D 4R3SA 4XCYB 3GMRB 4GW5A 4P46A 1GOFA 1OM3H 4C56D 5GSVB 2E6QA 1GAFH 1I85C 3BDBA 3F7VB 1AD9B 4APQB 5FCUH 4NZTL 1FFNB 1V3LA 4RSVA 4JRXB 5JUEH 3T1FB 5FM5O 2B39A 4F9PA 3ARSA 5DK0A 4S1SL 2IF7A 3DX6B 3KYOA 5IHZB 4Z8FH 3GI9L 1OAZL 4NQUA 4XB7A 5IBTH 3V6OC 3CCHB 4LCWA 5C0CE 1BFVH 3BN3B 3T0AA 3C08L 3CLEL 3PQYA 3MO1B 5FYKD 4Y4FD 1SQ2N 4Y1AB 3INUL 3O81A 1AGFA 1GYAA 3LSOA 3TN0C 2GKIA 4ETQB 5C09A 5H2BB 3CC5A 4OAWA 3WMSA 4NKDA 4KRLB 1MFCL 3D69A 1DBKH 3QQ3B 1LEGA 3IJHB 1WCBB 3OKLA 3GM8A 1NCBL 1T80A 2DQFB 3UYPA 2WIMA 1WZMA 3FO1B 4LSUH 4Z7QE 4JPVL 2BHZA 1OTTD 1C5DB 1HWGB 3N1MC 4JFDE 4JQXA 2R1YB 4N8VG 1CDJA 1TJHH 2W60A 5DQ9A 3B8SA 1HI6A 4N90D 4GG6A 1A0QL 4HMCA 1ZVSA 1WIUA 4FFZL 2RAMA 3I6GB 3O3AA 4DKEL 3TBVB 4WRLA 1IM9A 1KIRB 4ONHA 2YMXH 1RMFH 4W70A 4WWKD 3ALWA 5FV2A 2PYEA 1QSVA 2Y7QA 3TO4C 4QCIA 2NXYD 2QADB 1JNHB 2FIKB 1F3JA 4BZ2H 1E6OL 1HHGB 3D0VB 2YD8A 3P77A 5JW4M 2DKSA 5BS0E 4PJXE 2HH0L 2P5WD 2O5ZH 4WTXA 4ODSH 3VXTA 1G9EA 1YEIL 4RWYL 3MRKB 1BFOA 2HKFL 5A2JH 3VH8A 4WUUE 2QHLA 4JO4L 1T22B 3DSFH 3ECBB 3AUVA 2H1PH 5SWZB 1GSMA 1S7TB 3HRPA 4ZXBC 1DQML 3GSNL 4DGIL 4AZ8A 4JKLA 4P5KA 1EVTC 3FT2B 3LN5B 1KEGL 4YBLC 3JTTA 3IDIA 3V95A 4EVNA 1FZJB 3MRLB 4XNZC 4YX2H 3GHBH 4IRSB 3Q3GB 4GXUN 3BPLC 2Z8SA 4U6HA 1MWAA 4UT6H 4TQEL 4Q97A 3H2WA 1E27B 1ZANH 3O6MH 4JKKA 1MUJB 4LVOB 5IWLA 2AKRB 4HFUL 4RZCB 2BK8A 5BZWB 2EH7H 5HGHB 1G6RL 1D5BA 4LSQH 4YFLF 3T3MF 5E4IA 1G7HB 4LSDA 3P0YH 2WUBH 1FBIH 5LGJB 2YD4A 3H9SD 5HSFA 4MDIB 1HILB 5E5MA 1YYML 2V5YA 4CVXB 4HIJB 4LLDA 2AEWA 2A9NL 4NZDA 4O4YL 1CFTB 4YK4C 4JY6B 2YR3A 4RIRA 5JR1H 1UM5L 2ATKB 4P3CL 1IC5L 4PJIF 1Z3GH 1Z5LA 1A7PH 3O6FC 1IQDA 2X1XR 5F1IB 1EEZA 4P3DA 3AY4C 3KS0H 2B20A 4PJFF 3BVNA 2BVQB 2J4WH 4R4NC 1N2RA 1RFDL 3LS5L 3HZVA 3WHE0 3HCVB 1T1YB 2GITB 3MV8A 3GJFH 4PJEE 5GGQH 4M7LH 3MZGB 3KPSE 4XP4H 3IGAA 2QADC 3MLTB 1B0GA 3L6FB 2W9DL 1W8NA 5CSZB 1CF8H 1R5VB 1FNSL 3L5HA 4OZIA 2EIDA 1C7SA 2FBJL 4OJFL 4HPOL 2DQTL 4TULH 4LOUC 5FYJD 5INCA 1G6RB 2Z93B 3HAEG 5TE4L 4ELKA 3L5XH 3QEQD 4ZS7L 3C5JB 1GPOH 3WD5L 2R0WH 5T5NF 1HHJA 5HHQB 1G7LB 3SE4A 4JFFB 2Q20A 1TJHL 3CVHB 5GRWA 2FJFB 1U8JB 3C08H 3MJ8B 2R15A 2ARJB 4OM1H 2H9GB 4JO3L 3QNZB 5IVZB 5DC9B 4LARH 1MJ7H 2Z31A 4PRPA 4WI2A 3IFOB 3HPJB 3FN9A 3F5WA 4X6DB 2YD5A 2HFFA 1YEKL 4JCLA 4KROB 5LAXB 2QLVB 2CO6B 2DKMA 3BRGC 1OWWA 3TBTA 2Q1EA 4P5TB 4ELMA 4PGBA 5BS0D 3L9RB 5DRXA 2BOCA 2VXVL 5EC1A 3ZT5A 1F4YH 2ZPKH 3MOAL 4FFYH 2LV4A 1YPZA 1S9YB 3ARBA 3C2SA 5HI5D 3FQUB 3HPLB 4J3SA 3TP4A 3QRFM 3ARPA 3ORJA 2QHRL 3O45B 4MJ6A 3Q5YA 2FATH 4EBQL 2P46B 2D3VA 4HKJB 4XWOD 1CQKA 3UC0H 3QG6A 1IAKB 1TPXB 4OGAD 4KJQC 4OLXL 4TSBH 1EBPA 4LSPL 3EFFB 4L8SA 1I8LA 4YHKH 1EUUA 5FKAB 4RGNE 3CU7A 1XIWD 2NQCA 4R9HA 3QULB 5FHBH 3HR5B 4PGEA 3QI9B 1T2QH 4PLJC 3G6JA 4PGDA 3C5SA 3S6CA 3ZDYF 5DF0A 1JGUH 2BNRB 3CFJA 5KSBE 3BAEH 3UTSB 4O9HH 4I2XE 5CINL 1X6LA 1MCSA 4JZJA 1F90H 1QYGL 2EIBA 4MQ7A 4OI9A 1KCSH 3QUZC 1VEOA 5SWZE 3HS0A 3BD3A 5TQ0H 4MA3B 3LV3A 2ITCA 4EUPB 1FZOA 4UNUA 4G9FB 1F97A 2E6PA 1XIWB 4JDZA 3NAAL 1RZ7H 1J8HA 3ARGB 3IS1X 2JELH 1NH6A 1T66D 1OARL 3TCLB 3D1MC 1NAKL 3H3KA 5F93C 5GQBA 4HH8A 4PGCA 4HC1A 3VFUB 3FFCB 4EZMA 3SKNA 4IEFB 1CFVH 2YK1L 3B4NA 2W1NA 5DWUH 2B4CH 1FP5A 1RIHL 4JG1L 2G9HA 5DJYB 3DVGA 1CU4L 4P2RE 1KLFA 3O8XB 1P53A 4TVPL 2P8MA 1YMMD 4KH2A 4WW2B 1KTDA 4QRPE 4BKLB 3UAJD 4KAQL 3SE8H 2R69L 5FYKU 4P2YA 3W0WB 3A6OA 2X7LA 1CD1A 3G6AB 4JHWH 3D2UD 5L8KB 3MRCB 5EO1B 4IM8A 2P5EE 3NIGF 5TGBA 2HTKC 5CMAA 1FN4B 1WFNA 4KUCF 3PGDB 1RVFH 2X4SA 2X4OA 4X4ME 2V5MA 4JN2B 1QNZL 1KC5H 2ZSWA 1S7SB 4HS8L 2PKDA 4OGZA 4B5EA 3RPIB 1T7VA 5D7JC 1FNAA 2M8XA 1KIPB 3DXAE 1BVLA 5ESVA 5D5MF 4NO5A 3RVVC 4KPHL 1R24A 4L4VD 1QLEL 2JK5A 3OV6A 4HS3A 4ZOBA 3DHMA 1OQOA 1JGUL 4Y4HD 2DWDA 2F74A 1ROWA 3OR7B 2AABL 4O2CB 1EO7A 5IFHL 1UH4A 3GGWB 1U8HB 3MFFA 1XEDA 4JY4A 4K3EL 1KLUB 3V5HA 4M3KB 4YHNA 5MERA 3QI9D 1DN2A 4LPTA 1LK2A 3WJJC 1FCGA 2MWCA 1A7RL 1A2YA 4GSDL 2F54E 1NFKA 4AQOA 4Y4FB 3V7AG 4NBYB 1I7RA 5D72H 5CEZD 2LQRA 3HNTL 3QA3B 4C4KO 4C55A 2EDQA 5DRNB 1QRNE 1U8LB 5J9PA 5DA0B 2ADJB 2G75A 4PREA 4S1RL 4XNUL 4XZUA 1CI5A 3TNNA 2Q86B 4E0RB 4OZFG 4XP9H 1CGVA 3D39B 3LEVL 4YDVB 4PJHB 2XV6B 4LEOB 2PYEE 3BZFB 5TDOB 4UT9H 5F3HA 2GCYB 4F80A 3LIZL 1RZJH 1NMBH 4KXZH 1YECL 1IFHH 5IGXL 3NZ8B 2VITB 3ULVE 4OCWH 2ADGB 5C86A 3EBAA 1P4LA 4PGJA 3ARQA 2HLFD 4KUCD 5JZ7D 4AEFA 3EOTL 4QY8B 1MCKA 2D7OA 4LVOC 4HG4J 1AY1L 4EN3D 1MJUL 4D3CH 2IEPA 4X99A 5CP7A 1MQKH 1KUMA 3WIFB 1IL1B 4X8JB 3WNLA 1F4WH 4TSBL 5TH2B 3PL6D 3O4LA 1INDL 4R8WL 5CAYB 4YQXL 5F89B 3LH2L 1PBYA 4G6MH 1QEWB 3TVMA 5KTEH 1RK1B 4I0KA 2FGZA 4EIGB 5ID1A 3ZTJH 4PRHA 1XF1A 3OXRA 3R06B 4XH2A 4EJ1C 2NY0B 2EE3A 3VRIB 2ORBL 4BZYA 5GRJH 3NMEA 1MWAH 3T09A 4Z7UE 1WFOA 2Z9TA 4K7PX 3QWRD 1CF8L 3MRRA 5JNYA 1UWGH 4XVTL 3C9NA 3NOIA 1AHWA 5IW6B 2VB5A 2X42A 5I9QC 5AD0A 2V2TB 3U30C 3I6LD 4BSVB 3BPLB 4QXGH 2OQJB 3D25A 2Q3ZA 3GM0A 3NGBC 3AY4A 5AZEL 2MPAL 2HVKB 4E41B 4TUJB 3O2WH 5T5FH 2GSIA 3CDGA 4IRJA 4Z7QF 5DJAB 5T3XL 3CZFB 2IBBA 2BVTA 3PDOB 2VXUH 1JWMB 2VLKE 2FB4H 4D0CA 2O5YL 1J87A 5FECB 3S37L 3DETD 2E9BA 4QRSA 3KNBA 2QSVA 3GMQB 3FHAA 4BFIB 3MZTA 5CWSB 2YPKB 1OAZH 4H8WL 1IBGH 3IU4H 3LKRB 4OFVA 3Q1SL 3L3JB 2KZ1B 2AJ3B 3I75B 3UTTD 1KBGH 3KPSA 3S4SA 3S35X 5HI5C 1NUFA 1UYWL 5DMJB 5HGDB 1M71A 3EO1A 4X6EB 1QBBA 4TOYL 3O6ML 3R4DA 3ROLB 3SPVB 1PFCA 1N0XL 5DMGC 1BP3B 2FLRT 4LFHG 1CIDA 4HKZB 1NC4D 1T3FA 3VXME 4PB9L 6CGTA 1JHKL 3LY6A 4NRYA 5DRZA 1R5IA 4NZJA 2Q7YA 4YDKH 1KG0B 3C87A 5DD3L 1S7WA 3KPLB 1G7MB 1AGDB 1CZ8L 4P0DA 2JJWA 3QDJE 1F4AA 2ZUSA 4NQEB 1J88A 1IAMA 2DBLH 4JGUA 4Q9BA 3A6CH 4RWYH 4YX2L 2DBLL 1YYLH 3MPCA 3ALPA 1M05A 2EDTA 4G6FD 1MCLA 3W9DA 1B4JH 4Z7VE 3NFNA 1NEUA 4OF5A 4U1GB 1GC1L 4NO3B 2Z91B 3MBEC 3U36A 3L95A 3LHPH 1A8JH 1L9NA 3GB7B 5FDWA 3REVA 4MNHB 4BZ1L 5B39G 1DDHB 2VLRD 2D4DA 3NCFB 1JRHI 1YEHH 2CDFB 4NQVA 1ZSDB 1LD9A 5GRZA 3OGCB 1EFXD 4UT6L 1CFSA 5E6IC 3CMOL 4CU7A 2ZOLB 3DTXA