4X50A

Crystal structure of fimh in complex with biphenyl alpha-d-mannopyranoside
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title The Tyrosine Gate of the Bacterial Lectin FimH: A Conformational Analysis by NMR Spectroscopy and X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
total genus 34
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4x50A00
4XO9A 4AVJA 1N12A 3ME0B 4XOEA 1UWFA 5CGBA 4AVHA 5IQMA 1TR7A 4AUUA 4AUJA 5IQOA 2VCOA 4J3OG 4AUYA 4AVKA 4X5QA 4ATTA 4XOCA 4AV5A 4X5PA 3ZL2A 4XODA 1PDKB 4LOVA 2XG5B 4AV0A 3BFWA 5FS5A 2JTYA 5FWRA 1N0LB 5F3FA 1ZE3H 3JWNH 5LNGA 3JWNE 5FX3A 4CSTA 2XG4B 5ABZA 2UY6B 4AV4A 5AAPA 1QUNB 5F2FA 4X5RA 4BUQA 4J3OF 5AALA 3RFZA 5AB1A 4CA4A 2J2ZB 2UY7B 3ZPDA 4CSSA 4X50A 4XOBA 1KIUB 4AVIA 3ZL1A 2W07B 4J3OH 3MCYA 3SQBB 5IQNA 3JWNG 3BWUF 5LNEA 3BFQG 4XO8A 4XOAA 5FLUA 2WMPB 2JMRA 1KLFB 5JQIB
chains in the Genus database with same CATH superfamily
3LKQB 2MTPA 4N68A 3IPBA 2ENQA 5D1QC 5ANMA 1V8HA 2VRQA 1YVLA 3GMOA 3MROB 4GS7B 3VW3H 3ME0B 3A21A 1MCPL 4MJ4A 3AWFA 3WSQH 4DPBX 1LO2H 3DKHA 3HR5A 3HB3B 4DP9X 5D7JD 1RZFH 5I1LB 4LLWB 5I1KH 2ZUWA 4Z7WA 1GGBH 1U91B 3KJ6H 4S0TD 5KJRH 1UYWL 3EFOA 2VTFA 1UZ8B 1QW9A 5HHNA 2RIKA 2WGNB 4XT1C 1FC1A 1WQVT 4AENB 3QDJD 5KBLA 2P5PA 3L3HB 4ZW6A 1DN0A 1H6EA 2ROXA 3OMAB 1Z3GL 3DO7A 2IBZY 3FUHA 4YHMH 4NERA 3VG0L 5C8JB 4LF3B 4JFDD 2Q2EB 4MJ6B 4RBPK 3MV01 1C5DA 3N43F 3DGGB 1WC7A 3CFJB 2XWRA 3G9VA 3WN6A 1A4KB 2WWMC 4O5LH 3RZCB 3DJZA 1P7HL 1FGVH 2ICCA 3DSNB 3UACA 2WUCH 3MV7E 3I9AA 3W3BA 3RI5K 3IRCA 1R9FA 4KFMA 3L95A 3VFUA 2HN7A 1FI8C 3PLYA 1H3TA 3PDDA 3AJ7A 2HJKA 1MCWM 2GJRA 2HKHH 2QFRA 4H0LC 3QISA 5A6LA 4QGYA 2WZPD 1HWHB 2FIRT 5KVDH 4PJAE 3SBQA 2CLRA 1NFDA 1E27A 4QOKA 5IVXF 5KVFE 1QBLL 3TBVB 1GZPB 5MHSE 1FZJA 1UVQB 4I88A 3D51A 4FQXD 4R8WL 1T21B 2XY2A 4HCFA 3VXNA 4D0CB 4PJHE 5ABZA 4HPYL 4JAMA 3LTVA 4NQCD 2F7PA 2EIZB 4KGLA 4XP9H 2Z7ZA 1U6AL 3MOBH 3O3BB 3HN3A 1QFPA 3BWSA 3SYAA 4UTAA 3GXPA 5EU5A 4YJZL 1TJIL 1A2YB 1EERB 2DEYX 4OZHF 3UL4A 3SKMB 1DBKH 2C9VA 1KCSH 4XWOD 3GXIA 1TSRA 5DRWA 5BZWB 2NCMA 4J3OH 4MMXA 4PJ9B 2XA8L 4P07A 4WLCA 2ZSVB 4MDJB 2W95A 4FG0A 4M29A 3LRLA 3D9AH 1CFQB 2A0LC 3X12A 3PHQA 4WJG3 3LEVH 3S37L 3KBEA 3W38A 4IRSA 4MMXC 4OIAA 3HPLB 4X6FA 1KELH 3W5NA 2BVPA 1C16B 5C0FA 4LLMB 4NKDA 3KBPA 1BYOA 3BH8B 1WA2X 2DQMA 4MDRA 2TRHA 3K4DA 5AG8A 4LP8A 2FJSA 4IRSC 1IGYA 4FFWD 4HD9A 4JG5A 3MRGA 4JLRA 4QHMA 4Y5XA 4U1LA 1ML0A 2RGSA 2OTWB 3FB6A 2ZNXA 1INEH 3IGAB 4LHUG 4TOYL 2HX7A 3RDTB 3V0VB 3BH4A 3CH8A 1I8IB 2QEJA 5K9KA 2BVYA 3DGDA 3A6BL 4G8EA 1AOHA 2O1AA 3CC5A 2V37A 3O45B 4Y5XC 5C6TL 5E2WH 3MJ9A 4FQ1H 4HUUA 4OD2B 1ZLEA 2Z34A 4W70A 4WIQA 3SEPA 1NEZG 3L1GA 4CMMB 4N6RB 3S5LB 1UD2A 3VSUA 4NO2A 3BGFB 4PJCA 2V9TA 3QJFB 4PJFE 3T3PF 3B2DC 4GMSH 1PD6A 4GO9A 3WLWC 1E3ZA 3R7QA 5EUKA 2MQ3A 1QTPA 1SRDA 4XZUB 2J4WH 5I6LA 4N90E 1QA9B 4J3TA 2OL3L 2FX8H 3E2HB 4MD0A 5GGSA 1AXTL 2GUOA 4R26H 2F7OA 2JTYA 2FATL 4XPBH 5EIIG 5H37G 4LHUA 4KQ3H 4NKMA 3DIVA 3F7YA 2GC4C 1ZLSL 1T1XB 4PRAB 5JW3L 1MUJB 1CDUA 1NMBH 3HG3A 2EC8A 2FDBP 2FGZA 4R83A 4EIBA 4IBWA 5GJTL 2VDOL 4AEIH 4D0DA 4X5WA 1RFDH 1KJMB 4NENA 1JBJA 2HX9A 1R5WA 5TH2B 5K33A 4K0OA 1XGRB 2C1OB 4JO1H 2WYIA 1AMXA 2XJLA 2DYSB 1BGXH 2JJSA 2N1TE 2NTSP 3ALPA 3U4AA 4ZO9A 1UCBL 3DX1A 4ODXA 2QL1A 4B6ZA 4AQOA 2OW7A 1E50A 1VHPA 1KTLA 4JPVL 2OMVA 4L1SA 5FYKE 5BRZE 1LO3L 1J0YA 1Z66A 3TPUA 4M4RB 2CCLA 2JJSC 3O2VL 1HN1A 2J8UF 3SDDD 4CA4A 1KBKA 1SNRA 3S36X 1T5WA 2DQ6A 1BVKB 1ZSDA 4E9SA 4ZX4A 2O61B 5H37A 2PPCA 3L1OH 5EIIA 3L2LA 1O9VA 1AD9B 2CMRL 2DJSA 3D39A 2O6PA 3PWPA 1FSKC 1FP5A 3NIGE 4G8FB 3MRMA 1JWUB 1SJXA 4PCKA 5E5MB 5KS9F 3ETBF 1D5IL 1OAKL 2F8VA 1H5BB 1N9PA 2JKSA 3TNNB 5LGYA 2DYPA 2CO6A 3SGEH 4TVUA 3LS5L 4PW4A 2RD0A 2Y0SA 4HH9B 4LOFA 1QRND 4GB9A 3VVVA 5IB3B 4G80A 5KVGH 1RIHL 1TEFA 3X13A 2AJYH 3DX9A 3HC0B 1JVLA 4Z0BH 1AR1B 4OZIE 3QWRA 3CHPA 3UTOA 3AXHA 3BUPA 4CN4A 3WE1A 2FT8A 2WBKA 3OLEA 3PXHA 5CJOL 4NOFA 1G7QB 5EUOA 3EO9H 2WQVA 5DFTA 2OP4H 3SKNA 2AJZB 3ARFD 1EXUA 1ZLDA 5DFWH 2W59A 1JNLL 3Q1EA 3OAUL 1JGDA 3SE9H 1VFAA 3OG4B 3L4CA 1AR2A 4ONHB 3ULUL 4QF1A 2BJMH 1CXHA 3DC0A 3OKKB 3OVUB 2IDTA 1IMHC 3ZVVA 1F90L 3WKQA 4A6YA 4G42A 1G4MA 5EU7E 2WCGA 3MLUH 5BXFB 1EGJH 5C0AB 4TSBH 2CXKA 2FEDC 1JN6B 2XXGA 2Z35B 3PABB 5CF3A 1A3QA 3IVKA 2RCSH 4G8GB 4K9EL 1II4E 5KWYC 3O41A 2H2PD 4F57L 1YMME 1BG9A 1AGDB 2QVIA 3OC5A 5DD3H 5DJZA 1KIQB 4ZS7L 5DK2A 2MWCA 3JYBA 4LVOB 2X7LB 5DHVA 2AK1H 2FD6L 1MRCL 5F1IA 4B9YA 5E08L 1NSNL 3KHOA 4WTZA 1MCRA 2YAQA 4IIQA 3MLZL 4CVZA 4JUSA 1J1PL 1AGCB 3VTMA 1RVFL 4LSDA 4R5TA 2IFFL 1DSFL 2X4RA 2NNFA 3OKYA 3ZE0B 4Q9QL 3HIZA 1V54B 4QTHB 1V7NL 3RPIA 4M1CC 4M5ZH 4MMYB 3E3QE 4IIQC 3P9MB 5IESL 5I1CL 2NLJB 2BSSB 3D2UA 4LFHD 1CE1H 4PGCB 3RNQB 4LP5A 4DKTA 1VEOA 1IM9B 2WAHA 2WB1A 1KCBA 1LK2B 2Y07L 3BPLB 4Z76A 4OR1A 3A22A 3DWTA 4N0UB 3O2DH 2G9KA 5JDSB 2J2ZB 4FFVC 5J1AA 2OMNA 1LEGB 3GNML 2Z64C 1IGFL 2OXGA 4ZMWA 2J25A 1CGXA 4XOBA 2XFXB 4U1KA 3LIZH 1WUNT 1XH0A 5IFAL 1UXSA 4HFWA 4QLRA 3F2LA 3H2WA 3KYOA 4OLVH 1A0QH 2R2HB 4P2OB 5D2LA 5B22A 3RWIB 4KMQA 5GRUL 1S9VA 2D9QB 2EDNA 2V7HB 1G6RH 5B39A 2WSKA 3MNVA 3PJSA 2AJXH 1GYUA 3VYNA 3QXDA 4N2NA 3X3GH 1TQVA 2N01B 3PHAA 1F3DJ 3VFWA 3RWDA 3A67L 2BVQA 5L4IA 1ZLUH 1F4WL 4ZG1A 2ZXBA 3KVPA 3BIAX 1T0NA 1TENA 2M2DA 2EDMA 2CM5A 4C56A 1CR9L 4JJOA 3KBHE 1FNLA 1FNAA 1T04B 2B3RA 3FQTB 4JFVA 4XVUD 3UBXG 2KLSA 4X0KA 4I0PB 4Q9BA 4S1DD 4BM7A 1KJVA 4X8CA 3TZVB 3ARTA 4GMTH 1UEMA 2Y36L 4H25B 2RA1A 1M71A 2PPDA 1NICA 1RKRA 2X4OB 1Z5YD 3FPYA 4K4KA 1DQQA 5BW7A 3RVXC 2CLZB 3FO0L 4JFPA 1SY6H 4IOFD 4N3UA 1L9MA 2VM9A 2AEPH 1JRHL 1NCAH 1P0SE 1E4XL 1AXSB 4MVBC 1SDAB 5BW7C 5BOZG 3FRPG 2DLEA 1IQDA 4P2RD 3H9SB 1RUKL 4YE4H 4LASL 1CDYA 2ZQKA 3EOTH 4HGWB 3VVWA 2F53E 5BV7C 2IADA 4L29A 3MUGA 1BV8A 5EZLB 3LB6C 3WO4B 2QKIC 1E42A 2OJ1A 3BFWA 1SOQA 3SODB 3NCYP 4DJMA 2NY2D 5C9JB 4JNXA 3DNKA 1ZS8A 5HHXL 2CUMA 4JO4H 3VJ6B 1TZHB 4P57A 5CIPH 1TYEB 5FX3A 2X12A 3HJ0A 3VMOA 1V3LA 3KJ4B 4HKZA 3V2AR 3RA7H 3CWGA 4PG2A 3W2DL 3D08A 1ZV9A 3WI9A 3DV4A 1KTCA 4P2QE 1KT2A 3OTTA 4HKXB 1P4BH 2YS4A 1RP9A 1HQRA 4EVNB 1XIWD 4JE4B 4DN3L 4JHZA 1JZFA 2K4WA 4XPHH 1QSEB 4PG2C 3MGTB 4M7LH 4Z76B 1I8LA 1LO0L 2AERT 5F3HA 1MHPH 4JPIA 2BP0A 4Q6IA 1M4KA 2PCXA 3HMXA 4O4YL 2ADFL 1KFGA 1G9ML 2YBGA 2XV6B 5D1QD 4R7NB 2H4EA 4UQAA 3TO2A 5D6CB 4KRPC 1KIPB 3IDXL 1I8LC 4LLVB 4JFEE 4HJ1A 1A6UH 1HKLL 4Q6IC 4UINH 5K93A 3ZL4H 5IQ7H 1JPSH 2XPYA 3ZUNC 1OP3H 4XPFL 3GHBH 4XCYB 4I5BB 4POYA 3ULUE 1X7QB 5F96H 4XNAA 1EV2E 1MWOA 2C8NA 4FQJH 3BWUF 2AI0H 4TULL 1IAIM 1U8QB 1FHNA 1P5VA 1EMTH 4XBMA 5I19H 4HQQL 4DVRL 2F74A 1GY2A 4YR6B 3RURA 3H56A 4ZUSA 4PJIF 4LL4A 3IAPA 5T1LD 3DPBB 4IGBA 1Z9MA 4OIFA 5AVUB 3VB8A 3X3FH 3MREB 5SWZA 4ZTOL 4NNXA 4F8OA 2WWMD 3MUZ1 4GNKB 5CHNA 2Z0UA 1UA7A 1CIDA 1DQKA 1MFCL 1U3JA 2QPUA 1AZNA 5CAYB 3BPOC 4IGBC 4GG8B 2M26A 2LLNA 1D5MA 1OAUH 3WY4A 5F7NC 2OYPA 2IMMA 1DJHA 3GHPA 3QZBA 4HMCA 4QDGA 4U1GC 5EWIL 3E80A 1ZHNA 3FQ2A 3TT3H 1HJBC 3EF4A 2FZ3B 2E7LA 1XDTT 2VDMB 2LLLA 1IBYA 5DHMC 4ADIA 5J06A 5HVGB 3A5VA 5EF3A 4HH8A 1IGJB 2OSXA 3UDWC 3QUGA 1HESA 2LHAA 5EZJA 4HHGA 4I2XB 5MP6H 4OCYL 1ZT1B 4NNPH 4Y5YB 1L7TL 2E7LC 1VFOA 3TBSA 4JDEA 4GG6F 3STZB 3VGAC 4QOKD 3TBWA 1AYRA 3VDBA 2X88A 2R1YB 1JNNH 3QUHA 4QCIA 1IFGA 3ESOA 3ZYZA 1MLBA 1D7CA 2CJ3A 3WUZA 2BSRA 4LKXA 4TUUA 1NOLA 5BZZA 1OAXH 2X6CA 4RMSA 1SYSB 1BM3L 4I3GA 4FNSA 4PRIB 3CFBB 5DRNB 2BH0A 5T1JA 4YSTA 1P7BA 2X1PA 2NY7L 4NO3A 1ROWA 2C3VA 4JO2H 3GBLA 2A0LD 1DLHA 4L3EB 3P1VA 2VIRB 5HHOA 4K7FA 2HWZH 3NCBB 3ZE1F 1RK7A 3KPQB 5KJ4A 3Q8EA 2B1AL 1OGTA 4FERA 4CVXA 2DWSA 5LLIC 1CFTA 1OEZW 1ZHKA 4TUKL 5FDYA 2IPTL 4PJDE 3PWNA 3OGOE 3MRQA 3QCUL 2WXPA 4HJUA 5E1QA 3GWJA 4Z8FH 5CUSH 4O2CA 2LFEA 5ERWA 4IRSD 5F7UA 1CG9B 3NCMA 2VLRA 3QXAB 2XIIA 5LN4A 1I9RL 1CFSA 1CU4L 3B9AA 2ZX6A 3WFHB 5JORB 1XSOA 4XX5A 2DQJH 3JWOH 2VGLM 4GW1A 3IJSA 3KH4A 4M7ZC 4QRSA 4GI6A 4R4BA 3ZE1B 1EJOL 5F7HA 1N0XH 3SYCA 1ZKAA 1Q0YH 1KIUB 3FONB 1W0VB 2KERA 2YXMA 3QORB 3SQBB 1YA5A 4NRZB 4F7CB 4TM9A 3OAWA 3FNKA 1BAGA 3FQWB 5EFIB 5TF0A 2N56A 2H3NA 3H9HB 3U30C 4PV1C 4L4TA 1R5IA 2P8LA 1AAJA 3WLWD 2P45B 2VLMD 2CBOA 3DX8B 5KVMC 3PF2A 2BHYA 2ODHA 5CO1A 3D8MA 5C0EB 4WI4A 1CYWA 3WTSA 2DV6A 3PPEA 4AWJC 1M9SA 1XQ4A 2WTRB 3LS4L 2P8PA 2PW2B 4KDVA 1KB9K 3UMNA 4XOEA 1MRDL 2WXIA 4HAKA 2FX9L 1OE1A 3TBTA 3DXAB 4HZAA 4A38A 4CNIA 3U0TB 2VXUL 2X09A 1CLOL 2ENSA 3LN4B 1VDGA 1RIUL 2WGXA 2FYYB 1H8OA 1RSYA 3FULA 4LHUD 5T8IA 1KN4L 3QEQE 4G6JL 4J3OG 2Z4TA 5DJYB 4RFEB 1UWEL 1FRGL 4K8RH 1AC6A 3DOIA 5E4OA 3HUJF 3GRBA 1G7MA 1MHHB 3VXTA 1IGMH 1F41A 2WNGA 4NNYB 1XF2B 1MJUH 1BYPA 2LABA 4YX2H 4MNGB 1EZUA 3SDCB 3CXDH 1IBFA 4KX8A 3SCMB 5LWYL 1MPAH 4Q6KA 1G87A 4Z7VA 1MCJA 3UROR 2WINA 3VXUA 1KACB 3NCYS 4N9GA 5G2NA 1IAOB 1LM8V 1BF8A 4XMLH 2HYMA 4PWJA 3BO8A 3VWKA 5LGKA 4N8VB 3DYMA 3O81A 3DK2A 2RALA 3I2CL 2VXTL 4LLDB 5HGDA 1R3JB 1OP4A 4GKOA 3HS9A 5D6DA 2V5SA 3GT6A 5DUJA 3MXVH 2X9XA 4NKIH 4P4RB 3F7LA 1BD2E 1IKOP 2BZCA 5GRVL 3ZDXE 4D9LH 2AK4A 4LU5H 4OT1L 1O5PA 1U93B 2MNJB 2K6YA 3GSVA 2V5RA 3D39D 3GSUB 4O9HH 5DQDH 3VWKC 4EE2A 3C6SB 2ZXDA 3QJSB 4JO3L 5EO1A 1DO6A 5D6DC 5IJBC 1RK1B 4FQHB 4HJJH 3WTXA 3FCBA 5HVHC 3QXTA 1GC1L 1L9OA 1M05B 2KZ1B 2OK0H 4Z0XA 3QP3A 1S7XA 5LAXB 1BP3B 2DYPD 2J1XA 3BKMH 3Q1SH 3QK0A 3FFDB 5K1NA 1MCFA 4Z7OE 4OLYH 1CC3A 3KPNA 3D4ZA 3VGBA 4Y8DC 4PJ7F 2EDTA 3QWRD 4OUUA 4TVPL 5FF6B 2NW2B 1HHHA 1JZGA 2W0FB 3G08B 2VC2H 2VN7A 5IB1A 4XCNA 5IB5B 5EBWA 4G43B 2J6EH 1SEBB 5DK0A 1EEZB 2WZAA 1LD9B 4IQHA 5H94A 1A6VL 2A9AA 3MFFA 3OAYH 1D7FA 5GS0L 4EZJA 3JV5A 1BVOA 3P4OA 1P69B 4NPKA 5ACMA 2QQKH 4XMKL 1T20A 4PJ7B 2X9YA 2FEDD 1BAWA 5BS0A 1LLAA 2GAZB 9PCYA 3DUSA 4WSGA 4FKHA 1MH5A 2DMKA 5KANG 5SWQB 2NUTB 2Q7YA 3Q06A 1NDGA 3ZZLA 3T2PA 1JGLH 4Q0XL 3TC9A 4PJBE 3B2PA 5I1HL 2G5BB 2Q5BA 2Z9TA 2D03L 3TN0C 3AUVA 3GMPB 1HINL 1CZ8H 2R69L 3IU3A 3O4LA 5TDPA 1NBVH 3S3DB 3W9EA 4CGUB 2BDNH 4YSCA 4XC3H 2XKNA 2ZOKB 2O26U 4KNUA 5DVOA 4HXAL 4XN1A 4EI6B 3BDBA 1BHGA 1UD4A 5LHDA 4UNIA 3ZR5A 4M1CD 4YHOH 1RZ8A 1NIAA 4JGUA 4NYLB 4PVMA 4NT6B 3MC0A 3S8WA 1RULL 5IFJB 4OLZH 3OAZH 3QG6B 3TJPA 4F7KA 4X80H 1ZVSB 3D2UD 3UC0L 2XWEA 2G75B 4PTUA 3BUIA 4YHZH 2G0LA 1PS3A 4NZ8A 4P8QA 4JW3A 2XIDA 1AGFB 1LEIA 1U3ZA 4FFVD 3RUGA 2Q6WA 2LU4A 1A7OH 3OR6A 5HHQA 3LPWA 4HUVA 3G6JF 2ORBH 4MJIA 5E99L 2IBBA 1EIBA 3AQDA 3K6NA 1KYFA 5E4AA 5KYWA 4LESA 3FYIB 4E9LA 1RJCA 2H9GA 4GKSA 3CQPA 2QHRH 3CFKB 2ZXWB 1XBRA 2H6PA 3MQIA 3U1PA 4MLSA 1GSMA 5D71H 5DD0L 4PGBB 4YXHL 4OFQA 2E3VA 2ZAIA 3L5HA 4AYGA 3SOTA 3FN9A 1OW0A 4NWUH 1AKJA 2HG0A 5ABAA 5TD4A 5D9SA 4CU8A 2C4FU 4GRWH 4PG9B 2L3BA 3P4MA 2ADJB 2Y24A 5EV7A 2OZNA 3L16A 4BUQA 4PJEA 1JPEA 4YAQA 1MFAL 1KYDA 1PYWA 1TQCB 5AALA 5I75B 3GI8H 3SSGA 5IV2A 2UUDK 1VLXA 1NCUA 1P9MA 4K2UH 1I3UA 4GRLA 4WW2B 3V0HA 3VXRA 4YHNB 1HH6B 2P1YA 2J1KA 2MCPL 2E7HA 1PNDA 5F72S 3UTZB 1K2DB 3M46A 3PP3H 3ZSTA 1AGBA 4PJ5B 1P9MC 3RVXD 2BNQB 1JGUH 4GRLC 5CD3B 5LNEA 1Z0NA 1GTFA 3QNYB 5GGVL 4B9KC 2EH7L 1M6OA 3WIHH 4FD0A 6PCYA 3OB8A 4XE5B 4MVBD 1DFBH 4YVNA 2UXTA 5E1HB 4PQXA 3WS3A 5I24A 5DVLA 4GINA 4ODVL 4LLUA 3U6RA 4FZ8L 2B1HH 3P0GB 1EGJA 1EDHA 3LB6D 3Q2LA 4XXDB 2BIPA 3MV9A 1E43A 1C08A 4A2DA 1O75A 3MOAH 3UYPB 2BOBB 4QRAA 1GZHA 2YA0A 1J05B 4XAWH 4E9YA 5DJ0A 2QKSA 4JKPH 3RKDC 1PZCA 1NPJA 1BZDA 1WAAE 3QXVA 3GMQB 5D55A 2ZPKL 2JWYA 4KJWC 5GSVA 6FABL 2Z4QB 1FAIH 2J55A 4J3UA 5K9JL 3IKCB 2XWXA 4KOCA 3APCA 3PWJB 1G4RA 2X2JA 4WFED 4YBHA 4UWQB 4HSQA 4X5XA 3MV8E 3PQYA 4N4YB 4WI8A 2W92A 3OHMB 2ZKHH 4OIIH 4PBVC 4AC2A 4X4ME 3VXQA 1HC1A 2BWDA 3GSRB 4Y9BA 1CT8A 4EQ3A 5ETUA 3GBML 4UAOC 3ZYJA 4ZMYA 1ZGLB 2W0KA 3GBNH 3PDOA 4KRPD 4MCYA 4Z78A 2YMTA 3FQRB 5IW1B 2JB6A 4HS3A 1D6EB 3VXOA 3EIFA 1J8KA 2EYTA 1CI5A 4W9FC 3VO0A 2DQTL 4WV1A 2DS4A 3O2DA 1E40A 2AFNA 5KOMC 5EA0H 1SJEB 4X4XA 3LHPH 3E6FB 5HYJD 4NUQA 3VRIA 3CFNA 4WV1C 3LIZA 2VZOA 4JRFA 4M62L 1BMWA 3HG2A 1KPUA 2VOTA 3MGOB 1UG9A 5PCYA 4FXTA 4XN5A 4HX1A 5E5RB 1ETZA 1TCRA 1G6RA 1OVZA 1U2HA 4X5RA 5C2BL 3NCEB 2PTUA 4GAAA 4HPHA 4NZRH 4IGBD 1OSZB 3KDPB 2OTUA 2QTEA 4I1NB 5SWZD 3RWHA 3FCSA 4DERA 1B0WA 2NDFA 5DMYA 1UB5A 3VXMB 3HI6H 3M86A 2EO1A 4K15A 4LIQL 4PU2A 2Z0BA 3RX7A 4DTGH 3C5SA 3EXLA 1ZA3B 4M61B 2Z8SA 4OZ4B 3ILEA 3BZ4B 4NP4H 4OU3A 3VQMA 1OGAB 4OCSH 3QUXB 5ISZE 1PKQB 3APMA 1YPZF 3DX7A 3WJMB 1FVCB 3PU7A 1XH3B 1FE8H 4Y2DC 4ZQKB 1J8HB 2I85A 4XCFH 3L5WB 5HDBB 1CDHA 1SY6A 3IGFA 4YLBA 3P4NB 5B7MA 3BJ91 4L5FH 3KM2A 2UY6A 3VXSE 4GT0A 4GI9A 2HTKC 2OI9B 3G9AB 4E41E 5FCUL 2QDWA 5IBLC 2F54A 3ENEA 2R2BA 5I6MA 5HYEA 5K1VA 3KXFA 3W37A 1T83A 1SBSH 2VH5H 4OLWH 4I0CC 4DK5A 1THCA 1C5BH 3IPFA 3N3EA 4ZS6C 1TOXA 5AWNH 4PMFA 2XY1A 5D5MB 1F4XH 3V8OA 5CIPA 2MSPA 2BOCA 3CBKB 3KYMB 4Y2OA 1TUPA 4E9XA 3CVBA 2I9LA 5MENB 4U6VH 4APXB 3UIZA 4AYSA 1Q0EA 3S5ZA 3ILPA 2D0FA 3U36A 5A2KH 4E0RB 4CJ0A 2GT9B 1NBQA 3EG9B 4YZWA 4R9HA 1N2RA 1HHJA 5H2BA 1B90A 4L05A 2NNAA 1A6AB 2FLBT 4BUHA 2XPZA 3LRSB 1E3FA 5FWRA 4WNSA 3Q05A 2ZWLT 2VLRD 2JB5H 3U6XA 1QSFB 3QYCA 5DJXA 3SJVE 1UM4H 4A7GF 1W8NA 5IT2L 2JCWA 3TNMB 5LGHH 4BFIA 1I4FA 2P44B 4M8UA 1MF2H 3DGCR 3BIBX 1Y18B 5KVFH 3ROOB 1TYJA 3OXSA 5DEFA 1S7VB 3AXLB 3JTTA 2DQFB 3HLAA 3TV8A 3KCPB 3V4PB 5IF0A 3EH3B 4N2GA 1TJHH 4OV5B 4QTFA 3TEUA 4Z7UA 2UVEA 3OKOB 1MZYA 5F2FA 3VQLA 3NIFB 2P5EB 2EXTA 1J7VR 5D1ZI 2QQNL 1V55B 4KPHH 4CSPA 5B3NA 1U92A 5IVXE 2H3KA 4H0HB 1ONQA 4IS6A 5FK9A 2XIBA 3V7MA 1LEKA 1MQ8A 4RX4A 1K8DA 3T0EE 3A23A 1CICA 1FNFA 2DBLH 1FNGA 2XT1B 2NQ3A 5T33L 4UIKH 3RLSA 5J5EA 3ARGB 2FQGA 15C8L 3OGCB 3V55A 5IZ7A 1DBAL 1MAJA 3DYPA 1L6XA 1M42A 1AQKL 4LRNH 3ULVH 1CICC 1NCBL 4NSKB 1YEKL 4G7QB 1P4LB 2YC1B 4OZGA 4AM0B 4EBQL 3RU8H 3LQAL 5CN1A 4MNQB 1PL3A 5IQ9B 1VKXB 1Q0XH 1KLFB 1PG7H 2JKNA 4KUCD 4XMVA 4UTBH 5CSZA 1M7DB 4QRQB 1OB1A 1LK3L 4W9ZA 5I1IL 4IBSA 4EDXB 3N6YA 3V5KA 5F7EH 4EDWL 2X4TB 1D9KA 2AEQH 1FL3A 5I5JA 2J56A 5SWSA 1K3ZA 5DDHA 3VXUD 1E3XA 2FJGB 2UY7A 2YPLB 4OCXH 5LVEA 4R2GB 3WEXA 4HIXL 4PGZA 1LVEA 1HZKA 3AU0A 3VWKD 3GXUB 3H8NA 3KPRA 1D9KC 4XMWA 3T6WA 3FT9A 2WLNA 4A68A 5I73B 5IG7A 3GF8A 1MCWW 1MJJB 2WP3T 5F8RC 1DQTA 1EZVY 1QWNA 1VB9A 2AK4D 4PWEA 5GGTL 5F7DB 2WLYA 2VDKH 4CJ1A 1PD0A 4F2MB 3QAZC 1CYGA 2EVIA 1B0RA 4B9JA 1IGCL 1CURA 2VQ1B 7PAZA 3VRLF 1LJMA 1X6LA 3T3PE 5DS8A 2DQGL 5CZRA 2PUQT 2KZWA 2FSEB 1G7IA 3N5AA 1OPGH 4B3VA 4LIQE 3K71A 3NEEA 1OARL 1DQMH 1QI5A 2A83A 2UZXA 4RA3A 5A1AA 2CKBH 4ZJ9A 2B59A 4HWNA 4YC2C 2B5IC 3RAJL 2VJXA 4NUGH 4BH8A 2ZX5A 5EBLA 5E8EB 1NLBH 2O6DA 3BRFA 2BINA 4GSQA 3BPNB 1FN4B 5JPMA 4I3RH 3JWOC 4K7PX 3U46B 3VFSB 1QTYT 3V10A 2FH8A 3RGVB 4O58H 4R7DB 3LPFA 3B9VA 2BM3A 4I48B 5DFVC 5FYKH 1AZVA 5GZOA 1JZIA 1ZK9A 2AV1B 1J86A 5JPMC 4PJ8B 3H2PA 5BS0D 4HCIA 1PZ2A 1WCQA 2ID5A 2Z6FA 3BEWA 1ULVA 2X4NB 3D7PA 3TN0D 5C08A 1CIUA 2WYTA 1X5FA 5GZOC 1BMGA 5GRZA 3V52L 2F7QA 1FL5B 4ILDA 4GFXA 2G2RA 3PAYA 4GLRI 4TQ8A 3TH2T 3UZQA 3LKNA 3IBEA 3RL2B 4NJ9L 4U33A 4FYQA 1BPVA 1ZK5A 3QS2A 4MAYB 5DC2A 3O4LD 2WY3B 4L3CB 2J8UE 2CJUL 5TGBA 3V4UH 5FUCE 2FIKA 4JUTA 3POHA 4LDOB 1P7KA 4RQQB 2D4FA 3OLGA 2YKLL 5C6PB 1IVTA 4KTEH 1WYJA 3C09C 3EJZC 4LPYA 4R7VA 3NP3A 2EP6A 3SPCA 3QFDA 3NGBB 4RISL 2IFGA 4A67A 4EQ2A 1F6AA 3B6SB 2VZVA 3FKUS 5KS9E 1N6UA 4RMTA 2FO1A 3WKNA 4PRHB 3ZTDC 2D31B 2R1WA 3A4FA 1Z5LA 5C0GA 4Y19A 4LKCA 1HK6A 1KLGB 2M1KA 4ZQTA 4K8RC 1SHWA 3ES6B 2ITDA 4OUOA 4XNMA 1UOVA 3LEXA 2BS9A 3N85L 3PV6B 5D4QA 3VI4A 1T7XA 4IKLA 2YGVA 2NW3A 4ERSH 2ZAHA 5IB4B 3UTTE 4NLAA 4KKPA 4AUJA 1XF4A 4MJID 2X6UA 5I1GH 5EBMA 1A1OB 4NQDE 4MD4A 5C0AE 5CS7A 2W9DH 3FOLA 1JYWA 3FB8B 1K4DB 2IBZX 4NO0B 1FIEA 4W68A 5EO9A 2F1AA 1ZLVH 2AEOA 3DIFB 2RTTA 4NDMA 1EFXA 1IB5A 2WM0A 4GS7C 4Z77B 1ETJA 1MNUL 3ZR6A 4LVHC 1AKJD 4FQCL 5CCGE 2PP7A 4DO5A 3NJLA 3VGDA 3T3MB 1RUMH 2R8SL 1BQLH 3QDGE 3W0WA 4AGQA 3ZYIA 4GEJA 4OCLC 4NKOA 2APXA 2RQ8A 3IDJA 5IVZA 1K5NA 4PRNB 2UVFA 2VDML 1OHQA 3B9EA 3CFJA 3CK0H 4Y16B 1OTUC 5KVEL 1G1YA 4KY2A 4GRLD 3D3VE 3ZTEA 2VDNH 4DW2H 4UIMA 3DJ9A 4X7SL 3VXRD 3NP4A 1YEEH 3BVTA 2J6EA 5FO7B 3CAFA 2V6HA 4V2BA 4X6EA 3UEZA 2MCMA 5I1DA 1MFDH 1ORSB 1CE6B 1HT6A 3B34A 3G5VB 5L0QC 3FT2A 1BWWA 1HOEA 2IEPA 1A6ZB 1VFBA 2BCKB 1KDJA 1U8HB 4X9BA 2ZOTA 4MB5A 5T3ZD 1K6QL 1YCSA 2FBJL 1B9KA 5DJDA 1FCCA 4HG4J 4GXUM 1X44A 2PYFA 4KI1A 4PCSA 3OV6A 3VXPB 3B5HA 1JF1B 3RKDD 1XSIA 2XG5A 4HS6A 3HI1B 2A74A 2X38A 1U42A 3GRWH 5EEUA 4FQ2H 1RK0A 3O3BA 2QQLH 4KJWD 3P11L 2WSDA 1M6UA 1NL0H 3K2KA 5GIRB 1QPKA 5I8KL 3UO1H 5L7XH 5C0DA 3QJVB 3EZJB 3VRJA 1HDMB 1CS6A 3OZKA 2A74C 2APVA 1SMOA 1BFSA 4HFUL 5AW7B 3F12B 4TUJA 3BW9B 2LV4A 1RURL 4M8QA 3BAEL 1E4WH 4FHBD 5T1KA 4ODHH 4U1SA 4DKEL 5DD6A 4Y88A 3PQYD 3MTXA 4WJ5A 1PBYA 4PS3A 2R9HC 1QEWB 1HZHL 5I1JH 5GSRB 4HBCH 2V3EA 4LNVA 3UC2A 3VQ2C 2GJZA 2AXGB 4UQ3A 1OWRM 4LLMA 2EXYC 3K0YA 4JN2B 4L8BB 2IGFH 4PSPA 1MQKL 3O3DB 2PP8A 1DDHA 4IU3B 2XV3A 5MEOA 2VLJB 5HGHA 3TCLA 1NC4A 1S7UA 3ML9A 2K8QA 4IHBA 4RGNC 4UM8B 3WUWG 4ZW8A 5G5DB 4AVKA 1TNMA 2AJSH 2EILB 43C9B 3ZTNL 1CLYL 5JW4R 5KSAA 1NM9A 3S6CA 3WDIA 3FO1B 5AAPA 1XGQA 2VR4A 3FAXA 1KEGL 1XGPA 2WXJA 3F04A 3QG7L 2VXQL 4XCCL 3ZW3A 5HVFB 1NFIB 3NA9L 4FX5A 3RDTC 1I1AA 1BVNT 4OD2A 4ETQA 2BMKA 5JHDA 5F6IC 2MNWA 1JHTB 3JVGA 4RDQG 3NESA 5AVQB 3S5LA 2C1PA 4W6WB 3AY2A 2CA4A 1FFOB 2X87A 3F5WA 4RMQA 5L4MA 3QYMA 1P7QA 1JK8A 5EU6E 1I1AC 1QLRB 4MS8C 4XZUA 5HDQL 3JVGC 1E5ZA 3OX8B 4N2IA 5IEHA 2N7BA 3BGFC 1U8MA 3VFPB 4KV5E 3GJFH 3L3OB 3MUJA 4KTGA 2BSBA 2CHXA 3K6SB 3D25B 2R83A 1TETH 1SMDA 4AYEC 3WUWA 1FIGL 1QSEE 1VA9A 3S96B 4X8GA 1LO4L 1G7HA 4KTYA 4Y2DD 3STLA 3OKNA 1DQDH 1RJLB 1RIHH 1T1XA 5ADPH 3E2HC 3FU8A 1WTGT 5IB2A 1RIVH 3WIHA 4NO5A 4AG4H 1RPQA 2Y5TA 3UJTL 2HTKD 3QO0B 1LO5B 5A16B 1N19A 1KULA 5IBLD 1SQ2N 2HRPL 2Y69B 4K3DL 4YXLH 3KNBA 1AQMA 1F58L 5JO5B 3IMRA 5BO0D 3WL9A 3TA4D 4JRXA 2KPWA 1L0PA 4Q9RH 1EAPA 2X2HA 1X4ZA 4LSTL 4ZS6D 1MJ8H 3KWVA 4JFFA 5DS1A 3L17A 4MBOA 1C1EH 3KXFD 5C7ZA 1JD7A 5FXCH 2WO2B 3CZNA 5CR1A 4LBEB 5C3IA 2WVUA 5IM7A 1W0WB 1BVKA 1U0QA 1S8DA 2DWEB 2XXFA 3B3IB 3CU1A 4FTDA 3F7KA 2QLVB 2XZAL 5KTEL 1ANUA 3DI3B 1DVQA 2WLJA 1L9SA 3RIFK 3T8MA 4QAWA 1IFHH 1Q9WB 3CZJA 3TNNA 2G2PA 1WK0A 1OOWA 1AG6A 1S5IL 4F15C 4WNQA 3WIIL 3RX9A 4PJIE 1U8OA 3UABA 5L2KD 1R19A 1CUOA 3QUMH 1J1OL 3MBEA 4CGTA 2BSTA 1G0YR 4JZJA 1CGSL 2HFFB 4LSVH 4YDKL 4D8PB 4BA8A 3NRQA 4BZ2H 5LCVL 2P5WB 2JF1A 5CFAA 1JCVA 2VQ4A 4F91B 1LP9F 4I2XE 3IE9A 3MBEC 4YDIH 2R59A 4JZJC 5CR8A 1A21A 1AR1C 3FSOA 3AACA 4HP5A 1RZGA 4N2AA 2FLRT 1IIKA 4H8PA 2BY1A 3NFNB 4G9FD 4EKXA 4YZFF 4FMKA 4PW3A 4L8CB 3O11A 2BIMA 4JBSA 4TQEH 2FBOJ 1KB3A 4JG9A 5DRXB 1QO3A 1Z9LA 4NIYE 3GMLA 3PNRB 3P77B 4YHIB 1EZSA 2HVJA 2VDLB 2Y06H 4MQ7B 1J5DA 1E2WA 3U4EB 3EYUL 3OKMA 4GG6E 3KYNB 1KGYE 3W82A 5KYUB 1KC5L 4L3EE 4ZTPL 3QJUB 5GJSH 3WELA 5E56A 4WJKB 3QPXL 3T77B 1GXEA 5AOKA 3D0VB 4RX4D 1WA0X 4S1QH 4E36A 1CICD 2YO3A 1YO4A 4G9DA 4RAUA 1YN7B 4DCQB 1JXGA 5CILH 3WNKA 4OKVB 5C92A 1GH7A 4IMLA 1CMOA 5KW9H 2E27H 1R0AL 5E8PB 5K9QI 1UT9A 2FJUB 4DK3A 4X8JB 1QFWI 4XHQA 5I2IB 2VN6A 5F89A 1IIIA 5D1XB 4NJAL 1U8LB 2ZCKH 3ZE1E 4W9IC 2ENJA 1CR9H 3D06A 3HMWH 4GLRH 5L6YL 2BSDA 5KSBA 5BQ7A 1S7QB 4MMZB 1LHZA 2EIDA 5AAWA 1ADWA 3WIFA 4JM2F 1DTUA 1A4CA 1I1RA 1RUAL 5CXPA 3FOMA 5DWUH 3QHZH 1X5MA 2CLVA 4NC2B 2R29L 4DT2A 4QXGL 2EEXA 3ML8A 3WE6B 1HJCA 3TV3L 4N0UA 5AAWC 4CILA 1D9KD 4WDIB 5SWSD 3TYGL 5DEGA 5I1AB 4L2LA 1UXLA 3K3QA 4ZAKA 3L4YA 2C3XA 1E30A 1GHFL 2QR0A 3PHOB 4GBXA 5FLUA 4RAVB 3I6KA 3EFFA 4JY4B 5FFLA 3KPRD 3HCVB 1MAMH 2DTML 1XSJA 5D7JB 3QUKB 32C2B 4NIKB 4FABL 1A7PL 4NZJA 5EOCJ 5L8JB 5J12C 5I17B 4PGDA 4G72B 2YQ2A 2O4EA 3VH8B 1RJYB 3P3UA 4WW1A 3IDGB 2IPKB 1MHEA 2FYVA 3QCTH 4ZX6A 1GVIA 4P2OC 4HDIA 3EFDL 2APSA 2MKWA 5FKPA 1ADQH 3I9GL 3HPJA 3QPQC 4KZDL 4JFDB 3CSGA 1HZLA 4X99B 1S2EA 2HFGH 4FZEH 4ZDHA 3FU0A 4B60A 1YYLL 3BP6A 4ELMB 2ARJB 1QPPA 1YUHA 2CR0A 2ZF8A 2W81C 4MNGE 3MRHB 4N8CL 4PJAA 1DQJA 1R3IL 3EH4B 4UZUA 4YK4C 3L7EA 4HHAA 3S3BB 3RWFB 3IMSA 1ET5A 2IH8A 1PFCA 5DFVD 2YJQA 4HJGA 5FOBA 1RU9H 2FO4B 4HBQA 4PJHA 3M17A 4X2UA 4I0PC 2XVGA 1N18A 4QRUB 1JFQL 1I9EA 2EICA 4NUPA 3HUJE 1TCMA 2GTWB 1HKLH 3AM8A 3P9LB 4HKBA 4WWID 4Y7MA 3P0YH 1O6SA 4FQXB 3TO4A 3U1SH 1J18A 4BDVB 5GZOD 2XWBB 5TDNB 2JELH 3WY3A 4BKLA 1OQXA 4B3EA 4HLZH 4XPFH 4JG0L 4NQCB 2NZ9C 3SDXF 4QJ5B 5F1SA 3AM8C 2ICEB 4IOSA 3U0WL 4XO3A 3VFTA 5C08D 3AGVA 1XR8B 1G9NH 2CHNA 4U3CA 4LQFL 3BE1L 4FXKA 4AV4A 4AXWA 4DN4L 4D3CL 3EJZD 2P8MB 5L9DH 1U95A 4I0KA 4NZFA 1H8NA 2AMGA 5AYUL 2B39A 4XNQB 5CEXB 1UKQA 5F88B 3FUFA 3L9YA 3VTTA 1QBBA 1OCWL 3GXDA 4FXKC 2W8CA 1F11A 3GUTB 3LN9A 2R0KH 4K8RD 5E1AB 4JCMA 1XGTB 3KJ4C 2IDQA 4PJXA 5IBUB 1T2QL 2WW8A 3ULVC 4KXDA 2YD0A 4UTBA 3IGKA 1R33A 2XPGB 3BQUA 3MLRL 3L1EA 1FYTA 3NYKA 1A1NA 4Y19D 5JLZA 2J88L 5IQNA 3LXCA 1NBYA 4ZUTA 5I30L 2X4UB 3KBFA 2WQRA 4PJ7E 1KBWA 3BQUC 1F4AA 1BG1A 1T7YA 1IX2A 3EBGA 3TP4A 5CN2A 4JFXA 3ASWA 2G9HA 1CFNB 5FUZL 2G5RA 1OTSC 4DPCX 2WMPB 1U8IB 1A14L 2FH6A 3EYFB 5ESAB 3ASOB 1XGYH 3HN8A 1VJSA 3DHPA 4UQCA 3F7VB 3GI9L 1CTNA 1AHMA 4H4NA 1FF5A 3SZKC 1EFXD 2X0VA 1BM3H 5C07E 2B7DT 1RV6X 5JDJA 5AD0A 1CK0H 4QRBA 5F7MC 3FU9A 2UYLA 1LL1A 4XCEB 3MREA 2HMIC 5E6YA 1OTUD 5TTRA 3UTSE 4QD2E 5JR1H 3W0WD 2OSLA 1E9OA 3TPKA 5FA4A 1MIML 4MASA 3QQ4A 3FMGH 4N0YH 2CKBA 3MLTA 4ZYKA 2WCPA 4HKJB 1PLGL 1IEBA 4M7JH 1UT1A 4CBPA 3B8YA 3KGTA 5LB1A 3CPLA 3ZSSA 4JHBA 1JYXA 3MCKB 1A6WH 1DCEA 1YNTB 4JHWH 2OV0A 2WLZA 4Z7AA 1K4CA 4GAYA 5EOQH 2XNAB 4ABVA 5IHWA 3IDMA 5AVTB 1SXZA 2ZWZA 4KH9A 5F7KC 2ZICA 4M43H 3J07A 5BRZA 1N0LB 2DJUA 3BKCH 1S4IA 3DMMA 5GPRA 4XPGL 1P1ZB 2D2CC 4GKNB 4PB9H 2DWDA 3B37A 3UTPE 5CZKA 4F58L 4NZTL 1BIIB 4TV3A 2FR4B 3SN6N 4WK0B 1PD1A 3N40F 1R1CA 3DMMC 3SDDB 5JOFB 5DS2A 3G6JE 5GHWL 2V2WA 2XWDA 4U05A 5F44A 4XXCC 2FL5A 4ODTH 4P48A 1UM5L 1HIML 4H8HA 2VLKE 2NX5E 2ZOOA 2F1EA 3GTNA 2VXVL 3KPTA 4M3KB 4R0LA 4YXKL 4LCYA 2AJUL 2R9HD 3T2LA 2FEEI 1EVUA 2Z7WA 3WIAA 5T1KD 2E9BA 5E9AA 5FYLL 4ZT1A 2Y7LA 2EXYD 3CU7A 4R0LC 4KVNL 4UM9A 1QRNB 1UASA 3LSOA 2DWTA 3QDME 4PJ5E 3TIDA 2WSPA 4DAGH 4JPSA 3VE0A 4RGND 1TITA 4XP6H 4S1SH 5T3XE 4CC4A 2IXQA 1NIEA 3WFHA 4EIUA 1NJ9A 4RMVA 3C60B 2A77H 2VRAA 4AJWA 2XG4A 3FZUC 2FQFA 4NN7B 3ZT7A 5KAQF 3VFNB 3H42L 1OM3H 3N41F 4LVNC 1NC4D 1CO1A 3F62A 2R7EA 4JHAH 4QRRE 3WDHA 4CC4C 4MSWB 2DMGA 3B2VL 3RDTD 1IKFL 1GY1A 1KYOJ 3RL1B 4YEFA 1WBYB 1WRFA 2DQDL 2F18A 1HEHC 1NIBA 3EGXB 1I1YB 2LVCA 4XR8C 4FQIH 4BFGA 1TZGH 2P7TA 1I1AD 4S2SB 1NCDL 3NSDA 5EZIL 4MS8D 5GRJH 1AHWB 1L7IL 3BSZL 3PUCA 3SDYL 3IDNA 1P7QD 4P2YA 5DUML 2J7LA 2VZSA 1LYQA 5CKAA 3HZMA 4ABUA 1OT4A 3LKOB 4GO8A 5EEZA 5KBDA 3QRGH 2CDGB 1AZBA 1DUZB 4PUBH 3K2MC 4PLKC 4XOCA 4YN3A 2ZCHH 3UYOD 4F3FA 2Z7UA 2VABA 3QHFH 4UDUB 3RJOA 4HT1H 4M7KH 5F93C 2V7NB 4P3CL 2YQBA 2AQRA 3IDUA 3PWUB 4CDHA 3T2NH 2C9SA 3ET9F 2YIHA 4TSCL 2XZQH 2NQCA 5EBGA 4ODUB 1V3KA 3MJ7B 3Q6GL 4KNSA 3C2AL 3UPRB 5ESQB 3K72A 3GD1C 1VZHA 1MCEA 2XVKA 3TM6A 1UKTA 2P48B 5F1NA 5FGRA 1PPIA 2IDSA 3NEOA 2YFOA 5IMLA 1BJMA 2UZIL 3LKPA 4HIQA 3VFOA 1A3ZA 4MWFB 1A6TA 3EO1A 1PY0A 5I16A 4JRXD 1IT9L 1XMWA 1AGEB 3A4EA 3GRWA 4C83B 3IN0A 3KPLB 4ORGB 1QFWH 3SCMC 1IAOA 1QNZL 2OW6A 4J2QA 2DF3A 4JFFD 2H26B 2HP4A 1MWAH 2FK9A 1S7SA 3CMOL 3KWTA 4PGEA 4PPTA 1HSBA 1D6VH 1JYVA 5LN8A 1RLWA 1MJ7H 3O2WH 1G0DA 2B8OT 2CH8A 3BDYH 5GGVY 4Y1TA 6PAZA 3R06A 2AKRB 4D2NA 2BCMA 3AQYA 1Z9SA 3U2SA 1KCRH 1GPOH 1SUHA 2JJTA 4AYBA 3HAEH 4FXLA 1T5KA 2DM2A 2V3DA 5IFHH 1OGAE 2DQCH 3FF8A 4BSWA 3V5HA 4ZMAT 1T03H 1IJ9A 3ARXA 4KI5E 1VACA 3MBED 5DJ2B 1I75A 1AR1D 4PR5B 1J8HE 3BKYH 3HHMA 3EH1A 4FXGA 1IC5L 4AL8L 1XCQA 2VMCA 2HB0A 2VT0A 3HC3L 1TVBB 1HL9A 2ZOUA 4X6DF 5DSCA 4LSRL 2DRUA 4WFGE 1ESOA 4JZNB 1EJFA 1HX0A 3GMNA 4WWKB 2ALAA 3LH2L 1EHLH 4FXGC 2YZ1A 5JQHC 1YDPA 2IG2H 4X7TB 4L8DB 3SD2A 1Q72L 3L7FB 1G9HA 2DMHA 1X5AA 1YPZE 4CL7A 3UJJL 5EZPA 4DUXA 2F53A 1D5BA 1ZT7B 5BJTA 4UUJA 1I7RB 2LTQB 3GSOA 5EHFA 2R56L 3EHBC 4TSAL 3BT0A 2Y1AA 3FQNA 3IFNL 3QNZA 4X6DB 2BWIA 4V1DE 4P2RB 1R6VA 2UWEF 5L88L 1I8KA 3EYQC 1UA3A 1JPFA 1QYGL 1BREA 2G5BA 4J2XA 4G8AC 2XQBH 5EC2A 3JTSA 4G8GD 2NY2B 2NSXA 3GJFA 4LEXL 2RR3A 3FB5A 4P2QA 4K3EL 1SXSA 3NTCL 2EZ0C 3G5WA 3MYZA 5A7EA 2ZOKA 3FQXA 4MDIA 2Y5QA 4WY7L 5D1ZA 3U2IA 3SO3B 2F19H 4MB4A 4LPWA 1XIWB 2ZWYA 5DT1L 1QQDA 5FYLE 1NAMH 4OGYH 3X14A 3BUTA 1EVTC 5D1ZC 2JCCF 2IQAB 4UT7L 4JFEA 4YHPA 3QQ3B 4QRPA 3AT9A 1OP5K 1AGFA 3AG3B 5D1QB 3DOSA 5I6NA 1XZ0A 2EH7H 2HVBA 3WJLA 4FHKA 5E94A 3ZE2F 4LEOA 2PO6A 4JMXA 2JKTM 4BFFA 4GQZA 4M5YL 2YAMA 4G6MH 4ODVH 5BVPL 4IRZH 5TQ0L 2JH2A 2HCZX 4GUQA 2VN4A 2WJ5A 3SGJA 5ANMB 4YS4A 3GMOB 3FUEA 3WJLC 1YEDA 1G9EA 5IHLB 4JQXA 5FUOL 2PO6C 1UD8A 2V5YA 5D7KE 2XN0A 3MNDA 4YDMA 3AS1A 1GZQA 3GK8H 1OSEA 2JV6A 3N06B 3ZDYB 4JKKA 1KCUH 1MNNA 2R23A 3SGJC 4P2OD 3UJIH 5IJVA 1EHKB 5IW6A 1H3GA 2YSSA 3GO1H 4Z7WB 4JQXC 1DBML 2ADJA 4GIPD 3QPQD 5SX5K 1T4KA 3EFOB 2ZPKH 5HHNB 2IPUK 3QUMA 3FTYA 4P0DA 1DN0B 1THAA 1DLFH 1X9QA 3DO7B 2H1XA 3CVDA 2IO5A 4BZ2A 5HGAA 12E8H 3CN1A 4KY1H 4NM8L 5A2AA 4MNQE 1C5DB 1WC7B 1IO4C 4IKNA 1ZJAA 3P3SA 2N0MA 4GRMA 4XVSH 4LGRB 4AJYV 4HWZA 1BF2A 4WWPA 1TVDA 3VFMA 3N44F 4I0PD 1SDDA 3DO4A 3FUNA 2HN7B 1OF2B 3L95B 3QJOA 5B1BB 4I4WA 3VFUB 3PREA 4JY5H 3S4SG 1G6VK 3E6HA 4MA8L 5JXEA 1DVTA 3DROA 3HBZA 4ONFH 5E5UB 5CZVL 2A1WL 3OSVA 4XMXA 1TJXA 3MXWH 2CLRB 2NZ9D 4J6IA 3VGHA 4ZW5A 3K7UA 1NFDB 5MI0C 1E27B 4QOKB 5C3LD 1X5XA 4C59B 1FZJB 5E00A 5JXEC 3D4CA 4OCWL 3VXNB 1KJ2H 3IS1X 3T65A 3NABH 3ROLA 4CC0A 3H9SD 4IOSD 4UT9H 1GIGL 1BFVL 4AGMA 5BVJA 3KW8A 2VR7A 5H35A 4H20H 2ZXGA 5EU5B 4C55A 1QR4A 1GSKA 1WCBB 1DBBH 1L3NA 2ZJSL 2R0ZH 3M8OH 5CINH 1EO5A 3IGUA 3L6FA 4JREC 3E0GA 3IKKA 3ZHFA 1FFPA 5DRWB 3DECA 2GYSA 4ANVA 3ULVD 4MMXB 4WQOA 4M3JA 1N5AA 2WWNA 3ARDA 3X12B 3PHQB 1YEHL 4Y4FA 1GL4B 5LAPA 1FQ9C 3SBRA 2EYSA 1SHSA 4IRSB 4X6FB 4JE0A 3VRLE 3BQUD 4JN1L 5C0FB 1I9IH 1FYTD 3ARDC 4NKDB 4G7YH 4F24A 4F80A 4HK3N 3IK2A 3NJVA 2DLFL 2I5YH 1TO5A 4K7PL 2Z8VC 1OTSD 1ZCRA 2FHFA 3H0TA 1ICTA 4BE5A 2F1BA 1IGYB 1KCLA 4Y5XB 4JLRB 3MRGB 4PJCF 2D9CA 4P49A 4QHMB 3EW3B 4U1LB 4OD1L 4K23H 3D69B 5TQ2H 5K9KB 4G8EB 1AFVL 1QBMH 4HJSA 3MGOA 2W60A 3QZNA 3CC5B 4NCC2 4A55A 3KG5A 3C6EA 3QH3A 4HUUB 1JGEA 4WUUE 2HMID 4OD3L 2YWYA 4AVIA 3FO2A 1SMAA 4N90D 3MJ6A 1ZWIA 4NO2B 3G6DL 4PJCB 4HLZG 5HJ3A 3BC9A 3BUYA 5DXWA 1ADQA 3PWLA 4RFOH 1JF5A 2QQQA 3TXAA 4AKQA 4TL5A 5FGCE 7TAAA 1JUFA 4LAQL 4Y9GA 5AZEL 2FB4H 4KKLC 2WLHA 1U8JA 3MLWL 3QEQA 3S3CB 4CW1A 2V4LA 3PNWA 4JG1L 4ZOBA 1GCFA 4MD0B 2F7IA 5GGSB 1ZA3A 2GUOB 3EH2A 1JXDA 2A9CA 3BZ4A 1PZDA 3B56A 4QI3A 2LAAA 3I6GA 3KYKL 1MXDA 4LHUB 3MMEA 4NKMB 3RIAK 1J5CA 4AYMC 2EVFA 1LTXA 1PKQA 4KXCA 4Z3EA 3F83A 3GYRA 4MD5A 4O2FA 5F0MB 5KBMA 2JI3A 4ICWA 4DZBA 1BZ8A 2VQUA 3QZLA 4D0DB 4X5WB 4E42A 1IAKA 4EAEA 4P5RA 4NENB 5E6ZA 2WQSA 1XHHA 1R5WB 3K81A 3KWUA 2IWKA 2XOTA 3DMMD 4BFKA 5ICZA 4N8UA 3TJEH 4HOMA 2A73A 4ODXB 4P59H 1F42A 1CYXA 1KTLB 4AT6A 2OMVB 2W88A 2DTSA 1BD2A 2WC7A 3NJMA 5ADOL 1E6OL 1MCNA 3ESMA 5D93B 2MQGA 4HC1L 5E8NA 2WJ7A 1XV8A 3TPUB 1FSKB 3MO1A 2Q8AH 1XTMA 3UPCA 1T5WB 4F7TA 1R24A 1ZSDB 3HI5H 5EIIB 1RUQH 1GGIL 1IAMA 5CCKL 3CN4A 1G9NC 1A3RH 3PWPB 3DHJA 4APXA 3PFQA 4X4YA 5EUOF 5ACZA 4YUEL 3MRMB 2F08A 3ZKSD 3ZU8A 3O6MH 3JWNE 5E70A 5LBSH 2VJ8A 5FHAL 2HA1A 5I1EH 5AW1B 2DYPB 2CO6B 4AQAA 3FHEA 3BEVA 4NHCH 4UM9D 3WNPA 3P30H 4G80B 3DV6A 1Q1JH 3FZUD 3X13B 3DX9B 4HWEL 1JPGA 2RAMA 1E7UA 3F84A 1HILA 5IR1B 2XZCL 2KZKA 4UDTA 1IE5A 4HULB 1BZ9A 1QASA 2O5YL 3SKNB 2P24A 2RFXA 1YNLL 2VDLL 4H0IA 5E95B 1IBDA 1EXUB 2IQ9L 3MLXL 5HTSA 3WTYA 1FFNA 1JGDB 1PNCA 1VFAB 3HE7A 1OF0A 1OAZH 4QF1B 3KHQA 5AKSA 4FI8A 1I85C 2DWYA 3RWEA 4R4FL 4G42B 4B5EA 3Q44A 4MGXA 3KLKA 3FHAA 5EORH 5BOJA 2Z8WC 1JCKA 3WTTA 1IM3A 1Y0LB 1YJDH 4BV1A 1N7ML 1W8EA 4IBUA 2ESVA 4RFNC 3K2UH 3IVKB 4PLKD 5CEZL 4JDZA 3DX6A 4XWGH 1R34A 3O41B 3ZXAC 1I3RA 4HJ0C 5DJZB 5JMRA 3A6CH 5CMAA 3RVTC 1Q9OA 4E5XG 5DK2B 1URZA 1ZMYA 4FYSA 5DHVB 3R1GL 5GRWA 5IROC 2NSMA 5F1IB 1LE5A 2VDQB 2AEWA 1MELA 2IJ0C 4HEPG 1A7NL 4IIQB 4CVZB 3QQDA 5BNXD 5D2NE 1IGIL 1VESA 2X4RB 2Y3AA 4MXQC 3PUUA 5EC1B 2B4CL 4O02H 3RPIB 2NR6A 1NLDH 2AXHA 3CJJA 4GEIA 4E9VA 4IJTA 3D2UB 4RRPG 4JFZL 7FABL 1KYUA 4GIOA 3SCMD 3H55A 1JXKA 2ZYSA 3SO5A 3NFSH 4EDXA 1EZVX 2DMCA 2NR6C 4NN5C 4UQ9A 3S97C 3MLVH 4NC1C 4M6NH 2EXWC 2XQYK 2Y2TA 4GI8A 3BCFA 3CXFA 2YOCA 3KPSA 3V0WH 5J1AB 2EAEA 2OXGB 1FORH 3GIZL 2X1QA 1OSYA 4U1KB 3S36H 2CRYA 4AE1A 4HEPA 1UXSB 4HFWB 4A7UA 3KYOB 5D2LB 3CX5K 5KSVA 3GTTA 3KPOA 2BFGA 3U9PL 5F7DA 1S9VB 3HNSH 1SOSA 5B39B 1H3VA 3AVEA 3UGEA 3N50A 4XNYH 1UM6H 4C4KT 3MNVB 3PJSB 4AITA 3QXDB 1LE9A 4ADGA 2CO1A 3KDMA 4OZFH 4PRBA 1C12A 2DMBA 3QEHA 3VFWB 3RWDB 3TH3T 3CZSA 2BVQB 5INCB 4YHKH 1JVOA 1MG2C 1T0NB 3QFJE 3DX0A 2WYHA 6TAAA 4U7KA 4C56B 1L9PA 3MX0A 4FLQA 1E5UI 3IJYA 4MCZA 4X0KB 1KJVB 4PRPE 3DX2A 3F58L 3THMH 2V8MA 1M71B 3N85H 3FRUA 3EHBD 1DQQB 5E1IA 4M1GL 1DQIA 3DPDA 4HA1A 3LY6A 3MACL 3EH5B 4JFPB 4Y8AA 2VW4A 5CU9A 3EYQD 5BV7B 3B5GA 4BRJA 4PJFF 1FC2D 5D7SL 5FCSH 3U1QA 3MA9H 1GYAA 3HRZA 1IQDB 3RY6A 1IILE 1JYNA 3Q43A 1YHPA 1IKNA 4HWBL 2EZ0D 2ITFA 2IADB 4L29B 4BZ1H 1OB0A 2HKFH 3CLEL 3WFCH 1J9TA 1EFQA 4S11A 2E8YA 2R2CA 2DH3A 2L4OA 2EUWA 3HRZC 4Z95L 5EEYA 3RY6C 1ZS8B 35C8L 3DI2B 5CZXC 5ID1A 4X4MA 1IKNC 4P57B 3MODH 4G71B 4AVJA 2OJZL 4DSYA 4F20A 5E2VH 3CVIL 1T22A 5F3BA 3EUUA 4G3YL 4HKZB 1WEJL 5D1ZD 1TTCA 3AROA 5IEKB 1TLMA 4X6CF 1NMCC 4FULA 3DV4B 1VZIA 4NAMA 5E9DE 1JHLL 1KT2B 3M88A 4PHZA 2ZKMX 3L9BA 1HCFX 4YBLC 4NWTL 3M7FB 3HAEG 3TH4T 1FH5H 4HZLA 3ZJAA 5I6KA 4F9PA 5FFOA 1AZCA 1L0QA 4KRPB 2GABA 5F3HB 4JPIB 2BP0B 4Q6IB 5TF1L 4BKTC 4QRPD 2YRPA 3NGBC 4FFZH 2E74C 2CCVA 4AV5A 3DVGA 4HETA 1BBDL 3QXUA 4F9PC 3LNFA 3QWNA 5DMJB 5LBGA 5FC9A 1U8CA 4LSUH 1KF9B 3TO2B 5HYSG 2PO6D 1OCRB 1LP9E 1ZA6A 2CDEA 5IGXH 1MWAA 2TSBA 5CJ5A 3LEYH 3V5DA 1OY3B 1CVRA 4NZUL 1QPXA 1N59A 4YZFE 3H9YA 1IAII 4L48A 4PS4L 3WMSA 1SJMA 3A4AA 2WXFA 1P5VB 1YNKL 3B5TA 4JR9L 2F74B 4ZUSB 3UAAA 1A1MA 1I31A 1JNHA 3HAEA 3LYRA 1CDGA 1MCOL 3BPOB 4IGBB 2X1WL 3PRZA 5IP4A 5SWZB 1TJMA 4NNXB 3V0DA 1K9TA 5CHNB 3N40P 3GJEA 3IFLL 1UXMA 4FFYL 1TFHA 2X4PA 1CDIA 5ISZA 1AO7A 3C5ZA 3MCLL 5HYSA 2FX7H 1Y1DA 4KQ4L 2EYRA 1D5MB 2JE8A 4I85A 3QZOA 3O6LH 1ZHNB 1SPDA 3AU1A 5AB2A 3C8DA 3INUL 3VXSA 2I9TB 3C5ZC 4Y16C 4EKJA 1E8WA 1WFNA 1MAKA 3QFGA 4M48L 3VGAB 4E41A 4UQBA 3CHSA 2CO4A 3ZL1A 3II1A 4UNUA 5JXED 1JZ7A 2QSCH 2XWZA 1VADA 4BXSV 1WHOA 3ZRSA 4H8QA 4XXWA 3TBSB 3U4BL 3L45A 4JDEB 3QRFM 1NQBA 3WENA 5IHZA 3TBWB 3O6KL 2WKLA 2ZUVA 4DGYH 1D2OA 3K74B 4QCIB 1T1WA 1N3NA 4PBDA 3C8HA 1MLBB 2XBTA 4Q74A 2BSRB 1WUZA 4XXWC 4NQVA 4LKXB 4UOZA 4YFLF 1B2YA 4YGAB 1KXQA 3JT2A 3NT0A 3QDJE 4XC1H 4NO3B 4BBWA 1IQWL 2EDLA 2C3VB 1OCOB 4JFDE 3OR7A 1DLHB 4MZ3A 4OLUL 1YC8A 5HHOB 1SXBA 1ZSHA 1CGUA 2E4FA 4ELME 4QRTA 1NAMA 4KNTA 1OGTB 4CVXB 4ISVA 4WKZA 5IHBA 5DF0A 2AS5M 1CFTB 1WZ1L 1ZHKB 3CD4A 2B77A 4MA7H 3SJVA 2F5BL 3PWNB 3CVCA 3ARDD 3MRQB 4FC3E 2VDRB 1VEMA 2RHEA 4M7ZB 5ICUA 3UBGA 3CFEA 2MH4A 1YEGH 4O2CB 1JHKL 1AG0A 5ERWB 3FS9A 2VLRB 3BT2L 2BK8A 4PB0L 3VFGL 4ZUUA 1DHKA 1CFSB 1F00I 3WXVL 2CU9A 3CFCH 2PXYA 2Y1YA 4YBQC 1VGEL 3ZRCC 1A7QH 4GW1B 3IJSB 4IRZA 4QRSB 4RIRA 4R4BB 1YSOA 4LMQE 4AQ1A 4NOBA 43C9A 2AXFA 4QXWA 3U30B 4OTXH 2AJ3A 1F86A 1JERA 4NQCE 2PXYC 4JPKH 4XBPA 1M1XA 3LDBC 1YZZA 5IVXA 1IC7L 1UXWB 3IM1A 4FG2A 4AQ1C 4F7EA 3Q6FB 4WWOA 3N9GL 2H3NB 4L4TB 1R5IB 2P8LB 4IDLA 3T0EA 2ZCLH 1FFOA 1NIFA 1WG3A 3H54A 4OB5H 4ZOEA 1HCZA 4X8XA 1EBPA 4FJ6A 1R4XA 3QEGH 4KKLD 3T2QA 3DTXA 4Y9EA 1YECH 2WO3B 1XR9A 3OG6B 3SDXE 4HOXA 3T0EC 25C8H 4OZHA 1J1XH 3TIEA 3BGMA 4AMKL 2P8PB 4KUCF 1F8TH 3VXMD 4LT7A 3X1BA 3K1KC 3MRBA 4BRVA 3PGDA 3TBTB 3QEQD 5KG9A 4CNIB 4LP4A 4AOFA 3CLFH 2MNUA 1LWHA 4TNEA 4Z7VF 1M7UA 4O2EA 5EZOH 4WCYH 4LSPL 3L3DA 2Z92A 1F1GA 5GQBA 1U30A 3WKPA 1GGCL 5IOPA 1G7MB 3VXTB 5AOMA 5F9DC 4TTDC 3Q48A 5AB0A 3PIQA 1JGVL 3CX2A 4MXWH 1BZQK 2NY5L 3DSFL 4BZYA 2DM4A 3NAAH 3DRTA 2AABL 3VGGA 1KJ2A 2I7OA 3RGBA 3D09A 2WINB 3Q8FA 3VXUB 3PGCA 4JQIL 4N9GB 4UT9A 4LHQB 1BM7A 3VSVA 3VWKB 2YPVL 2O5XL 2A99A 4RRPM 1ET7A 5HGDB 5ALCL 4J28A 5C09A 2ODIA 1LDPH 1KC5H 5J3HC 3R0NA 4HHWA 5EG6C 2AK4B 3KLLA 3GSVB 4YSUA 2CE6A 2HT2C 1LNUA 3FSVA 3U4KA 4GQPH 2F8XC 5EO1B 2QELA 2LU5A 4XTRC 2E4TA 2V0AA 4KC3B 5AKRA 4TL4A 4YSRA 3K6IA 2A9NH 2JTDA 4Z0XB 4LLQA 1S7XB 2A6DA 1YQVH 4WEEA 3TL5A 4D8PA 2CDFA 4I13B 3KPNB 5KOVC 2Q8BL 4OUUB 2K7QA 3BKJH 1BLNA 2YLHA 1HHHB 3G5XA 1ORQA 1ZIBA 2Z31A 3TJHC 4QXVA 5IB1B 4XCNB 3B43A 2WLKA 3NH7L 5EBWB 2ZD0A 4ZRGA 3HC2A 2IF7A 5FV2A 4W9DC 5H94B 3MFFB 4KBPA 5LKNA 4FE9A 2R29H 2Z31C 4RBPH 3EGSB 5EULV 3NDYE 3P4OB 5BO1L 2J71A 1U21A 3VGFA 2DDQH 3L81A 1T20B 1S9XA 3UBXI 4F93B 2V2TA 1TO4A 3GSNH 3ZKQD 5DHEA 4TQHA 4EEEA 5F7LB 3GDBA 2L7UA 2P5ED 3DUSB 1GW0A 1S9WA 3QDAA 4WGWB 5B38G 4ZSOE 5JHLH 5DR5H 1A9EA 2Q7YB 1IM3D 2J8UA 4HJ0D 1NDGB 4A7QA 3RVTD 3G6AA 2ESVD 4PYHA 5DZNA 3N0PB 4Y1SA 5IROD 5HI4C 4X7DC 4DHLA 1OGPA 2C7FA 3PGFH 3IU3B 5GISL 3O4LB 3IXAA 4N86A 2O93L 2KLRA 3UEQA 1QRNE 2XI9A 3RFZA 1MCDA 2UXFA 4M03A 3Q8BA 5DK3A 4DCQA 2XKNB 4PHXA 5TE4L 5KS9A 4MXQD 3GLDA 4AIOA 2YAOA 4KZDH 1MI5A 4R6UA 1RZ8B 3GKWL 3WFDL 1QFWM 3RFZC 5T3XH 1HTYA 1TJGH 4Y5VA 4YWGL 1NGZA 3ILDA 2XRAL 1KCWA 1Q8MA 2V17H 3CXHK 1S7QA 4D9RD 2NR6D 1KBGH 3UTTA 1AP2A 1E8XA 2EXWD 4FG4A 5B38A 2CBMA 3W11C 3H7BB 4A7VA 1SLXA 4NQDA 4PTUB 4Y5VC 1QLEH 1Q94A 1XEDA 2BRRH 1LEIB 2Z65C 3RUGB 2FLMA 4MMZC 4LDLB 4NQQA 4PLJC 5HY9A 3OR6B 4HYTB 2Q6WB 4FEMA 5CWSA 4F7PA 5HHQB 4HUVB 1E9PA 1JI1A 3QULA 2CD0A 4OM1L 4HCGA 4MJIB 4PWGA 1V7ML 5DHXB 5DZPA 2YPLD 4QUOA 3GDCA 3GHEL 3KPSD 4R2GD 5KYWB 1BIHA 2H9GB 4YH6A 1TQWA 4GKSB 1FNSH 4KHXL 4PY7A 1Z3RA 4YFDB 4Q58C 1XWVA 4RGMB 5F7AA 2SEBA 5DMKB 4KZEL 4Z3JA 3QDGA 1DQVA 3QUKA 4LXFA 4KHTH 1WIPA 2P42B 5T5NF 4IBQA 2MHAA 2VXSH 3C08L 2OPCA 3P02A 1AKJB 4UNVA 4PJDF 4YIQA 4LPXA 5D9SB 3EBAA 2X9ZA 2XETA 1U8KA 3P4MB 5LBSA 3MBXH 1CBVH 4QTIL 3UOAB 5AVRB 3D3VA 1KWGA 4HIIA 3B8SA 4PJEB 3UP1A 3GMRA 4YAQB 1PYWB 3BJLA 4TNFA 4KXZI 2LW3A 3SPGA 2HG5A 4HV8A 2XQ0A 1EHAA 3F05A 5FM5M 5IV2B 3RJQB 1OSPH 4GRLB 1IAIH 1VCBC 3ISYA 4AW7A 3VXRB 3O3EA 2ZNWA 2WXKA 1EWHA 3BIKB 4ONGH 2QVKA 3BVDB 4GAJH 5DMIL 4U1IA 4HF5L 3ZKXC 2D4DA 1X5ZA 1AGBB 1GCYA 1KG0A 3ABGA 2R4RL 3L54A 2PYEA 3VWJA 3D48R 4UQIM 1LDSA 1M6OB 4QHNA 1MFBL 3KEHA 2DBJA 3UZEA 4QRUA 1T5XA 3WS3B 1UA6L 3KS0H 4LCWA 4JK0D 4LLUB 3ZMNA 1YEIL 4YSSA 5IUCA 4FLSA 3U6RB 3DVFA 4UTAL 2Q76A 2R1XA 1S6NA 3WFBH 1HH9A 3VWJC 2QV2A 5GGUA 3UZEC 2APWA 1OAQH 5PAZA 3MV9B 5FW6A 3CZKA 4W81A 1C08B 2OZ4H 4A04A 3MRJA 3P3YA 3OB0H 5CZXD 3DRQA 5DI8A 2Y1ZA 1J0KA 1N4XL 1QRKA 4I77H 1YJDC 5DJ0B 4XMPH 5HD8C 5DUPL 4ICXA 2ICEC 5KEZA 1FH2A 2CZNA 5GSVB 1R3HA 3MR9A 1M53A 2NUPA 2XHNA 4WEBL 3T04D 4P9HH 1DL7L 4LSQH 2V2XA 3LVTA 3BSHA 5CEXA 4JFUA 2ZKYA 4DKFH 4X5XB 2NYZA 3PQYB 3QRLA 4Y0GA 1CGVA 4O02A 1NUGA 3VXQB 5CD5C 1CT8B 1S3KH 5ETUB 2IANA 4E68A 4PRHD 2B14A 2B0SL 3KM1A 4MCYB 4Z78B 3KEDA 2JB6B 1ASOA 4U3HA 4HS3B 3VXOB 1CWVA 4ODSL 4B0MM 2EYTB 1XVSA 1QFOA 3QJZA 4WV1B 1TQSA 2I27N 1BZOA 3BAJA 3MJ9L 1NUNB 5GZNA 5EOCL 4F33A 3RIAF 2MTAA 5C0RL 1CFNA 4X4XB 1U3HA 4FMFA 4X6DE 4JCLA 5DZLA 5IWLC 2F8OA 4X9GA 3VRIB 2K7PA 2NY6B 3BLBA 4JPWL 4FAAB 5C0NC 1KPUB 5EU6A 3CIQA 2EUVA 4KK5C 5I9QC 3EYOA 3CZUB 1FJ1A 4HX1B 4FA8A 1ETZB 1U3HC 4Y4KA 1LGVA 1WBXA 1A7BA 1G6RB 1TCRB 3FN0H 2DQHL 3ATFA 4KK8C 2A6KB 2CK0H 3U7AA 1KGXA 5I6XC 2ED7A 3MZGB 3O6FA 1P4UA 4OZFA 1UFGA 3HS0A 4Y4KC 2OTUB 2UWEE 3VAEA 1MEXH 3EYSH 3RWHB 3FCSB 4KAQH 1FBIL 4DEWA 2YGNA 4M1DL 1UB5B 4MB1A 2HRHA 5DZOA 5E4EC 2CA3A 2ZKXA 4L4JA 2OR9L 3S8GB 4NQSA 2P3YA 5ISZD 4HKJA 1AO7D 3O6FC 3Q5YA 3C5ZD 2X5PA 1SQMA 4Y16D 3HS0C 5FS5A 1A02N 3GXTA 5DD5H 1F1AA 1NIDA 4ELDA 5CBAA 2X6MA 4FOMA 3TYFA 2Z91A 2Q3XA 1FG9C 4R3SA 5IUSA 4N28A 2C4FT 2F58H 5TE7H 3DX7B 5I8CB 4JKWA 5MEQA 4BGDA 4FLOA 1XX9C 4E41D 1A8ZA 1MCKA 4DGIH 2FO8A 3FFCA 3S88H 3IFPA 3BPCA 1YEJL 2D8KA 2YQGA 2JCCE 2UY6B 4URKA 3IDIA 1NGQL 2AGJL 2LAGB 1QHQA 2ADIA 3QO1A 5ITFA 3PL6A 2BXYA 5JIKA 1B0GA 3P0VH 1OL0A 4H88L 2R4SL 1XGZA 2F61A 3UYRH 3P73A 1N6QH 2F54B 5E0FA 1AQHA 3U7WH 2R2BB 3KXFB 3ZE2E 4BZ1A 2VSCA 3UG5A 4DIXA 4QJ4B 5I8EA 4N26A 3PL6C 1UWYA 3TWCH 4XNUH 1HL5A 1EEYB 3DJSA 1I9JL 4RGOL 4WAFA 4GSRA 5CIPB 5DTFA 3EJTA 5ENWA 2BOCB 3HNTH 4Y2OB 4Q89A 1B6UA 1OAYL 3F6LA 3BWUC 3L48A 2I9LB 4W9HC 2FUQA 3SE8H 1U8PA 5I0VA 1R75A 2A9MH 2BXZA 1PF3A 2I60L 3ILPB 3U36B 5E2TL 4OF7A 4YDVA 3SJVD 1N2RB 2FJFA 1HHJB 1MXGA 4YBQD 5H2BB 3NQKA 4ZFFA 2NNAB 4YSQA 4DGWC 2FSDA 4FFZA 4EOWL 4N2BA 4OJCA 2QLYA 4OJYA 3FTZA 1RJZA 4M6OH 3A6OA 4YPGA 4PTTA 5DJXB 3TEWA 2X6VA 3T4AA 2PXYD 4OLEA 4XP4L 4QOKE 4TLUA 4A6YL 1H0DA 1CF8H 2H1LM 4AVHA 4BFIB 1I4FB 3QWOA 3E1F1 5CLXA 3C60C 3IU4H 4WF7A 2YMXL 3OXSB 4N0FA 5DEFB 5G4NA 3TURA 4GG6A 2DEWX 2NY4B 3JTTB 4JFQB 3J8F7 5IF0B 3HLAB 5C0BE 4Z7NF 3P3TA 1T6BX 5T5FA 4Z7UB 2EEDA 3NIDB 1G94A 2OCFD 3TFBA 5EN2A 3V8CA 1WIUA 2WUBL 3TS8A 3ESPA 4ZFOA 1U92B 1HXYA 1AHKA 3C8KA 1JE6A 2VDQL 1E28A 1BECA 3EAKA 4U3XA 5FB8A 4YSOA 1ONQB 4H0GA 4IS6B 4OZGF 5FK9B 4BUGA 4GAFB 3BHBA 1LEKB 3AZUA 4MA3A 1K8DB 4JJ5A 1ZVHA 1CICB 1AY1H 4IYKA 1FNGB 3CGTA 2CIKB 2R0WL 2MOGA 3LN5A 3QEUA 3KWWA 3L3GA 4OGXH 4H1LH 1FGNL 4ZO7A 2CM6A 1MIEL 4F8QA 4D94A 4TTDD 1OZTG 5E2UH 1OANA 4HPOH 2G60H 1V5JA 1HE8A 1O7DE 2G4GA 3NRPA 4J23A 4OZGB 4U6XA 4DEPC 5L8LB 4JVUA 2AXWA 1P4IH 3UPRA 3HC3H 3GRGA 4OJFL 3F6JA 1QR1A 1EO8H 5CSZB 1OB1B 4X5LA 4DESA 1RCYA 2FT6A 4OCRL 4NGHL 2DKSA 1XT5A 1NGWA 3U48A 1PZ3A 3V5KB 1MVUA 1D9KB 5D7HA 1FL3B 1NPNA 1PMYA 2KLTA 2J3SA 3KPLA 4OLXL 1VFMA 5SWSB 2A6JA 4H26A 2P46B 3CDYA 5AB1A 2VLME 2ITCA 2UY7B 5I76A 2QTVA 2GITB 2JKLA 5HDWA 5J3HD 3WEXB 3O0RL 3T1FA 1QFUL 2CXGA 4PJCE 4AYFA 1TVHA 1YYCA 3KPRB 2HT2D 2A4ZA 5ECGA 1TTAA 1H15A 4URTB 4XTRD 3QAZB 5IG7B 1I3GH 4EF3A 3O4OC 5C09D 2X89A 1JMZA 5I0DA 1VEPA 2DLTA 3ABKB 1TDQA 1IC4H 3PXLA 1W6WA 4X7FC 1CL7L 4H8WH 1ILUA 1B0RB 2WB7A 3BLKA 1HXKA 3M1OA 3N42B 4YC2B 4JDTH 3ELQA 2B5IB 5DS8B 3MI6A 2OMZA 1G7IB 1SFHA 3ABLB 3EJUA 2QVFB 2DQEL 3TJHD 3UO8B 3K71B 3STBA 4IJ3C 2A83B 2UZXB 3T9WA 1O5DT 3HG1A 2B59B 1F18A 5HDOA 2YA1A 3HUJA 5BV7L 5J9PA 1Y7VA 4TPRH 2Z31D 1KOAA 2CJTA 1MRFL 4K5OA 4BH8B 5AENA 4WWKA 4KJYA 5EBLB 3BESR 3GSXB 4UQ2A 3KAAA 1OP9A 1TKWB 2PR4L 2EH8L 2OM5A 1IEAA 3PP4L 4GSDH 4PP2A 5JPMB 2XKSA 1USQA 4KXZH 4UF7C 1UGNA 5D7IF 4MQSB 5EMYA 4QHUA 4AGOA 1FDLL 4WWKC 3WKML 4PGJA 4PD4J 4LAJH 4TTGA 2H47C 1OPOA 3RY4A 3W57A 4L4VA 3QUZA 5HI4D 1B4TA 3BEWB 4QXUL 1HHIA 3D39E 1OLZA 3CSFA 5C08B 1B2WL 3LRMA 3T8XA 4X7EC 1TTFA 3OM3B 3D0AA 4E9WA 3RWGB 1AQDA 5D8JL 3BH9A 2G2RB 4K7PY 3DVNA 5E6UB 3UZQB 3LKNB 5BMFH 3QUZC 1KY6A 1FNEB 1F5WA 2YD2A 5FW8A 5ILTL 3C09B 1F97A 4P3DA 1NMAL 3I75A 3JWNH 5TGBB 1GGUA 4QPEA 1FLRH 3SQOL 1NC2A 1P7KB 5HHVH 3L5XH 5KN5B 1KXVA 3VI4F 2WLIA 2YUVA 3HMXL 1MI5D 4EUPH 4NQEA 3LMJH 5EUOE 3W11D 3QFDB 3SGKA 1F6AB 5DURD 2YFNA 1F4YL 4XVTH 1KXVC 1KGJA 2XTJC 4GQ9L 4MAUL 4JRYE 2R1WB 4PLJD 5AQ0A 5C0GB 1A7RH 1Z5LB 3LZFH 4Y19B 3UTTD 3OKLA 4LKCB 4Y2LA 2QMKA 5HHME 1RMFL 2ITDB 1M1SA 2V9RA 3LEXB 4XNMB 1OAJA 2NY0C 4NQDD 3VI4B 5GS3A 1KJ3L 5TE6H 2NW3B 5C2UB 4G11A 1BEYL 2BVOA 2BX5A 1XF4B 2ZUUA 3T0XA 5EBMB 1NWPA 5C07A 4MD4B 2AVGA 4PS7A 4J4PA 3FOLB 4OCWH 4LVHB 1JZ3A 1J0JA 3QC5X 2CALA 1Z9PA 5EO9B 1P5UA 2EIEA 4R5VA 3UTSA 4NDMB 4F9LA 5HYQA 4XN8A 4W93A 1EFXB 5GGQL 4J4PC 4DQOH 1CJYA 4FQLL 4JGMA 4KK9C 1VCAA 5DJ6A 3L9RA 4Y4HA 3N04A 1P5UC 3SE6A 1HHKA 3W0WB 4F9LC 3D3VD 3QCVH 5E8DH 1O7SA 4NKOB 3JYCA 3H3PH 3IDJB 4G6KH 1K5NB 4MKMA 4XRCA 5IVZB 1S7TA 5LXGH 1K8IA 3FSZA 5F9OL 4TQPA 2YK1L 4Y4HC 5JIPA 1PSKH 2ISDA 2IIJA 5CLWA 4KKAC 2VMEA 4UIMB 2NPLX 3Q9QA 5L0QB 3MNMA 2EDFA 2VC2B 3OMIB 1XGUA 1DE4A 1U58A 4J12A 4PBXA 3H1ZA 4Y7OC 1OF2A 5AVZB 1INDL 4X6EB 3A47A 2BNRA 5I1DB 2X0UA 1B4JH 1RUPL 5D4IA 4YQXL 2Z3FA 2R29A 1X5JA 2PYED 2J43A 1QMUA 1RZQA 2DQUL 3FT2B 2PF6A 2BVTA 3VWJD 4C8XA 1VFBB 3R4RA 1UACL 4L18A 4W9KC 1SEQL 3GSNA 1SM3H 3NJGA 4WI5A 4DF9A 1MW1A 1WD8A 4LCWD 3U7YL 5JHLA 3G6JA 4DZ8A 1WH0A 2MIZA 3RILA 5DJDB 3HBPA 2AQ3A 1NAKH 2PYFB 2W91A 5FO9A 3MLYH 1ZVNA 4BQ8A 4BSVA 5HD8D 3EJRA 5D2LE 4OQTH 2XG5B 1C5CH 2NX5A 2VLKA 4HS6B 5F1OB 2A74B 4CRPA 1RK0B 4AY0A 1GJUA 1WCBA 5LNGA 4RWYH 5C0DB 1NM4A 3VRJB 1BX2A 5HPMA 6CGTA 4YHLH 2NMSA 4OI7A 2VDRL 5J56B 3FCTA 4F8NA 1JSYA 3QDMA 4TUJB 1A5FH 3FT3A 4M8QB 4FNUA 3CHOA 2X28A 3QDHA 4PY8I 5T1KB 5CD5D 4U1SB 1UOLA 4WU5A 5DD6B 4CKVX 4WJ5B 5C7XH 2VQTA 3WNLA 4CADA 4CKQA 2GJZB 2IAND 4UQ3B 3BWAA 4RGNB 3ZQWA 3VW3L 1SOKA 4ODWA 2V3FA 4KTDH 3O3AA 4UOJA 3WNJA 3WSQL 1LO2L 2XWTA 1URIA 1SVBA 4KUZH 1DDHB 4MJ2A 4NZDA 1M2VA 5D70H 3KR3H 5D7EA 5MEOB 3O8XA 1UEYA 5HGHB 4AEEA 3TCLB 1NC4B 1RZFL 1S7UB 3B7RL 1TG8A 2KPNA 5CJQH 5C0ND 3ZN6A 5I1KL 1GJIA 4N1EA 1GGBL 1J5IA 1KCVH 3KJ6L 4MYWB 4JVWA 4KK5D 4PV8A 5KJRL 1BOYA 1U3HD 5F6IB 3D69A 5KSAB 1CXKA 2EDOA 2EECA 3TU6A 3O8XC 1FO0H 1CXIA 1XGQB 3DUUA 4KK8D 1XGPB 2Z93A 4RESB 4ALAH 1I7ZA 3K4ZA 5EU6D 3D85A 4YHML 4ETQB 1OTTC 1I1AB 2BMKB 2WOBA 5JHDB 2DIBA 4Y4KD 4DGVH 4GRWB 3M1BA 1ZLWK 2BO0A 2C1PB 4O5LL 3F5WB 5GS2H 4AYID 1FGVL 5DJAA 1P7QB 2WUCL 5E7FA 1ND0A 4WFEE 1JK8B 4L1BA 1WWCA 3O6FD 2MRYA 3U9WA 4N2LA 2FNBA 4XN9A 5DWPA