4X50A

Crystal structure of fimh in complex with biphenyl alpha-d-mannopyranoside
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Tyrosine Gate of the Bacterial Lectin FimH: A Conformational Analysis by NMR Spectroscopy and X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
molecule keywords Protein FimH
total genus 34
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4x50A00
2JTYA 3ZL2A 5ABZA 1KLFB 4XO9A 1PDKB 4XOBA 4X5QA 4X5PA 4XOEA 5AALA 4X5RA 4AVIA 4XO8A 5FS5A 1N12A 4AV5A 4AVKA 3ME0B 2VCOA 5AB1A 3BWUF 4X50A 4CA4A 2WMPB 3BFQG 4XOCA 3SQBB 5FX3A 1N0LB 1UWFA 3JWNH 4BUQA 2UY7B 2XG4B 4XODA 5CGBA 1TR7A 5F3FA 4AV0A 4AVJA 3BFWA 1KIUB 4J3OG 5IQNA 4CSTA 4J3OH 5FLUA 3JWNE 2JMRA 5AAPA 2W07B 3MCYA 4LOVA 3ZL1A 4AUUA 5IQMA 5IQOA 3JWNG 2J2ZB 2XG5B 5FWRA 1QUNB 4AUJA 4ATTA 4CSSA 2UY6B 4AUYA 3RFZA 4XOAA 4J3OF 1ZE3H 5LNGA 4AVHA 5JQIB 4AV4A 5LNEA 5F2FA 3ZPDA
chains in the Genus database with same CATH superfamily
5KVEH 3S5LB 5J1AB 4G8GA 5MHSD 4X7EC 2QQLH 2OK0L 4RWHA 5CEZL 5IMOB 1IGML 5KJRL 4OQ1A 1J9CT 3D69B 3AS1A 4OUUB 3OGCA 5E4EC 1M3JA 1H5BA 4G7VL 3HBPA 4LGPB 4R83A 3MBWA 3EZJB 4IEFA 2MJWA 3WEAA 3DROB 1N68A 1JZFA 1EO8H 1QD0A 5DJ6B 2CIIA 3KLAA 4NM4L 2JMRA 5EZJA 1BYPA 3FO9A 2LOEA 4JFHD 3ZE1B 1X5KA 3NPSB 3IU3A 4Y2LA 5TDOA 1IAOA 4L9LC 3QQNA 1U3HC 1LK3H 4PRNB 3WIIL 3HPLB 4RX4D 4F24A 1FORH 4NC1C 1PZBA 2C1PB 3B3BA 4GSQA 3GMMA 3L95A 3PL6B 2HRPH 2G60H 2XYCA 4GEJA 3SDCB 1Z9OA 1KTKE 3VMPA 1CLYL 1RV6X 1EZVY 4ZX4A 4ACPA 1RXLA 4D3CL 3OB8A 4OLZL 4K3EH 1LHZA 2QDWA 3VD2A 4LEOB 4J4PA 4OBRA 4B9GA 2J3SA 4A2DA 3L3OA 4P46D 3ETBJ 1NCCL 2GTWA 3PHAA 5GZND 4UU9B 2GW5A 2I9TB 1Y6MR 2G5UA 2DJMA 4XXCA 1F97A 3PIQA 5DA4A 3TA3A 1HQ4B 3DVGA 3LN5B 1QFUL 4Q9QL 4M7LL 3ZDYE 1WFIA 3OPZH 3U0WL 3BGFB 3FO2B 5D7HA 2EDLA 4LBAA 4X6DF 1M71A 2FH8A 3GKWL 1QMUA 3W9EA 4JFDE 5CBEA 3GLZA 3WOVA 1B3JA 1UFUA 4X4XA 1HINH 3IGAB 2YN3A 1VFOA 3RU8H 3R8BB 1A1OA 2BSED 4HLEA 3IKCA 3WLBA 5DQJA 3UYRH 4AEHH 3U6XS 2QLVB 2OJ1A 1I8MA 5L2KA 4NI3A 2UZYA 4PM1A 1GAFH 1AC0A 4FYTA 3BPLB 5AVTB 1OANA 1RVFH 5FYLE 1C1EH 5KZCB 4HGWB 2C26A 2B2XL 5EU6E 2PO6A 1G9NC 2IO5A 2PTTA 3DECA 2ZWKA 2Z0UA 5FXCH 1X5GA 5A2FA 4ECNA 3QPQD 2AABH 4OY9A 5AQ0A 1CURA 3QR2A 4KHTH 4J27A 1B4RA 4AZ8A 5FOJA 4NPYA 3T71A 2CGRL 3GLEA 2OTUA 1UASA 4PJAB 3EJZC 4N0YL 3L48A 4MLIA 1LE9A 3GLDA 4B9ZA 2DY2A 1PX3A 4G72B 3PGDB 1NDTA 3RWHB 1P7BA 1QFUH 1S3KL 2UWEB 2QGEA 4HWBH 3SY6A 5MEPA 4X6DA 5ALCH 1NBZB 2R0KH 3FU7B 4ZAKB 5IFJB 1D3CA 4NNYB 1FYTB 4KI5D 4HA1A 4XWGL 4HH8A 3QUZD 5CN1A 3LPFA 4EUPG 4NZRL 4NIYE 1MCHA 4BE6A 5FYLD 2D0HA 2EO1A 3UIZA 3WSQL 4NQEE 2V3EA 1LQBC 3NBNA 2BZCA 2WVVA 3H6JA 5GZNC 4U0QB 3FQRA 3BP5A 2NY2B 3K4AA 1H9DA 2FT8A 2A7BA 4DGVL 5HGAB 3L3GB 5ISZA 1BLNB 4PPTA 5C2UB 4I0PD 5EO1B 1MLCB 4DP2X 1HDMB 5DRWA 1N6UA 4R7XA 4NWTH 3RZCB 3ZYZA 1EV2E 1U8KB 2V5YA 1NL0H 2VR4A 2BP8A 1SFDA 1ZLUH 3G6JA 4AOFA 4AEIL 1QQDB 1I4FB 3AZUA 3EHBC 1ZV9A 4LLWB 2F54E 3FH5A 4AXWB 3C6LB 1NINA 6FABL 1KLGB 3HJ0A 4C4KO 2VNCA 1JFQH 2YPLE 4WJ5A 1I7RA 4CBZA 1IC0A 3UROR 4JFYA 5J12C 1DBAH 3M17B 4L5FL 1FNGB 3QA3A 4DEPB 3UIYA 4WTQA 3QEQA 2Z4TA 3RBSA 5AVYB 1LGVA 3LPOA 4ZMVA 4WK0B 2EDMA 4N1CA 3BVNA 4NQEA 3N44F 4IIQB 4Q9RL 3FRUA 4K55A 5KUKA 5JQHC 4TSBH 3QHFH 2AGJH 4GRLD 4ZNEE 2DBJA 4PB0L 4JKNA 2Q0ZX 1WTLA 4PJGE 5D70L 1RJYA 4HQQL 4X42A 2OMXB 5FKAB 1TTUA 2MOGA 2D3JA 3O9WB 5JOPE 1DVSA 4UT7L 3QNXB 2VIRA 3OB0H 1K9TA 2G0LA 3Q5YA 3IPBA 5B1BB 3CMOH 1DQQA 2VZ1A 1IGIL 5I0XA 5J13C 1HL8A 4JG5A 3BFOA 4HGMA 4YSQA 5GSRB 1F1GA 4IYKA 4U1NB 2PNDA 2LFEA 2ZSWA 4CMHC 2H6UA 4Y5VB 4V2CB 5GZOC 1QI3A 1QBBA 4EBQL 5F0PB 4YR6A 4JM2D 5IMMB 3HN3A 5FC9A 3WNMA 5LCVL 1J86A 5JXED 1ZA3A 4CW1A 3PAZA 2NXYD 3T9WA 4O2CB 3KCPB 4H8WC 4UILH 2ICEC 1WFMA 4PCKA 4JO2L 5HJGA 3Q8AA 4AXWA 4P2OA 4N8VG 3P3RA 2BS71 4HIPA 5AVVB 4CU8A 4AQOA 1N9PA 3DHMA 4MZ2A 3KYOA 4YDVB 4C56A 3TBWB 1XIWC 4QIRA 2A38A 3T4YB 1AE6H 2C3VA 2NT1A 3IYLW 4Z18A 1WAAA 1DFXA 1H3PL 4JFPA 4X5XA 1CD0A 1HXMA 1RZKC 2FIKB 4N8UA 1M05A 1JUFA 2DQIH 3NVQA 2AAAA 3L3GA 3SGJA 4KK9D 5ISZB 1N5YL 1AGBA 1LK2A 4YBLB 1LO5B 3FZUD 4UM8A 1K5NA 1BCIA 4P0DA 1EDHA 1BQ5A 4GFXA 1KULA 2MCG1 1BAGA 1RLWA 3VDBA 1ZD6A 4YSDA 2PW1A 5DC9B 3GNML 3ZZQA 3SZ6A 4QMEA 1ZE3H 3FU7A 1M7IA 1NBZA 5EU6B 4TLTA 5C07A 1OAYL 3NP3A 1S5IL 1L7IL 3OBAA 1OCOB 3DBSA 1DVTA 1JYWA 3HNSH 3MLXH 2BCKA 2CKBB 5AWNH 4QOKD 4XNXH 3UTPD 1P4IL 4JDVB 5AKRA 3KH3A 4Y19D 4KJWC 1Z9MA 5E5MA 5I17A 1J1XH 1C1EL 3BZFB 4Z76B 1W72H 2BVQB 1CLZH 4DQAA 2ZUQB 3KYMA 1TZGL 1YJDL 4WHDA 2JKNA 2AQPA 4DERA 2QJDA 4BGLA 3O3DA 1CB4A 1GOFA 2AVGA 4OW6A 4RMTA 1JGUL 3I02A 1EGJA 2ATKB 4PIBA 2KL6A 1UOKA 1PVHA 2Z31C 1J18A 2MCAA 2K6ZA 3DJRA 4HCGA 4N0UA 3AS0A 2CNZA 4X8CA 5DO8A 3WN5A 1INEL 1JRHH 3O4OC 5D1ZD 3PL6D 3LB6C 3NZSA 2EABA 5GS0L 4LQFH 4OLXH 3RKDD 3UJJL 1LP9E 3SIKA 5DHVB 1HEJC 3MLUH 1WA0X 1T5WA 4A38A 3GYRA 2GJ6B 4E9TA 2W80C 4M48H 2YSSA 1Y1DA 2QHLA 3MLWH 4NPKA 4AX3A 1PQZB 1JGLH 3QJUB 4H25A 5KANI 4OGXL 3CMOL 5IB4B 3NFNA 4RDQG 3HEIB 1MOEA 1DJWA 5IT2H 4XVJH 4KJPC 5L2JA 1CFSA 3O6KH 4QWWD 1E4WL 1HXMB 2FIKA 3E38A 5HDBB 4H0IA 2LV4A 2D31B 3ZHLA 1Z6JT 2N4IA 2ZCZA 3FYIB 3MV8B 3SDYH 3VG9C 3BT2L 3EFOA 3KPNB 4DP4X 1LDSA 4U4BA 2C7UA 5TE6H 3C6EA 3DUHA 4P2OB 2ODHA 4M8UA 2NXZD 1Z9NA 4IKIA 4JY6A 3HB3D 5HD8C 5EC2A 5I6OA 4O02A 4L48A 5GRZA 1BGXH 2ZKWA 1TZ8A 4KJWD 4OQTH 4PBXA 2LLGA 3QNYB 4ELME 3WN5C 2WK2A 1FL6A 5JTWA 4J2XA 3WMPA 5IJDC 4ZUUA 1QI4A 4Z7WA 3L8QA 1QSEB 2VCOA 1IC5L 1G4MA 1GGCH 3P69A 2ADJB 2DJUA 4UBDD 3MRCA 1S9VB 2FD6H 4DVRH 4ZNCD 3VFMA 4DUXA 3QH3B 4XP9H 1BMGA 4BYHA 4AL8C 2JFCA 2HN7B 3UYRL 4NJAL 3KPTA 2DPKA 3TZVC 3U4BL 2JKWA 2BNRD 3DHPA 1PBYA 3RAJL 2ZUQC 4E42B 3VRJB 2OX5A 3NPZB 3L5XH 4H0LC 4GFTB 1OT2A 3CC5A 1G7QA 4ZOCA 1FYTD 1BOGA 1SJXA 3RIAF 1CTNA 2P8LB 2PO6D 3FB6B 4O02B 4S1DC 3V0EA 1MLBB 4OZGA 1QSFD 1UH2A 1YQVH 1T6VN 2QTEA 1JN6A 1VZHA 3HE7C 3QORB 3EFOB 3UC0L 1PJ9A 2DEWX 4HWUA 2VN7A 5AW6B 3QDME 4JRYA 5I6KA 1E8WA 4XCNA 3NN8B 4Z8FL 1OB0A 1JHTA 3N42B 3F58H 3SDAC 4XCCH 1R1CA 3VWJD 2KPWA 1I7RB 1OP4A 3FB7A 4JZNB 4O51A 5DVLA 4WFFE 2DM4A 2PLTA 3MMEA 5KBNC 4I85A 3G5VB 1A25A 2BY1A 3I3EA 3MV9B 1YY9D 1AIFA 2R7EB 3DOIA 1KBKA 3EAKA 3NQIA 4JFFB 3H2WA 4NSKB 4ZS6C 2PTVA 3SKOB 4DZ8A 1KCVL 1IGCL 3WIHL 1KCRH 3I9PA 5HTSA 1QZNA 1TVBB 1NIAA 3RZCA 1OAXH 4NYLA 2GB2A 3PGCB 4M9OA 1A7QH 3RNQA 3UG4A 2G2RB 2JK5A 3BEVA 5E5RB 4AJYV 4Y8AA 4LF3B 1T1WA 4HBCH 3F01A 3PUCA 2GK0B 4PY8I 1RZ7L 1VF5C 3B2UD 2MKWA 4W9DC 1XZ0A 4AIXA 4ZO7A 4CSPA 5TQ2H 4NHUA 3VGFA 3LY6A 1QO3B 4DPCX 3Q5OA 4PBWD 1BPVA 1OAYH 4L3ED 3TV8A 3FO0H 4XNUH 1AGDA 5EBLA 4P5MA 3D2UA 1QFWI 3E3QC 5FGCB 3TBVB 2C1OA 5KYXB 4X6CF 5HHPB 4NKDB 1AZBA 2H7WA 4J3OG 4R26H 3P0YL 4BEIA 3H9ZA 3MRPA 1TZHB 4XNBA 5EU3A 2CO3A 4CAGA 3OMNB 3AXIA 5DQ9A 4S1DD 5TE6L 2ISDA 2YA2A 4WTZG 1RMFL 4YHIA 2UXVA 1XF4B 2ZG3A 3CHRA 4G7RB 4GUPA 1S7RA 4LEXH 2GIMA 3T3PF 2VDMB 5AOZA 5EU7C 3NN8A 2NX5E 4J3TA 2NSXA 3ZLQC 2GK0A 4N2CA 1NCIA 2Y1ZA 1KBGH 5K1JA 3RJQB 3PGFL 3IN2A 3MQIA 5FGBC 3ROLB 5DQJB 1F4WL 4S11A 4XP1H 3BGMA 2YMTA 2CRMA 5ANHA 1HZHL 3HJEA 4NYLB 4EZJA 3WV0A 3VTAA 3H7LA 4YFLI 1NANI 4IU2B 3KYOB 4YDVA 4ZTPH 1RK0A 5FHBL 3J7HA 3RDTA 1KPRA 4HBQA 7TAAA 2LAGB 2JJTA 3FH8A 3HTLX 5E6UB 2WZPA 3T8XA 3CX5K 3VDCA 2FZ3B 3PCYA 4GRMA 4RAUB 3WLWD 1A7PH 3VFVA 1RKRA 4LCUB 1M2OA 3GIZH 3RIFK 1MFNA 3SDYL 5D7IA 4PI0A 2XKUA 3S34H 5CLTA 4FXGB 4FFYH 3MFGB 1O7DC 4I9WD 5KBMA 2WIIA 3IRCA 3MJ9H 2AXWA 1KLUA 2N0MA 3BVXA 3EHBB 3JVGC 2GC4C 4R7VA 3PLYA 4YDJA 3W0WA 1XEDA 4UNUA 2VN3A 3DRQB 2O93L 3BAIA 1X9QA 2VLJA 2NY5H 4I1RA 5BVPL 4OFVA 3L2MA 3O6MH 4AQ8A 1CIUA 3SDXE 5BRZE 4RRPA 4PJBF 4H1LG 2C1PA 2NNAA 2W60A 4AQAB 2D7TH 3MX0B 3N40P 4OTXL 4DEPC 2E9GA 3CVIL 3QJTB 4BUQA 4YN3A 2QZQA 1V3LA 4BSJA 5F7YC 3WKPA 4AQAA 4JRXE 1JMXA 2X53A 1CGUA 4DN4L 1BPLB 1IAIH 2D31A 1KYDA 1TCMA 4NKIL 1PG7L 4MA3B 4QR7A 3RZWA 3DROA 4EI5D 3ILQC 1TQBB 4NBXB 1R75A 1F86A 4WRLA 5TJWK 4BKLA 3C5XA 3EZ8A 3FRUB 4UI2A 2AV7A 1IBFA 3O2WL 4GLRH 4FXGA 4XH2A 3SE8H 4H25B 4IRZH 2Q87A 3L5XL 1OOAA 4HP5A 3U1PA 4ONHA 3UCRA 3KL0A 4UINL 5DC0A 1ZANH 1BLIA 3VE0B 1HNGA 3IGUA 2QL1A 3HCVA 2NUPA 4U6TA 1KCKA 1L3WA 2YEVB 2WN3A 4Y2DC 1PZ3A 2ARWA 3BIAX 3C75A 2EIZA 1C16B 4IQHA 3PP3K 4OH2A 4YAQA 2BNRE 2KKQA 1MI5B 4P2RA 2VDKL 1HC1A 1ORSA 3HS0C 4TSBL 4P04A 4XPTH 2O5YH 4XXWA 4AQ1C 1RMFH 3BPNB 4J6IA 1CZ8H 1HCYA 3BZ5A 4PREB 1X5IA 2DLHA 1UCBH 2TSAA 3CVHA 3C5ZD 2IC2A 4WAFA 3A24A 3BP5B 3WCYA 2YKLL 1UENA 1X4XA 4GQQA 4M4PA 4MHHG 2BIIA 2ENJA 4M6MH 5CHNA 5ELIA 5CEZD 1KGYE 5I1JH 1WS7A 4P48A 3EXLA 4PYGA 3RIKA 1XF4A 2YC1A 2XQYK 5T8IA 1H8OA 4YHIB 5KVEE 1NCWH 1DBML 2XLLA 2RBLA 3ZE0F 5GS1A 2UWEA 1CDIA 2OSWA 3BAWA 4M56A 3UMNA 2WB1A 3I3DA 2BVYA 3LS4H 4XMKL 3UZEA 4HMDA 3I3BA 3JQOB 1L9NA 3PRZA 1G9HA 1PYWA 2VZTA 3L4VA 3GBMH 2EP6A 3UZQA 1D6EA 3ZT7A 4UQ2B 3DRTA 4UV7L 2YJLA 3QQ9C 4P5MB 1AGDB 1MW0A 1IARB 1JUFB 1QNZL 2FNBA 5ALBH 1VA9A 4RCAA 1HHKA 3FMGL 4JPIB 2PTTB 4CGUB 4M5ZH 4BSWA 4UQ3A 2CQVA 1MKFA 3V7MA 5E99L 2WP3T 4YGVB 1OGAD 5CJOL 2PYEE 2Y06H 2FYYB 3MCLL 5A2AA 4QLRA 4UAOC 3ULAB 2NR6D 2JJVA 4YXLL 5KWYC 4IGBC 3S0PA 1J0YA 2WYTA 4OCWH 2B4CC 3PQYA 5H4ZA 1A1OB 2M1KA 5EPMA 3VE0A 3Q2LA 2GTZB 2CIKA 4OZFG 1Q1JL 2K6WA 2X1XR 2YMOA 2ZT9C 3T4AC 1GA2A 2IGFL 1TJGL 3BVWA 2BZ7A 1W91A 2H8PA 2YOCA 3ZHKA 5MP6L 1TJHH 1G9ML 3H3PL 5TPWL 3ZX1A 4L4VB 4K5MA 3QWRD 3DSNB 1MCWW 2APWA 1R0AH 4LEEA 2E7BA 4U7SA 4FZEL 1GS8A 1GC1H 3SO3C 1IM9B 3UGXA 1QRNA 4M8VA 1YEJH 4N26A 1A3LH 1RHFA 3FMGH 3DK2A 5MEND 1DFBL 4H20H 3RWGB 2QT6A 4XBMA 3WBDA 1HU8A 2CHDA 1EUTA 2BW5A 5DSCB 1KN4L 4MA8H 4GG6E 3K74B 2VN4A 3OKKB 1HK6A 5DFAA 1D7BA 4KFZC 5F7EL 4LRNL 4JHUA 3JWOL 2R29A 3ZTJG 5SWZB 3VXUE 2AEQL 2OL3H 4FCAA 4JFUA 3L9RB 3U1QA 3FBKA 4NXSA 3ARFD 4R4NC 1KLFA 3L4UA 1PKQA 3S2CA 3HPLA 3A22A 4BBWA 4L1DA 1M7XA 2BLFA 4L4VE 4E42A 3EDDA 2LU7A 3LHPL 4NQEB 5M94B 1R34A 4E36A 4MB5A 3HAEB 3WTUA 1L0PA 4N2GA 1FSKB 2WXQA 3DVNA 4LVOB 2A0LD 2ZJSH 5FCUL 3SE4C 2VAAB 4UM9A 1MHCB 3DPDA 4RMSA 5KSVA 5F1OB 2FZ3A 1F4AA 3IDIB 1ZWIB 4AUUA 2H2SD 5CWSA 5EIIG 3VG0H 1CVRA 4WJKB 2DYRB 4ZQTA 3TC9A 3TBYB 1DQQB 4TSCH 3QJZA 4KK8D 2P5WB 5I16B 1N6QH 2IALA 2PCXA 3KBEA 4YBHA 5ESQA 4E41A 3PWUB 4QXWA 1CS6A 5IVOA 5I19L 1PPIA 4X7FC 3DGCR 1CMOA 3A21A 1KZYA 1QRNB 4ODVH 4R4BA 4N2KA 1YVLA 3UFIA 3P0YH 3FSZA 3UACA 1E7VA 2GPZA 5E9DE 4MCYB 3QZOA 3A6OA 3L3HA 4X0KB 4L4VA 3WJJC 4ZS6D 5AYQA 4KZCA 4HX1A 1QWHA 2PPAA 4GT0A 4ETQA 2DMGA 3MACL 4UV7H 2MIZA 3ALPA 1BJ8A 4GUPB 4R2GB 1CFSB 1UD3A 4GRMB 1K3ZA 4PRDB 5DD1H 1IM3D 2EJ1A 3BLBA 1KLGA 3M6DA 2YEQA 1OCWH 1G1CA 1FE8L 1FNEB 1NGXB 2WVTA 4ODTH 4PRPD 1T5XA 2OMNA 2M8XA 2WMPB 3IJ9A 1BXAA 3BKCH 4HZLB 1WCBB 3AS3A 4HPOL 3VXRE 5KVFL 4KRNA 3VH8A 3JZ7A 2VW7A 4HS6A 3KPMA 4JQVA 3HKFA 3X1FA 4OLVL 1AGCA 4PJFB 5DJCA 1DSFL 4JDEB 4EQ3A 3G04A 3ZUNC 3GBLA 4OIIH 1Z5HA 3BPLC 1WCQA 4OD1L 5HYJD 4TUOA 1N0XL 4WI7A 3E7JA 2NDGA 4KMTL 3QJXA 1W80A 5B3JF 1FYTA 4NNYA 3MACH 3RWCA 4ZXBD 2NY3D 2HH0H 3GI8L 5MEOA 3UAAA 2IDQA 2LHAA 2DQMA 4CVZB 1ZRUA 3ZYIA 3KPLB 3HN5A 2EDXA 2HG5A 5F8QC 1BXUA 1FNEA 1NGXA 4X7CC 2A83B 3SHSA 3U1SL 2VDPL 4HULB 2OTPA 3LN5A 3MMEB 3V8CA 5DZNA 1EHXA 5GGUA 4A67A 4JEGB 1FFRA 2KLSA 1K6QH 1K8DA 3GMOB 2E27L 2X1QA 2I9TA 2ZNWA 5JIHA 1KPVB 3OMIB 2VO8A 3GSVA 4NWUL 5E6IB 2W81C 2ZXWB 1OQOA 4S1SH 3C5JA 2QFRA 3BAYA 4YAQB 1AQKL 1MXDA 2VQUA 3F7LA 4I4WA 4XNQA 1KEGH 4HK3N 4G7VH 1CIDA 2YPLB 3JYCA 4JY5H 4LVHC 2AK1L 2XA8H 3B2XA 1YUHB 3LMJL 1NC2A 3QQ9D 3TJHD 4HS6B 5JXAL 1D9KB 1FYTE 1CTMA 3NSFA 5D1QE 5G5DA 1TFHA 3WLWC 3VD9A 5B38A 2ZXDA 3TBWA 4C56B 12E8H 3AREB 35C8L 1WCBA 3K46A 3DHJA 1IFHH 2PTUA 3NCXA 5EUOA 4HDIA 1A9EB 5EU3B 1IBGH 2X4OA 3KD4A 2GAZA 3F7VA 2X28A 2X0WA 5DWUH 2WJ7A 1MHCA 1XB6A 1VGEL 4P59L 4FYQA 2AXGB 3MZGB 5F7BA 3O2DH 4G3YL 2J8UF 1MHPL 4GXVH 1XB8A 4HFWA 4XCNB 2QSTA 2BERA 5D1XE 4X99A 5DJAB 5J1AA 5HI5D 3M1OA 3X1EA 4LSRL 3OAYK 3AM8C 2UY7A 2XWJA 1W8NA 2R69A 4MDRA 1FRGL 4ISVB 5C08A 3IDJB 3PWJA 4ODBD 5DYOA 4AMXA 4LLVA 4EI6B 2FO4B 2HVJA 5IG7B 4JY6B 1HT6A 1MVUB 3HFFA 5DD1L 1OM9A 4GW4A 1FN4B 1ZT7B 4PRHD 1I8KA 2QFPA 4X9HA 5GS3A 4ZG1A 1WZKA 4XI5D 4KXDA 5EUOE 1ZHLB 3RWGA 1OO2A 1YMMB 3S5YA 3TFKC 4U3HA 2XC8A 4C4UA 1KTLA 1OZUA 4LCUA 4Z3TA 1XCXA 3TA3D 2FNWA 1JXDA 2V3FA 5DWUL 1CLYH 4QPEA 4PI2A 4R84A 4HOMA 4JKPL 1H5BB 1GRWA 1QAWA 3PXHA 5K9KB 1RJLA 3T2QA 1FV1B 2GI7A 1TSRA 2PWEA 3II1A 4ZSOE 1OF0A 1AJ7L 1XIWD 1ONQA 1UEYA 2GJ6A 4M61A 4HG4K 3CIQA 1NKRA 2QKIB 3ILPA 5ENWB 1NCUA 5G5DB 2F53E 2JCCE 3UX9B 3A67L 2WYZA 4XPGL 1E4KC 4D3CH 2ICEB 1CXFA 1BZOA 1FGNH 4WFED 1SVZA 3JTSA 1W0VB 4UTCA 4W6WB 1YYML 4WJG3 3EJQA 2VXVL 3FYEB 4N0UB 4ENEC 1SXCA 4GRWB 1HKLL 1JZHA 3MV8A 5AW0B 5B39G 3O45A 1D2PA 4LL4A 2NY1D 2MKLC 3CDYA 3FF7A 2OXHB 5AB2A 5ALCL 4OD3L 1S7RB 2R59A 4AL8L 3C60D 1Q0YH 4JNXA 3K6FA 3R1GL 4UQ2A 3V6ZA 4MNHA 3STLA 5I23A 2BVQA 1U42A 2PPCA 4YVNA 1MF2H 3WO4C 3BZFA 4Z76A 2VRAA 4ZMNA 2A83A 4M7ZC 3VM7A 3KLLA 5GGRY 3KPLA 3BH8B 5DZ9A 1NCHA 2FLMA 5I6PA 4EXKA 1AJ7H 3I9GH 2LGNA 1QSZA 3EOAA 1PLGH 1WITA 2EINB 3MODL 1T6BX 3PQYB 3C6LD 1K8IA 3PGDA 5D71L 4G8FA 4UUJA 4ZUSA 1LE9B 2AI0H 1S9WB 2CKBL 3K5RA 1UH3A 1LK2B 5J11C 5E1GA 4UT9H 2BP3A 5C0CD 4Q9CA 3D0LA 4UDUA 4QAMB 3V7AG 5T1MA 1MW2A 4BQCA 2FR4B 3LQAC 2ATAA 2WUCH 4BDVB 4QRFA 5GGTL 2XIBA 1ACZA 2IAAC 1FP5A 4N2IA 2DL9A 1ROCA 3CPLA 5B8CA 1AZCA 4JPQA 2ZE0A 4EI5A 4UMGA 4QRAA 3CFEA 5JHAA 3ARBA 2WXNA 5AENA 1ZLVH 5BXFA 3ECQA 2W9EH 3O9WD 2AVFA 2F7RA 4NT6B 4DK5A 1YNLH 3NEOA 3IGAA 2B59A 4XMXA 5FUZH 5C6TH 1A7NL 3ARVA 3B37A 3W9EB 1S9XA 1YEHL 2FHBA 4CW1B 4G83A 4MGXA 1JHTB 1EANA 4HIIB 1AZVA 2DLGA 2UWEF 3FFCD 4Z7UB 4OGZA 4N3UA 2V2XA 1A6PA 1NKGA 4B9PA 4LQFL 2DYSB 4KKBD 1DQLL 1J12A 1WBZB 4WHYG 2ZSWB 5AOMA 5I8EB 2C3VB 3BZ4B 2FQFA 1J1PH 2WKGA 1JGUH 5F3HA 3BT0A 3QDJD 4KFMA 1OXYA 1BVNP 1I8KB 3A47A 4FQHB 4XCEB 3ZZLA 4GUOA 3G5XA 3LEYL 2NNAB 5HHVH 3D3VA 2QGDA 3N0PB 4P59H 5T5FA 3JBG7 5KSVB 4O2CA 2AK4A 1XH3A 2EH8L 3VXPB 4DKFL 5DJ8A 2I32A 3GIVA 2OA9A 2WLLB 4OSUH 5B1KA 5L88H 1T1XA 1J11A 1KB5A 3GIVB 5A2BA 3VSQA 2NY4B 2VH5L 4I48B 1BZ9A 5TDNA 1U30A 3PHOA 2XETA 4OLVH 2GHZA 1OTTD 2XN9E 5DMYA 2AHIA 3NT0A 4YIQB 3F7VB 3V6BR 2RHEA 5GGSY 3HE7D 2Z6FA 4DW2H 3L4TA 3QXTA 1I4FA 4KPHH 5EU6D 1XCTA 2XWDA 2LVCA 5ABAA 3G6JB 1KB3A 1HEHC 3AG3B 2GSIA 2ZSVA 2NSQA 4I5BA 3M1CA 4LARL 4AW4A 2KUTA 2PCPB 4HXBL 3KW7A 3LD8B 5DXWA 5L8LB 2XQYA 5F9OL 3ZMRA 4H8WL 2AJXH 3C5SA 1GC1L 3ZDZE 1CBJA 1Z0NA 1EFXB 5J6GA 1SZNA 1Q4NX 5JIQA 3F6JA 2D0GA 1KLUB 3GHBH 2DMCA 2VRQA 3BVNB 3BN3B 1RP8A 1DSWA 4M62L 2PYFA 2DEYX 2MQ3A 2XV3A 1T22A 3ZQ9A 4JPKL 3UEQA 3UYPB 4M1CD 2Q6WA 4ABVA 1S7VB 2OI9C 3NJFA 2WM0A 3ESNA 5GS0D 1EHKB 4BM7A 3QDAA 4FMVA 2XN9A 2G9HB 3M07A 4HWEL 4NUMA 3LKSB 4NT6A 4P2QE 2IBGA 2CM6A 1OGTB 1WD9A 3GI9H 4JCMA 4LDEB 5E6SB 1OSZB 3WTVA 3WN5B 3NCYP 4N3TA 1MREH 2DBLL 3HHSB 3D30A 3LNDA 3EF7A 5KYXA 2CHNA 4KMQA 1JZ5A 2VDNL 5L4JA 2BDNH 4BDVA 5DK2A 1UCTA 2RFXB 3VXTA 2FECL 2BIPA 4KKPA 3TONA 4OJDH 4NRYA 5GZOD 3V52L 4RRPM 3G04B 1A6WH 5C97A 4G80A 3U7YL 1IGYA 5F1IB 1BQHG 1KY6A 3ULVE 3CFMA 4JO3H 4LMQE 1A4KA 3FSAA 4D7BA 3VWKB 4AYMC 4EI0A 5BOJA 4JFXA 1OAXL 1JGDA 2M26A 3DX6B 2VMJA 4IHOA 4KO7A 4EMZA 3QQ3A 2R29L 4JPWL 2WMPA 4LVOC 5I0DA 1P7QB 4GO9A 4HHAB 4Z0XB 4OZIE 2Z93A 1DL7H 1JNNL 4ZX5A 4Q0XH 2P5PA 5HGDB 4JFTA 3ZQWA 3GMNA 2XQBH 4FJYA 4JFEA 3STLB 2FSEA 4HUMB 4X5XB 3QG7L 1DVUA 4XPTL 1FHGA 3FQTB 4AVKA 2YPVL 3IFPB 1XQ4A 4PGDB 3PFQA 3WFHB 3MRHB 4FABH 5K39B 1RFDL 5EDSA 2ZD0A 1UM5L 4QJ3B 3H42L 4OZGB 4HIXH 3CVBA 1ZK9A 4W93A 1BVNT 4GXUM 5D93B 5AKVA 3C6SB 3L95B 3LIZH 5IBLC 3QFDA 4PYHA 5EEXA 1HYRC 1AYOA 2QLYA 4J3OF 1F4HA 1DBBL 2B5IB 1ZHBA 5B4MC 4X9GA 3MNZA 3N85H 5TGBA 3RLSA 4UQ9A 2C9QA 1U41A 3CC1A 1BVKA 4PD4K 5EBWB 4MQ7B 3DBXB 5JPMA 4H7VA 1SDYA 5IJVA 1JD9A 5DJ6A 3APNA 3CDFA 3OJ2C 4D9LL 5IVNA 4JK0D 1FIGH 5JLZB 4IBTA 1GGUA 1IUZA 4EIGB 4AYID 3BT2H 3X14B 1HE7A 3BUPA 1BM3L 4Z7WB 3PWLB 3R7RA 1OHQA 1JERA 2F7IA 2WLMA 2XA3A 4PUBL 4OCRL 4OJAA 1DHKA 2Z31D 2VDOL 3NSCA 4X6BB 4MWFA 3PQYD 5C07E 2ZX5A 5JW3L 5JO5B 3TA3C 4HC1A 5SWZA 5K69A 5TK2A 4AT6B 2FX8H 1L5GB 3VXRD 2C9AA 2XVGA 1CLVA 4PS4H 4MA1C 2EO9A 5E1AB 4E5XB 4KTYA 3P0GB 2DLEA 5ESAA 1P0SE 4W6YB 3GRWH 4OGAC 3V6FB 4NZFA 5IQMA 1TQSA 4PU2A 1THAA 3APMA 2ZP9A 3QEQB 4IRJA 2DD8L 3HG1D 4ZZFA 3L1OL 2KDGA 4ZAKC 2P80A 1U8CB 2ADJA 3Q6GL 3Q0HA 2EXWD 1WIOA 1Z9SA 3IF1B 3NABH 3UO1L 3D18B 3FUHA 1F5WA 4G8GB 1YNTF 5TGBB 2H8PB 3FU6A 3F85A 3IJHA 2NZ9C 3HC0B 1Z2KA 3LPPA 3HHRB 2EDKA 2WUCL 5GRVK 5IWLC 1XGYL 1RURH 2Z8SA 4ZODA 3C60C 1AG0A 4Y2OA 1HFUA 1P53A 1MXGA 3P3YA 4GKSA 1SMDA 3N9GH 2O5XH 4Y1AB 2YAFA 3Q3GA 4CSSA 4HUVA 1BF5A 4L8CB 2EECA 3NRQA 1FFNB 3VI3B 1H5BC 3FQRB 5EORH 5DFWH 3WKML 5KTEH 5BJTA 5EUKB 3QZWG 3MGOA 2NX5D 4Y4KA 3B34A 4M1DH 2CR3A 3O8XC 4AQ1A 5FHAL 43CAB 3DJTA 1M42A 3PV6A 1EX0A 3DTXB 2Y1YA 4FHKA 1CO1A 1UA6H 5IZ7A 4HWNA 4JO1L 4G43B 5DMIH 3GT6A 3T3PE 1HWHB 4XXCC 4PHZA 3A5VA 4HBCL 1IJNA 4BZ1H 3BC9A 5EBGA 2KZBA 1EO8L 1UACL 4FABL 1KV7A 3NJXA 2XX1A 1MAJA 1P7QA 4K9EL 2XOTA 2ZNXA 2CUIA 2EDFA 3T0DA 4R7DB 3DWTA 5KVFE 2OPCA 2DICA 1WFTA 1FL5A 4P07A 5EBLB 4UNVA 4M1GL 1AGFB 4Q6KA 5AB0A 4PD4J 2DQEL 5D5ME 4J3XA 4Z0BL 1WBYA 3MHZA 4XNMB 3RVVC 2OR8A 2JKTM 1TYEB 3NGBB 2HB0A 2FIRT 4PJ7E 3U6XA 3HRZA 1XIWA 2Q2EB 3FO0L 2WN2A 4J3WA 4XNUL 3G6JE 1QACA 2XWXA 2Y1VA 1A7PL 4L4VD 1KZQA 3HHSA 2UV3A 3S37L 4YXHH 1XSJA 2A9NL 4HZLA 3KCWA 3AQYA 4RGNE 1JGVL 4NOFA 4PJ9C 4U6VL 4DP1X 3GJFA 5JYMA 4HYTB 1IM9D 3AWFA 5GRWA 2VRKA 3G5VA 4LSTL 1QLFA 5CLYA 3K2IA 2JQAA 4JJ5B 3UH8A 3PIQB 3CHPA 2R4SL 4LASH 4HJJH 4YPGB 4BKSC 3DURA 4BZYA 4OZGE 2FWOB 5DJZB 1Q72L 1I82A 5D55A 4HPOH 3ATDA 2J44A 3HG3A 4EDWL 3CDZA 4HHGA 4L1TA 5D5MA 5FPIA 3TEYA 4EN2A 2Y2WA 5DD6A 2GBTA 4BFIB 5IMMA 4N87A 2GABA 4HXBH 4KO6A 2AJUH 1LO3H 5EDXA 2NUTA 4W9EC 1AKJB 3RL2A 3QRFM 4Z7VF 3H9SB 3PWVA 2X0UA 1JDDA 3SKJL 2BSBA 4NCDA 4L4JA 3KPOA 1G7QB 5F7MC 1HI6B 5CD5D 3KVQA 1TFPA 1XDTT 1DUYB 4WFEE 3IAPA 4Y2DB 1IEBA 4M4RA 4QRRD 1XR9B 1IIKA 1R46A 2Z92A 3HNVL 2DQCH 3CMGA 3RTQA 1U4FA 5DD3H 4OCWL 4MB1A 2DDQH 3DARA 1X9RA 5C7XH 1K3IA 1KJ2B 1NLDL 3F65A 5CBAA 3TOPA 2WGNB 1B0WA 2EDBA 2OZ4H 3L5JA 4MA7H 4HK3J 4PJBA 4PTTA 3OGCB 3U6RB 2EH7H 5K59E 1ETB1 4AVIA 3ALWA 3SGEI 1J48A 2E9JA 3CX5J 3WJMA 5KVEL 5JQ6L 2PW2B 2WLLA 2YRZA 4W9IC 2OFQA 5I28A 4E9YA 5DK0A 2ZYHA 4MD0A 4JZJB 1CXIA 1F58H 2VYRE 3E1F1 4X6EA 5E7FA 2XZZA 5D8JH 3EGSA 3H56A 2NTFA 3HAEH 3S8FB 2NLJB 1DDTA 3MRFB 4PCSA 2H0PA 4C56E 4XVOA 1WFOA 3ARUA 1HVXA 1D9KD 4KI5E 2HJLA 3QQDB 1WAAE 4CRPA 1NC4B 1IGMH 1SDDB 3NOIA 2Y5TB 2CKNA 1O5PA 2R2BA 1MCWM 4N2HA 3E6HB 2K9UA 1ZEAH 3QCTH 1DQLH 3RVTC 2OMXA 5FKAA 3QZWA 4R90L 1IGJA 2R0WL 1EQWA 1FC2D 4U1LA 4NEHB 1BBDH 4DFHA 5L2JB 3AT9A 5GSVA 1CQKA 4NKMB 2DOCA 3CLFH 3HG0A 4AE1A 2A74B 3OAYH 5LAPA 3SD2A 2K78A 2YS4A 4HIIA 5JOEA 1A7BA 1UG9A 4OFYD 1PQZA 2B4CH 3V7AE 3CXHJ 4B5EA 2ICCA 5DT1L 5B21A 1UVQA 4NLAA 1M6OB 1OALA 3FUJA 1IGTB 4GW5B 1T5WB 4JFED 3UMTA 3TYFA 2Z91B 3TM6A 2YN5A 3PY9A 3BAXA 3BSHA 1LWRA 4LSVH 5BZZA 5K9QG 4NP9A 5E99H 4EPSA 2N1KA 2A9NH 4QRSB 4OLUL 2WIMA 2X4UB 2XVKA 1UATA 3DPBB 3GS0A 1XGZA 4UT6H 3SDXB 3OAUL 1N5AA 2E74C 3U7AA 2CRIA 3SDAD 1RZJL 3I02B 4LSQH 5C9JA 4NHUB 3NJVA 1F6AB 2WSKA 5F7LB 5C0FA 1BYNA 2A6DA 5D2LE 3MGAA 3K6NA 5E51A 5D5MF 2I26N 4HGWA 4LNRA 5DFVD 2EXYC 3F7YA 3IVKB 1RZ8A 1PYWB 4DO5A 3TNMA 5E4IA 3APCA 2UZYB 1WA1X 1SNRA 1MFBH 2VXSL 5E5MB 2BOBA 5I17B 1KYUA 1OP5K 4KZEL 2VWEE 4RH4A 5IW1B 3HG4A 4PWJA 1FIGL 3PHSA 1A6TA 2QQNH 4RBPK 5TD4A 3B2VL 5DLMH 1DN0A 5GRXG 5HXMA 2NY5C 2NY4C 1K2DB 4H0GA 4N9OB 4D8OA 4RWYL 1MH5A 4UILL 2WWNA 1MCDA 5SWZD 2VL5A 4RSVA 3X12B 4GG6F 2MOVA 1TQTA 2E7LA 4Z7VA 5ICZB 1LEIB 1KPUB 3BI9X 5JIKA 2GTWB 2WJ5A 2R56L 3FU5A 5MENA 4OZGF 1BZQK 4LPUA 4KJQC 4O2FA 1AXIB 2PYED 4JDTH 5CGTA 3T4YA 4M7KL 2YLKA 1MELA 4BWWA 2QQKH 5FYJD 3UJTL 3RGVB 2ZTBA 5JORB 1PZ5A 5FA3B 2LE9A 1MHHA 2H2SC 4J1UB 4Y1AD 5ABDE 3L1EA 3HBGA 1MW3A 4YSCA 1DVXA 1LEGA 1VDGA 3W56A 1JZ6A 2DQ6A 4YHOH 2VXUL 4XWGH 2IAMC 1J8RA 2YGPA 4IU3A 3FQ2A 1M71B 1DN2A 4WEBL 1A1MB 1E65A 3RPKA 4FZ8H 4G42B 4AKPA 2P5ED 4W6XB 3CHOA 3JVFC 2IH1A 1T7VA 5AW2B 3V5DB 1QR1A 4TV3A 4YHMH 1U8NB 4QRRA 5KYYA 3QR1A 4PW3A 3RDTC 2F61A 4M6NH 4MA3A 4MS8C 2C9XA 5MENE 1RUKH 3L3OB 2L7UA 4H20L 3P30L 4MAYC 4OCYL 4F9LC 1UC6A 2RALA 2R1YB 4CMMB 4JFQA 2LU5A 3T0EE 1ZHLA 2DMHA 2AEIT 3QJQB 2TRHA 2FJFB 2OYLA 1TPXC 1AI1L 1IM3B 2VL4A 3O9WA 4FNLL 4XBEH 2AITA 2FHCA 2EYSA 1ZJAA 1ZY9A 4BINA 4H26A 3TWCL 4S2SA 3PL6A 3RJDA 2BJMH 2V7NA 3BESR 4EAEA 2G3NA 4A68A 5LO7A 3IDJA 1OEZW 3BVDB 4RMBA 4XP5L 3S96B 1HJCA 1ZOXA 1MHPH 1CL7I 4S1QL 3S8GB 4YHOL 1N4XL 3NIGF 3KPNA 3LNIA 3OJMB 5EC1B 4ABQA 2TSBA 3S35X 3OAWA 1U58A 2MCPL 1R4XA 2OW7A 2DH3A 2QTVA 4OCLC 1TSHA 2CIIB 3KLAB 2CHZA 2Q3XA 3GJFK 2XSKA 2CK0H 5LJYH 1SQMA 2G60L 3O4OB 1XZWA 1K72A 1NPJA 2QV2A 4BFEA 4I3SH 3MA9H 1A7RH 4FYSA 1GXEA 3FQUB 3L16A 3P9MA 4FTVE 3LZFL 3FTSA 3HNTH 4LKXB 4LLWA 4XX5A 3FU8A 3V2AR 3CJJA 4WZ9A 1L0YA 5D7JA 2ARJA 3PWPA 2NY3B 5GGRB 5GGTA 5B1JA 2BP8B 4WHTA 4OI7A 4XB8A 3T65B 2HFFA 3H2PA 2F7OA 2F8XC 2OMBA 2QGBA 1PEWA 2GCYA 1XCWA 4TULH 4GXFA 4WO0A 4I4WB 4XNQB 4XXDB 3BWAB 1EAOA 1UB5A 2LTQC 4TUKH 2XRAH 4PRIB 3FK3A 4ZQKA 5E8PB 5B1AB 4OSUL 4K71C 3NUKA 1NFKA 2QDVA 4BV1A 1ZGLM 4AJWA 3NCEB 1UKQA 4KY1H 2FEEL 3PNWB 4BK5A 3MUJA 1LEKB 4FQ1L 1AMYA 4R0LC 4Y2DD 1JPST 3MSPA 2Y4SA 3MLRH 4RFNC 4FG6C 2VDMH 4X5WA 3UJTH 5IESL 1RPUA 4ZX3A 1TLKA 3IXAA 1U8IB 4QF1B 1IE5A 3LXBA 4HVBA 5IK3B 3OJDB 5C0BD 2W0PA 3RWCB 2AABL 2EUWA 1HXYB 3HE7A 1QO3A 3BMVA 4JM2F 4PJDA 5H4YA 1HTYA 4OZHA 3MNDA 1YECL 1U3JA 5H35A 4OIIL 3ZQXA 1R5VA 5C6PB 4XBGB 1PCXA 3BSGA 3QDGB 3SJVA 4AM0A 4D94A 1V7NH 4L8SB 2ENQA 3MVSA 3ZSTA 4F5CA 2WXJA 5AW7B 3GBNL 4MMYB 1ADQH 4JRXB 3WG7B 3IM1A 1CFVH 4LLDA 4ORGB 3HZVA 3LNFA 4XVSL 5I0ZA 1F42A 2XN1A 1JDCA 1KCUH 3QWRA 1TTCA 1PFCA 4KITB 1I9IL 4PJHB 1BQUA 1JXKA 2K7QA 5FKPB 4MDJA 4PRHB 5JPNC 4HIHA 2ED7A 2NW2B 2ZWYA 3DJ9A 3QSKB 4JG0H 3ARXA 4MJ4A 2QZ5A 1I1AB 3BVVA 4UU9A 3SB3A 2IWFA 1XMWA 1S7QA 1OB1A 2WKOA 4PJDE 5ESVA 2LLLA 2FDBP 1N4XH 3T6WA 1IJ9A 5E94B 3W2DL 3FTWA 3CZSA 3V55A 1YNKL 1VESA 3MRRA 3OKEB 4F15C 2ZF8A 4AEFA 3K6OA 2GJRA 4PLKD 4R90H 3IMBA 1Y6KR 3JT2A 4KJYA 2VTFA 1EDYA 3MKGA 1NICA 3Q2CA 2X3CA 2ID5A 3LKRA 3RWDA 3ZRFC 5IMKB 5L9DL 2E8ZA 4LCWE 2YO3A 5D7LB 4MQTB 2B4CL 1WBXA 4KK5C 3TBSA 4YNYB 3DX9A 5HHQA 3SYCA 1HS6A 2YD7A 1KCWA 4GLRI 8FABB 5DURB 4R5VA 5CNHA 1YEIL 3QDJA 3AG2B 3D2UD 2J25A 4JAMA 2DZEA 1FCGA 2PR4L 3US1A 2V2TA 2FLRT 2EDDA 2UZIH 4ZUUB 4KXCA 5I82A 4U1JA 1T03H 3OF6A 4GRWH 1J1OL 4AIOA 2NCEA 1MAML 4PWFA 5IW3A 1IBYA 1C5DA 1FZKB 4MAYB 1QEWB 1FLTX 3CU7A 4IRJC 1QEXA 3RG1C 1HX0A 4MXWL 4NQDB 2J6EH 2MNJB 3NCMA 4WV1A 5GIRA 2B20A 3TO4C 1RHHB 2O5NA 4L37A 5FO9B 3WENA 1N59A 4EVNA 1NAMH 5DHDA 4B9JA 4QGYA 5ILTL 4N0FB 1DBBH 1NQBA 1ACYH 3PDOA 2XV2A 3TYGL 2WUBH 3KLHD 1BVOA 1SOSA 1T2QH 4L1HA 4DAGL 4XNZB 4PJ9B 4HT1H 2C9PA 3GM0A 4Y19B 5TFSL 3V5HB 3ZIYA 3BD3A 4HKBB 5F8RC 1QHQA 3LSOA 4PJ8A 3RY5A 5L2KD 2JJSA 3GWJA 2NY7H 3C60A 4MTMA 5CM1A 4GBXD 4IBZA 2WQWA 5DRNA 3M1BB 1HAWA 3R8QA 2WTPA 5GGVY 4BIKA 3FUMA 3KZ8A 5DUBB 5ID0A 4A2GA 1KEML 1OARL 1UHVA 3AJ7A 4B53A 3QDMD 2JF1A 3L7FA 5D1QA 3U0WH 3FH7A 3JWDC 4R4FL 2IBZY 3WJJA 4GW1B 3TPUB 2H6PA 4WENB 1CLOL 1VKXA 3QAZB 3DUSB 1O6VA 2H41A 2YWYA 3SDCC 5BVPH 1P5VB 1SYSB 3UP1A 2QELA 1O7VA 3MO1A 4HUWB 5KN5B 4F91B 5H8DA 2XKNB 2VUKA 4PB9L 3IEAA 3IXTA 4WW2B 5CLWA 3BPOB 3CVHL 4BXSV 5DZLA 3AUVA 3QIWD 2OMZA 2HT4C 1LP9F 1CGTA 2I5YH 5E08H 3ZL1A 1A7NH 1VRSA 1JK9B 4ZDHB 3Q2NA 3VI4F 4WIQA 2BC4B 3D09A 4PVNA 1IU1A 4XPAL 1JZJA 2C3GA 2XICA 4JPVH 2VISA 4WI9A 2PABA 3NMEA 4L4TA 3SY0B 4RQQA 3FB8B 3V0FA 3L3KA 1C08B 4AGQA 4BCZA 5DU7A 1NBYB 5ADOL 2E46A 3WXWH 4GQ9H 3HA0A 1P6WA 2A6IB 1P2CB 4JRYD 1F41A 1Q9OA 1N8OE 1I8LA 4Z7AA 1G7HB 1LNUB 3L4YA 3MRIA 3V0GA 5B7EA 3O41A 3D1MC 3EFFA 5E9NA 4K3DH 3QFJB 2CKBH 2CO7B 4LLUB 4A2HA 4XVUC 1J7VR 2E6JA 3S3BB 4MMXC 1LO5A 1AR1D 4U6YB 1NGWA 1CL7H 5D1QC 2AAVA 2ENSA 5BZWA 4C57C 4NPJA 4BGDA 3U0PB 5I15L 3QQ4B 2VDKH 2W65B 1SQ2N 5ID1A 1Q94A 3QNZA 3MNVB 4FG2A 3GBNH 2PWHA 5GRJH 1FFQA 4KVNL 3GINA 1BFSA 2FJHA 1CR9H 3O6FD 4ZMLA 1ED3B 1KIRB 2J56A 5FLVA 1QPXA 1U91B 4ZSOA 3VWJC 1MCKA 5AOLA 3LKQB 4OLYH 3IT8D 3OF6D 2IF7A 2BW4A 4Q0XL 3EO1B 2A4ZA 4I0PB 1U4EA 2WQXA 4G9FB 3W81A 4BZ1L 2VH5H 4FOMA 4AENA 4HWZA 4LESA 1YY9C 4X4MA 2LU4A 1KIUA 1NGZA 1X5ZA 2Q2LA 1HEZB 3A6CH 2KPNA 5I6NA 1Z3GL 4QUOA 2AJ3A 3RVXD 3AU0A 3RVTD 1JF5A 3MV8E 4E68A 4E9SA 2O6PA 4LAQH 4GRWE 4E2OA 3EJPA 5DEFB 5AOJA 1TG8A 3FT9A 3QPXL 1BGXL 4L9LB 3SODB 1RZFH 5BV7B 4GKZB 2QQNL 3WY4A 1J1PL 5LLIC 3BQUB 4WNSA 3B9KC 3QI9B 1C08A 5L88L 2V8LA 5C0BB 2FYVA 4PJIE 2WWMC 3T77B 3MLTB 5EU5B 4NNXB 2XV6B 1WPCA 2Y06L 2WINA 4A7VA 1L9PA 1E27A 4BHUI 1NCCH 3TNNA 5LN4A 4I3RH 4M5YH 2FX9L 1KOAA 4QRPE 5JNYB 3THML 1U3HB 1CDYA 1E28B 3DJSA 2G9KA 4TNVF 4XBPA 2YPVA 1FH5L 5F44A 3KPQB 1THCA 2WBXA 5AUMA 3MUGA 2YFNA 1E6OL 3P2BA 5ECJE 1ZLDA 1J1OH 1EXUB 1SEQH 2UXFA 3R0MA 4OCMC 4POZC 5E8OB 3TT1L 1GMEA 3O3UN 4RDBA 2FRGP 3KNBB 3OKYA 1R0AL 5LHDA 2XV0A 3V0DA 1RIUH 3BOVA 4RGOH 2W94A 4KO9A 2GC7C 4K2UH 3VAEA 2DF3A 5AW8B 2P28B 4XC1L 2JKSA 3D5OF 3SPGA 3F7KA 1CVSC 5JUEH 2X89D 4P3CH 3RVWC 1GHFH 1ZJBA 3AWGA 3K72A 1DCLA 4RGND 1I8AA 4JPWH 1MRCL 5J12B 4CC1A 4AG4L 4P5TC 4I2XA 2VUYA 2P8PA 1NWPA 3F2LA 5CU9A 3Q05A 3VWKC 2CLRB 5C0AB 3MC0A 1IB5A 4K9JA 3HC3H 4WGVB 3RVUC 2PPEA 3FAXA 4A2FA 5AB1A 1GY2A 2R0KL 5I1HL 2WKOF 5LVEA 1MJJB 3Q9QA 4TUJA 1HQRB 1TU2A 1LMKA 2FBRA 2F8IA 4XB3A 1S78D 4Y1AE 2DYPB 3FFCE 3FJTA 2HPTA 2DW5A 2NYKA 3T4AA 4DZBB 3P4LA 1IKNA 4HC1H 4LP4A 3T8VA 1ZLWH 3MRPB 1DVFC 1J5CA 4AUJA 1H3UA 4IW4C 5MEQA 2CO2A 3PABA 2ZOTA 1X6LA 2X4TB 2VR8A 5TQ2L 1UA6L 2OTWA 5CEZE 3REVA 1CFMA 3U9PH 1W9XA 43C9B 3IU4H 5HVHB 2O26U 3KGSA 2FWSA 1QLRA 3S3CB 2CPUA 5EWIH 5FYKE 4UQBA 3KPSB 1ZS8A 2XZQL 4HLJA 5CIPB 4M6ML 4YK4C 1WC7B 1A5FL 4EJ1C 1PCSA 3KJ4B 4PJEF 1JNNH 4HAFA 5F0JB 4W9JC 4QYOA 1WGOA 1A6AB 3L45A 1JMZA 2D3LA 2AEPH 3V5KB 2YEZB 1QNZH 1W0YT 1GR7A 4TTDC 1TVBA 1DBAL 2R4RH 4KXZH 4LEXL 4F7EB 3HUJF 4RMWA 4IDLA 3SPJA 3NIFF 4OF0A 3AU1A 4H2CA 4HSQA 4QKXB 4X5QA 4ZO8A 4NRXA 3VQMA 1IAKB 4W9CC 25C8H 2ITEA 4PB0H 3O0RH 1AKPA 5AVWB 3MJ8B 3PPSA 2HLFD 1JWMB 4PJAF 3TURA 1CPUA 2EE3A 4HIHB 1Q1JH 1EXGA 1WVZA 5JW4Q 3VW3L 2CHXA 5BMFH 5AOIA 1T4WA 5LNDA 5B7MA 3CHQA 4PS8A 4OZ4B 1MRFL 3LKPA 2IDSA 4YXLH 4ANWA 3UYOD 4RFEB 3TN0D 3VFWA 5EIIA 1K85A 1KBBA 5FDWA 1HNFA 4MMYA 1MLBA 2GG1A 2NY0B 4LBEA 1YEDB 1FNSH 3ZMNA 5SWSA 2VXQA 3GIZL 3UTTA 3SE9H 2A6JB 2F74B 3Q6FA 5C0JA 2IPKA 4CN6A 4H88L 3E1ZA 5AZUA 4X6DE 2HLAA 3WUWA 3WY2A 4A04A 3IGLA 3MXVL 4JCWA 3JV4A 3SKUD 2EIDA 2GUOA 4LSTH 4Q89A 4YBLC 3P4MB 2PMZA 4ATWA 2B77A 3D4YA 3MBED 3PHQB 5CINH 1PEZA 2HRHA 2GJZB 1FL3B 3MROB 4ELKB 5I1GH 3G6DL 3B43A 4M03A 2OJZL 2Z0BA 5ERWA 2E9IA 3G5WA 1KJ2L 4FA8A 3ULUC 2Q9OA 3ZL4H 1WEJH 3ZUCA 4QRQB 3HNVH 5DZPA 2CO4A 5JYLA 1MRFH 3QNYA 3LQZB 4TQ8A 3T0XA 4NKIH 2DJ4A 2IANA 1JHLH 2BNRB 3CCHB 1G7MB 2I7OA 3G08B 1UZ8B 5EZLB 4F7CA 4AYDC 5D7KE 2W0LA 1S7SB 3LPWA 3UTTE 4CVUA 2EH7L 2CMRL 3LVTA 2A4EA 1RUML 3II2A 4MMZA 2HLFC 4B9CA 3ABZA 4Z7UE 35C8H 3DX0A 5TE7L 3IS1X 1LK3L 5E6IC 4XN5A 1QHPA 3WIIH 5I1KL 1YNKH 4ZW8A 3V4LA 2BMKA 3L1OH 3AXLA 3OXSB 4TVPH 5HPMA 2XTJE 1KCBA 2JJTC 3I84A 3MXVH 1BF8A 1T4KA 8FABA 3FL7A 3ZT5A 3WIHA 4AIZB 3NH7H 4QTHA 2WLYA 4X7TA 2YD9A 3BZDA 2BX5A 4XNDA 4QTHB 2LU3A 3N5AA 4FULA 4F2MA 4Q8BA 2HFGH 2H3KA 5T3ZL 1ZGLA 1BEXA 3AACA 2IMNA 2R0LH 3T2LA 2CK2A 5B3JE 2R0WH 2IANE 1PTZA 1ZXQA 1D6VL 2EYTB 2WSPA 4EI5C 5E4OA 1JBJA 3MUGB 1U8JB 5FYJE 5J0BA 3ZE2F 5FO8B 2D2CC 1KGIA 4A6YA 1RU9H 1YAIA 2K1MA 3MRLA 1DEEB 3LEXA 2XG4A 4U1KB 3I6LE 3VQ1C 5E6YA 4QJ4B 4CL7A 4HJJL 2UYLA 2ZONA 4ZFOA 1WH0A 2D7MA 4KY2A 4NQQA 3T5WA 1MWAB 3KYMB 1O7DE 4JFWA 1NEZA 2KHAA 1IM3A 4G1MA 4MCZA 5F7AA 4BELD 4XMKH 1NBVH 3SYAA 4XGZA 1AY1H 2VABA 5C7ZA 2WBWB 3AROA 1NAML 1T0MB 4AGMA 5DJDB 1WIPA 3B7SA 2PYEB 1T0OA 3CQFA 4NNPH 3OMAB 1KT2A 3O3BA 1ADQA 1U8MB 4R7LA 4TNFA 2MMXA 5DT1H 3ECBB 4MAZA 2AKRA 3L6FB 1M7IB 5EU6A 3S88H 1KIQA 3RWFA 4GINA 5IHBA 3S8WA 3J27A 5KVDE 5AVRB 2CBMA 5I2IB 4U6XB 2RQ8A 1U8QA 5MI0B 4GKOA 2Z31A 2NY3C 2DTML 4BWUA 4NZTH 4ALAC 3WKYA 4IU3B 5ACZB 1JNLL 3WS6A 1XR8B 4ZBJA 3Q13A 4R3SB 5CINL 2ORBL 2OZ4L 1D5ZA 3SYPA 4DSYA 3GXPA 2VXQH 2A9ML 4L8DA 4NQUA 3FU0A 1U91A 3HG1E 1E6OH 2YAHA 3F00A 3FUDA 5MERB 5T3ZE 1MF2L 3BYTA 4IRJD 1E43A 3SBRA 5DK3A 3QORC 4V33A 4PV8A 5AL8A 1AHKA 2HMIC 1H8SA 1MI5D 1NA8A 2X6UA 2P5WD 5CLZA 3V0HA 4JDTL 4MSWB 1CE6A 4PRPE 1JCVA 2CRYA 4ZUWB 4KVCH 3RUGE 1JS4A 1NGWB 4HJIA 4MKMA 5BPPA 4UDTA 1WD8A 1MH5B 3EFFB 1UYWH 1A9BB 1LO3L 3AU1B 2X2IA 3RTQD 1MCNA 2OSYA 4LRNH 4FXLA 5D9SA 3TJPA 2IFFL 2HTLD 3MJ9L 3W0WD 5DD3L 2IPTL 2F54A 3FSVA 1J8HA 4F7PA 4KKCC 2W88A 3EFDH 3SE9L 5JDSB 2C9SA 5IQ7H 2OSLB 3O3EB 2WXIA 1BFTA 3LHPH 1KELH 1SBSH 5GJTH 3SY0A 4AH2A 4WSKA 3QNXA 5DQDL 4LP5A 2NY0C 4Y4FC 5IM7B 1A2YA 1SHMA 3IJYB 4PRPB 5C09A 1Y0LB 4JE4B 3RUGB 1GAFL 4NQCD 1JTTA 5C3IA 1PG7H 4U33A 2XTSA 2H2PC 3IXTB 4WW2A 1KYOJ 4WWKC 3M46A 1YEHH 3H3KA 3I6GB 4NFDA 3BH4A 4E9LA 3OAUH 3VVVA 4W68A 4WFGE 4X6FB 3SDDA 5IJBC 5GZOA 1B3IA 3BRFA 3QHTC 5HVWA 4WJ5B 3U2SB 1B88A 4HEPG 4R4ND 2P49B 5ID0B 4ERSH 3K6DA 2EKSA 4FN0A 3ETSA 1MCOH 2APVA 5E2WH 4K94H 2V9UA 3A0OA 4YDLC 3EFDL 1UGNA 3I50H 3NZHH 4X6CA 2EIBA 2FJGA 1CD9B 1GVIA 3QG6A 4UB0H 3V5HA 5I66B 4XVUD 1BBDL 1L7TH 4FNPA 3WFDL 2HVKB 4P23B 2R2BB 5HGAA 4RISH 1SM3L 3FU3A 3ROOA 2H6OA 4NO5B 1G43A 2Q7YB 2NOYA 2W1NA 1Z0MA 1TVHB 3EGDA 4WU7B 1URIA 1FBIL 4MNGA 3VFTA 1IC4L 1WT5A 5JDSA 3RY4A 1FZKA 5EZIH 5LWYL 5EEYA 3EJRA 4Z7NE 3DIDA 3O2VH 2K3TA 4EUPB 4TRPL 2OQJB 1ZCRA 1IVTA 3KVDD 7PAZA 1MAMH 4UTAA 3WMQA 4ZUTB 1QRKA 4PRIE 5BNXD 3EBAA 4B50A 4JAMB 2KMWA 5F89B 1KJ2A 4UZGA 5I1LB 1Y0LA 4UT9A 2VXUH 2WPGA 5KSAA 3NSDA 4WI3A 1KXVA 1EDQA 1OSEA 2F8OA 2VXTH 2FGZA 2X40A 2R2CA 1KFAH 1NBVL 2XPZA 3ZTNL 4GSDL 4P9HH 2XN9D 5D1ZC 3ERXA 5H94A 3JWDH 3C08H 1T83A 3G5YB 4KO5A 3WE6B 1WE5A 5L2KB 3B2DC 1I8MB 2OSLA 4XC1H 3WLBB 3O8XA 5I1EH 1HCZA 5DDHA 3FT3A 3I6LD 2WCSA 3VXNB 3S88L 2Z8VC 3NFPA 1RCYA 3GGWA 2WXHA 4GQZA 5HHOB 1USZA 2XTJB 3MCG1 1TQCC 1XX9C 3EYOA 4OD2B 4D9RE 1XGQB 3REWA 4UDTB 2MWCA 3BH9B 5IROC 2XIDA 5CJ8A 4PLKC 2VITA 2LTQB 1Q0XL 3P2DA 5A7EA 3RX7A 4F1SA 4YH6A 5FOBA 2DBLH 3MJ8A 1PNCA 1KT2B 2Y2TA 2RCSL 4OTXH 1ET8A 3EO9H 5MERA 4OI9A 5HDRA 4H1LH 3UOAB 4R2GD 4KKZA 4UIKH 4XN7A 1OAQH 2W38A 5SV3A 2ZZUT 1BX2B 4I77H 4PJ8C 4R6UA 4ZPTA 4TVPL 4LLMA 1W72B 1X9UA 2CK0L 1KXVC 4RAHA 2ZCKL 2R9HD 3FT3B 1OP9A 4HH9B 5HDWA 5C71A 3LZLA 3ARDD 2VJ0A 1DQJB 1M7DA 2E7DA 4WEBH 1AS6A 4RVBA 3NH7L 2C3WA 4S1RH 4WGKA 5ITBH 3TIEA 4ILDA 3D6GA 3H3BC 4P3DB 3MNWB 4KHXL 2VZOA 4LFHD 2XWBA 4APQB 3T6QC 3PU7A 4RFOH 4QXGH 1S7WA 4NQDD 4DWHA 2EYTA 3NIDB 4GB9A 4OGQC 3EW3B 5F6HJ 2HRPL 1SJVA 4H8QA 3ECBA 5F6HI 1YEGL 1G94A 5IK3A 3ULUF 1UFGA 2V37A 4NQED 4V1DD 2COVD 2F18A 3MUY1 4OV5A 1NMCB 4JZOA 2A6IA 5DJDA 3ABKB 2CHWA 4TYUA 1M56B 1EO7A 2NTSP 5ACMA 1QFOA 4ZXBB 5H2BB 2R0ZH 2GBAA 4CJ1A 2CH8A 5IHHA 1N7MH 3D4GA 3Q01A 4Z7WE 4N85A 1IC1A 5KANG 1RP9A 3L4WA 3C5ZA 4DVRL 4P4RB 4G9FD 2KQMA 4X7DC 5D6CB 4X9IA 2N7AA 2DTSA 3TBCA 4AQ1B 5T5FH 3QWOB 4S0HA 4C83B 4NO5A 3H7BA 3VWJB 1QI5A 1GKOA 3P4OB 1N0LA 3MN8A 3ECVA 5BW7C 3NSYA 3DO7A 4Q6IC 4XNAA 2ED9A 2GI0A 1CN4A 4K3JL 1WWBX 4N0UE 2BVPA 2H6PB 1JWSA 4ODXB 5I8CA 1BBJB 2BOCB 3MI6A 2L8AA 1MJUL 2CLVB 3POCA 4ZPVB 3KE0A 3LAFA 3MLSL 4I87A 4WCYL 3TGXA 4FS0A 3VGHA 3WEXA 1CYGA 4QRQA 3KG5A 2D4DA 3BUTA 3JV5A 4KTEH 2MH4A 3N06B 4UTAH 1V7NL 4N28A 1IAIM 4WI6A 2B2XH 5MHSE 3NEEA 1ZLWK 3CZUB 3N0AA 3ZDYB 3WO3B 1MFEL 3D7PA 1XF2A 1E42A 2WBKA 3TXAA 5E24E 3BP7B 2RB8A 5JW3H 1OPGH 1G7LB 4Z7OE 2OR9L 1BJ1H 4HQQH 1UB6B 3VU1A 4PJXB 1DJZA 4HWEH 1PKOA 4PW4A 5D1XD 4M6AA 3TVMA 3ILDA 1MFCH 1RHHA 2ESVE 4Y16C 1XGRA 3NJMA 5FO9A 3RZCC 3MUZ1 4E5XA 2W0FA 1CG9B 3BWSA 1P7KA 3CZNA 4GO6B 4JM4L 3DIFA 5AYTA 5DMJB 3MJ6A 2WQAA 3UPCA 4CC4C 2JLPA 4FQ1H 2UY6B 2ZICA 4BQ9A 3U25A 4ZUVB 4ZPTB 3T0EA 4X8GA 5TFSH 3T77A 2VLJD 3OR7A 2A0LC 3DYMA 1YECH 3ZE2E 3GSWB 2AI0L 3V10A 4YDIH 4G11A 5HYJB 3VD7A 2P42B 4ELMA 2JB6A 5TE7H 5I1AA 4L3CA 4G71B 1ZVYA 5GHWL 3ZN6A 1M1SA 1F2QA 1UWFA 4YHLH 5FOBB 4MJID 3UAJD 1C5BL 5I1CH 5ICYB 2D3VA 3QPKA 4APQA 4GSDH 4P9HL 3RRQA 3VXOA 4P3CL 1BVKB 4IKJA 5EBWA 3VFPA 3NDYE 2Z1PA 3GZQA 3QVAA 5D7LA 5BO1H 1DSYA 5HPOA 1D5IH 4MFHA 4TNGA 6FABH 5AZ2L 3ZYJA 1HHIB 3NFPB 1A3ZA 5FGRA 1NH6A 4X5RA 3IDYB 4HH9A 1DEDA 3QXVA 2VLRA 3HFML 1AZNA 3BKJL 4JANA 4PH8A 1A3QA 5EO0A 2X09A 3V4PB 2JI2A 4HPYL 3U9UA 3VXSB 1Q9LA 1RL1A 3MRRB 3OKEA 4X98B 1F11B 2JQZA 4FQQB 3EOYG 1KXTB 4OIBA 1SGKA 4QT5B 5JHDB 1PX4A 1B90A 2J7LA 2VDKB 5DMKA 5ANMB 4ERSL 3HUJB 4KX8A 5CUSL 4PRHA 4K94L 3O6KL 1XSIA 3KXFB 4XMLH 1SEBB 5D72H 1LL1A 2D0FA 4I13B 4WU5B 3UGEA 5IR1A 2WLKA 4Y7MA 4OD2A 1DQKA 1UWXK 4QLWA 1QLEH 1RSFA 2J5WA 2Y7OA 5CJQL 4UNTA 2VJXA 3ZRSA 4IDJH 4UZUA 2EC9T 2X9YA 2ZG2A 3QZPA 3EGDB 5T1KA 1SHSA 1PIFA 1H0DA 3ULVL 4G80B 2ZUUA 1DO6A 2PWGA 3BCDA 2P8PB 5F2FA 5BRQA 3VD5A 1UD2A 2VISB 4U0RB 3OG4B 2BINA 3CDGB 5CGYD 1X5HA 2BC4A 4PJXA 3SDCD 1TNNA 4Z7WF 4IK7A 4ONGL 4KXAA 3NRPA 1QKZH 1RK1A 3LKOA 4YDKH 2P44B 2XG4B 2QPEB 4OV6F 3IFOA 3HZKB 4TLUA 2DIEA 3P73B 2R27A 3FUNA 2BOLA 1MDTA 4WQOA 5TK4A 3RX5A 2W59A 4LOVA 1WFJA 1AQ8A 1WF5A 4YSRA 1MFCL 1VJSA 2ZP8A 3VM5A 3TBBA 1ID2A 5I6MA 4GMSL 4HFUL 1BD2E 1D5XB 3QUGA 1CDJA 1JVKA 5F9JB 4TNEA 3VFUB 2AJXL 1AS7A 3KDPB 1S7VA 4XVJL 4X9YA 5C0AD 3NJHA 3P02A 4GG6A 4LCVA 3BUYA 3OJVC 2K8MA 4L3EB 3SO3B 3M1BA 4F9LA 5DRNB 4YUEL 2B0SH 5EO9B 5D4QA 4OFIA 4XRCA 2IH9A 4DCQA 3QUML 5I71C 3OR6A 3BFWA 5AW3B 5GS2H 3RGVD 5B22A 5I6XC 3GMLA 1JK8A 2BY3A 3IRPX 5AZEL 4PBVC 3ZOAA 1YPZF 2BMKB 5I1DA 3QG6B 2VZVA 4XAKD 2C9VA 1NAMB 3NJKA 1UM6L 3NAAL 1GOGA 2YD8A 1Q0YL 4AYFA 5IUSA 4QWWC 4K2UL 1JD7A 1ICTA 3AADB 3DV6B 5IB1B 1OARH 1Z5YD 1YUKB 2KZWA 3G6DH 2VMCA 3FQUA 4PJ7F 2BNRA 3ZE2B 3HE6D 2J21A 4I0PC 1NCDH 2EE2A 5F9JA 2B8OT 3CFTA 2Y36H 3VI4E 4MMXB 4OBSA 1DQTA 3AXHA 4LDCA 1BQLH 3ARSA 5D8JL 3T2PA 2RIKA 4QHUB 4XNXL 3CVHH 3RFZC 32C2A 1JGEB 3ZO9A 1CD1A 3U30B 4LLAA 4FERA 3OKMA 1JXJA 3KYKH 5D7IE 1TPXB 2EIMB 1T0NA 4PV8B 2RAMA 3TLRA 3EOTH 2E5EA 3HR5B 2EEDA 2ZCLH 4KROD 4YMPA 2UZPA 1BEYH 3D25B 2BRQA 4P2OC 1GZQA 5LQBL 3WDJA 5K9OB 5BRZA 2NY2C 5HJDA 3QXDA 3KJ4C 1I7ZA 4WUUD 2SEBA 1D5ZB 1M9WA 1NMAH 4ZOBA 3U0TA 4YHLL 3RZCD 3MNVA 3H9SA 3PWVB 3QUKB 4D8PA 2I9LA 3OX8A 3VFWB 5G55A 2IH1B 4OZ4A 3V5DA 2V0AA 4GSXA 3BLKA 5BVJA 2Z1KA 4OT1H 4PJIF 4ZO6A 4U6VH 5IGXL 2V3DA 1B0GB 3S35L 5JW4R 1A66A 1AHWA 3BRDA 5JW5A 4Y16B 1WHPA 2B9BA 4MNQA 1NGZB 1EEZA 4U1IB 4YPGA 4XP4H 1LEGB 1D7DA 1UQSA 2FUTA 4LSQL 4BFGA 2UZXB 1IMHC 1F4WH 5EEZA 2J8UB 3FT4B 3THMH 1I85A 3L3KB 3ABLB 4IMKA 3QGVA 2XZQH 5K9OA 1VB9A 2J5LB 2VMEA 1KIRA 4HFUH 1RJZA 4FFZH 2YFOA 3ARPA 2Z7YA 1PLAA 3MRKB 3DIFB 3A6CL 3F12B 5T1MB 1ZPUA 4PJ5D 4GG8A 2WQRA 2XIIA 3OKNB 3VI3F 4L29A 3B56A 2E7LC 1QRNE 1YG9A 4G9DA 4OGYL 3RAJH 5BOZG 2VDQB 1B4TA 1ESOA 4ZYKA 1NLBL 2CO7A 3QFJA 3EG9B 2ZXEB 1DLHB 4MLSA 1WBYB 3LN4A 1UCBL 3QPXH 3SQRA 1CICB 1AP2B 5CP7A 4BZ2L 3DTDA 4QXTA 3RWIB 3L7FB 3O3BB 3SN6N 2FBJH 2R56H 4M3KB 3I6SA 4KDWA 3SSGA 4CBPA 1IKNC 1OTSD 4K7FA 5I1JL 4J3UA 2WNGA 1T5KA 2XI9A 3BW9B 1TMCB 1KYFA 1PD0A 1ORQA 2Q3ZA 4JLRB 4ZUVA 3T0EB 3WHE0 1WDAA 2VDPB 3A4FA 2XWTA 5FB8B 3K0YA 2OMWA 1HOCA 1JWSB 2A6DB 1CFQB 4ODXA 4F9PC 3ARTA 2MNUA 5I1DB 5I8CB 3T0WA 3R1GH 3QE5A 2BSEA 3ZKXC 4M3JA 2FJGB 2VQ1A 2OJZH 3R18A 5EZPA 4RGOL 4AGOA 4HEME 1N5AB 4XB7A 4APXA 4C56D 1KSRA 4QDGA 2PKDA 1U21A 3ENEA 3WFBL 4A2MA 5JQ6H 2VQ1B 3QW9A 1HYSC 1JYXA 1T66D 3CFBB 2H45A 4GT7A 4UQEA 2R69L 2YGVA 3C87A 4JGMA 4L4TD 2IANB 5JHDE 2BSCA 2EXYD 4ZW5A 3WY1A 3EOBB 4Z7OF 1I1AC 1QWUA 2E56A 1R5IA 3N9GL 4FCHA 4HXAL 4PS3A 4QY8A 2JJUA 5GGSA 3HC0A 5IQNA 5H2BA 5KBKA 4S1RL 4OLWH 2PWFA 5JR1H 2VDLL 1RJLB 3Q8CA 3QUMH 3LS5H 4HJ1A 2A74A 4JZOB 3P54A 3PL6C 2X7LA 1OGAB 1WJ3A 4PS7A 5BRZD 2JTYA 1U2CA 3V6OC 4DEWA 4JKMA 2HT2D 2L0DA 4ZYKB 4YDMA 2KI6A 5CILL 5C0DB 1UM4H 1M53A 1KJ3L 3CE1A 5JNYA 4NM8L 3QWOA 2F74A 3Q6FB 2NZ9D 1FIEA 4FMFA 4JN1L 5CZXD 4TVUA 1TQUA 1B6DA 4EN3D 2P7TA 5LG6A 1WGVA 2ZYIA 1G7MA 1A3LL 4GS7B 1JF1B 1B4JH 2NTFB 4KJYB 5EWIL 4HIQA 5C08B 3ZSSA 5DVKA 3QXWA 2Y72A 3H9SD 4CMMA 3G9AB 2R1YA 3F6IA 1PKQE 4F7TA 5ERWB 5AD0A 1QG3A 1HHHA 3QIWC 1CDCA 2GJZA 2VDLH 3GTVA 4XP1L 4F93B 4AQEB 3FN0L 4PJFE 1HZHH 2IDFA 3WL9B 1AHWB 3PJNA 3L9YA 2WWOA 2DIAA 1IAII 3D4ZA 1W8EA 4HW6A 4M7ZB 5LQBH 2CD0A 1B0RA 2VSKB 3QPQC 2PXYA 4ANXA 2F0CA 4FQQA 3RWJB 2BSSB 4K8RL 4KGJA 4PVLA 4Q14A 5D70H 3QISA 3AREA 1MIEL 5T3XD 2X3BA 1E6JL 2ICWB 5HGHB 4N90D 4KRMB 1AD9B 2DQJL 4O9HL 1PFOA 4IIQC 2XCMC 1I9JH 4JFDD 1UJ3C 3A4DA 3ZE1F 3BN9D 3GXMA 4U0RC 4WY7H 5C0IA 1A7OH 5JORA 1ZHKA 3DYPA 1DDHA 4FNUA 2Y7LA 3LIZL 1PNDA 4I8DA 1F6FB 5L4FA 3LKPB 5D7KD 4P2OD 2HFTA 3IFNH 2IIJA 2H4EA 3FQXB 1ACXA 4MBRA 5AVZB 1WHOA 3P4NB 4NNPL 2CJUL 3WHE1 5KAQF 2X4TA 4HWBA 5DGQA 5ICZA 4J39A 3GMPB 6CGTA 1KTBA 4WHYH 4PY7B 4HALA 5LCVH 2W92A 5KSBA 4DW2L 2X6AA 4FI6A 3FFOA 1WAAF 3LX9A 5EUOF 2IWGA 1BFOA 1ZSHA 4H88H 4XN1A 3QQ3B 2OQJA 4EUPA 1MFUA 1FO0H 5IREA 1HQRA 1TU2B 3TCLB 5EN2B 1QTSA 1ZT4B 3GSOB 5C0CB 1CF8H 3MGTA 5LB1A 4BH7B 3IWUA 2UYLB 2C8NA 5CP3H 4A7SA 2W9LA 1CT8B 2NXYC 4TQEL 5AAWC 3P9LA 2J5LC 3GQFA 4LL9A 4P9MH 2HFEA 4ELDA 3CLEH 3BVUA 1CQYA 4HHWA 5A16A 1R24B 3ILEA 1G7LA 4AEHL 2HUEA 3S9DB 5DD0L 3OLDA 5IQ7L 3T8MA 3ZZ1A 1XEUA 1I3VA 1V27A 4HETA 1KCVH 4FA6A 2E8YA 5EF3A 3SE8L 3LD8C 3WEXB 1IZKA 1QTYT 4XBEL 3DI2B 1UYWL 1EIBA 3EOTL 4PVBA 3M8OH 2EUZA 2WTOA 4Q6IA 2EYRB 3WKQA 4WU7A 5CUSH 2I60L 3GSNA 3UZEC 5JPMC 2Y22A 4HX1B 3T2NH 3ARWA 3LTVA 3L3OC 2B39A 3C60B 4FFVD 4DGIH 1NL0L 3ESOA 4KKLD 4C83A 2WWKO 1A6VH 2FTAA 1S7SA 3LKOB 3T04D 3X3GH 4F8NA 4H26B 2OMVB 4N6QA 4Y2OB 1F90L 2HFFB 3RBGA 2OMWB 4E41B 5PAZA 3WTXA 3KMDA 5G4OA 1ZKAA 3I6KB 1JFQL 1EJFA 3DMMD 4Z3GA 1GGBH 1X44A 3RNKB 2JKJA 3LS4L 1N59B 1UA3A 3HZMB 2Z65C 4QHNA 3BD4A 1OVZA 1GZPB 1E6JH 1W2KT 5KS9A 4XOCA 3SQBB 5SWSE 4F2FA 3RA7H 2CAKA 5I8OL 1T80A 4FJZA 3SGDH 1AP2A 1CICA 5CP7B 2N56A 4RGNC 1JZ8A 1S7WB 4U1JB 1JV2A 1KXQA 1A9BA 3JWNE 4IRJB 2XWBB 1P4LB 1DLHA 1R17A 2VXQL 4MA1B 2IEPA 2HLAB 3WJMB 2J2ZB 1RFDH 2Y7QB 4N6RB 1CGWA 1MCOL 3AABA 3CPUA 1U3HA 1A1MA 3QI9D 3QUXC 4Z95H 5DJ8B 1MCSA 3VFRA 2B7DT 3HUJA 1Y6NR 1KLFB 3FTVA 2YA0A 4NC0B 3T6ZA 3L9RA 1MZZA 1L5GA 3GXDA 1N3NB 2VDQH 2Z92B 3RTQB 1OGPA 1ODAA 1OT1A 4HS8L 4WEUD 4Y2DA 5FDWB 1WBXB 3RGVA 1E8ZA 5C1MB 4TNWF 2B16A 5AVQB 2Q8AL 2X4RB 5IWLA 1JNJA 1AR1C 3V4PA 3GO1H 1GW6A 3POHA 4JFQB 4UQIM 4N0YH 3HS0A 2X4QB 4LLYA 4FNTA 3FTZA 2HWZL 4MD4B 2Q7NA 1LQSR 1XR8A 4KK6D 5JLZA 5KS9E 1EEZB 3QQ4A 2F54B 3U0PA 1X9LA 2F1BA 1NC4D 3CNKA 4CILA 1R3KB 1F00I 1HILA 2VITB 5DUPL 1KXQE 2VDRH 4NFCA 5DEFA 3V6OA 4IBWA 1QSFA 3BHBA 4FQXC 5DFVC 1CFVL 4ZMTA 7CGTA 3AQDA 3BQVA 4CVWA 3VXOB 3S4SA 3DOSA 4WW1B 5AG9A 2X5PA 4GNKB 4WTXA 1ET7A 1TJHL 5DJ2A 4JQIL 2JLLA 3KL3A 4PSPA 3LEVH 1LNUA 4XI5C 4PB9H 3DURB 3CZLA 1F4XL 4TPRL 1HINL 4IOSA 1AANA 5DDHB 4BKTC 3ISRA 1VEOA 5FA3A 2ZKYA 5HJ3B 3NZ8A 3FCTA 2VABB 4YC2C 4HS8H 2HKHH 2CPCA 1AOZA 3WFEL 5H37H 2YJQA 4IRSD 4V1DB 3HOGA 3NIDE 2G4EA 1OP3K 4RETB 3IKKA 1LO4H 1XIWB 5I1EL 1CG9A 3CDCA 2VLKA 2H1PL 2OTWB 3GNMH 1XGRB 1KPUA 3P30H 5HHME 3ZDZB 5C7XL 3GMNB 4N6RA 4HF5H 1V7MH 5EZOL 4X8JB 3FS9A 1SYSA 3AG1B 4XNMA 3ARBD 2HKFH 2Q20A 2NR6C 2CDEB 4N2MA 3HE7B 3B2MA 4KNUA 2OULB 1LWHA 1A6TB 1MWOA 3D3VE 2YC1B 4ENED 4EUPH 4DQOH 1FFOA 3C8HA 4RSYA 4D0CA 3BH8A 1GZPA 4H40A 2KERA 2BSDA 1T0MA 3HKZA 1CI5A 3VG0L 3MLPA 2NSMA 4LNVA 5HHXH 3HVDA 4Z7IA 5DR5L 1JSYA 3FULA 4FFWC 4OLYL 1B4JL 1BBJA 2BOCA 2KDYA 4JHWL 3VX0A 3RA7L 3AXLB 3OXSA 5I8OH 4L0PB 2Y23A 1J0IA 4RFNB 3UAFA 3GS4A 4IBSA 2VLKE 3O4LD 4AK1A 1PD6A 4OQTA 3L9BA 4P5KB 4Y0GA 3H0TA 4GIOA 4XXDA 12E8L 1UWXH 4DPRA 5DGRA 4HUVB 1E9OB 3C6LC 1WZ1H 3ZGIA 5E8NA 2R1XB 1G6RB 2DWSA 1FG2B 4U1HA 4JMXA 2HCZX 3LIZA 2B1AH 4X4KA 2XN9B 4HCRA 4FHBD 2YQ3A 3SPCA 4RFOL 3GJEA 3SGKA 2XXCB 3VTMA 3MRDA 3UYPA 1VPOH 2APBA 5DUBA 3MV11 1XH2A 5FLUA 1J5IA 2XPYA 4JO4L 3ZDWA 5T33L 2JXMA 3IJSB 4G3YH 5AUMB 5K9KA 2F5AH 4MQSB 3KL5A 1DANT 1KCSH 3QO1A 1G5GA 2BIMA 5D2LB 1TYJA 4PRPA 5C09B 3RUGA 3KH4A 2EDOA 3V4VH 3DX9B 5HHQB 3KPRE 5DD5H 5DUPH 5EFIB 2ZYRA 1PG7W 1ZV5A 2OYMA 1QBMH 2WTRA 3ARGA 3MLTA 3TBSB 3V9FA 3BX7C 2JB5L 3O11B 1DUYA 4HD5A 4W4NA 2LFGA 1GJUA 5J89A 3DV4B 2FX7H 1MREL 2R4SH 4LASL 1MI5E 5FYJU 1R47A 2YQBA 3O6FC 5J1TC 5DVMA 4BFBD 1GYWA 3Q8BA 4TRPH 1D5BB 4HIEB 1G1OA 4K3JH 4BUHA 2VN6A 4YSPA 2DI7A 1KBVA 1OPGL 4X6BA 3KXFE 4N8CL 4NS0A 2Y6SC 5LGJA 3IFLH 3E3QE 1XAUA 1MCRA 3K3QA 4N8VB 4XP6H 3QB7C 1E3ZA 3HNSL 3MLXL 3ET9F 3Q1EA 4PCYA 4X0NA 4Z95L 3ME0B 3WFBH 3TBTA 4YHNA 5T33H 3O8XD 4OM0L 4KTEL 3L54A 3T1FB 1CE6B 4ZUWA 3PHQA 3EJTA 1S7XA 4NZUH 1KIUB 3OC5A 1CDGA 1OAKL 1UT1A 5TTRA 4BWTA 2IADA 1MQ8A 5AZEH 4JQXC 3C08L 5A1AA 1IEBB 4M4RB 1KXTA 4BZ2A 5HVFB 1JZDC 4G2AA 4QXVA 4FQHA 5EUOB 2WW8A 3ZYOA 1OE3A 2GY7B 3E9TA 4XO3A 3GSXB 5HP5A 4OZIA 4ZMXA 2ZXCA 4J3SA 5HHNB 5ETUB 1NLDH 2YPLA 4JY5L 1QSED 1AKJA 4FX5A 3RI5K 4D9RD 1BFVL 2NXYB 2X6BA 5SWQB 3QJFA 3TJEL 1YMHA 3E6FB 4CVXB 3DETD 3UG5A 5J57B 4XE5B 2V2XB 2YOAA 1U8QB 3QEQE 4R0LA 4Y9FA 3MLWL 1F3JA 1FLRL 3R4DA 4E41D 1KPVA 2DWTA 1A6ZB 2FEJA 5GRJL 1FC1A 2FWOA 5F89A 5BS0D 1H3VA 3PABB 4ZFQA 2WZ0A 1UJ3B