4X50A

Crystal structure of fimh in complex with biphenyl alpha-d-mannopyranoside
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title The Tyrosine Gate of the Bacterial Lectin FimH: A Conformational Analysis by NMR Spectroscopy and X-ray Crystallography.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
total genus 34
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4x50A00
4XO8A 5LNGA 4AVKA 2W07B 4AV4A 3BFWA 5AB1A 1N12A 5JQIB 4XO9A 4CA4A 2UY7B 4AUYA 4XOBA 5IQNA 4XOEA 5F3FA 5IQOA 4AV0A 5LNEA 2J2ZB 3ZL2A 5F2FA 1ZE3H 3RFZA 4BUQA 3ZPDA 3ZL1A 4X5QA 5FWRA 2JTYA 1KIUB 4X50A 4XOAA 3SQBB 4X5RA 3ME0B 3JWNE 4AV5A 1PDKB 4X5PA 2XG5B 4J3OH 1QUNB 5FX3A 4AUUA 2VCOA 2WMPB 5ABZA 1TR7A 4CSTA 3BFQG 3JWNH 1KLFB 1N0LB 4J3OG 4AVIA 4LOVA 2JMRA 3BWUF 4J3OF 4AUJA 5AALA 5AAPA 4ATTA 4AVHA 3JWNG 5FS5A 5CGBA 4XODA 4AVJA 3MCYA 4CSSA 1UWFA 5FLUA 2XG4B 2UY6B 5IQMA 4XOCA
chains in the Genus database with same CATH superfamily
3SSGA 3QR1A 2YSTA 4Q6IA 2R15A 3LY6A 4NERA 4FLSA 4P06A 2OMNA 3LRGA 4XO3A 3PP4H 2O4EA 3VMOA 3MZGB 2QTEA 1RCYA 2WTRA 2ZUXA 3CFNA 4JRXD 1N12A 2PWDA 4WF7A 5DC2A 2ICEC 4UUJB 4BFFA 1XGYH 1SVCP 3CBRA 4I1NB 4PJXE 5E2TH 3VRJA 1T4KB 4JAMB 3EJPA 5KSBA 4EDWH 1H5BC 3V2AR 5KYUA 3PL6B 4UTAA 4IDJL 3Q2CA 3X12B 1EZUA 4HWEL 1ORSB 5MEOA 3DRQA 3IDUA 1KCLA 5KJRH 2D4DA 5IVZB 1MCOL 1KTKE 4XMPH 3GWJA 2VRQA 2EVFA 5EDSA 4P5TB 3JTTA 1ULVA 4K7FB 4EUPH 4K7PH 2QGEA 4PJ8A 2EVHA 1O0VA 5CMAA 4PJFE 5E1QA 4Q7DA 2VJXA 4PRHE 3B8SA 1L7IH 4F5CE 2CK0H 3CFTA 4PS8A 2FLMA 4N22A 4MNQA 2J44A 4KKQA 5BRZA 4PJCE 4XPAH 2YAQA 5DEGB 4NN6C 3BXNA 4IIQB 3ZE2E 1K3ZA 3BKJL 1I1FB 5KVMC 5HD8C 3VW3L 3T65B 2P8MA 5L6YL 4MA1C 2OQJA 1FIGL 2XXMB 3AS0A 2ENJA 1KTDB 4F7PB 5TQ2H 2OMWA 3WY2A 1W0WA 2ZG1A 3QCVH 4HKJA 4ELDA 1ZT4A 4NQCB 3A22A 3AZUA 4PM1A 3FTSA 2FL5A 1M2VA 1ML0A 3FPYA 1T1ZB 5JW3H 2ZPKH 1OV8A 1RHHA 3GSQB 4BFIB 4JANA 4JN1L 2FDBP 3AXLA 4FFZL 2K3HA 2DYPB 2NR6A 1RMFL 1U3HC 5FDWB 5KVDL 5AAWC 4ZMNA 4NS0A 2NY2B 3ZBMA 4K73A 3KXFA 1WEJL 1RIUL 1SPDA 4HKZB 5C92A 3KR3H 3IKCA 2CO4A 5DLMH 2KYIA 1HQRB 3ABLB 3SDAC 4AVHA 2BSTB 1H8NA 3N43B 4ZMPA 4P4RB 1S5IL 2YOCA 4JE4B 5DK2A 4OSUH 2OZ4A 4UAOC 4P9HL 1HHKA 3GSWB 4M1DL 5L2KB 5I23A 3T0EA 1MCWM 5FLUA 1R0AH 4G43B 4L3AA 1JV5B 2F18A 2V9TA 5ELIA 1OF2A 3FBQA 3WIFA 1F86A 3PNRB 3CVHB 4LLVB 1VCAA 3WDIA 4BUGA 1TVBB 1KC5H 3BPOC 2VOTA 1JDAA 2BH0A 2UWEB 3AREC 4CVUA 3DV6B 1KB5A 3QIWC 3UAJC 1NPNA 1NPUA 4LO9A 4RMTA 3VFVA 1R3KA 4D9QE 2F8XC 3UAAA 1D7CA 1W80A 1A1MA 1YRKA 1SM3H 4TQEH 4QTIH 3LB6C 5FYJH 5IVXE 4IHOA 1USZA 1QR1A 1AO7A 4MS8C 2W60B 4XP1L 4JDZA 4QRPB 3KCWA 3T2NH 1FNSL 1C12B 5CD5C 1N18A 3OVUB 3VFGH 1I7RA 3SDYH 4S1QH 1XTLA 2GSGA 5INDA 2CHNA 1UG9A 2OL3H 4HAKA 3II1A 1IBGH 4P9MH 1H3PL 2FNWA 1A5FH 2P8PA 5D1XC 5LUMA 3DSNB 3BX7C 2VDQB 1GZHA 5CCKH 2GJPA 2DLIA 5KZCD 4DWHA 2R2HA 3DPDA 3QAQA 3LTVA 4XBPB 4RWHA 4Y9EA 1BXVA 3APMA 3O8XD 3F01A 4OU3A 1N9PA 3MXVL 4HJUA 4UM8B 2ZWSA 2WVVA 5DVNA 3OB0H 5DHYB 4KUCD 1G7IA 4WKZA 4DKAA 4AZ8A 4JHZA 1NFAA 2KPNA 4AENB 5HGBA 3ULVD 2ICWJ 4PTUB 5DQDL 4H88L 2VXTL 1CGYA 3DJZA 4ADJA 3TNNA 2PYFA 3N1QC 4LLWB 1V5JA 3CX5J 1KFAL 2F1AA 2O5NA 2G3MA 1JZGA 2QVIA 5IEHA 4UNIA 1N0LB 1UYWH 4PHXA 4KO6A 3ZYZA 1F58H 2NSQA 3CX5K 4P57B 3MUZ1 3FONA 4MNQE 1RZ8B 3Q6GL 3C5ZA 3FB5B 5BRZE 3EKCA 5AB0A 3ZKNC 1IJ9A 2R0LL 4RGOH 3QIBB 5FYKE 2P46B 2XVLA 2W0FB 5HSFA 2XXCB 2Y2WA 5KYWA 4ZQTA 4UAHA 4XMLL 1DQLH 1SJHB 4BJLA 2OZ4L 3EOTL 4E9WA 1OTTD 5B1JC 1L6ZA 2YOAA 4KKZA 3V4VL 1EA9C 4OLXL 4YBLB 3VMPA 4APQA 4S0SD 4Z5RA 1KEMH 3WFDH 3RPIA 4XVSH 4EZLA 5IESL 3BGFB 3QXAB 3P9MB 1DQJA 1YNTF 4OF0A 3HE6C 3E7JA 4MA3A 4Y88A 4EQ3A 1DVYA 4WFFD 1QNZH 1FLTX 3SEPA 5GS0L 3D39D 3MFFA 5CF3A 3ELAT 1Q38A 6TAAA 3TVMA 4CMMB 4ELME 1N59A 2ICEA 4JFHE 3VXSB 4F27A 2DWXA 3T0EE 5I6OA 1IRAY 4GKLA 5CSZB 3WNJA 4N8CL 4RRPA 3HB3B 3L2MA 5BOPA 3ARBB 1G1CA 1H5BA 2OSLB 5IOPA 1OP3H 2BVQB 2KQMA 2PLTA 4XOEA 6FABH 5BZWB 3VXRD 1ZIBA 1X7TA 2NXYB 4ZPTB 5D7JC 3D4YA 4PV8B 3UYPB 3O3UN 3K6NA 1FLRH 4KMQA 2GUOB 3PNWA 4BHUI 4P2AA 3VVWA 4O2EA 3DMMB 4HETA 1T5XA 3ES6B 3HKZA 4X9IA 1TSHA 1JN6B 3HVDA 2UY6A 3FCTA 1F0LA 3GK8L 1WFOA 4TVSa 5E00B 5D2LA 1RZJL 3HS8A 4MMYA 5F70A 1N4XH 5HDQH 2NSXA 1AO7E 2N1KA 5SWZD 1LEIA 2DQTH 3OAWA 3BP5A 4WCYL 5SX5K 1YEHH 5I8CA 2CD0A 3T3PE 1I7UA 1Z3GL 1SHWA 3QO1A 5G4NA 5HGGS 4IJTA 5DCCA 3B2VL 5TGBA 2N7SA 4FQXD 5EIIG 1T5KA 1JOIA 2VC2B 3WNMA 5I71C 1JMZA 3JWNE 3HE7B 4ZXBB 4CADB 1UD8A 5DC4B 1UUSA 3TZVB 1C8PA 4ZO6A 3C5SA 2DMHA 3K2UH 4OUUA 3VRIB 3MRQB 4YSCA 2E7DA 4MAYC 2XN9B 3RNQA 3VDBA 2PXYC 1U8KB 4QT5B 5LBGA 3BZ5A 3UJJL 5DYOB 1OSEA 1UEMA 3MGOB 1HDMA 4YXLH 1CC3A 4U1KA 1NGPH 1EDHA 4LSVH 4BWUA 4KKLD 1HILA 3CZFA 2JK5B 3DECA 4LL9A 4M62L 1I3UA 4N0CD 1AR1D 1OQOA 1EMTL 3UTPE 1T2QH 2EUWA 3B8YA 2DTML 1FH2A 1KIUA 4ZX6A 2AJVH 4XN4A 1OCOB 5GGSA 5EO9B 1ZSDA 4Z7UB 3QXDA 5AAWA 4WJ5B 4F15B 3O3AA 4MB5A 4WDIA 4I2XB 1UXSA 4DVBA 3CDYA 3SDAA 3AGVA 3EHBB 1R4XA 4L4JA 2VZVA 5IB4A 3VG0L 5ADPH 3RAJL 3I85A 4OIAA 3SY0A 3ECBB 3DYOA 4XHJD 4DT2A 1BVKB 4YHML 5KN5A 1ZHKB 2PCFB 3I3BA 5L7XH 1S9WB 3U6XS 4C4KT 3HMXA 5TD4A 1O7DE 4KTGA 3VG9C 2R23B 1DJXA 1R5WB 3UZQA 3TL5A 4KK9C 4L4VE 3MXWH 4ZFOB 1TTUA 4C56A 1P4BH 1RFDL 4LGPB 5C0AA 5DMKB 4KVPA 1MFEH 5JNYB 1USQA 1SBSL 3PE9A 2B3RA 4QXTA 1DQDL 1CDYA 5D1QD 5J56B 1TSRA 3AREA 4OVUA 3DXAD 2FQGA 3ZYOA 4IRZH 2MPAL 5T1KD 3GMPA 2EZ0D 5EC1B 3DX8A 5AVYB 3ARGA 1CIUA 1BQLH 4Q74A 3L1EA 5DQ9B 2CM5A 4FQQA 3WS3B 4XN5A 4IBUA 5JOPD 3V0EA 3WTVA 4U6HA 3JT2A 3RZCC 1YY9D 2LU5A 4NKOB 3COOA 3ARVA 3Q9PA 1EO8L 3QUZC 1P5VB 3T6QC 2VLMD 5DGQA 2OPCA 3V4PB 3T4YB 2YEZB 1FP5A 1EJFA 5D1XA 2FR4A 4FQJL 4K23L 1CF1A 4OLYH 2ADYA 3HOGA 1RZ7H 4DHLA 4LCCA 4ONFL 3D3VB 1KN2L 2B7DT 3DVGB 5TDOB 1QWUA 5I8OL 1O9VA 2BY1A 3ABKB 2YD7A 1XAUA 1MG3C 2WC7A 4ABVA 3R0MA 4I3GA 5ICZA 5IEKB 2NY7H 2IO5A 4PJEA 1FGNH 1WPCA 3O0RL 3KM1A 5D2LE 1BG1A 3KYKL 1KGCE 1KN4H 2WLJA 4JUSA 4LVNC 3BWZA 1IU1A 5FO7A 4HOXA 2Q2LA 3ZHLA 2QVKA 2WZAA 4FJYA 1XDTT 1MQ8A 2VW6A 2KL6A 2R0ZL 3D30A 2IALA 5DZLA 5DHXB 2Y7LA 1UACL 2XICA 4R2GB 4N2IA 1VACA 3ARYA 5DJYA 1MFMA 4HULB 3MRGA 3ILEA 4CRPA 1HHIB 2AEQL 1F02I 4FFYL 1HH6A 1Q9KA 2FAUA 3II3A 3T6XA 1NGXB 1I8UA 4NCDA 3CXHK 4XPGL 5E94A 1G7MB 4N6RB 5EBWB 2DYSB 3FT9A 4YQXH 2O72A 5ISZB 2XACC 2ZKXA 1ESOA 2Y07L 3CHOA 5B1JA 2A9AA 5KBNC 1WC7A 4JZOA 5M94B 2H32B 1YEIL 3PV6A 1O6TA 4WFGD 5DS2A 4A2HA 3UBXA 2WLLB 4XTRD 4AJVA 3E6FB 3MYZA 4QXVA 1G7LB 3QJOA 2EKSB 5GJTL 1UUNA 2NNXA 4WWNA 3TWCL 1ZVNA 3L3GA 1H8LA 3KG5A 5JA9A 3HE6A 2ITDA 4KKRA 4N24A 1NMAH 5DURB 3HJEA 3V52L 5ESQB 2QBWA 4XBEH 4QRTB 4YWGH 1FGVL 4WV1B 4JLRB 4F8TA 3HZ3A 4M4RA 2OFQA 1IT9H 3UJTH 3THMH 2I9LB 4TPRH 4C56E 1DO5A 5C0AE 1IIIA 1WBXA 3C2AH 2EH8H 3TT3L 4POYA 5D7JA 4N9GA 3V0DA 3TPUB 4NN7B 1KJ2H 4KUZH 1KYDA 2X3CA 4JG5A 5SWQB 3EOBB 4EI5C 1XGUA 2KPWA 2RQ8A 1AY1L 3IE9A 4N2EA 1Z5YD 1MVYA 1QFHA 2OMZB 3IJSA 2GCYA 1ZE3C 3NP4A 5HGAA 4OLWL 5HYJB 3MLTA 1RUAH 4QO1B 3BP4A 3B83A 3VA2C 1PX8A 1XSKA 1EERB 1S7SA 3PY9A 1ZTXL 4ZPVA 4A38A 4G8EA 2X3AA 3QWNA 3BVWA 2UXFA 4YAQB 1VKXA 2ENYA 3DNKA 2EILB 4W1TA 1T0NB 1DBBL 4M8UA 3MCLH 3KGUA 3LRSB 3S35H 5D1XE 4DJMA 1Q0YL 1KSRA 1EAPB 2XG5B 3K6SB 4MAYA 3OXRB 5I73B 4OZFA 2PXYA 1CD0A 5CILH 4WUUE 2BSEA 1RUML 3HRPA 1RU9H 1JE6A 3QFJB 4MA7L 5E2UL 5JHMA 2FBOJ 4A39A 1XGTA 3N3EA 3QDMB 3QRGH 4EN3B 1QTYT 1XF5B 1HEZB 4AWJC 1SHMA 3BSGA 3NCJL 3T0WA 4PJEE 4LP8A 3AU1B 1UH2A 4ODTH 3EYSH 3B7UX 4GUPA 1AACA 4QKTA 3TJEL 4FFTA 5AOLA 1B0GB 4JY5H 4R26L 2NRDA 4NX0A 4EUPB 2LFEA 1ZT7B 2X4RB 1CG9A 2IC2A 3QGVA 3SKOB 3CC5B 2D7TL 3WN5C 3IU3A 1QW9A 3FFCA 5B7MA 3MLVH 3QWRD 4XPTH 3WYRA 1GYWA 4TSBH 4ORZC 2AEPL 1E0OB 3MJGX 4FA8A 3MU3A 1A3LH 4WENB 3LDBC 1JAEA 1BMZA 1IKFH 4Z23A 4MNHB 2P5EB 3GHBH 4D9LH 5KS9B 1NUDA 1WICA 5HYSB 3MTXA 2ZOOA 4H2AA 2PMZA 4YHIB 2YFOA 3KWWB 3Q2VA 1FC1A 2LTQB 5GJSH 3TT1H 5HYQA 3GXMA 5JYLA 1WF5A 1R9FA 5FO8A 3RKPA 4M9OA 5AWNH 4HGWA 3RZCA 3GJFA 1SN2A 2VR8A 2W5PA 3QJRB 5CGYD 3I02B 2F9BT 1URLA 2QKSA 3P3YA 1UD4A 2ZNWA 1L9MA 2NX5D 1P9MC 1AQDA 4TUOB 1RVFH 1XBRA 3DARA 5CJOH 1I8AA 2IWFA 1T7XA 3C60C 2B1AH 4HISA 3IFOA 1YO4A 4JVPA 1JFHA 2MEJB 3O6FC 5C8JB 1BZDA 5IHHA 4I7ZC 2XY2A 1A6UL 3QEUA 4UQ3A 1I8IB 4DGUA 4U1SA 4HH9A 5ANHA 3LKRB 2I25N 4FQCH 1CLOH 4E0RB 4RGNC 3ME0B 5JXAH 4KTDH 2PUQT 4P23C 2QV2A 1QWNA 1FZJB 4H13C 1OAUH 1Z9SA 2DQCH 4P0DA 5JQHC 4M5TA 3VI3F 5EF1A 5CJBA 5JZ7D 5LGHL 3D0LA 3CFBB 3MLYL 2W59A 1PY9A 4OLUL 3LPGA 4JDTH 3B9VA 3CDGB 4YNYA 2QPUA 3IPEA 3WUWA 3RY6C 3HR5A 1LO4L 4MQXC 3T2OA 5BVJA 2RFXB 4PREA 1HHHA 4RSYA 4FULA 1JJUA 3DBXB 4X7SH 5L8LB 2CAKA 1YEFH 2OL3B 3EDFA 4JHVA 2CHXA 2H3NB 4IKLA 3HPLB 4EZMA 5DEZA 3TYFA 4OD2A 1F6LL 3VXMB 1AI1H 5ITBL 4ODUA 2BVOB 3RFRA 2F54A 1T83C 3JYBA 1MCQA 2WB1A 4B95C 3F7KA 4BSWA 4EO5A 5AALA 1EJOH 3TBWB 3BP7A 2QGDA 3WIIH 1VFBA 2C3VA 1RP8A 4LP4A 4MA8H 1OVZA 4PRHD 4WZ9A 3SE4C 1DHKA 5C6PB 2P43B 4HS3B 2A9CA 3PPSA 4FFWD 4GW5B 4LE8A 5EOTA 1HEJC 2QSVA 4EVNB 5FA3A 5ID1B 3W57A 2EDMA 4WW1A 1ILUA 2LHAA 3FRPG 1UVQB 1XIWC 4QXUL 5JPMC 1RSYA 2YXFA 3FFCE 5DJ0A 5F7MC 2WINB 4MS6A 1NICA 5JORB 1SHSA 3G9AB 3IGKA 2BJMH 5T1LA 3UG4A 2BNRA 3I9GL 3N6YA 4JM2C 4NLAA 5IQ9A 4KRLB 5KW9L 4YE4H 2X4SB 5E8EB 4OGYH 4RETB 4OCXL 1ROWA 1TZ8A 5I74C 2D8KA 1JGDB 1UA6H 1DLFH 4FYRA 1I7TA 1TZAA 2DEYX 2BSSB 3CPLA 3O6ML 4MZRA 4C58B 1HWHB 4EI5A 1OM9A 3BWUC 3OKKB 1V3MA 3WTUA 4JL2A 2BVTA 2NQ3A 3DOIA 3UO1L 1EXUA 4UV7L 2GHZA 2P5WB 1RUPL 4PUBL 1LWJA 3FB6A 3VFSA 1L0XA 3FUIA 5BUGA 2AQQA 5SWSB 4F24A 4GRLB 3NJLA 3EO9H 5DJ8B 1SLWA 4JFSA 4YBHA 4HCRH 1PSKH 4CW1B 5TF1L 4PJBE 3UJIL 1DQQA 4TOYL 1BZ8A 3MBED 2JB5L 2WQWA 2MCMA 1E8YA 1HHJB 2EICA 2VLJB 4DO4A 1RJLA 3DUHA 3TN0D 3WFHB 5CR1A 5E8OB 4X4YA 4D9QD 1QO3B 4F3FA 1E8WA 2ICES 3FMGL 3G6AA 1O6VA 1FG2B 2A1WL 5GIRA 1OTSC 4P99A 3OG6B 1B3IA 1ED3B 1NAKL 4UTCA 3FUMA 4OD1L 4ZYKA 3G9VA 2Z31D 4DP8X 3RA7H 2GEQA 1TVHB 5IFJA 2XWDA 1E67A 4ENED 2JB6B 1F8TL 2IPKB 3LNGA 4UQ9A 4LQFL 2FNBA 2ITCB 2AGJL 1AG0A 2D2CC 2JKIS 3D9AH 4NDMB 5AOZA 1ZRUA 2AW2A 1X7SA 2OX5A 4QJ3B 3O4LA 1P2CA 3CV5A 4JFEB 3IWUA 5DHDA 3TJPA 3WN5A 3WIHH 3SDCB 1T1YA 5E9NA 4K4KA 5E24E 2DS4A 3STBA 1FZMA 2VDKH 4JR9L 5C7XH 4HHGA 3S34L 1WJ3A 4JRWA 3BHBA 1CICC 5E5RB 1MCBA 3H54A 2DLTA 3X14A 4HUWB 1EBPA 2HX7A 4J3BA 4LAJH 4FKKA 2R0KL 4M6NL 2YRLA 1NBQA 2FX9L 3EYUL 1L5GB 4PRPA 4HJIA 3EYFB 2OMTA 1WHPA 2DQ6A 3CMGA 3CHSA 3I6GB 3K5SA 3LQZB 4H5SA 2J88L 3DROA 4Q52A 4NM4L 4MNQD 1H3WM 2KS0A 2ZUWA 3ZOAA 5BRZD 5LWYL 2OMYB 4XN7A 5KUKA 4N9OB 1ZGLB 3N40P 1F4WH 2J3SA 5FYKD 3FW6A 1F18A 1J9SA 3JVGC 1P9MA 2EIZB 3Q8EA 2IPTH 4MJ5B 1JPSH 3U46A 3N1PC 2BNRE 4TSCL 1FFNA 3C60A 5C0IA 4JMXA 2D4FA 3UTSA 2AJSH 4JB9L 4DZ8A 3O6FA 3S96A 3CIAA 5F88A 2A74B 5T8IA 2NY6B 4FKHA 1PD1A 1CFQB 2NR6D 3KMDA 1PVHA 5FUCC 1MCLA 2PP9A 2V4LA 3FU7B 3NN8B 3W82A 4B9KC 4M7LH 3IDXH 1NIEA 3BUIA 4R7NB 1MCRA 4NO3B 4NNYA 4UQ2B 2WZ6A 3I84A 1XMEB 2MCG1 1N6UA 4D7BA 1DANT 5FKAA 2CIIA 4HHAA 2NY1D 1HKLH 1YSOA 1KPVB 4JFHD 3CQPA 4M1GH 4P49A 3T0ED 3C8HA 5JDJA 3DO7B 3KVPA 4FEIA 3RY6A 4HD9A 4KUCF 3QCTL 5H94B 2HTKD 2Z0UA 4GKNB 3IJ8A 5AUMB 4CKQA 4NT6B 3ULVF 4H1LG 3PJSB 1I1YA 3C87A 2JKRM 1N5AA 3BEVA 3WMPA 1MH5A 3VI3B 5D4HA 1SXBA 2ZD0A 4F58H 3WFBL 1ZV5A 3D25B 3JT0A 2VLKA 1JHLH 2AFNA 2OM5A 5GS0D 4QYAA 2R1YA 3ETSA 4JY4A 1NIBA 3PUCA 1R3JA 4G8FA 1T83A 2XZZA 4OZHF 3ZKXC 4ES8A 3HHMA 2WKOA 1D5XB 3TV8A 4JDEA 2B16A 1AO7D 3REVA 3VM7A 2JNZA 2IDQA 5I1AB 1TEGA 1S7XA 5TH2B 4KMTH 1QBLH 4HJ1A 2X4QB 3SE4A 1ZVSB 2V7NB 1GMIA 2OJEB 3ZJAA 4OZGA 1M05A 1MW2A 2A77H 5ABDE 1BLIA 3HI1A 1OP5K 4UQBA 3KS0H 5AKRA 4L2LA 3TBVA 2Y7MA 3O4LE 4I87A 4Z7WE 2XTJC 1XIWA 5HHME 5JPMA 4OCSH 3G08B 1N7ML 2G60H 1FPTH 3FSVA 2AV1A 4K8RC 1QWHA 2KZKA 3EYOA 2CPCA 3FPXA 3VD1A 4NGHL 2B4CC 1TJMA 2WVTA 4XOCA 4GW1B 3MOAL 2BCMA 4JM2A 3NA9L 3EYQD 2FT6A 2XYCA 4IOSD 3UTPD 2D3VA 2NXZC 3OKNA 3CXDH 2WBJD 3PGCB 4DN4H 1PKQA 4LRNH 4MB4A 2CCWA 1AS6A 1QQDB 3ALWA 3VJ6B 4PRPE 4OR1A 3SE9H 5H4ZA 1U2HA 2EABA 1DFBL 1RD6A 2CO7B 3VGAC 2Y36H 4EIUA 2LE9A 4A7GA 4I77H 4DUXA 4JRXB 5EIQA 3C5ZD 2O30A 3FT4B 3KYNB 3I6LE 3FFOA 4IU2A 2ZAHA 4RMUA 3V6BR 3WO4B 1CR9L 1XZWA 4OCRH 3Q01A 3G6DH 4XP9H 3RFZA 1TQBB 1YC7A 4Q0XH 2WXOA 3IF1B 4L4VD 3J7HA 2RB8A 4F92B 4ZI8A 1JGEA 4PAZA 2YGNA 4KITB 2BDNH 2EO1A 4PJ7F 4S1SL 4IMLA 3BCDA 1ETA1 3GM0A 3K5RA 4PS4H 3UTSE 1JNLH 1NCDH 5GS1C 4S1RH 2Z91B 2VO8A 2HKHH 5I30L 5GRUL 1UCBH 4ZO7A 2J5LC 1MFAH 3RNKA 3APDA 3CHQA 1D2OA 1JV2B 1U92B 2AJZB 1XH3B 4MD0A 2DI7A 4OFIA 4UDUA 4BK4A 4K3JL 3CFQA 1HOCA 3FUDA 2YBRB 5LBVA 1U41A 5IGXL 2HFFA 1KJ2B 4E9XA 3JV0A 2W9LA 4D0DA 4DQAA 3CH1B 4HK0B 5F0MB 3TVMD 2D9QB 1R47A 4X99B 1OEZW 1A9EB 2J6EH 2GJ6A 3IRCA 1DUYA 3GEFA 4LKXA 2ZJSL 3A6OA 4Z0XA 1IB5A 3V6FB 1IVLA 1U8JA 2UZXB 4ZFZB 4Z0BH 5FGCB 2DQUL 4ALAC 1W8EA 1XO8A 2UZPA 4OM1H 5DJCB 1OHQA 4IK7A 2JMRA 1YQVH 5ETUA 2LABA 4AEHL 4PWFA 1XSIA 2FZ3A 1BJMA 2H45A 4O2FB 4FKEA 4JDVA 2EDHA 3BP6A 4XO4A 1JK9B 5T1MA 2VLKE 1XV8A 4WWKA 1QA9A 1CICA 3LXCA 5MI0C 4MCZB 2L8AA 4LIQL 1NCIA 3OJVC 4N0YH 5GGTH 1KGCD 2X5PA 4XC1L 5JO5A 2E9GA 3R0NA 4ZD3L 5EBLB 2RQEA 4XMWA 4HIHB 4LNVA 5DD6B 4XNXH 4OJFL 2QKIB 2A73A 4IGBC 2ED6A 3NABH 2DZEA 4N0FA 3S36X 1KJVB 4OZGE 4IKIA 3KPQB 2CGZA 3MV11 3ALPA 3X11B 5MERB 1MFNA 1QI3A 1HIMH 4RZCB 1IGJB 4LIQE 2D3LA 3BAKA 3IDMA 4LLDB 2BOCB 5AVXB 4ABUA 1N5YH 4WK2B 5DFWH 4KX9A 5G4OA 4UILL 3I50H 2R0WH 1VCBC 3G6JE 3C5JB 3I9AA 4JO1H 2HVJA 3MRMA 1KENH 3PYCA 4XVUD 4DGVH 4XRCA 3L5IA 1PKQE 3FCSB 3GO1L 2C3XA 1NBVL 4ZMAT 1A0QH 1S3KL 4Z7QF 3QHZL 4B7IA 4B3EA 3VWJB 3OAUL 5T3ZE 3JTSA 1AVAA 5C9JB 2OI9B 3BYYA 4HV8A 3MREA 2DIBA 3HEIB 3S3DB 4KK8C 1OPGL 1F42A 3SYPA 3FFDB 3ZDWA 1UM6H 2BK8A 5IM7B 4YDIH 1COBA 3SHSA 1YEDA 3IFNL 4DOHB 3HZVA 4PGCA 4RFEB 1L9TA 1FF5A 3L9RA 3QUYC 2WM0A 4X7TA 1BFTA 4AIZB 1IGIL 2X2HA 4M6ML 5ICXB 1YJDH 4C56D 3U2IA 3WLBB 2EDBA 4UTBL 5C0AD 4AUUA 4N0RA 3DOSA 5KZCB 4EI6A 5EU4A 2VABA 2HLFD 2QQNL 3QULA 4FXTA 3ARED 1IKOP 4G2AA 4OBSA 3KZ8A 4E9VA 1WIOA 4C4KO 2HX8A 3Q13A 5J12B 3WTYA 1NUNB 4KNUA 2O5XH 4Q14A 4XX5A 4G8GA 3ARGD 5DO2C 3INOA 4Y8AA 2G3XA 2YC1A 4XC3L 1K85A 4BFJA 5CWSB 5EA0L 5KSAA 4E9TA 2F74B 3BO8A 5D7SH 5C70A 1H0DA 4GO9A 2EE2A 1CE1L 2BNQA 2GJ6E 5DK3A 1THAA 2P26A 1TTGA 2CE6A 4OZHB 1A6ZB 3NMEA 1CDBA 5D1XD 3L2NA 5HJDA 4O51A 5EV7A 3LZRA 5E08H 2EYTA 3HFMH 3PXLA 5IJCC 5ES4B 4WUUD 4XPFL 4Z76B 3MCYA 3GLEA 4F8LA 1YNLL 2B08A 4RGMC 3MRJA 1P7QA 4QJ4B 2HAZA 2XFXA 2CDFB 1FO0A 1BQ5A 1A4CA 3FQRB 5EU5B 4LU5L 5EZLB 3EDKA 1SGKA 2HVKB 2VAJA 1MI5E 2QDVA 1MAMH 1OY3B 2HWZH 3F83A 5F6IC 4ZDHA 1JRHL 3GIZH 1E7UA 4D9RE 4F37F 4PRAB 1NGZA 3S98A 5IW1A 2A2QT 1WD9A 1H15A 3IRPX 4D2NA 4GO8A 4AYEC 2J57A 2E46A 3T1FB 1JXJA 1E40A 2BSBA 4JHAL 2I07B 2AAAA 1IEHA 3D39B 4QAWA 2ARJQ 1WEJH 1RIUH 2IH3A 5AQ0A 4JFYB 5DRWA 3K6OA 3LN5A 4G80A 3ZKND 3F6IA 1OM3H 4AG4L 3KNBA 1MCNA 3CVIH 4N2LA 1S5IH 3GMQB 3PFUA 4IRSC 4HFWB 4UCFA 1BJ8A 3W0WA 3QB7C 4DK5A 5JLZA 2E9BA 2VO5A 3EYVB 4UT6A 3VXRB 1VJSA 4GT0A 5EUKA 5CFAA 1XF4A 3DRTA 4U1IB 5IB1B 3P11H 4I5BA 3ZUNC 3EDDA 2N59A 4FDWA 2GFBB 3HNVH 1HXMB 4I18C 3RDJA 2YD5A 3BVNB 1BX2A 2OSWA 4IS6A 3SDDC 5CEYA 2IXQA 4JGUA 3ESUF 4X9YA 4AYMC 2YEQA 2BLFA 1T22B 1T20A 4HXAH 5CN3A 2CRIA 4PJ7B 3HE6D 3CFCL 5CKAA 1QFWH 1UJ3B 4XP4L 2Y6SC 3DX9A 5SWZB 3QYCA 3STZB 2GK0A 2A6JA 1DL7H 5FFOA 2K9FB 4AQAA 4UTAH 1QUPA 3ARDC 1RL1A 3V9EA 3NFNB 3VRLE 1B4JH 1IC1A 3UADA 5DI8A 4GIOA 4Y1AB 4MVBC 3LRKA 5K1VA 2X4TB 4LLYB 4YSSA 1WBYB 5TPWL 2V0AA 1UZ6F 2I7OA 4YEFA 5KAQG 1U58A 4QD2E 3W37A 1ZA3B 2WCGA 1N8ZB 3BSZA 1CE6B 4M43L 1A1NB 2F1BA 3NIDF 1AGEB 1WAAA 4F20A 2DJ4A 4ZUUA 1UGKA 4ZJ9A 2WLYA 1YPZE 2VDRL 1FYHB 3C6SA 4BQ8A 4YDLB 3RIKA 4Y5XB 4IBVA 1AR1B 3TFBA 4G8GE 4QHPA 1JZJA 3FQTB 4M4PA 1BFSA 4BBWA 4L5FL 2EO9A 3UZVB 4K8RL 3P4NA 3QDHA 4GB9A 4UQEA 1M42A 2BS71 4PGDA 4TUKL 2B4CL 3SQRA 1OSZA 3H3PH 3L3IB 4IGBA 4Z3HA 3KBPA 5AOMA 2BNQE 2YPVA 5HP5A 4WEBL 4L8CA 5KVFL 1JYXA 1GTNA 4BA8A 5FYKH 1FHNA 1FO0L 4GS7C 3B2DC 2WKGA 3NEXA 2CO6B 1DBAL 4AJYV 1SDYA 3JWDC 3F6LA 4IRJC 4JPIB 2XTJE 4UZGA 4CSZA 1D5BB 3RWJB 4U3CA 1NSNL 2BSED 4QTHB 1RSFA 1KCUL 3CFJB 4ZUSA 5DUJA 1GOHA 2Z92A 4M3HA 1SVBA 5LBSA 2WGXA 2NSMA 4HJ0C 2D7QA 2X87A 5ESAB 1KNOB 3HCVB 3NZHH 4MSWB 3OGCB 3RVUC 5D1QB 1MJUL 2CXGA 5CD3B 8FABA 4XZUA 3QQ3A 1A7NL 4XMLH 3DSFH 3GMMB 2CRMA 1KIRA 3CLEH 4BQ9A 1FNLA 5T1KB 2MHAB 4YSDA 3V79C 1MNUH 1LP9F 2A83A 3WI9A 5IMKA 1V7ML 1KG0B 3ATEA 3EFDH 1K5WA 3A47A 1TQVA 1I8MA 3SYQA 2WO3B 1NAMA 1OP3K 1U8HA 1U8CA 4A55A 4HSAC 2J8UF 2BY2A 1TTCA 3GI8H 3DGCR 5F6HI 4JFWA 5AL8A 5DRXA 3STLB 4URTB 4J27A 2AABH 3FFCD 1GCYA 3MNWA 4YDMA 1L0PA 4LSQL 2A0LC 2AXJA 3AQXA 3QUYA 3RG1C 4MMXB 4Z7QB 3MAWA 1KB5H 3DV4A 4HAFA 2X6BA 1EVTC 1DLHB 3W0WE 1ORQA 2VUOA 3T77B 4WK4B 4IW4C 3OLEA 3ZT5A 3SO3B 2VN7A 4B5EA 3AACA 4XCNA 4S2SA 4KNQA 4HLZG 3SQOH 1L0YA 5FHAL 1WH0A 2BINA 2WXPA 3NRPA 3EJQA 3U79A 4JPKH 1TKWA 5FGSA 4ALAL 5D71H 4PJXF 5D9SA 3BVXA 4XX1E 3ULAB 3JWNH 4ACTA 3GSUB 3MRCB 1OALA 2AXFA 1TQCB 5C6TL 5ALCL 3BIAX 5CZKA 1RJYB 2D31A 2J6WA 1RUQH 2W80C 3TXAA 2YRZA 4W81A 5DJZA 3KYMB 3P4LA 3UMTA 1G9MH 5E70A 3IDIB 3KJ6H 2JJTA 3FF8A 3PWUB 2YA1A 4BSVB 3CFDA 1EO7A 2XDHA 3OPZL 4WHTB 1NANH 1GY2A 4HJEA 1GPOL 4PJFF 3QUMA 1DANU 5L4IA 1AFVH 5I18L 4MD5B 4GY4A 1WAAE 3DOHA 1ZSHA 4JJOA 3GI9H 3NZSA 4PIRF 4Z7OF 4DKEL 2GSIB 4GFTB 3W39A 3NG5A 3PWNA 4G59C 4HSCX 4BZ1H 2X1OA 1UXMA 3NPZB 4MZIA 3FRUA 1ZCRA 3JQOB 4PJCF 1INDH 3W81A 4M62H 3ZE2F 2G9HA 1URIA 2HJLB 4URKA 5LBSL 4LVOC 4H0HB 4LLQA 2QFRA 4G8AC 3L6FA 1KUMA 2D73A 3CSYA 5IB5B 1KIPA 4Z77B 4PJ9C 4U0QB 1X5XA 2X44D 4TL4A 3RWIA 3T71A 2PCXA 4M61A 1AMXA 4AMXA 3UAFA 2YAHA 4ZMVA 4NZFA 3II2A 4BUHA 5B1AB 1LK3H 1NAML 4BELD 2AV7B 4Y9GA 4I0CC 4HX1A 2BHZA 4IRSA 1JVKA 4CUCA 4GUCA 4HZLB 3ZVVA 2IIJA 3DYMA 2R39A 5FUOH 1VFAB 3V5KB 4ZMYA 3P9LB 5E7FA 4GMSL 2CKBL 1QATA 4Y2DC 3L7EB 1BEYH 2Y06L 2XFGB 3GLZA 1QBBA 1GSMA 2Z4QB 4I18A 5FWRA 3FQ4A 3SDDA 5IB2B 3FC8A 4FE9A 4UANA 4OCWL 3HUJA 3ZT7A 4DERA 2ZKHH 1MRCH 5EORL 5JIHA 4KV5F 4G6FD 4KKAC 1NCBH 5F8RC 2DQHL 2E5EA 4RISL 3E9TA 4MJIA 3P4MA 1QSEA 3R8BB 3UP1A 1ZA6B 4O9HH 1TQWA 4ONGL 5DT1H 3QEGH 3UTQB 5KG9A 1MJ7H 1QBAA 2O1AA 2R29A 2Y72A 3DTXA 5F1IB 5BUPA 1AKJA 4PJ5A 3LEXB 5T1LD 1JFQH 1SNRA 4A2EA 2F8OA 3NZ8A 2BNRD 4JZJB 3WTXA 3AG1B 4I88A 3L4ZA 4G6MH 5IVXF 4X0NA 2BIIA 3VYPA 1UA7A 3HMWL 5GSRA 1MCHA 1OAXL 1U8OB 3HBZA 3C2SA 3O2WH 3QS2A 5JR1L 5E4AA 5E2VL 3ZN6A 4EI5D 1U8PB 4WW2C 1ZVYA 3O3EB 2FBRA 2MNJB 5TDNB 3Q1SH 2CZNA 2H1PH 1I1RA 4C83A 4MX7A 5LCVA 3RVXC 2G3NA 2Y22A 4GAAA 3KJ4B 1A02N 1OAZL 3UACA 1U8QA 3NIDB 1IMHC 1BYNA 4K5LA 2FGWH 4U1NA 4XMXA 5D1ZC 3GMLA 1DR9A 2VXSH 4AXWA 5J1SC 5C3LD 2X2IA 5FOBB 2ZXEB 5HHPB 2R4RL 1A6AB 3SPGA 3KYOA 1SZNA 2Y1AA 5L2KA 5D55A 3WKQA 2ZWNA 1JHTB 4XH2A 1MLCA 2OMUA 4UNUA 1QFWI 2I27N 3W9DB 4JCWA 1ZOXA 2CJ3A 2H0PA 2Q5BA 3QR2A 5L2JA 35C8H 4PJHB 2ZG3A 5AVZB 1MPAL 4PJGB 2CGRH 4RAVA 4DKFH 1L7TH 3QO0B 2XT1B 2P45B 3AU0A 3TV3L 3IMUA 1BBJB 4XPGH 4UU9B 2WWKO 5J0BA 3F58H 2XRAH 3VFPA 2PTUA 5HPMB 4L8DB 1IC4H 2V7HB 3IETB 1FWXA 1N6VA 1WBZB 4TF4A 5E4OA 2W9DL 5L4FA 1IGYA 3HMXH 3P02A 4YN3A 4ICXA 3WEXA 1MLBB 1BQSA 5DFVC 4G9FB 2OMXB 1DJWA 4Q9CA 3MJ9L 3O4LD 4KRPD 5HHMD 5LXGL 3GSVA 4MZ2A 5G5DB 2EE6A 3V9CA 1TG8A 1NGYB 2FUTA 4NP4H 1LP9B 4Y7MA 3DIVA 1GGCL 2GJZB 2PPEA 3G5YA 1JF5A 4GG8A 4YIQB 5G55A 4Z7VA 1IQDB 4J8RB 2JF1A 1CLCA 3RQ3A 3MODL 4HT1L 2PKDA 4XE0A 1G7PA 2O5YH 2Z3FA 4OFPA 2J8UB 3SQBB 5E1IA 4Y7OC 3RVWC 2YWYA 3FQYA 3GKWH 3UP6A 3D0AA 2OBGA 5LO7A 3TF4A 3RL1A 2WUCL 3WELA 2R29L 5J11C 4ELMF 2Q3AA 3B3IA 5DHYA 3TT3H 3WNIA 1I8KB 4FLHA 1DVFC 4PRPD 5ABZA 1U3JA 2ERJC 3HUJE 5IHUL 1GW6A 1GHFH 1Y7VA 2CKNA 2F19H 2XZQL 4R4NC 5A3IC 1JCVA 3LMJL 3NSFA 2ITFA 4QRSB 3P3TA 3UCRA 5IV2A 4A6YA 2EXWD 1XZ0A 1ZT1A 3I6LD 2OJZL 1JUFA 3G5VA 3RUGA 3VU1A 4OLWH 3C08L 2BRRL 2R2BB 1KJMA 4PJXB 4J3OG 4PJAA 5JHLA 4NWUH 3E8UH 3NEEA 5LCVL 5MEPB 3TO4D 1IGFL 3VTMA 3NPSB 3K71A 2BNUA 5BJTA 1YLBB 1MWAL 2B5IC 3FOLA 3UTSD 1W72H 2YARA 1ZANH 3BI9X 4D8OA 2X6VA 5FCUH 1BFVL 2AXGB 2NY4C 3O6FD 4NUGH 3GGWB 3KL3A 3QQNA 4HFUH 4Z95L 3T3PF 3T2QA 4DP9X 2KERA 4ZTPH 1JZ8A 1Q0YH 3EG9A 3ECWA 3ZRSA 1OP4A 1U6AH 1S7QB 3JWDL 4QWWC 2W8CA 3VQ2C 5KSUB 3HN5A 2EIKB 4R8WL 5GGRY 1DBJL 2DQGH 4ZFGH 3FQ2A 4BQBA 4HKBA 1XGPA 2XG4B 3KCPA 2YSSB 4PJFB 2EACA 3RI5K 3BZEA 3S7GA 3IJHB 4NFBA 4KKNA 1QEWA 4Q9RL 2HLEB 2B0SL 3GUTA 4Z7OB 4X8JA 4XCCL 2PW1B 2GITA 3H0TB 4NQXA 4NENA 4BV1A 2XPZA 5IHBA 3U9PH 4ORGB 4PJCB 3JBG7 1S7UB 5L2KE 1L6PA 4HS6A 32C2A 2WXKA 3ZE2B 4ZTEA 2VDLH 1SLVA 3U0PB 3EJYC 1J8KA 4P59H 2VLKD 2X4NA 5JW4R 3K8KA 1ZK9A 2Y1YA 3QC6X 2QPEB 1TOXA 4NSKB 4XNUH 4YFDB 5DJDB 2UWEE 2QFPA 5JHDB 3NGBC 4FJ6A 3FSOA 1I9RH 1JNHB 2IMNA 4QHNA 4KU1A 4HPOL 5E6UB 2K9UA 1U9KA 2CLZA 1MY5A 2DI9A 1IX2A 1PLGH 3QAZC 2IV8A 5DHVB 1NANI 1RY7B 3W56A 3MCG1 1FVCA 1I9JH 2HRPH 2P48B 3VB9A 1MWOA 1MCWW 1YDPA 4N2KA 1UA3A 2NTFB 2AXHA 5CGMA 1KZQA 1CTNA 5F93C 1ZEAH 5KJ4A 2BIHA 5TFSH 2CDGB 4N28A 1E9QB 2HH0L 1IEAB 5E4EB 4F33A 2V9UA 1M1SA 1K72A 2G2NA 2FJGB 4Z7VE 2HJFA 1AZRA 2WZ5A 4AC4A 1V7NL 1BD2A 1ACXA 3RL2A 3RTLA 3VO0A 1CFSA 3IAQA 3M17B 4JM2D 2W88A 4U6VL 5CCJA 3RWFB 5EOCL 3BMWA 4HJGB 1KEGL 1I53A 1I4FA 1EEZB 2Z1KA 5ID0B 4O2CB 5J13C 5BOJA 1F5WA 5JHLL 2I60H 2GC7C 5T3ZD 2QR0A 1FFPA 1E5ZA 2ADFL 3BQVA 1KXQE 4X8CA 3UROR 3VM5A 4F7KA 3L16A 3QYNA 1Z9NA 4Q6IB 5IVXB 3UL4A 2HFGL 3WAJA 2WTRB 4N3TA 4I48A 3FB8A 4OF5A 5CBAA 5HHXH 1SUJA 4IM8A 5AD0A 3RUGE 3BAXA 4B9GA 4OZFH 5D1ZA 2VDOH 4PB0L 1IAMA 5GXBB 4PJAE 4P46D 1OTUC 3MRLA 3VRJB 5KSBB 3QR0A 4QUOA 1EK3A 5KYUB 4NZRL 5D2LF 3IFLH 4JQXC 1JZ3A 5IMLA 1YNKL 2BCKA 1K8IA 4LXFA 4DPAX 3DRQB 5AW4B 4CJ1A 4J28A 2MQCA 3O45A 5HDRA 1SOQA 2WY3B 3BKYH 3CPUA 3FNKA 3V95A 2CUMA 1JCKA 2CDEA 2WWMC 3U30B 3ZRFC 5I1JL 2BFGA 1ANUA 3JTTB 3S4SG 2QVFB 1JHKL 4K9JA 4NNXA 1TLMA 4KI1A 3WFZA 1G43A 2M83A 4PJ8B 1KBVA 3S36H 5CMAB 1NINA 1JL8A 1MHEA 2VKWA 4I3SL 2O5ZH 1TTAA 3GXPA 2XWTA 3HBGA 5D2NC 2GJ6D 5ACZA 2DH3A 2ILLA 4OZIA 4G3YH 4JHWH 1MXDA 4UZSA 4MNQB 3L9EA 3MLXL 2JELH 4OCMC 5BRZB 3VUAA 2ZX8A 2W0PA 4G7RB 4HG4J 4PSPA 1Y18A 3BXNB 5KBMA 4KFMA 4K5NA 2HYMA 2OR9L 2YAPA 2P8MB 4NKQB 2QADD 4NRYA 4ZS7L 5CJ8A 5KBKA 5DQJA 2OQJB 4JO4L 3FH5A 4WWKD 1MCPL 2OMWB 1CICD 1W0WB 4HC1H 1C5BH 4HG4K 2OTPA 4HKJB 1ZT4B 1A2YA 4PW9A 4YSTA 4LGSB 2FL5B 1M2VB 2GJJA 1H6UA 1CZ8H 3HG3A 1RHHB 3B7RL 4I1RA 1MI5D 5IROC 4JANB 3AXLB 4FCHA 1MEXH 1KMGA 4D9RD 2VM3A 1K6QH 5F3HA 5KW9H 4S10A 2L4OA 1TO5A 3KXFB 1DVFA 1DP0A 3GJFH 4YEEA 3FTVA 3IKCB 5CKGA 1TLKA 3HLKA 4HPHA 3MGAA 3FK3A 2OYLA 4NJ9H 1JYWA 2ESVA 3P69A 4HIXL 5DK2B 2RGSA 1KELL 3QZBA 4AW7A 3QORD 3QZWA 3OKEA 4NAJA 3D2UA 1HHKB 2O61A 2NY1B 3DWTA 4LCVA 3T0EB 5E1GA 4PGEA 4HAGA 1G1OA 3MNMA 4ZO9A 3LH9A 1CO1A 1OF2B 3WIFB 3P0YH 4Z3GA 4NZUL 5A2FA 4KTEL 25C8L 2XN9E 1HAWA 3GYRA 3FUEA 4JN2A 5HHVH 3VFOA 1L3NA 1KB5B 2D2OA 3VFVB 1KXVC 1R3KB 5E6IA 4WSKA 2XUWA 43C9A 3H42L 4P5MA 1A1MB 4Y4HC 3NIFF 5I26A 2VERA 3ULUL 4NN5C 2H2SC 4U1LA 4NNPL 4X4ME 2V2WA 3ZY7A 4IHOB 5JMRA 2XQYA 1QR1B 1AO7B 2D7OA 4FP8L 4JDZB 1U0QA 4Z7UE 4FHJA 4CSSA 3IXAA 4FX5A 5L8JB 1I7RB 3T3PB 4PS7A 2GSGB 3DURA 4ZAKD 5INDB 1S9XA 4BEIA 2VNCA 2PCYA 2ZYRA 2WXQA 1ZHNA 3CHRA 2C9AA 2P8PB 1ASOA 4PJEF 4W4NA 5TE7L 5I6LA 2WBKA 2J8OA 2P3YA 3T4AC 4XVJL 2R2HB 1TU2A 5HYIA 3K8MA 3PF2A 4G42A 4MNGA 3FF7A 1EAOA 2X0VA 1YAZA 1XD1A 3JV4A 2WVVB 5F0LB 4UOZA 2VQ4A 5C0CA 1EIBA 3MKKA 1G7IB 4WKZB 2VN5A 3KPPA 4K5PA 4G8GD 5CP3A 4AZ8B 5HGBB 4JR9H 2P80A 4LEBA 4FABL 3GMRA 5KSAD 1BXAA 3TNNB 5IFHH 2PYFB 4KVNH 4YHLH 1NBYA 1ZWIA 2ATPA 4KC3B 4TL5A 4EF3A 2BY3A 3L5XH 2X09A 3KDPB 2BNQD 5AW5B 2HJKA 5IEHB 4OZIE 4ILDA 2X70A 1QFOA 3MRNA 2XV0A 5I0XA 2APBA 4P2OB 5LN8A 4BZ2H 3A6CH 1TCRA 3FONB 4MKMA 4EBQL 2JLPA 2XTJD 3C5ZB 3Q48A 3TIDA 3P2BA 4MMZA 2ZG2A 1DJGA 1BWMA 1YUHA 2VZSA 1CLYH 4OIIH 1OZTG 1RZKH 1MFBL 1NFKA 4HS8H 2Z65C 5KYWB 1DSYA 3OGOE 4BKLA 3MLRL 1E30A 1P7QD 5KBPA 5EIVA 4PYHA 1IFHH 4FNLL 1FSKC 2ARJA 4LESA 2XQ0A 3Q05A 3IMVA 1RK0A 3PGDA 2EH7L 2NXZD 5BO1H 5TDPA 3ZE0E 2Q6WA 4A63A 4HJSA 3QDMA 4GAJL 1AIZA 4APQB 4TSCH 4Z5RB 3RPIB 2C9PA 4DN3L 3C09B 3FUFA 3SKMA 2I5YH 1DSFH 2Q7YA 4CN1A 1DQJB 5K39A 4MA3B 1IAIM 3N9GL 3UBXI 4W9EC 4NKIH 1CDJA 3AFLA 2ESVE 4I4WA 3MFFB 4FNPA 3QG7L 3TVMB 2FD6H 1N59B 3VH8A 3PP3H 2ICEB 4EOWH 4FQ2L 4K2UL 1EHLH 4WU7A 4AY0A 1N19A 1NLDL 2G2PA 3BAJA 3W0WD 1H5BB 4JPWH 5IOPB 4BZYA 5FIEA 3TESA 4JQXA 4R4FH 1J0IA 1P0SE 3KS0J 4L29A 2EC9U 2MIZA 3SB3A 4HJJL 2ZWYA 3LKSA 5IW6B 4U6TA 2EINB 4NFDA 3PNWB 4E5XA 3UBGA 3DIFA 4O2EB 3N85H 2C34A 3ARQA 4A7QA 4E2OA 1T5XB 3WL9A 2JIXA 2UY6B 3FCTB 3BESR 3N91A 3T0VA 2VXQH 4N1CA 5D2LB 4MMYB 4QHKI 1KJ3H 3QHFH 1ZPLA 1N2RA 2ZCHL 1LEIB 3WENA 1XR8A 3F04A 3BP5B 5I8CB 3VGHA 4N1HB 1I7UB 5TGBB 3QO1B 2HTLC 4MXQD 5D2NA 4KXCA 4K07A 4U1JA 4PRIA 3VGDA 4G6KL 5AVUB 4D0CA 1T0MA 3O6KH 4H8PA 2AMGA 3C5SB 1IGCH 2CBTA 4OUUB 3D85A 4JFVA 2VQ1A 3RNQB 4JO2H 4NN6B 2K8MA 2C7UA 1HDMB 4DQOL 2WAHA 2BP5M 2E8YA 3NK3A 3O11A 4U1KB 2AS5M 4MA1B 4OKDA 4YSOA 1Z9MA 1AE6L 1HILB 3CZFB 4HUNB 1OAYL 5C0CE 1CL7H 4LOEA 3T8XA 1QR4A 2ZCLH 3SZKC 1E27A 4XB8A 5GSVA 4UV4H 2R9HD 1KIUB 2PR4H 3WY1A 5IROA 4G72B 1WZAA 4HWBA 1S7WA 4OTXH 5GGSB 1ZSDB 3QXDB 2ROXA 3O3AB 3S5LA 1M7UA 5HYJE 4JW3A 4WDIB 5C0JA 1UXSB 2QQKL 2WV3A 2Q7NA 4DVBB 1ETB1 3SDAB 5IBUB 2Q87A 4XN8A 1KT2A 3HC2A 4JQVC 5J5EA 3QNFA 5IB4B 1UWGH 2NOYA 3SY0B 5EU6A 1PZSA 4UOJA 9PCYA 5EH1A 5KN5B 3HC3L 1BQRA 4UAOB 5FO9A 4M1CD 3LV3A 2L7JA 4M7KL 4OFYD 4BE6A 1XSOA 4CVZA 4UM9B 5LQBH 4TQHA 3UZQB 4C56B 1IILE 3EJRA 3Q8CA 3RGHA 5C0AB 2FJHA 3L9BA 2VMDA 3LSOA 2R4SL 3NCEB 4OJAA 3CSGA 3BPOB 3BFOA 4PI2A 1H6EA 4QXTB 3QFJE 3SPVA 4J3TA 3AREB 4FXGC 3T3ME 3BLBA 3K2IA 3QDME 4JM4L 4X8GA 1RIVH 4BRVA 2F7RA 1OLLA 4S1SH 3O3DA 1LO0H 3GMPB 1EJ6A 2WCSA 3CN2A 3VDAA 3I6KA 3ARFC 4QGYA 4B9PA 3O3BA 4Y4HA 3DX8B 3U4AA 3ARGB 2EEXA 4X6CA 2J72A 1A7PL 3QUKA 4R97C 5EO0A 1C1EH 4FQQB 4HIIA 2LGNA 3BOVA 2AJYL 4NHCH 5FF6A 3NQIA 4U6HB 2NW3A 5AFAA 4OLZH 1FIEA 5EWIL 1N64H 4LOFA 3WHE1 2XJLA 1T3FA 3NIFB 4TTGA 1M7IA 1CFNA 2HKFL 2MOQA 2W95A 5D1XB 2FR4B 1BZ9A 1WE5A 2FBJL 3T4AA 1L9OA 2Q8BL 1AD0A 3KH3A 3PABA 4O02L 1KLUA 1IBHA 4ODSH 4LCCB 2FB4L 1RUKL 4PQXA 4TNVF 3VQ1C 5HDLA 4H0LC 43CAA 1G7JA 1JVOA 5ICZB 1IE4A 4AEHH 1H9DA 2QZQA 3CK0H 5KS9E 5CJQL 4PJEB 1TJGL 3FU6A 5DO2D 2L0DA 1IEBA 4O58H 4TQ8A 4H25A 1JNNH 5FO7B 3S5ZA 3OSKA 4PMFA 1T1XA 3QI9D 4LHUA 4B3VA 1XGRA 5FA4A 5DRNA 2Y7QA 4HMDA 4M6OL 4WHDA 4Y19A 5D2NE 1S7VA 1EEQA 3CHPA 1RURH 2IALB 3OKOA 4PRIE 3SDXA 3RDTC 4F57L 4F7TA 3S37L 4U0RC 3ISRA 1V55B 1VACB 5DJYB 1AS7A 3AG2B 1FH5L 1U93A 3HG1A 1PJWA 3MRGB 5JOFA 1SYSA 1HH6B 1Q9KB 3ZIMA 4NWTL 1DBKL 3D09A 3RVTD 4XCFH 5E94B 1MIEL 5D96C 5DVMA 3PDGA 1X5LA 5T3ZH 3V0AC 4K15A 2PWGA 4R9HA 1B2YA 4GQQA 5DD5H 4EZJA 1IAKA 1WC7B 4JZOB 2GTWA 3PV6B 3AXHA 4A7VA 3ZW3A 1DQVA 3PHSA 3UBXB 4XXDA 2R2EA 2Z8RA 2OSXA 4MDJA 4LCWA 1BXUA 5DXWA 4UF7C 3KPSA 1G0YR 1CDCA 1TVHA 1BVLA 3L3GB 3HE6B 2ITDB 1J0HA 2VDMH 4QY8B 2WXRA 4RAHA 3SE8H 1BM3L 5FHBH 5T33L 1S3KH 1K4DA 3L5WA 1U30A 2QSCL 1LTXA 3PWVA 5FLVA 5EU6E 4NCC2 1K8DA 1JIBA 4JCMA 4M4RB 4U1HA 4WWOA 3LZLA 3K4ZA 2YXVA 3TC9A 4ZBJA 4XN2A 5H37A 5LB1A 3ROLA 2VKXA 1E4WH 4ICWA 4AT6A 1FAIH 3ZQXA 3CE1A 1WBXB 2MSPA 3S97C 2VLLA 4P4KC 3L7FA 2PWFA 1IGIH 4N9GB 5D7JB 4TLKA 4Q4IA 3NJJA 4JO3H 3SGEH 3DUUA 4G6AC 4L8SC 2APSA 1T2JA 1XGUB 1CD1A 2E27H 2K6ZA 3D87B 3JYCA 4L8BA 5TTRA 1W8OA 4HCIA 3VXOA 3IJSB 3O0LA 4PBWD 2GCYB 3MDJA 3V0HA 5BO0D 1KDJA 5HGAB 2A4CA 2QQNH 3VFUA 2OK0H 5KYNA 3BGAA 1BLNA 3MLTB 5IQMA 5C0NC 3CDZA 4XO8A 3BP4B 4GUOA 1ASQA 1S7SB 5F7KC 3LOWA 4ZPVB 3JVFC 2CHZA 4G8EB 3TBTA 2L3BA 4ETYA 4KZDL 1X5FA 4EZKA 5I71B 5DGRA 1KV3A 1A7OL 5DHMC 2F15A 3CNKA 1AKJD 3I6SA 3R18A 1VKXB 3OAZH 2Y5QA 4XNMA 3SE3C 3PDOA 1GOFA 4MAYB 4R7DA 1GC1C 2PXYB 4OZFB 1NL0H 2VRAA 4Z8FH 3P4OA 1T7YA 5ADOH 2E56A 1PL3A 3A4DA 1XGTB 2X3BA 1DVXA 2QLYA 4NQCD 4U7KA 2BC4A 5EOQL 3PIQA 2ZKYA 4KKBD 3RBGA 4BGLA 4Z7WF 4UOQA 4PEEA 5EZJA 1OHZA 3CU7A 5DZJA 2BXYA 4PPTA 2NY2D 4GUPB 4KQ3H 2EDKA 4XOAA 5JOEA 3U2SA 3VXUA 2ICWA 1ZLVH 2P5WE 3V7AE 3RX7A 4Y19E 4YK4C 1OOWA 3SDXE 1CG9B 3BKML 2WD0A 2X9YA 4JQVA 4X6DA 5C0BA 5SWSE 5T1JA 2NT1A 3IU3B 3R1GL 3FFCB 5L2KD 5TE6H 2HT3C 3HG1E 4G1EA 3VG9B 1AQHA 5D70H 2FQFA 2D0GA 1IFRA 1C5CL 2V17L 2VRKA 1NGQL 5DDHA 2F5BL 3TEWA 2OCFD 3EGSA 1J1XL 1IGTA 2C26A 5L88H 5I1IH 3SCMC 3V4UH 1CF8H 2X9ZA 2K6WA 4TS6A 3D25A 4ZW7A 1HZKA 1Z6JT 1HYSD 5KYXA 1OQXA 4FXGA 5T1DL 1EZLA 2A6IA 5I75C 4HGMA 1ZLWK 3O81A 2WNKA 4LCWE 3WFCL 3ARFA 2D9CA 1CFBA 3BUBA 4OGZA 3HA0A 3KPSE 4XWGH 2ZUQC 2AVGA 1TENA 2NQCA 4YSRA 3NQKA 2EECA 5HYQB 4YHOL 1C8QA 1BBDH 4KO9A 4OM0L 5J7CC 1CL7I 3OAYK 5FO8B 1JXDA 1AZZC 1G6RA 3IS1X 3RZCB 5BNXD 3GJFB 4LSRH 4U6XA 5A2CA 3ZHNA 1W91A 1CGSL 3EO1A 1MELA 5TE4L 1AQDB 2QLVB 1TETL 5CZXD 2AQTA 4JFEE 5C6WH 2PW2A 2IQ9H 4NAMA 1A8ZA 4PTTA 3VACA 1QNIA 3IFOB 3BUTA 3MLWH 1UD5A 4UT9A 1JPFA 2R69H 3QEUB 4UQ3B 5JIQA 5JDSA 1SUHA 4F7EA 3GRWA 5DUPL 4U1SB 2BW4A 2ZAGA 4HH9B 3WTSA 5DWPA 4ELKA 2OCJA 3GMNA 2LQRA 1C9SA 5F21B 4PG9A 5CXPA 3AABA 1Z9SB 4LVNB 4HOZA 1E4JA 2VDRH 2GT9A 3HIZA 1WUZA 4LARL 3VFNA 2ZUSA 3D0LB 1JG9A 3MV8A 2XWBA 1TZGL 5I24A 1E5CA 4YNYB 3IDNA 3HNTH 3BCFA 5CN1A 3WUWB 3HR5B 2BIQA 2H2PC 3RDTA 5BVJB 1N67A 1YYMH 4PREB 4N0UA 1HHHB 5CCHE 2WKOF 4X9GA 3BPLB 1NUGA 3MBXL 5FV1L 4V1DA 4DSYA 5JQ6H 2J73A 4YSPA 5ALBL 5D4JA 3TYFB 4OD2B 2WJ5A 2FEEL 5C0DA 3X3FL 3BAEL 4K3DL 4ODUB 1V3JA 1BG9A 4XN9A 1XB6A 1RJZA 1NBZA 4OZGF 2RBLA 3MRFA 2B8OT 2Y69B 2F54B 5DD3H 1N26A 1WRFA 2X4OA 4FG0A 4W9ZA 1PBYA 1MQKL 1I1AA 2ZF9A 4BSWB 4JG9A 4DTGL 5FYJU 5ERWA 3MACH 3LN4A 3BP7B 2OXGA 3EFOA 1LYQA 1WZKA 3FHAA 1VFBB 2C3VB 1KTBA 3VXUE 4JY6A 5IK3A 1R19A 1LHZA 2NW2A 3G6JF 2E7BA 4RZKA 3ULSA 3Q0HA 5EOTB 4DEUA 4EUPG 3A6BH 2H0EA 1JGUH 4HUXA 5FA3B 2K1MA 5CS7A 4JM2F 4WW1B 4X6DE 5C0BE 4UT6H 4QI3A 5E23A 3MROA 5DJ0B 5E1AA 2FSEA 3GBDA 4FQLL 4R5XA 2E47A 5EF3A 1WFTA 5C08A 3IJEA 3HB3D 2E3VA 3BWUF 5KVGL 1VESA 5T1LB 2ADGA 2IH9A 2BNRB 5IQ9B 4P4KA 2LOEA 2YKLL 5FYLL 3PL6C 4X5LA 1TO4A 5CBEA 1WA2X 2Z7YA 4A7GF 1UHVA 2XA8L 3DMMD 2K8QA 5CGBA 1I7TB 4L8SA 4LPTA 3CPLB 4FQ1L 4NUQA 2MCAA 3ESPA 3S0PA 4EI5B 2HRHA 3CDCA 5AKVA 4J7RA 5GRZA 3QK0A 1P7HL 1EXUB 1T0OA 3QXVA 2LU7A 4ODXA 1E5UI 4R5TA 1Q94A 1RIHL 5BW7C 3P73A 4KKAD 3HZKA 2NDFA 1U42A 3KPLA 3FB6B 4K7PX 5T3XL 3AAZA 3CZEA 2ZYIA 3LKPA 3VFSB 3EJZC 2WPGA 3GRWL 5ICYA 3SGDI 5FYLE 3BSZH 3OZ9L 3TZVD 3SKUD 4FQIL 1DQQB 5ICUA 3SJVA 4UINH 1SXAA 3SE6A 5ALCH 3VDCA 2XN9D 1NJ9A 4LSPH 3SE3A 4OGXH 4MHHG 4K9EL 3MLZL 1OGTA 4PLJC 1RJLB 3W38A 1BFOA 4N90E 2C8NA 4X4YB 4IIQC 5B4MC 2Q1EA 2Z93A 4F3FB 5I6MA 3G6AB 1ETZA 1MHCA 2VQUA 1GPOH 3CFKA 1HINL 5GIRB 1VEMA 3N42F 1PX4A 2YPVH 2C1OA 3ML8A 4PY8I 4ZYKB 5J1AA 2YLKA 3LPPA 2F5AL 2CM6A 5IFJB 2HSIA 5DYFA 1QASA 3BIKA 3SGEI 2GHWB 4NUPA 1P4IH 3QZOA 3H2WA 5I6PA 2DJUA 2OX5B 3O9WC 4FC3E 5C0RL 3O4LB 1J88A 4N0UE 2GJRA 1P2CB 5LBSH 3WN5B 5EEZA 1J1PH 2QPFA 5J89A 1A47A 4V1DE 3FXIC 1TJXA 1T1YB 5FX3A 2HN7A 2LAAA 1FZMB 3WLBA 3BE1H 3NSDA 1F2XK 2VIRA 3LDBB 1ZTMA 1SOXA 1PPIA 4XT1C 5F9OH 3X1GA 1KCWA 2UVEA 3SCMA 2KZWA 2AJUH 3X14B 4B0MM 4FNTA 1GS6X 4BH7A 1T5WA 3CZNA 1QOKA 2X89A 4OF7A 4PR5A 3RVVD 2VM9A 4PRPB 4Z7NE 1J5CA 4JFZH 4LOVA 2OMTB 4AL8C 2DTSA 15C8H 3V0VA 1C5DA 1DQML 2ATKA 5D93C 5EZIL 4H5SB 5DFVD 1A65A 3GHPA 3DROB 4WEUD 1F4HA 3FZUC 5D7IA 4DGYL 4CC0A 1YYLL 4P5RA 3D69A 1IC5L 2FT7A 3I75A 4DW2L 5LXVA 5F7DA 3CDFA 5J3HC 5FGCE 1TYRA 2NY3D 1BMGA 2KKQA 1G84A 4KHXL 4HUCA 3VCLA 1MF2L 3U46B 1A6VH 2LFGA 2BO0A 1FFNB 3C60B 5B1KA 5C0IB 1YEEH 5FWQA 1UWFA 3FTZA 4NZTL 4OFVA 3UTSB 2E9WA 5E2WH 4DZ8B 3O6FB 3S96B 3D34A 4A67A 5F88B 4AE0A 3MNVB 3VRLF 1XMWA 2IBBA 3BWSA 2C9VA 9CGTA 2B39A 1DVFD 2VR5A 4O00A 5KANI 1QX1A 4RGNB 3UYRH 5A3ID 1JPST 1CTOA 5BUAA 1FUNA 4NNYB 3MRBA 4DNLA 1G9EA 1IE5A 2ESVD 2EC8A 5FKAB 2IFFL 1IC7H 3D2UD 5C07A 2CIIB 3ARRA 1T21A 3CZKA 3GDBA 3EIFA 3L3DA 4HHAB 4LQ1A 4KZCA 5IVXA 3QUMH 4ZOEA 1DQIA 4KPHL 2BP8A 2MKLC 5KEZA 1QG3A 1YPZF 3DK0A 3SJVE 1OAZH 2K70A 1YY8A 1KCRH 3QWQB 5BV7C 4L18A 4M7LT 1DUZA 1KBPA 4MBRA 1I1YB 1N5AB 3BEVB 4NI3A 1MH5B 1CVSC 2NY4D 4YOKA 5FUZL 4M5ZH 4ZMWA 4WY7L 4KGLA 3PG2A 1AZUA 2VLKB 4NM8L 5IBTL 4JFPA 1HL4A 2R1YB 3UGXA 5E6ID 5AYUH 5F9JA 2DM4A 4JY4B 3VXPA 4QWWD 1R3JB 1S7RA 4G8FB 1KF9B 1YAIA 3WHE0 2ZTBA 2K7PA 2XWRA 2Y23A 2DQIH 4JDEB 1T7ZA 3REVB 4TUJA 3TJHC 4WTZG 5LAPA 1S7XB 4DAGH 2QQLL 4KZEL 4DGIL 1XVSA 1E6JH 3BLKA 4OZGB 5C0EA 1TEYA 1M05B 2DB8A 5CEZE 3WFEL 2VDNL 3HI1B 5DURD 3STZA 5J6HA 3B5TA 2FECL 5E99H 3SGKC 4B9CA 1R3LA 4L1LA 3TBVB 4ODVL 1XIWB 5JPMB 4WI7A 5B3NA 3Q6FA 2J4WL 4NPYA 2AV1B 4LASL 2OYKA 3EYOB 1QPKA 3HRZC 3MMEA 4JPSA 3EJYD 5BQDA 5EO1A 3VXTA 5B39A 3QCUL 1ZS8A 4JJ5A 5HJBA 7PAZA 4DF9A 3QXUA 5C0CD 5C2BL 3DX7A 4JM2B 5AKSA 1NDGA 1YEKL 1OKEA 2Y7NA 3FTYA 3MUHL 4NJAH 2P80D 3OKNB 2DRUA 4XPHL 4LL4A 1OIOA 2YPLA 4R7LA 4YE0A 4P5SA 1PKQB 5I74B 4Q2ZA 3TFKD 3TA3C 2AITA 4IMKC 2A5UA 2WMPA 1FL3A 5HYJD 3KPMA 3CUPA 2R29H 4WFHE 4C55A 5BW7A 4N4YB 4PYGA 5DMIL 4GG6A 4FA7B 4PLKC 5D7IE 4IU2B 4Y2NA 1BECA 4D3CH 1MZZA 3QSKB 2XZCH 3CSTA 3OB8A 2WK2A 3S88H 5IQ7H 2BERA 2VDMB 1A22B 1Z1WA 1R5IA 1JGEB 5IFAH 4OCYL 2QHRH 4IMLB 3D52A 5CUSH 1D7FA 4JHBA 3C08H 2J1KA 3QFJD 1URZA 1I3VA 3GS7A 5FKPA 3QDMD 4M03A 1ZLUK 7FABL 3RNKB 3QG6A 1F4XL 1IGMH 4MD0B 4UDUB 2DWDA 1HOCB 3UTZA 1MXGA 3AVEA 3MVSA 3ARZA 3QZLA 2HFFB 2M2DA 4HZAA 1LO5A 1MVUB 1R24A 2AQ1A 3GSRA 1ZLEA 4DUVA 4JFFA 1DEEA 1KGXA 1T89C 3X3GL 2IGFL 3PGFH 3S3BB 1MHPH 4D0DB 1IZJA 5DFAA 1DBJH 1HN1A 5C07E 1T03H 1WAAF 2GJ6B 1DUYB 4LKXB 4W9DC 4O4YH 3N42B 1ZY9A 4Z0XB 2NNCA 1U8JB 4J6RH 4UIMA 3MC0A 2WP3O 3O9WA 3EHBC 4GH7B 1RXLA 3SPCA 2YRPA 4XNYL 5ETUB 2EE9A 4YLCA 3NCCB 1XTMA 4POUB 3AS3A 2FZ3B 3I3EA 2BP0A 2QADB 3BP6B 3BUQA 4JDVB 3IGLA 5T1MB 1NEZA 4WWKB 1QA9B 1CICB 2GPZA 2IDUA 2XX1A 5HXMA 4RMBA 1Q90A 3T8MA 2WANA 4QHKJ 1J05A 2G4EA 4UBDC 5LVEA 1P1VA 4IBLT 4TSAH 5HY9A 2BXZA 3BJ91 4YLQT 2ORBL 1OSPL 2A73B 4N2NA 2IF7A 4MDIA 4N0FB 4HPOH 5GZOD 1HL8A 2HA1A 3NH7H 2N7BA 4PRID 3AW5A 2EDNA 3B9EA 3RWEA 3HG5A 2XBDA 3VYOA 1B0RA 4W93A 1PDKA 2X1PA 3D85D 3IDMB 3LQAC 4GAGL 4LMQE 3RU8H 3BDXA 5I9QB 1OGAA 3HG0A 4K94H 4RFOH 1A3RL 3LPWA 3JWOH 4GBXC 2F8IA 2A4EA 3L9YA 1WFUA 3D5OF 2VMFA 2HH0H 2X6AA 2HVJB 2AF2A 3KGSA 3MRMB 2NY5H 4U3XA 4XRCB 4HGKC 1FVEA 3ECUA 1MIML 3BLPX 4MD5A 4BXVA 5IROD 2J7LA 3QDJA 4GP5B 2XWJA 3FT3A 4EJ1C 3IDJA 4LKCA 2FHCA 4A6YH 3OMZA 4LPWA 1H3VA 4FYTA 3JTSB 1MJ8L 3V4LA 3MRDA 2RH0A 4HV8B 3MREB 2P9RA 4ZOCA 4W4OA 3I2CL 3WXVH 4GG6E 1AZCA 2BHUA 3CSFA 6PAZA 3EJJX 2DMKA 1YEDB 3HZVB 2WNXA 3Q7JA 1F13A 4HQQH 4PGCB 4XO9A 1RKRA 1RV6X 2BFVH 3L9RB 4X7TB 4NIYE 2HFGH 4YZFE 2E76C 1KTJA 5FECA 3GXDA 3DOSB 4EI6B 1OE2A 5EU4B 2VABB 1UD2A 2B9AA 2CO1A 1XH2A 4AEEA 2CK2A 3QULB 4N8PA 2IEPA 1ERNA 2WXGA 3BT2H 4WNSA 3L17A 4XZ4A 2W38A 4PJ6A 2AHIA 3ZTDC 4Z7IA 2WKLA 1D7BA 3C8KA 3I9PA 4AQEA 3P30H 4NB7A 1A14H 2CLVA 4G8GB 3ZKXB 3BWAA 4FL4C 4L1DA 4FADA 5CHNA 3C8DA 2YC1B 5FAAA 4JFFE 4OGQC 1NOFA 3VWKC 5KSAB 3BO8B 3QQ4A 1H0DB 4LDEB 4DVRL 1MY7A 3T2LA 2HT2C 2BNQB 1CBVL 4QHMA 4X5PA 5EZOH 4FHKA 5I2IA 3CVHL 3SOBL 2D03L 1UM4H 2DBLL 1SQ2N 3M7OA 2SEBA 5E8DH 1ZA6A 2CUIA 2VDRB 4L3CA 4PHZA 1F1AA 4O51B 2XTJB 3LEVL 1AOZA 1F1GA 5HTSA 2EYTB 4Y2OA 1ACYH 1AZBA 4AL8L 3HRZA 2UXGA 3MRJB 1X9UA 4QXGL 1P7QB 5BOZG 1J0JA 1ZVHA 3ET9F 5CZVL 1XXFC 4XB7A 5I5IA 3K0WA 2XFXB 4PCYA 1FO0B 2JKTM 5IG7A 2NXZB 5I5RA 4KXDA 2JFCA 2C1PA 4KVCH 4E68A 4ZDHB 3DIDA 5I19L 3TA3A 5AVWB 5I1HH 5CSGA 3ZR5A 3TX4A 1NGZB 3HC0A 4LHUD 5IW1B 3WKMH 2VC2H 2ZUVA 1H15B 4KI5E 2UZIH 2P5WD 3FO2A 4Y19D 1IBZA 3F6JA 5FS5A 4AMKL 4UIKH 4QRBA 5BVPH 3VGAB 1QBML 2OYMA 5SWSD 3O4OC 3R4RA 4GRLD 1YC8A 1ROCA 2EEBA 3SKJH 3ZKQD 2IH3B 2B2XH 2VWEE 4LFHG 5DRWB 3HG1D 1CK0L 3LN5B 4G80B 5AG9A 1UXLA 3KNBB 1OGAE 3RPKA 1CURA 3W0WB 4RWYL 5JLZB 3HUJF 2ZKMX 3RPBA 5GRJH 3WSQH 4KY1L 5DMGC 2K6YA 5EUKB 1XF4B 3DRTB 4I5BB 1OCWL 4PU2A 4M7JL 3KH4A 1FE8L 1X5AA 1KCVH 5MEQA 3K6FA 4X0KA 1QFUH 4L3EA 1BX2B 4IS6B 4LT7A 4NKMA 5FK9A 4PJGA 2IXQB 2J5LB 5CEYB 4LCWD 3D51A 4H8QA 4KJWC 1BHGA 4UQIM 3OXSA 4XMTA 3KPSD 2OP4L 5GISL 1T20B 5JW4Q 4DK3A 2JI1A 2D0FA 5CN2A 3DX9B 4KDVA 4N2AA 3FU8A 2A6JB 5FGBC 3RHWK 4AQAB 5HHQA 3HR6A 1T7VA 4MD4A 3T0DA 5I0DA 1Z5LA 4YDVA 3OC5A 4NAQA 2L7QA 1KBGH 1P4LA 4OGAC 4N2OA 2ZX5A 3NCBB 1TZHA 4OUOA 4JFED 1FORL 2YK1H 4OLVH 4PLNC 4KXZI 1NKGA 4ZTOH 2ZXDA 1U58B 3UBHA 4B60A 3BPCA 1MAJA 1HCVA 1KOAA 3U0TA 3FT2A 1QKZL 4W9LC 1S5HA 3CN0A 4ZUUB 1C7TA 1S9YA 4J3VA 5AL0A 4RQQA 5MI0B 2CXKA 3OQ3B 3C6SB 1JWUA 1PZDA 2F0CA 4G5ZH 4BFBD 3V6OA 3NJMA 2B1OA 3F7PC 5EEXA 2EIBA 2JH2A 1FV1A 5IP4A 3P4NB 2H1XA 3C5XA 4PGDB 1WISA 4YGVA 3IDYC 1OSZB 3NP3A 4IGBB 4YHZH 4H20H 3AJ7A 3B2UD 4L8CB 1P5UC 2HTLD 3AITA 2FX8L 2QPSA 4EEEA 3GM8A 3WY3A 3MO1A 1EGJL 1XCXA 1PYWA 4GP8B 4GEJA 2UWEF 4ZMXA 1NMCC 4NQDA 3CTTA 2EE0A 1W16A 1CFMA 2ZXGA 4GQPH 4YHKL 2EEDA 4AYDC 4YDJA 1X5IA 4YUEH 1JTOA 4PW4A 1WITA 2Z7UA 3A5VA 4YXKL 1A4AA 1A7QH 4ZUSB 1MCCA 4ISVA 5I8EA 4PWJA 1TQTA 3LS5L 5T5NF 4GBXA 1R5VA 2VXVH 2Z92B 4AIOA 5F97E 4XP6L 2G4GA 4AEIH 2YD6A 3GLDA 3LZFL 4E9YA 3NOIA 1G9NH 3EF7A 4LSUH 3KD4A 1CU4H 8FABB 2NY6D 3QQ3B 1KIRB 4XNQA 1X3DA 1Z7JA 3PP3K 4FNLH 2ALAA 4KBPA 2G5UA 2A83B 3CD4A 3QDAA 5IMKB 4Z7VF 3VXUD 2WSKA 4AE1A 1I8MB 1NAMB 1U8HB 1U8CB 4LCIL 5FM4A 3ZO9A 3U7WL 2BVYA 5KVEL 3NT0A 2EXTA 5C0BD 4DN3H 1BF2A 1OT4A 3LS4L 5DRXB 4LCUA 3RLSA 4OBRA 5EU3A 2G5RA 3QXTA 3MNWB 4HUKB 4DP7X 3OZLA 1NM4A 2CKBB 3QUYB 2VISA 3NCYS 5F44A 1W2KT 4CN6A 2YMXH 1WDAA 3KE0A 3NAAH 1M1XA 1VPOH 1ORQB 1TFPA 3TH2T 3WAKA 2P42B 1DCLA 4FQ2H 5CFHA 4K2UH 1C08A 2H32H 4XCNB 2N4IA 4S2SB 5F89A 5F7LB 4LSTL 1D6VL 4XAWL 4PJHE 3LD8C 4L3EE 3RUGF 4R0LC 1YECL 4PJGE 2DQEH 1B2WH 4X9BA 1TKWB 5F0PB 4PRDA 5JHDA 4K7PY 4N5ED 2AK1H 4PJAF 1XHHA 5D9SB 1KCSH 3VFWA 3MKGA 1YEGH 1C16A 3N50A 1G6VK 1KGWA 3CMOL 4LBEA 4NPKA 3VVVA 4ABWA 3AY4C 2I9TA 3BD5A 3VWKA 3AADB 2AXFB 4JKPL 1JF1A 1S78C 4A37A 5I15H 5FYLD 4E9QA 2D31B 4ZFOL 2J71A 5F7UA 1ET5A 4BINA 5DJZB 4G9FE 4B9YA 1BA9A 3VD2A 5D7KE 3CFDB 2MQ0A 3ZTNH 4MQTB 2NYYC 1I8LC 4JFQA 5CP3H 2ZCKL 4J2XA 3B7TA 1INQA 4FFZA 4N90D 1MZYA 3L95A 1LMKA 4UOW1 4BH8A 1BJ1J 5AB9A 4RGMB 3EBGA 5FM5M 5IR1A 5FM5O 3TYGL 4RNRA 5E4IA 3PWJA 3PWNB 1YNTA 4HIJA 3W39B 3V6OE 3NJVA 4BHUA 2BS8A 3LQAL 3FRUB 1DE4B 5SV4A 5F6IB 1KXHA 1NUFA 1PFCA 2OW7A 1TJIH 2G9HB 2HT4D 3IDGA 4KKCC 2C7FA 4RA0C 1CFTA 3G3LA 3MLSH 1ET7A 3MV9A 4LEOA 4NO5A 2BWIA 3GSNA 3LH2H 4LLQB 3V4PL 5F7EL 2YA0A 3L6FB 5BPPA 1MJJA 4GSDL 3CSYB 4NRXA 1KIPB 3RDTD 4NQDE 3ZL4L 3RWIB 4PP1C 4M61B 3GSOA 4G7QB 3W9EA 4GO6B 5B8CC 3HI5L 3U1SH 2X10A 4V1DD 3VGGA 4M8QA 2DY2A 4X9HA 1DBML 1JPEA 1SDAB 4HX1B 5AZEL 2BPBA 2GI7A 4IRSB 2VDPL 1KWKA 1FZOA 2K45A 4YX2L 1S8DA 5A6LA 4NO2A 1QSFA 4FZ8L 4DK6A 3F5WA 3RWGA 3FU3A 1I1AD 1QI4A 4LGRB 5EG6C 4I18B 3SDDB 4HLEA 1SEQL 3QEHA 1QACA 3GF8A 3EBHA 4XB3A 3HUJB 3H2QA 2YPKA 4KK5C 1UWXH 3CZJA 4EXPX 3H3KA 4MJIB 3BAIA 5FGBA 3P4MB 1QSEB 3WEAA 3L4VA 4Z7OE 3DJTA 3RWDA 5HI4C 2QZ5A 5KG9B 4TTDC 2YD1A 3KL0A 2JKJA 3DTXB 4Y0GA 5F2FA 1AKJB 3BVTA 5JIMA 1EFXA 4PJ5B 4LVHC 2A9ML 4CN4A 4Y4KC 4BDVA 3X13A 3NZ8B 3EO0A 3Q44A 4BSJA 4WJG3 1CGXA 4UB0L 2DQDL 4OZ4A 2RCSL 4P4KD 1GAFL 2FHBA 3FTXA 4Z7UF 5GSRB 1ACCA 1AC0A 2ZP0T 3L1OH 3TNMA 1MFDH 1QLEH 4XMKL 1FHGA 2ZUTA 5IY5B 3SDCC 1JTPA 5H35B 1GSKA 4HJTA 4GSRA 1PZBA 2WYIA 4OB5L 4ONHA 2NQDA 5JHDE 1AQKH 4ETQA 1LM8V 4WO0A 1EJ8A 2CR3A 3PPEA 5DK0A 3B9AA 4GNKB 5JXEC 3V8CA 4C83B 5IREA 5DWUL 4MX7B 4DP0X 3GHEL 4WSGA 5E6ZA 2WZPA 3IPBA 1U8QB 2PNDA 2XHNA 5GGVY 1JXKA 2CBQA 4U1NB 1ES0A 5BXFA 4I0KA 2AI0H 3GMLB 1Q0EA 1W6WA 1P5UA 4AXWB 3NCMA 4GS7B 1VIWA 3PHQA 3SJVD 5A7BA 4DEWA 1VEPA 1EHAA 2XIBA 2E7LA 3INUL 3GXIA 1HC1A 3WOVA 4DP4X 2FJFA 4LFHD 4YSUA 1AXSA 3KYOB 4K5MA 5GHWL 1ZAGA 2P49B 3V4VA 1TMQA 1INEL 1UOVA 4M5YL 2YQBA 4QMEA 1GGBL 1MLCB 4XH2B 3U82B 1T66C 2OMUB 5DHEA 2BSRA 2FJSA 3GSNL 4FMKA 5KVDE 4HUMB 4KV5E 3I9IA 2ZWLT 4HWBH 3LNEA 1NLBH 3O2DL 5L2JB 1GGUA 3U2JA 3CC1A 5CLWA 4RAVB 4OZIF 4RVBA 4Y16C 3FL7A 1GR7A 5I1GH 5IJVA 3PWPA 3VXNA 1JZ7A 1AJ7L 4HZ1A 1T1WA 4AGMA 3QZMA 3VFPB 4NZDA 1CUOA 4H0GA 4F9LC 3VWJD 1THCA 3S8WA 3P0VH 1XF1A 1IGYB 3PP4L 4J5VA 5CEZD 4GW4A 3FQ1A 2R1WA 4E9LA 3WEXB 1HNFA 3TM6A 2OV0A 2XPGA 4F8PA 2QELA 3RX5A 5AZ2H 2KDYA 1XGYL 3E80A 3GSVB 4ZMTA 5C71A 2ADJA 1NCWL 3O2VH 3ZE0F 1Q9LA 1OD7A 1T6VN 1XEDA 4WNJA 1NCOA 2OKMA 4EDWL 3G5YB 4GG8B 4Z7VB 5KSBE 4G83A 1PG7X 4FG6C 3MNDA 4X4KA 3MGTA 1G7PB 3U6RA 1KDIA 1F4AA 2WN3A 3SCMD 4BKTC 5KJRL 3RL1B 1HWWA 1CIDA 3U48A 3BAYA 1T04A 2FSDA 4XMPL 4ZX5A 3RWHA 3B3IB 2X89D 4HBCH 4R0LA 2G9KA 5LDUA 2XWCA 1EXGA 3OAZK 1AGCA 3AGWA 4GJTB 5K5YA 2C9SA 4POZC 2D0HA 1FFTB 3LHPH 4JX0A 4WFHD 1JYNA 4JG0H 3BN9D 3LAFA 4FN0A 5BS0A 2W07A 2DDQH 4XP5H 3SODB 4YDNA 5IV2B 4CNIA 1L7IL 1YMHA 5DUMH 3VQMA 4A6YB 1XZ0B 1ZT1B 2CK0L 2E59A 1JUFB 3G5VB 3RUGB 2A99A 3SBRA 5GGVH 1ZPUA 2VLRA 3DETC 4P2OA 1KJMB 4PJAB 4G7YL 3J27A 4KHTH 4XPAL 3AT0A 3DJSA 3OLDA 4YVNA 4JFUA 3K71B 2BNUB 2JKXA 1I8LA 2ZIDA 3FOLB 4KZDH 3A67H 3QW9A 4C47A 3FS9A 4KO5A 3QJVB 2ZP8A 5DEFA 1BREA 1YN6A 5TQ2L 3QCVL 3WY4A 1DVZA 3EG9B 3QJQB 3T6ZA 4DP6X 2L7UA 5CP7A 5JW3L 1T6WA 4Y5YC 4D8PA 2UZYA 3CLFH 1JD9A 3L4TA 1CQYA 4Z9KB 3GBNH 4HKBB 4HUUA 3RIFF 1XGPB 3KLAA 3KCPB 4TNWF 3ZKMD 1O9ZA 4F2MA 5F1KC 3B43A 3KR3L 3KXFE 3BZEB 1F41A 5DLML 5C7ZA 5C07D 1QEWB 3QH3A 3IU4H