4X51A

X-ray structure of mouse interleukin-10 mutant - s1_e8del, c149y
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
142
structure length
142
Chain Sequence
GQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINYIEAYMMIKMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of mouse interleukin-10 mutant - S1_E8del, C149Y
rcsb
molecule keywords Interleukin-10
molecule tags Immune system
source organism Mus musculus
total genus 53
structure length 142
sequence length 142
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 4x51A00
4X51A 1CNT1 1YKBA 1D9CA 1RCBA 4ZF7A 2L3OA 3QT2C 1EMRA 3NPZA 2B8ZA 2CYKA 2D9QA 1ITLA 1D9GA 5D70A 4CNIC 1A22A 3EJJA 3UF5A 1AU1A 1BGEA 3B5KA 3QAZA 3WCYI 1BUYA 2HYMB 3N0PA 1PGRA 1HIJA 4DOHA 1ITIA 1EXZA 3QWRB 4NEJA 1VLKA 1CD9A 1HGUA 4WRLB 3D85C 1HZIA 1LQSL 1PY2A 1M4AA 4NKQC 1M48A 2L3YA 3QB7A 1INRA 2B8YA 4Z5RD 2Q7NB 1Y6NL 3HMXB 3SE3B 3NCEA 3D87A 4GRWA 2D48A 3INKC 1FYHA 3BESL 1M4BA 1CSGA 2B90A 3DLQI 3LB6B 4J4LC 2INTA 1LK3A 5LQBA 1PVHB 3PIVA 1M47A 3VA2A 2ILKA 1M4RA 1NBPA 3G9VB 1ETEA 3BPLA 1EVSA 3DGCL 1GNCA 3QB1A 2Q98A 1BGDA 1JLIA 1V7MV 2LMSA 2ERJD 2B5IA 1M4CA 1Z92A 3L5WI 2B91A 5C7XA 1IJZA 1HUWA 1EKUA 4FA8E 1RW5A 4YDYI 1KF9A 3LB6A 3UEZE 1F45B 1QVNA 1HWGA 1AXIA 1FG9A 2O27A 5FUCA 3UX9A 1LKIA 3NCBA 1Y6KL 3DUHC 4PS4A 1F6FA 1B5LA 4ZS7A 3SE4B 1BP3A 4O9HA 2E9WC 1BBNA 1ITFA 2KZ1A 3OQ3A 4MHLA 5KNHI 1Y6ML 3N06A 3UF2A 1V7NV 4YUEC 1A7MA 1BGCA 3NCCA 1CYLA 2B8XA 1GA3A 3G6DA 1M49A 5D71A 5D22A 5FHXA 1HWHA 1WU3I 3PIWA 1P9MB 4O6KA 1I1RB 2B8UA 1ILKA 4NI7A 1N1FA 3BPOA 4YQXA 2LAGA 1IARA 3L5XA 5E4EA 4RS1A 1HULA 1IL6A 1ALUA 1J7VL 1PW6A 2GMFA 1Z7CA 4NEMA 1IK0A 3Q1SI 5L6YC 4I77Z 1RFBA 3MZGA 1CN4C 4NI9A 1RHGA 1SCFA 3EW3A 1ITMA 2H24A 2O26A 5D28B 1BCNA 3NCFA 3BPNA 1IRLA 1AX8A 2IL6A 3HHRA 5D72A 1EERA 4YPGC 3D48P 1HIKA 3S9DA
chains in the Genus database with same CATH superfamily
1YKBA 4U4VA 1RCBA 4DKCA 4YB9D 1A22A 4PYPA 4J05A 4OAAA 3PO2D 4A3GD 4DOHA 1ITIA 4A3MD 2B8YA 2VUMD 4GC0A 3SE3B 4BBRD 4DKDA 5LQBA 5IYCD 3WDOA 1NBPA 3G9VB 3DGCL 5C44D 3HOVD 4IU9A 2B5IA 2Z3RA 1IJZA 3TGXB 1HUWA 4Q65A 4FA8E 1RW5A 3UEZE 1PV7A 1LKIA 4EXPA 4PS4A 3OG4A 2CFPA 4IKXA 2Y5YA 2KZ1A 3OQ3A 5KNHI 4IKWA 1M49A 5FLMD 3PIWA 1P9MB 5IP9D 4IKYA 4NI7A 4A93D 2GMFA 1ALUA 4IKZA 2JA5D 1Z7CA 3Q1SI 2R93D 3HOWD 4I77Z 3MZGA 1CN4C 1RHGA 3I4MD 3EW3A 4D2BA 1BCNA 3BPNA 5IYDD 1AX8A 1EERA 1CNT1 4TPHA 3DI3A 4LEPA 4ZWCA 3NPZA 2B8ZA 2CYKA 4CNIC 2Q14A 3EJJA 1BGEA 4LRLA 1BUYA 4IKVA 2CFQA 4BY7D 1PGRA 1HIJA 3QWRB 4BBSD 1CD9A 5C3ED 5TS9A 1INRA 4Z5RD 1Y6NL 3HMXB 4D2CA 1PV6A 3INKC 1FYHA 4A3ED 1CSGA 3DLQI 2INTA 1PVHB 4XNIA 1M4RA 1ETEA 3BPLA 4GBYA 3QB1A 2Q98A 1BGDA 1JLIA 1M4CA 1Z92A 2B91A 3I4ND 5C7XA 1EKUA 4BY1D 5IP7D 3LB6A 2R7ZD 1F45B 1QVNA 1HWGA 2O27A 4YBQA 4QIQA 1Y6KL 4ZS7A 3SE4B 4IU8A 3HHCA 1Y6ML 3N06A 5EQHA 3UF2A 1A7MA 5A2NA 1CYLA 2B8XA 5D71A 5FHXA 4A3JD 4W6VA 1HWHA 5GXBA 4JREA 1I1RB 1ILKA 4XNJA 2JA7D 2LAGA 1IL6A 1J7VL 1IK0A 4ZW9A 2XUTA 1PW4A 1ITMA 2H24A 3NCFA 4A3DD 3D48P 1HIKA 4X51A 5C4XD 1D9CA 2L3OA 2D9QA 1ITLA 1D9GA 5D70A 3OG6A 2C35A 3UF5A 1Y14A 3QAZA 3WCYI 5D58A 3PO3D 4NEJA 1VLKA 3D85C 1HZIA 1LQSL 1WCMD 4NKQC 1M48A 2PSMA 2L3YA 4EXNA 4U4WA 4GRWA 2D48A 3LB6B 5IYBD 1M47A 4JA3A 4U4TA 4A3KD 1GNCA 4NN7A 5A2OA 4A3ID 1AXIA 5FUCA 3UX9A 4DKFA 3HOUD 3DUHC 1F6FA 1BP3A 3HOZD 2E9WC 1ITFA 1Y1WD 2R92D 4APSA 4YUEC 1BGCA 2OQPA 1GA3A 4NN5A 5D22A 1WU3I 4A3LD 1N1FA 3BPOA 4YQXA 4JR9A 1HULA 4NEMA 3HOYD 5L6YC 1RFBA 1SCFA 2O6IA 5D72A 3HHRA 2V8NA 4NN6A 3AYHA 5EQIA 3IRHA 4ZF7A 4TPGA 3QT2C 1EMRA 3HOXD 4GS7A 4OH3A 1AU1A 3B5KA 3N0PA 2HYMB 5C65A 1EXZA 3H3VE 4WRLB 1HGUA 1PY2A 1M4AA 3DI2A 3QB7A 2Q7NB 3NCEA 4TPJA 3D87A 4ZWBA 4J4LC 3BESL 1M4BA 2B90A 4A3CD 3O7QA 1LK3A 3PIVA 3FKID 3VA2A 2ILKA 2JA6D 1EVSA 1V7MV 2LMSA 2ERJD 3L5WI 4DKEA 4YDYI 1KF9A 3O7PA 2XQBA 1FG9A 4D2DA 3NCBA 2JA8D 1B5LA 2B63D 4O9HA 1BBNA 4MHLA 1V7NV 2Z3QA 3NCCA 3G6DA 1Y1VD 4O6KA 2B8UA 3H0GD 4A3BD 4BXXD 1IARA 3L5XA 5E4EA 5EQGA 4GBZA 4RS1A 1PW6A 4LDSA 4ZYRA 4NI9A 2O26A 5D28B 5D6KA 4UVMA 4YPGC 1IRLA 2IL6A 4A3FD 5D59A 3S9DA
chains in the Genus database with same CATH topology
4X51A 1CNT1 1YKBA 5C4XD 1D9CA 1RCBA 3IRHA 4DKCA 4ZF7A 3DI3A 4YPGC 2L3OA 3QT2C 1EMRA 3NPZA 2B8ZA 2CYKA 2D9QA 3HOXD 1ITLA 1D9GA 4GS7A 5D70A 4CNIC 1A22A 3OG6A 2Q14A 2C35A 3EJJA 3UF5A 1AU1A 1Y14A 1BGEA 3B5KA 3QAZA 4LRLA 3PO2D 3WCYI 1BUYA 2HYMB 3N0PA 4A3GD 4BY7D 1PGRA 3PO3D 1HIJA 4DOHA 4A3CD 1ITIA 1EXZA 3QWRB 4NEJA 4A3ED 1VLKA 3H3VE 4BBSD 4A3MD 1CD9A 1HGUA 4WRLB 3D85C 3S9DA 1HZIA 1LQSL 1PY2A 1M4AA 1WCMD 3DI2A 4NKQC 1M48A 2PSMA 2L3YA 5C3ED 5TS9A 3QB7A 1INRA 2B8YA 4Z5RD 2VUMD 2Q7NB 1Y6NL 3HMXB 4EXNA 3SE3B 3NCEA 4BBRD 3D87A 4GRWA 4DKDA 2D48A 3INKC 1FYHA 3BESL 1M4BA 1CSGA 2B90A 3DLQI 3LB6B 4J4LC 2INTA 1LK3A 5LQBA 1PVHB 3FKID 1M47A 3PIVA 3VA2A 2ILKA 5IYBD 5IYCD 4A3KD 1M4RA 1NBPA 3G9VB 1ETEA 3BPLA 1EVSA 3DGCL 2JA6D 1GNCA 3QB1A 2Q98A 5C44D 3HOVD 4NN7A 1BGDA 1JLIA 1V7MV 2LMSA 2ERJD 2B5IA 1M4CA 1Z92A 3L5WI 2B91A 4A3ID 3I4ND 2Z3RA 5C7XA 1IJZA 3TGXB 1HUWA 1EKUA 4DKEA 1RW5A 4FA8E 4BY1D 4YDYI 5IP7D 1KF9A 3LB6A 3UEZE 2R7ZD 1F45B 1QVNA 2XQBA 1HWGA 1AXIA 1FG9A 2O27A 5FUCA 3UX9A 1LKIA 3NCBA 4DKFA 2JA8D 4EXPA 1Y6KL 3HOUD 3DUHC 4PS4A 1F6FA 3OG4A 1B5LA 4ZS7A 3SE4B 2B63D 1BP3A 4O9HA 3HOZD 2E9WC 1BBNA 1ITFA 2KZ1A 3OQ3A 4MHLA 1Y1WD 3HHCA 5KNHI 2R92D 1Y6ML 3N06A 3UF2A 1V7NV 4YUEC 1A7MA 2Z3QA 1BGCA 3NCCA 1CYLA 2OQPA 2B8XA 1GA3A 3G6DA 4NN5A 1M49A 5D71A 5D22A 5FHXA 1Y1VD 4A3JD 5FLMD 1HWHA 1WU3I 3PIWA 4A3LD 1P9MB 4O6KA 5IP9D 1I1RB 2B8UA 4A3DD 1ILKA 2JA7D 4NI7A 1N1FA 3BPOA 3H0GD 4A93D 4A3BD 4YQXA 4BXXD 2LAGA 1IARA 3L5XA 5E4EA 4RS1A 1HULA 1IL6A 1ALUA 1J7VL 1PW6A 2GMFA 2JA5D 1Z7CA 4NEMA 1IK0A 3Q1SI 2R93D 3HOYD 5L6YC 3HOWD 4I77Z 1RFBA 3MZGA 1CN4C 4NI9A 5IYDD 1RHGA 1SCFA 3I4MD 2O6IA 3EW3A 4A3FD 1ITMA 2H24A 2O26A 5D28B 1BCNA 3NCFA 3BPNA 1IRLA 1AX8A 2IL6A 3HHRA 5D72A 1EERA 4NN6A 3D48P 1HIKA 3AYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X51 A;  1CNT 1;  1YKB A;  1D9C A;  1RCB A;  4ZF7 A;  2L3O A;  3QT2 C;  1EMR A;  3NPZ A;  2B8Z A;  2CYK A;  2D9Q A;  1ITL A;  1D9G A;  5D70 A;  4CNI C;  1A22 A;  3EJJ A;  3UF5 A;  1AU1 A;  1BGE A;  3B5K A;  3QAZ A;  3WCY I;  1BUY A;  2HYM B;  3N0P A;  1PGR A;  1HIJ A;  4DOH A;  1ITI A;  1EXZ A;  3QWR B;  4NEJ A;  1VLK A;  1CD9 A;  1HGU A;  4WRL B;  3D85 C;  1HZI A;  1LQS L;  1PY2 A;  1M4A A;  4NKQ C;  1M48 A;  2L3Y A;  3QB7 A;  1INR A;  2B8Y A;  4Z5R D;  2Q7N B;  1Y6N L;  3HMX B;  3SE3 B;  3NCE A;  3D87 A;  4GRW A;  2D48 A;  3INK C;  1FYH A;  3BES L;  1M4B A;  1CSG A;  2B90 A;  3DLQ I;  3LB6 B;  4J4L C;  2INT A;  1LK3 A;  5LQB A;  1PVH B;  3PIV A;  1M47 A;  3VA2 A;  2ILK A;  1M4R A;  1NBP A;  3G9V B;  1ETE A;  3BPL A;  1EVS A;  3DGC L;  1GNC A;  3QB1 A;  2Q98 A;  1BGD A;  1JLI A;  1V7M V;  2LMS A;  2ERJ D;  2B5I A;  1M4C A;  1Z92 A;  3L5W I;  2B91 A;  5C7X A;  1IJZ A;  1HUW A;  1EKU A;  4FA8 E;  1RW5 A;  4YDY I;  1KF9 A;  3LB6 A;  3UEZ E;  1F45 B;  1QVN A;  1HWG A;  1AXI A;  1FG9 A;  2O27 A;  5FUC A;  3UX9 A;  1LKI A;  3NCB A;  1Y6K L;  3DUH C;  4PS4 A;  1F6F A;  1B5L A;  4ZS7 A;  3SE4 B;  1BP3 A;  4O9H A;  2E9W C;  1BBN A;  1ITF A;  2KZ1 A;  3OQ3 A;  4MHL A;  5KNH I;  1Y6M L;  3N06 A;  3UF2 A;  1V7N V;  4YUE C;  1A7M A;  1BGC A;  3NCC A;  1CYL A;  2B8X A;  1GA3 A;  3G6D A;  1M49 A;  5D71 A;  5D22 A;  5FHX A;  1HWH A;  1WU3 I;  3PIW A;  1P9M B;  4O6K A;  1I1R B;  2B8U A;  1ILK A;  4NI7 A;  1N1F A;  3BPO A;  4YQX A;  2LAG A;  1IAR A;  3L5X A;  5E4E A;  4RS1 A;  1HUL A;  1IL6 A;  1ALU A;  1J7V L;  1PW6 A;  2GMF A;  1Z7C A;  4NEM A;  1IK0 A;  3Q1S I;  5L6Y C;  4I77 Z;  1RFB A;  3MZG A;  1CN4 C;  4NI9 A;  1RHG A;  1SCF A;  3EW3 A;  1ITM A;  2H24 A;  2O26 A;  5D28 B;  1BCN A;  3NCF A;  3BPN A;  1IRL A;  1AX8 A;  2IL6 A;  3HHR A;  5D72 A;  1EER A;  4YPG C;  3D48 P;  1HIK A;  3S9D A; 
#chains in the Genus database with same CATH topology
 1YKB A;  4U4V A;  1RCB A;  4DKC A;  4YB9 D;  1A22 A;  4PYP A;  4J05 A;  4OAA A;  3PO2 D;  4A3G D;  4DOH A;  1ITI A;  4A3M D;  2B8Y A;  2VUM D;  4GC0 A;  3SE3 B;  4BBR D;  4DKD A;  5LQB A;  5IYC D;  3WDO A;  1NBP A;  3G9V B;  3DGC L;  5C44 D;  3HOV D;  4IU9 A;  2B5I A;  2Z3R A;  1IJZ A;  3TGX B;  1HUW A;  4Q65 A;  4FA8 E;  1RW5 A;  3UEZ E;  1PV7 A;  1LKI A;  4EXP A;  4PS4 A;  3OG4 A;  2CFP A;  4IKX A;  2Y5Y A;  2KZ1 A;  3OQ3 A;  5KNH I;  4IKW A;  1M49 A;  5FLM D;  3PIW A;  1P9M B;  5IP9 D;  4IKY A;  4NI7 A;  4A93 D;  2GMF A;  1ALU A;  4IKZ A;  2JA5 D;  1Z7C A;  3Q1S I;  2R93 D;  3HOW D;  4I77 Z;  3MZG A;  1CN4 C;  1RHG A;  3I4M D;  3EW3 A;  4D2B A;  1BCN A;  3BPN A;  5IYD D;  1AX8 A;  1EER A;  1CNT 1;  4TPH A;  3DI3 A;  4LEP A;  4ZWC A;  3NPZ A;  2B8Z A;  2CYK A;  4CNI C;  2Q14 A;  3EJJ A;  1BGE A;  4LRL A;  1BUY A;  4IKV A;  2CFQ A;  4BY7 D;  1PGR A;  1HIJ A;  3QWR B;  4BBS D;  1CD9 A;  5C3E D;  5TS9 A;  1INR A;  4Z5R D;  1Y6N L;  3HMX B;  4D2C A;  1PV6 A;  3INK C;  1FYH A;  4A3E D;  1CSG A;  3DLQ I;  2INT A;  1PVH B;  4XNI A;  1M4R A;  1ETE A;  3BPL A;  4GBY A;  3QB1 A;  2Q98 A;  1BGD A;  1JLI A;  1M4C A;  1Z92 A;  2B91 A;  3I4N D;  5C7X A;  1EKU A;  4BY1 D;  5IP7 D;  3LB6 A;  2R7Z D;  1F45 B;  1QVN A;  1HWG A;  2O27 A;  4YBQ A;  4QIQ A;  1Y6K L;  4ZS7 A;  3SE4 B;  4IU8 A;  3HHC A;  1Y6M L;  3N06 A;  5EQH A;  3UF2 A;  1A7M A;  5A2N A;  1CYL A;  2B8X A;  5D71 A;  5FHX A;  4A3J D;  4W6V A;  1HWH A;  5GXB A;  4JRE A;  1I1R B;  1ILK A;  4XNJ A;  2JA7 D;  2LAG A;  1IL6 A;  1J7V L;  1IK0 A;  4ZW9 A;  2XUT A;  1PW4 A;  1ITM A;  2H24 A;  3NCF A;  4A3D D;  3D48 P;  1HIK A;  4X51 A;  5C4X D;  1D9C A;  2L3O A;  2D9Q A;  1ITL A;  1D9G A;  5D70 A;  3OG6 A;  2C35 A;  3UF5 A;  1Y14 A;  3QAZ A;  3WCY I;  5D58 A;  3PO3 D;  4NEJ A;  1VLK A;  3D85 C;  1HZI A;  1LQS L;  1WCM D;  4NKQ C;  1M48 A;  2PSM A;  2L3Y A;  4EXN A;  4U4W A;  4GRW A;  2D48 A;  3LB6 B;  5IYB D;  1M47 A;  4JA3 A;  4U4T A;  4A3K D;  1GNC A;  4NN7 A;  5A2O A;  4A3I D;  1AXI A;  5FUC A;  3UX9 A;  4DKF A;  3HOU D;  3DUH C;  1F6F A;  1BP3 A;  3HOZ D;  2E9W C;  1ITF A;  1Y1W D;  2R92 D;  4APS A;  4YUE C;  1BGC A;  2OQP A;  1GA3 A;  4NN5 A;  5D22 A;  1WU3 I;  4A3L D;  1N1F A;  3BPO A;  4YQX A;  4JR9 A;  1HUL A;  4NEM A;  3HOY D;  5L6Y C;  1RFB A;  1SCF A;  2O6I A;  5D72 A;  3HHR A;  2V8N A;  4NN6 A;  3AYH A;  5EQI A;  3IRH A;  4ZF7 A;  4TPG A;  3QT2 C;  1EMR A;  3HOX D;  4GS7 A;  4OH3 A;  1AU1 A;  3B5K A;  3N0P A;  2HYM B;  5C65 A;  1EXZ A;  3H3V E;  4WRL B;  1HGU A;  1PY2 A;  1M4A A;  3DI2 A;  3QB7 A;  2Q7N B;  3NCE A;  4TPJ A;  3D87 A;  4ZWB A;  4J4L C;  3BES L;  1M4B A;  2B90 A;  4A3C D;  3O7Q A;  1LK3 A;  3PIV A;  3FKI D;  3VA2 A;  2ILK A;  2JA6 D;  1EVS A;  1V7M V;  2LMS A;  2ERJ D;  3L5W I;  4DKE A;  4YDY I;  1KF9 A;  3O7P A;  2XQB A;  1FG9 A;  4D2D A;  3NCB A;  2JA8 D;  1B5L A;  2B63 D;  4O9H A;  1BBN A;  4MHL A;  1V7N V;  2Z3Q A;  3NCC A;  3G6D A;  1Y1V D;  4O6K A;  2B8U A;  3H0G D;  4A3B D;  4BXX D;  1IAR A;  3L5X A;  5E4E A;  5EQG A;  4GBZ A;  4RS1 A;  1PW6 A;  4LDS A;  4ZYR A;  4NI9 A;  2O26 A;  5D28 B;  5D6K A;  4UVM A;  4YPG C;  1IRL A;  2IL6 A;  4A3F D;  5D59 A;  3S9D A; 
#chains in the Genus database with same CATH homology
 4X51 A;  1CNT 1;  1YKB A;  5C4X D;  1D9C A;  1RCB A;  3IRH A;  4DKC A;  4ZF7 A;  3DI3 A;  4YPG C;  2L3O A;  3QT2 C;  1EMR A;  3NPZ A;  2B8Z A;  2CYK A;  2D9Q A;  3HOX D;  1ITL A;  1D9G A;  4GS7 A;  5D70 A;  4CNI C;  1A22 A;  3OG6 A;  2Q14 A;  2C35 A;  3EJJ A;  3UF5 A;  1AU1 A;  1Y14 A;  1BGE A;  3B5K A;  3QAZ A;  4LRL A;  3PO2 D;  3WCY I;  1BUY A;  2HYM B;  3N0P A;  4A3G D;  4BY7 D;  1PGR A;  3PO3 D;  1HIJ A;  4DOH A;  4A3C D;  1ITI A;  1EXZ A;  3QWR B;  4NEJ A;  4A3E D;  1VLK A;  3H3V E;  4BBS D;  4A3M D;  1CD9 A;  1HGU A;  4WRL B;  3D85 C;  3S9D A;  1HZI A;  1LQS L;  1PY2 A;  1M4A A;  1WCM D;  3DI2 A;  4NKQ C;  1M48 A;  2PSM A;  2L3Y A;  5C3E D;  5TS9 A;  3QB7 A;  1INR A;  2B8Y A;  4Z5R D;  2VUM D;  2Q7N B;  1Y6N L;  3HMX B;  4EXN A;  3SE3 B;  3NCE A;  4BBR D;  3D87 A;  4GRW A;  4DKD A;  2D48 A;  3INK C;  1FYH A;  3BES L;  1M4B A;  1CSG A;  2B90 A;  3DLQ I;  3LB6 B;  4J4L C;  2INT A;  1LK3 A;  5LQB A;  1PVH B;  3FKI D;  1M47 A;  3PIV A;  3VA2 A;  2ILK A;  5IYB D;  5IYC D;  4A3K D;  1M4R A;  1NBP A;  3G9V B;  1ETE A;  3BPL A;  1EVS A;  3DGC L;  2JA6 D;  1GNC A;  3QB1 A;  2Q98 A;  5C44 D;  3HOV D;  4NN7 A;  1BGD A;  1JLI A;  1V7M V;  2LMS A;  2ERJ D;  2B5I A;  1M4C A;  1Z92 A;  3L5W I;  2B91 A;  4A3I D;  3I4N D;  2Z3R A;  5C7X A;  1IJZ A;  3TGX B;  1HUW A;  1EKU A;  4DKE A;  1RW5 A;  4FA8 E;  4BY1 D;  4YDY I;  5IP7 D;  1KF9 A;  3LB6 A;  3UEZ E;  2R7Z D;  1F45 B;  1QVN A;  2XQB A;  1HWG A;  1AXI A;  1FG9 A;  2O27 A;  5FUC A;  3UX9 A;  1LKI A;  3NCB A;  4DKF A;  2JA8 D;  4EXP A;  1Y6K L;  3HOU D;  3DUH C;  4PS4 A;  1F6F A;  3OG4 A;  1B5L A;  4ZS7 A;  3SE4 B;  2B63 D;  1BP3 A;  4O9H A;  3HOZ D;  2E9W C;  1BBN A;  1ITF A;  2KZ1 A;  3OQ3 A;  4MHL A;  1Y1W D;  3HHC A;  5KNH I;  2R92 D;  1Y6M L;  3N06 A;  3UF2 A;  1V7N V;  4YUE C;  1A7M A;  2Z3Q A;  1BGC A;  3NCC A;  1CYL A;  2OQP A;  2B8X A;  1GA3 A;  3G6D A;  4NN5 A;  1M49 A;  5D71 A;  5D22 A;  5FHX A;  1Y1V D;  4A3J D;  5FLM D;  1HWH A;  1WU3 I;  3PIW A;  4A3L D;  1P9M B;  4O6K A;  5IP9 D;  1I1R B;  2B8U A;  4A3D D;  1ILK A;  2JA7 D;  4NI7 A;  1N1F A;  3BPO A;  3H0G D;  4A93 D;  4A3B D;  4YQX A;  4BXX D;  2LAG A;  1IAR A;  3L5X A;  5E4E A;  4RS1 A;  1HUL A;  1IL6 A;  1ALU A;  1J7V L;  1PW6 A;  2GMF A;  2JA5 D;  1Z7C A;  4NEM A;  1IK0 A;  3Q1S I;  2R93 D;  3HOY D;  5L6Y C;  3HOW D;  4I77 Z;  1RFB A;  3MZG A;  1CN4 C;  4NI9 A;  5IYD D;  1RHG A;  1SCF A;  3I4M D;  2O6I A;  3EW3 A;  4A3F D;  1ITM A;  2H24 A;  2O26 A;  5D28 B;  1BCN A;  3NCF A;  3BPN A;  1IRL A;  1AX8 A;  2IL6 A;  3HHR A;  5D72 A;  1EER A;  4NN6 A;  3D48 P;  1HIK A;  3AYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...