4X57B

Structure of an arabidopsis e2 / membrane-anchored ubiquitin-fold protein complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
PEEESIDIKFRLYDGSDIGPFRYSAASTVDFLKQRVVSDWPKGKTVVPKGINEVKLISSGKILENNKTVGQCKTPFGDIAGGVIVMHVVVQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an Arabidopsis E2 / Membrane-anchored Ubiquitin-fold ProteinComplex
rcsb
source organism Arabidopsis thaliana
molecule tags Ligase/protein binding
molecule keywords Ubiquitin-conjugating enzyme E2 8
total genus 19
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4x57B00
1VCBA 2MSED 2KWCA 3APCA 2BWES 1P0RA 3VUXA 3W1SC 1WGHA 5L95C 2NBWB 2N9PC 3PRPB 5EDSA 1TBEA 3QCAA 4JL9A 3V62A 3R3MA 4YL8A 5HKHA 4EZJA 3MTNB 4KVGB 3L13A 1MG8A 2IO3B 2PEAA 5CX3A 3JSVB 2JPHA 2LVQA 2KTRA 4MSQB 1NBFC 4NJ7A 4DDID 3WIMA 2KX0A 4DDGD 3ZNHB 1E5WA 1E90A 1KJTA 3W1SA 1WJ6A 2Z59B 1EF1A 2EMSA 2LI5A 4HDOA 4JGHB 2KNBA 4IWOA 4MELA 3AI5A 2KK8A 4FBJB 2D3GA 2V1YA 1L7YA 2DZIA 2OOBB 3UIPB 2ZPNA 3M3JA 4PS3A 2MP2B 2LWPA 2N4FA 1ZGUB 4ZYNA 2MP2A 3CSTA 3ONSA 4I6LB 2PE9A 4DBGA 5KHQA 3JW0X 4GN1A 3QQ8B 3U7DA 3DCGA 2MBQA 4II2B 3ZO5B 1J0GA 1WR1A 2O2VB 4LDTB 2AEHA 4G3XB 1Z5SB 4E71A 4IUMB 2YLMA 3U30A 3KYCD 5D2MB 4BKGA 2A5UA 1EF5A 2CR5A 2ZEQA 3DDCB 2KDEB 2GOWA 3ZVVA 4HXDA 4M8NA 1J8CA 1T0YA 1OEYJ 4IW0A 2AL6A 4NAWA 2C7MB 2DYMA 1M94A 2L05A 4FJVB 3TBLD 2DYOA 2HTHA 4ZRKA 1WXAA 2XK5A 4MGKE 1P98A 3K9OB 1E8XA 1GNUA 4W9HA 2OJRA 2MA9B 3APDA 4PS8A 2K8CA 4G50A 2IYDB 3DBLI 4FHJA 2MRPA 1XT9B 4NQKE 1YIWA 3VAWA 1NDDA 2FNJB 3ML9A 4MJSB 1BT0A 2G3QB 4KIKB 3R7QA 1WGRA 1GG3A 1Q1OA 3DVNU 1YX6B 3WAMA 5CHVC 1WJ4A 1V81A 3ZRFA 1XD3B 4A3PA 4EFOA 2KJRA 3R66C 4KV2A 2KHWB 3CMMB 2JVCA 3KVFB 2DAFA 1WYWB 2KMAA 3UGBB 4ANUA 3APFA 3WAOA 1YX5B 3IFWB 2D11A 4HWIB 2RSUA 5GMVA 1E8ZA 2AYOB 4KSKC 1WZ0A 1Z2MA 4E74A 4AP4C 1K8RB 4EZKA 2M17A 1TTNA 2KJ6A 2M1MA 4E3CA 2MW5A 2KMCA 2CHZA 4X57B 2J0MA 2NR2A 5C1ZA 2N1WA 3ENEA 2KDBA 2N7EA 3KUCB 3K9PB 2KANA 4WJNA 1R4MI 4ICUA 3PHXB 1WE6A 3L17A 4BKSA 2R2OA 3OJ4B 3RT3B 4W9LA 3KYDD 3UQAA 4FN2A 4TUUA 3DBHI 3ALBA 1D3ZA 5JZEB 2R2QA 1YQBA 4F8CB 2GBRA 1AARA 2BYFA 3EFUA 3H7PA 3ZW3A 4DXAB 3B0AA 2JWZA 2KXJA 3H7PB 2KZRA 1SE9A 2KFJA 4HPLB 3UF8A 4GDKB 4NQLB 1WM3A 3EHVA 1LXDA 4GDKA 3ZIMA 3QK0A 3RYTA 4DHZB 4WJOA 2M0XA 4M8MA 1JRUA 3B1LX 3VTWA 3V60A 3NHEB 1WZ3A 4ICVA 3UIOB 3DBSA 3VXWA 2LRUA 2FCMA 2KQ7A 5DPWA 2ZNVB 3PGEA 4XX5A 2J7QB 4KSLC 3VUWA 5CHFA 4DK5A 4MSMB 1C1YB 1Y8RC 3SHQA 3NY5A 2IO0B 2MCNB 3ZRCA 3KH0A 4DHJB 3A9JB 5KHOA 1C3TA 3VQIA 4EOYA 1S1QB 3QHTA 1PQSA 4KDIC 5D7GA 5DPRA 3S2AA 2BF8B 3PTFC 4BVUC 2DZMA 3PV1A 5FR6A 2GBJA 4WWPA 1ISNA 2ZJDA 3GOEA 4K7UA 4M0WB 3LDZE 4B9KA 3KUDB 1WIAA 2KOXA 4K81A 4NJ6A 5IA7A 4TKNA 2G4DB 4JLCA 1V6EA 3C0RB 3PSEB 1YD8U 3RCZA 4CHKA 3CF6E 3OAWA 4GMVA 2L0FA 2I1KA 4WJPA 3AXCA 2NVUI 4RMAA 4OVUA 4FJYA 3UINB 2KJHB 3JSVA 3M95A 4HK2A 3AU5A 3DPDA 4K1RB 2G4SA 3PS6A 4MDKE 4W9EA 4MGZE 3L08A 3LJ3A 5AEKB 4NNJB 5DCNA 2XBBC 5LXIB 2DENB 1HE8A 2LASA 2GBNA 1S3SG 3V6CB 4TQ1A 3WAPA 3ZUNA 3A4RA 2AWTA 2REXA 4DHZE 4IWPA 2HJ8A 2YVCA 5AZGA 1V2YA 3A4SC 4IWQA 1P9DU 4BKTA 2FCSA 3QAQA 3L10B 4GGQA 1RAXA 2J0JA 1UELA 1LM8B 2MX2A 4LJOB 4FADA 4PYZA 2BKRB 3PT2B 4HJKA 1WE7A 2KN5A 2L00B 2WX1A 3QARA 3ECIA 3H9DA 1ZW7A 4K7WA 3VHTC 2BGFA 3L16A 2LUEA 3N32A 3PLUA 2C7NB 3HIZA 4A20A 4BFRA 5E6PA 1WJNA 1RLFA 4BOZB 3ZNZB 1WMHA 1H8CA 4BBNF 3M63B 1Q0WB 2CS4A 2RGFA 3D32A 1GJZA 2FCQA 2KDFB 2L8JA 2HE7A 4XC2A 5G2NA 4MGIE 4W9FA 4G11A 5BO4B 2JUOA 1WH3A 4ANWA 2FCNA 2LD9A 5LLIA 3TMPB 2DX5B 3NZSA 1KM7A 2CKHB 2N9XA 4FLHA 5AZHA 4RM9A 1A5RA 2LJ5A 4HDQA 5DPSA 4IG7B 2DHZA 3PHWB 2D07B 4FJZA 4K7SA 2NPTA 3KUZA 3HHMA 4AUQC 2Z0EB 4W9CA 4F1SA 3TJPA 4WQOB 4MGYE 2LRWA 2IY0B 2Z0DB 2BPSA 4WWNA 1WR6E 3ZKJC 4AJYB 3V61A 3IG3A 1RFAA 3OJ3A 4MEMA 1WX8A 3DVGX 2D2QA 2NBVB 4W9DA 2BWFA 1WX9A 4W9KA 1TZ1A 1EUVB 2O2VA 4BOSC 4FHKA 4KZCA 1LFDA 2JRHA 2WX0A 3QC8B 1EO6A 3BINA 4I6PA 3QIJA 1WY8A 2IO1B 3X23A 5E6NA 4NPNA 3VH3B 3I3TB 3N3KB 2M8SA 4LDTD 1ZKHA 2AL3A 4GXBA 1WJUA 4EKUA 1U4AA 2KWVB 2LGYA 2N7DA 3AU4A 2EKEC 5J18A 2MBOA 1WGGA 2FIDA 1Q5WB 2W9NA 5IAAC 1V80A 3VTVA 1E7UA 4AOFA 2ZZPB 1WGYA 3ZDTA 1V9JA 5E6OA 2KDIA 3A1QA 2JY6A 2UWQA 2LVPA 4RM8A 2O6VD 5C23A 2CHXA 2MBHA 2JZZA 2WYQA 5JHBA 2JRIB 2K25A 1P3QU 1E8WA 3DVNV 4JQWC 4WJQA 4AWJA 2NS5A 4ZRIA 3SD5A 2J0KA 3JYUA 2KLCA 3A9KA 3RUIB 3T9LA 1WRDB 2LVOA 3N30A 3VDZA 4DWFA 5LXHA 1GC7A 3TL5A 3NOBA 2O6VA 3PPAA 2LGDA 2GBMA 2ZNVC 4B6WA 1OEYA 2PE6B 2PPHA 3DVGY 3U8ZA 4ASWC 2L0TA 3PRZA 3RZFA 1GUAB 2K8BA 1WM2A 1E8YA 2KX3A 1WGDA 5CTRC 2A4ZA 3EECA 3PREA 4CYEA 2XK5B 3VVWB 4TQ0A 4KDLB 2JZ3B 4GDLB 3WA0A 5J2RA 2C7HA 3W1YA 2MBEA 2HD5B 3IBEA 1WX7A 1SIFA 4TV3A 2IY1B 3VH4B 3QJZA 5AZFA 3PRMB 3DOWA 5CHWA 2LXAA 2I1JA 1SGHA 2JF5A 1I42A 2RPQA 3GZNI 3HM6X 3X0WA 3ZDMC 1IYFA 2KTRB 3H7SA 3IHPC 3A33B 2L76A 3KW5B 5JHAA 4KIKA 2Y5BB 2KWUB 2BYVE 4GU2A 2C60A 1UGMA 3RULA 3ZNID 3QA8A 4WAAA 4CO7A 2MQJA 2ZVOA 1CMXB 2KFKB 2JT4B 3TIXA 4J6IA 1R4NI 4ANXA 1UH6A 1H4RA 1GC6A 1TGZB 4WWOA 2VRRB 1V5TA 1P1AA 3HK0A 3O65B 2ASQA 2NPTB 1F9JA 5DPTA 4EEWA 2EMTA 4W9GA 3B08A 1UBIA 4BKSD 2JXXA 3L0WB 3SDLC 2KQSA 1IP9A 3JVZX 4IC7B 4ZRJA 2KO3A 1OGWA 1WMHB 2CHWA 3EC8A 3P2BA 3SU8X 2K6DB 4IM0A 5D6JB 1KLVA 3R7RA 1UBQA 3WANA 1WF9A 2ZPYA 4BBNC 1QZEA 2B3AA 2KVRA 2QHOA 2K39A 1LQBA 3A9JA 4N9F4 3DBRI 4W9IA 3A9KB 3RZWC 3CSFA 1NI2A 1J19A 2WWZA 4G0NB 2KFKA 1L2NA 4PS7A 2D10A 4MM3A 3PZDA 5D94A 1YJ1A 3AULA 3ZTCA 1E7VA 3ZTDA 3Q3JA 4GSWA 2KC1A 2K1FA 4HCPB 1UZXB 2FIFA 2KD0A 2DZJA 2LZ6A 2MLBA 2L7RA 3IVFA 2L3ZA 4HPMB 4GIVA 2IZVB 4OVVA 2UYZB 2DYBA 1V86A 3OLMD 2MBBB 4II3B 1UD7A 2K6QA 2ZVNA 3UQBA 2K8HA 3NZUA 2RR9A 4LCDE 3ZLZA 1WI0A 4HVBA 1VD2A 3H6NA 2KTFA 3VUYA 3ZNGC 4A3OA 4B95A 4EUTA 2FAZA 2N9EB 4GB9A 4IM3A 1I35A 1RRBA 4LJPB 3VFKA 2NBUA 4I6NB 4IM2A 2KLGA 4P7IA 2NCNA 3M62B 1G6JA 3ML8A 5L83A 3Q3FA 4FULA 2O6VB 3DQVA 2GMIC 1XQQA 3V6EB 2N1VA 1OQYA 2ZCBA 5TR5A 2WDTB 2BYEA 1IPGA 2G45B 1FXTB 4JIOU 3PLVA 2CU1A 2ZCCA 4EZLA 2V4LA 4HLEA 4NY0A 3MHSD 2KC2A 3A1QB 2IO2B 4ZDVA 2M4NA 1WXVA 4ANVA 3TCAA 2GBKA 3QWZB 3BY4B 1WFYA 4XZ4A 2PJHA 3HM3A 4MJSA 2DAJA 1V49A 3H1UA 3L54A 4MH0E 4KZ0A 3NS8A 2DZKA 5G55A 2BKFA 2RD0A 2LGXA 1V5OA 4URKA 1KOTA 5JH5C 2KKCA 3WALA 2IBIB 3RD2A 3PVLA 5J17A 4PYUA 3VTUA 3T8MA 2XEWA 4HCNB 4W9JA 1WXMA 2C9WB 1X1MA 4AJWA 2C5LC 2V3SA 2MWSB 3QX1A 2LXCA 4NAWB 4F7ZA 1OTRB 4FA6A 4DHJD 2FUHB 3MJWA 4GOCA 1WXSA 4GDLA
chains in the Genus database with same CATH superfamily
2MSED 1P0RA 1WGHA 5L95C 1FNWA 3ZYYX 4A90A 1TBEA 3QCAA 4JL9A 3R3MA 3P4SB 5HKHA 1FXAA 4KVGB 3L13A 2IO3B 2KX0A 1V1OA 3MJ5A 1KJTA 1WJ6A 1WSPA 2EMSA 3P42A 4HDOA 2KNBA 3Q8EA 1FD6A 2KK8A 2PVGC 2V1YA 4DQOC 2DNFA 3N1YC 2ZPNA 2G9HD 3CWIA 2WXFA 2MP2A 3CSTA 2PE9A 2NTSA 3JW0X 3ZO5B 1J0GA 3N9YC 4LDTB 2XNAC 2AEHA 4G3XB 2V3PA 2YLMA 3KYCD 5D2MB 2A5UA 3ZVVA 1WXQA 2GOWA 4HXDA 4M8NA 5G5HA 1OEYJ 4IW0A 1N5XA 1IUEA 3VR9B 2DYMA 4FJVB 1WXAA 2XK5A 4PT5A 1P98A 1GNUA 2IYDB 2LGIA 5H92C 4YTNB 3DBLI 3LXFA 1XT9B 3Q8FA 1YIWA 2GB1A 2FNJB 2G3QB 4KIKB 1XLOA 3WAMA 1TS3A 3GE8C 1WJ4A 4HKQA 4A3PA 2JVCA 1WYWB 4HROA 1N61A 3UGBB 2IGDA 1JWSD 1UWMA 1PGXA 1VLBA 4AP4C 4EZKA 2M17A 1C77A 2KMCA 2CHZA 4X57B 5HG2A 5C1ZA 3DBLB 1J7AA 4YTPB 3KUCB 1IBXA 4ICUA 4B0EA 3L17A 1WRIA 3W9CB 1WYGA 3UQAA 4TUUA 1D3ZA 3DBHI 2R2QA 2GBRA 1AW7A 4DXAB 3GS2A 4JE3B 2KZRA 3N1ZC 2KFJA 3UF8A 1V97A 1HTQA 4WJOA 3AB5A 5BMHA 1WWTA 2L83A 2QILA 2FCMA 3PGEA 2AQ1B 4DK5A 2MCNB 3KH0A 3A9JB 4MACA 1S1QB 1PQSA 2DZMA 3PV1A 1L5PA 3E56A 1FRRA 1D6EC 2GBJA 3AECB 3KUDB 1WIAA 1TKEA 1EWYC 2G4DB 1YD8U 4CHKA 3OAWA 2HJ1A 4RMAA 2VZKD 4RFBA 4HK2A 1GPXA 1YNTE 4K1RB 2G4SA 2KMMA 2JU6X 2BS2B 3LJ3A 2WNMA 2LASA 2GBNA 1S3SG 1E6EB 2WXOA 4TQ1A 3WAPA 4ARCA 2REXA 3U2SC 4DHZE 1UWXA 3AE7B 4LNOA 3NVVA 2VZKB 4IWQA 3QAQA 3L10B 1RAXA 2J0JA 3BIID 2Z8LA 2YEPB 4PYZA 2KN5A 2WX1A 1HTOA 2H88B 3QARA 2LUEA 3PLUA 3MC8A 4A20A 4BOZB 3ZNZB 1JCKB 3ZQ4A 1H8CA 3I5JC 4C7YA 2RGFA 3D32A 1GJZA 2FCQA 1PFDA 1LGRA 2D3CA 2KDFB 1HZ6A 2ICIA 1TYGB 2FCNA 2J53A 4L23A 3TMPB 3NZSA 4WAFA 2LJ5A 2MJ3A 1MVKA 1PUTA 5IKCM 4XWWA 5AUIA 3HHMA 3TJPA 4YSYB 2IY0B 2Z0DB 4KX6B 2LUMA 1TKGA 2MHJA 3IG3A 4MEMA 1WX8A 1CQVA 4W9DA 1FRDA 1EO6A 3BINA 3X23A 1N62A 1QOFA 4EKUA 1U4AA 2EKEC 2KT7A 2FIDA 2MJEA 3AE9B 2W9NA 3VTVA 1E7UA 4AOFA 2ZZPB 3OG5A 1WGYA 1V9JA 2KDIA 3A1QA 2K5PA 2UWQA 3GZNB 2JZZA 3AE4B 2JRIB 2K25A 1VDVA 3AEGB 2I38A 1ZDVA 2D5GA 2NS5A 3AE2B 2KLCA 1WRDB 3N30A 2IPKD 2O6VA 2LGDA 1IGCA 4B6WA 3DVGY 3RZFA 1GUAB 2K8BA 1E8YA 5MPOA 1DGJA 2W82A 2XK5B 3VVWB 3TEWA 2MBEA 2HD5B 3IBEA 3R2IA 1SIFA 3VH4B 3QJZA 5CHWA 2I1JA 2QC8A 4A55A 3HRDD 3A33B 4KIKA 3N20C 1EM7A 2KWUB 2BYVE 4OZBA 2C60A 3ZNID 4WAAA 2MQJA 3P63A 2ZVOA 3LYYA 4RNAA 2WU5B 2UU7A 1N6ZA 2VRRB 1V5TA 2ACZB 2BS3B 3W5VB 4WIPA 1MFWA 4HEA1 4BKSD 2TSSA 5AUKA 3L0WB 4ZRPA 2KQSA 1UBQA 2QHOA 2LHEA 3DWMA 3IAM1 4W9IA 1VR9A 2D10A 1YJ1A 2CJNA 4AS1A 4GSWA 2KC1A 2IDYA 2K1FA 2L7RA 1AYFA 4GIVA 4C80A 2V9HA 2UYZB 1QOGA 3UQBA 2RR9A 3ZLZA 4HVBA 3H6NA 1JALA 2KTFA 4K3BA 4B95A 2N9EB 2NBUA 4I6NB 1JWAD 2NCNA 1P7FA 3DQVA 1CK1A 2BT6A 1SJHD 3PLVA 4BAXA 2CU1A 4HLEA 2SAKA 2M4NA 1SB3C 3TCAA 3BY4B 1FNVA 2KQ4X 4MJSA 2DAJA 1V49A 2Q5WD 4P16A 4EE2A 4MH0E 4KZ0A 2DZKA 1HXYD 4URKA 2KKCA 3WALA 3P4QB 3SEBA 1T5XD 4WH4A 1EU3A 3T8MA 2MEKA 4W9JA 2QSDA 1YQ3B 2C5LC 2Y5PA 2LXCA 1L0VB 4F7ZA 1GB1A 2DWQA 4GOCA 1VCBA 2WXLA 1FEHA 1ZOYB 1F2RC 2N9PC 3PRPB 1JWMD 2HTME 4YL8A 2JYTA 3MTNB 4IOIE 4YTMB 1ZXHA 3V05A 1NBFC 1EWCA 4LNIA 4DDID 1KH0A 4DDGD 3ZNHB 3W1SA 4REZA 4US8A 4JGHB 4IWOA 1BXTA 3VRAB 2D3GA 3FKYA 4ARIA 2OOBB 3UIPB 1R4MB 2LWPA 1XO3A 4I6LB 1YN3A 4DBGA 4GN1A 1CZPA 3QQ8B 3U7DA 1SE4A 3MFGA 3MC0B 1EF5A 2CR5A 1NYQA 2AL6A 1PDXA 3R2TA 1TKYA 2L05A 4YXDB 4ZRKA 1E8XA 1N63A 3VAWA 3ML9A 1YX6B 3IT6B 4EFOA 4KV2A 3Q3MC 3CMMB 3KVFB 2DAFA 1UUPA 4YSZB 3HVDA 3WAOA 4M0WA 3IFWB 2D11A 4HWIB 1KRHA 1SJED 4IKGA 2QIEB 4LLGM 3K9PB 2KANA 3KQ4A 1R4MI 2KACA 2FE8A 1QILA 3OJ4B 3RT3B 4W9LA 2E3TA 2WXGA 2BYFA 3AEBB 3EFUA 3H7PA 1ZP0B 4OVZA 2JWZA 1SE9A 5E6JA 2PW9A 2QMTA 3EHVA 1LXDA 3RYTA 4DHZB 4M8MA 3B1LX 2LJIA 4ICVA 3UIOB 4P1BC 2LRUA 4XX5A 3VUWA 1C1YB 2IO0B 1C3TA 4EOYA 2WXPA 4KDIC 4XGAB 5DPRA 3SR6A 2WXQA 2INDC 1L4DB 3BVZA 3FILB 4LNNA 4WWPA 1ISNA 2ZJDA 2PMVA 1GAQB 1F77A 1QOAA 1V6EA 3C0RB 3PSEB 2KN4A 1KTKA 2NMQA 3L4PA 3CF6E 5EE9A 4L2YA 2L0FA 4WJPA 3AXCA 2NVUI 3UINB 2KJHB 3JSVA 1VRAB 3Q8BA 3PS6A 4MGZE 5AEKB 3P4PB 3DHHC 1BMLC 4XYCA 4MH8A 2L32A 1HZ5A 1MJDA 5D3IB 5JXVA 3FILA 4IWPA 5AZGA 1AN8A 3A4SC 1P9DU 4KGRA 1DOIA 4LJOB 4FADA 3PT2B 2I2YA 2L00B 3ECIA 2BGFA 3L16A 3N32A 1XEEA 4AQ7A 4BFRA 5E6PA 1Q0WB 4XWTA 2L8JA 2HE7A 4G11A 2JUOA 1ZUD2 3TEZA 2DX5B 1KM7A 2CKHB 2N9XA 1A5RA 4HDQA 2D07B 3C19A 3RFZB 4W9CA 1NYRA 4MGYE 4NJCA 4S0RA 2MJDA 4N58A 1QOBA 2RMMA 5FR3A 4S17A 2NBVB 4W9KA 1EUVB 4BOSC 1JQ4A 1EU4A 1LFDA 1FMAD 3QC8B 4LNFA 4RH6A 1WY8A 2IO1B 2L52A 4XE0A 4MT5A 5E6NA 3VH3B 3N3KB 1ZKHA 3AE3B 3URYA 3Q2AC 5J18A 2MBOA 1F2RI 1C78A 1V80A 1ET6A 2JY6A 4A6QA 3AE8B 3U7ZA 2O6VD 1E10A 2CHXA 5JHBA 1P3QU 4AWJA 1OQQA 3UI3A 3SD5A 3NJTA 2J0KA 3A9KA 3T9LA 1GC7A 3Q3OC 2X38A 5IN7A 1PGBA 1OEYA 2PPHA 3PREA 4UDUC 3NVYA 3WA0A 4GDLB 5J2RA 5FKAC 5I4DA 1RFKA 2C7HA 4FXCA 3W1YA 1WX7A 2IY1B 5AZFA 3PRMB 3DOWA 2JF5A 3GZNI 3HM6X 1IYFA 2QCZA 2L76A 1I4XA 2Y5BB 3AEDB 3IAS1 3O13A 3RULA 2IGHA 1RWSA 4CO7A 3TEXA 2KFKB 3TIXA 4J6IA 1R4NI 1SEBD 1STEA 1UH6A 4OZAA 3ZXVA 2RDGA 2E6XA 5IOIA 2NPTB 1T0RC 1ENFA 3SDLC 3JVZX 2KO3A 2LGSA 3P2BA 5D6JB 4JWUC 4RGMA 3R7RA 1KLVA 1WF9A 4BBNC 2K39A 1LQBA 3FAHA 3RZWC 4G0NB 2WWZA 2KFKA 3CIRB 4ITKA 4RF0A 3PZDA 1V1PB 1XLNA 3W5UB 1E7VA 4HCPB 2FIFA 1XLPA 2KD0A 3PZ8A 2LZ6A 2IZVB 1MG4A 4II3B 2WXMA 2K6QA 1FCLA 2ZVNA 3Q8AA 3IXSA 4LCDE 4ZYSA 1N5WA 3ZNGC 4A3OA 4EUTA 4ZHOA 4IM3A 4LJPB 3VFKA 5BMGA 1J7BA 1K52A 1G6JA 3AM9A 4JWSC 3J9CA 2WP9B 1OQYA 2ZCBA 5TR5A 1FFUA 2G45B 4NZLB 4JIOU 3MHSD 3A1QB 2IO2B 2M19A 3Q8CA 2PJHA 3IT4B 2RD0A 2LGXA 3RN9C 1KOTA 1UGJA 2BQQA 3PVLA 1HEZE 5J17A 4PYUA 2XEWA 4HCNB 3QX1A 1FFVA 4NAWB 4FA6A 4DHJD 1IPGA 3SU8X 3KWVA 2KWCA 3APCA 1SSNA 1XLQA 3DHGC 3V62A 4EZJA 1JMLA 3B2GA 2LVQA 2V3NA 2KTRA 4NJ7A 3BK1A 1HQRD 3WIMA 4LTUA 5C2TB 1XXGA 2Z59B 4MM3B 3SFDB 2FUG1 2INNE 4HRSA 1ACCA 1T6BX 5TSSA 3ZJUA 3AI5A 4FBJB 3NRZA 1ZGUB 2VH2A 5KHQA 2G1EA 3DCGA 4II2B 4YSXB 1WR1A 4LK0M 2YEPF 4E71A 3U30A 1K50A 3DDCB 2GI9A 1VZ6A 2ZEQA 4C56C 2C7MB 3ABVB 3TBLD 2DYOA 3K9OB 2QDFA 4LNKA 4C7ZA 1D5XC 3APDA 2K8CA 4RCOA 4FHJA 1YJJA 3R7QA 1WGRA 1V81A 1T0SC 1XD3B 1TJEA 2KJRA 4L1BA 2KMAA 2CU3A 2WDQB 4P1CC 2J4XA 2LHDA 4ANUA 2J42A 2PLPA 2WXJA 3LB8C 2RSUA 1T3QA 1E8ZA 1WZ0A 1OFFA 1Z2MA 3EUB2 2KWDA 1JROA 2J0MA 4KKIA 2NR2A 3C8YA 1I7HA 2N1WA 2KDBA 2N7EA 1YOVB 4WJNA 1K51A 1WE6A 2R2OA 3BYYB 4FN2A 3NVZA 2KVZA 3ALBA 4YT0B 4B0MA 5JZEB 4F8CB 1B9RA 1R4NB 1AARA 3ZW3A 1I4RA 5HI1A 2KXJA 3H7PB 1TZOA 4GDKB 4NQLB 2GRIA 1JRUA 1RYJA 2WXNA 3DBSA 3VXWA 1C76A 1Q10A 5DPWA 1QQRA 2J7QB 4KSLC 4MSMB 1Y8RC 4NAMA 3ZRCA 3NY5A 4DHJB 4DXGA 3VQIA 3S2AA 3QHTA 2BF8B 3PTFC 1V1PA 3E9SA 1OQRA 5C3JB 4B9KA 4M0WB 1FNUA 2D3BA 1FPYA 4K81A 2PTLA 4TKNA 4JLCA 3RCZA 5BYRA 3ZJTA 3GB1A 1ROEA 4OVUA 3BVGA 4FJYA 3M95A 4RGNA 3AU5A 3DPDA 2WS3B 3HUIA 4W9EA 4NNJB 2XBBC 2BBCA 5LXIB 2DENB 3V6CB 2KDMA 3DHIC 2RDHA 2AWTA 4US9A 3FC4A 4KKJA 2YVCA 4BKTA 2N7JA 4GGQA 2BB5A 2RDBC 1UELA 1LM8B 2MX2A 3DBRB 4HJKA 3VRBB 2KYWA 1K53A 1MI0A 4K7WA 1ZW7A 3VHTC 2ZW1A 3MC9A 4USAA 3NVWA 1WJNA 1RLFA 3NUHB 1WMHA 1L0YB 3EFCA 3M63B 1NENB 2SEBD 4XC2A 1SIJA 1TS4A 3RNGC 3T3OA 5BO4B 2CJOA 2LD9A 1UNSA 5AZHA 4RM9A 3AEAB 4IG7B 2DHZA 3W2DA 4K7SA 3KUZA 4AUQC 4KGTA 4WQOB 3ZKJC 1WR6E 2JXTA 4ZOHC 1RFAA 2D2QA 2BWFA 1TZ1A 2O2VA 4FHKA 2JRHA 1D5MC 4HPPA 3EGRA 2VH1A 3QIJA 4NPNA 3I3TB 2M8SA 4LDTD 2AL3A 4GXBA 1WGKA 2KWVB 3AU4A 1WGGA 3EA6A 1Q5WB 5IAAC 3RI7C 2LVPA 2MBHA 1LO5D 5EE3A 3BK2A 4DWFA 2LVOA 5LXHA 3TL5A 3NOBA 2GBMA 2ZNVC 2PE6B 3U8ZA 4ASWC 2L0TA 3PRZA 1L0XB 1WGDA 5CTRC 2A4ZA 3EECA 4KDLB 1RM6C 3DWGC 3ZJVA 5BMIA 3AEEB 2LXAA 3X0WA 2JZPA 2KTRB 3H7SA 3KW5B 5JHAA 1T0QC 1F52A 4GU2A 1ZDXA 1UGMA 3AEFB 2Y5CA 3BVMA 4M02A 2JT4B 4ANXA 1TGZB 1GC6A 1IGDA 1ET9A 1P1AA 2M0AA 3HK0A 4OW0A 2BTEA 5DPTA 2EMTA 1UBIA 1XCTL 2JXXA 1QLBB 3SFEB 2K22A 5IO9A 3EC8A 1SF0A 3U52E 3N1XC 2ZPYA 1VZ7A 2B3AA 5FK9C 4N9F4 5BYQA 3DBRI 3A9KB 1SE2A 3CSFA 1F0ZA 2K0PA 2X8XX 5HHDG 4PS7A 5D94A 3ZTCA 2Y3AA 1UZXB 4J3OD 3V3XA 2DZJA 3IVFA 2L3ZA 1YN5A 2MH7A 2DYBA 1V86A 2MBBB 1UD7A 1YMHE 2K8HA 3NZUA 1WI0A 2WU2B 2JWUA 1YJIA 2H89B 1D4BA 4IM2A 2KLGA 2XN9C 2GLSA 3ML8A 1BUIC 3Q3FA 1C4CA 2O6VB 2V4IB 3RNBC 3V6EB 1XQQA 2BYEA 4TMAB 2JQRB 2ZCCA 4EZLA 2V4LA 3TSSA 3VR8B 4ANVA 2GBKA 4O1NA 1WFYA 4XZ4A 3H1UA 3L54A 3NS8A 5G55A 4JPSA 5JH5C 1I4HA 1L6VA 1Y56A 1MHHE 3VTUA 1TS5A 1XCQL 1WXMA 1QT9A 1X1MA 4AJWA 5LNK1 3R66C 1WXSA 4GDLA 3RMKC 1MHXA 1C79A 4Q2JA 2BWES 2K9XA 3VUXA 3W1SC 2NBWB 5EDSA 5T8IA 4N59A 1MG8A 2PEAA 5CX3A 3JSVB 2JPHA 4MSQB 4HJGE 2WQYB 2LFIA 2ONQA 1E5WA 1E0ZA 1E90A 2BYTA 1ESFA 4C4VB 1EF1A 2LI5A 4MELA 2HDEA 1L7YA 1ZXIA 2DZIA 1QF6A 3BYTB 3M3JA 4PS3A 2MP2B 2N4FA 4ZYNA 1V8CA 3ONSA 2IGGA 2W54A 1C4AA 4C00A 1SE3A 2MBQA 1MPEA 2O2VB 3MP9A 1Z5SB 5EE0A 4IUMB 3AV8A 3RNFC 4BKGA 2KDEB 1I4GA 1CJEA 2WXHA 1J8CA 1T0YA 4NAWA 3Q69A 2BW2A 1M94A 2HTHA 4MGKE 4A8XC 4H2AA 4PK1A 4W9HA 5HFYA 2OJRA 1SXTA 2MA9B 4PS8A 4G50A 2ZW0A 2MRPA 2N9KA 3B9JA 4NQKE 1NDDA 4MJSB 3ZGZA 1BT0A 1C4PA 1FIQA 1GG3A 1Q1OA 2W55A 3DVNU 5CHVC 3ZRFA 2KHWB 4JX1C 2WDRB 3APFA 3Q14C 1YX5B 5GMVA 2AYOB 4KSKC 4E74A 1K8RB 1TS2A 4OHJA 1TTNA 2KJ6A 2JX5A 2M1MA 4E3CA 2MW5A 2M56B 1E9MA 4RGTA 3ENEA 2LEKA 3RNAC 4OZCA 3KWLA 2OHFA 3PZ7A 3PHXB 1A70A 2AQ2B 4BKSA 2DLBA 5D3DA 2N9LA 3KYDD 4M01A 2B76B 2WXRA 3NZ3A 2OJWA 1YQBA 3Q6BA 3B0AA 2BS4B 3ETRA 1J7CA 4HPLB 1M4VA 2PKOA 1WM3A 1PGAA 4GDKA 3ZIMA 3QK0A 2M0XA 3VTWA 3V60A 3NHEB 1WZ3A 2KQ7A 2ZNVB 5CHFA 3NG0A 3SHQA 5KHOA 2J52A 3OWEB 5D7GA 4BVUC 4XDCA 1N60A 5FR6A 1TY2A 3GOEA 4K7UA 3LDZE 2OEDA 4IDIA 1FXIA 1TY0A 2KOXA 4NJ6A 5IA7A 2WXIA 2RPVA 4GMVA 2JYEA 2I1KA 2DBYA 3AE6B 4MDKE 3L08A 5DCNA 1HE8A 1NI3A 3ZUNA 3A4RA 3I57A 2BVCA 2HJ8A 1V2YA 3RNEC 2FCSA 3AN1A 1I4PA 3U4EG 2BKRB 1WE7A 3RNCC 3RPFC 1SBBB 3AMZA 1AWDA 3H9DA 2C7NB 3HIZA 2V0GA 1KFYB 2FBWB 4BBNF 1FM0D 3AH7A 3GE3C 1GOZA 2CS4A 1TT5B 4K3CA 1L6UA 4ZRQA 5G2NA 4MGIE 4W9FA 1WH3A 4ANWA 5LLIA 3R8BA 4WQMA 4FLHA 5DPSA 1VZ8A 1B1ZA 3PHWB 2PVOD 4FJZA 2NPTA 1FCCC 2INPE 2D3AA 3BZDB 4ACFA 2Z0EB 4F1SA 3AE1B 1DOYA 1DOXA 1XF5L 2LRWA 3NS1A 4WURA 2BPSA 4WWNA 4AJYB 3V61A 4GLSC 3OJ3A 3DVGX 1WX9A 2EELA 4CQNA 4KZCA 4N6EB 2WX0A 3WCQA 4A9AA 4I6PA 2LMCA 2NTTA 3ZXRA 4C4VA 1HA5A 1WJUA 2IJ0A 2ON8A 3DBHB 2LGYA 2N7DA 3P4RB 1I4QA 2AX5A 1NVID 1F1HA 3ZDTA 5E6OA 1JWBD 4RM8A 5C23A 1E7PB 2WYQA 4QAYA 5BYSA 3HVZA 4HKZE 1E8WA 3DVNV 4JQWC 4WJQA 4ZRIA 3JYUA 3RUIB 3VDZA 3B2FA 4WWMA 3PPAA 3I9V1 4ZHPA 3KLSX 5GXGB 2JSVX 4RGOS 1JWUD 5G5GA 2WXKA 1WM2A 2KX3A 1KF6B 5EE1A 4CYEA 4M00A 1PYWD 4TQ0A 4TSSA 2JZ3B 1YN4A 2W3RA 3I63C 4TV3A 1DYQA 1L4ZB 1SGHA 1I42A 1IBXB 2RPQA 1KLUD 2N0SB 3ZDMC 3IHPC 4YWGG 1VJKA 1R7SA 1ZPSA 3QA8A 2WLBA 1CMXB 2KAJA 1KLGD 1H4RA 4WWOA 2W3SA 3T3NA 3AE5B 2WDVB 3O65B 2ASQA 4EEWA 1F9JA 4W9GA 3B08A 2WHIA 3H8HA 3GP7A 3PO0A 1IP9A 4IC7B 4ZRJA 1OGWA 1WMHB 2CHWA 2K6DB 2QJLA 4IM0A 3WANA 3BWUD 1QZEA 2KVRA 1P7EA 2BB6A 3A9JA 3TEYA 1NEKB 1NI2A 1J19A 1L2NA 5H8YE 4MM3A 3AULA 1YQ4B 3ZTDA 4DXFA 3Q3JA 5IP4D 2MLBA 4HPMB 4OVVA 2PIAA 3OLMD 1ZE3D 3TUOA 1VD2A 2INCC 3VUYA 3Q3NC 4D2KA 2FAZA 4GB9A 1I35A 1RRBA 4P7IA 3M62B 1QKZA 5L83A 4FULA 2GMIC 2N1VA 2WDTB 1JRPA 1FXTB 4P6VF 4BZAA 2EKIA 4NY0A 2KC2A 3MHZA 4ZDVA 1GB4A 1WXVA 3QWZB 1TIFA 3HM3A 1JW9D 1FO4A 1UF0A 2L1AA 2BKFA 4XDDA 1C9FA 1V5OA 4KGSA 2IBIB 3RD2A 4RF1A 2WGSA 2C9WB 2AQ3B 2MWSB 2V3SA 2R61A 1OTRB 4R3DA 2K3UA 2FUHB 3MJWA 2QEJC 1D5ZC 3P1MA
chains in the Genus database with same CATH topology
1VCBA 2MSED 2KWCA 3APCA 2BWES 1P0RA 3VUXA 3W1SC 1WGHA 5L95C 2NBWB 2N9PC 3PRPB 5EDSA 1TBEA 3QCAA 4JL9A 3V62A 3R3MA 4YL8A 5HKHA 4EZJA 3MTNB 4KVGB 3L13A 1MG8A 2IO3B 2PEAA 5CX3A 3JSVB 2JPHA 2LVQA 2KTRA 4MSQB 1NBFC 4NJ7A 4DDID 3WIMA 2KX0A 4DDGD 3ZNHB 1E5WA 1E90A 1KJTA 3W1SA 1WJ6A 2Z59B 1EF1A 2EMSA 2LI5A 4HDOA 4JGHB 2KNBA 4IWOA 4MELA 3AI5A 2KK8A 4FBJB 2D3GA 2V1YA 1L7YA 2DZIA 2OOBB 3UIPB 2ZPNA 3M3JA 4PS3A 2MP2B 2LWPA 2N4FA 1ZGUB 4ZYNA 2MP2A 3CSTA 3ONSA 4I6LB 2PE9A 4DBGA 5KHQA 3JW0X 4GN1A 3QQ8B 3U7DA 3DCGA 2MBQA 4II2B 3ZO5B 1J0GA 1WR1A 2O2VB 4LDTB 2AEHA 4G3XB 1Z5SB 4E71A 4IUMB 2YLMA 3U30A 3KYCD 5D2MB 4BKGA 2A5UA 1EF5A 2CR5A 2ZEQA 3DDCB 2KDEB 2GOWA 3ZVVA 4HXDA 4M8NA 1J8CA 1T0YA 1OEYJ 4IW0A 2AL6A 4NAWA 2C7MB 2DYMA 1M94A 2L05A 4FJVB 3TBLD 2DYOA 2HTHA 4ZRKA 1WXAA 2XK5A 4MGKE 1P98A 3K9OB 1E8XA 1GNUA 4W9HA 2OJRA 2MA9B 3APDA 4PS8A 2K8CA 4G50A 2IYDB 3DBLI 4FHJA 2MRPA 1XT9B 4NQKE 1YIWA 3VAWA 1NDDA 2FNJB 3ML9A 4MJSB 1BT0A 2G3QB 4KIKB 3R7QA 1WGRA 1GG3A 1Q1OA 3DVNU 1YX6B 3WAMA 5CHVC 1WJ4A 1V81A 3ZRFA 1XD3B 4A3PA 4EFOA 2KJRA 3R66C 4KV2A 2KHWB 3CMMB 2JVCA 3KVFB 2DAFA 1WYWB 2KMAA 3UGBB 4ANUA 3APFA 3WAOA 1YX5B 3IFWB 2D11A 4HWIB 2RSUA 5GMVA 1E8ZA 2AYOB 4KSKC 1WZ0A 1Z2MA 4E74A 4AP4C 1K8RB 4EZKA 2M17A 1TTNA 2KJ6A 2M1MA 4E3CA 2MW5A 2KMCA 2CHZA 4X57B 2J0MA 2NR2A 5C1ZA 2N1WA 3ENEA 2KDBA 2N7EA 3KUCB 3K9PB 2KANA 4WJNA 1R4MI 4ICUA 3PHXB 1WE6A 3L17A 4BKSA 2R2OA 3OJ4B 3RT3B 4W9LA 3KYDD 3UQAA 4FN2A 4TUUA 3DBHI 3ALBA 1D3ZA 5JZEB 2R2QA 1YQBA 4F8CB 2GBRA 1AARA 2BYFA 3EFUA 3H7PA 3ZW3A 4DXAB 3B0AA 2JWZA 2KXJA 3H7PB 2KZRA 1SE9A 2KFJA 4HPLB 3UF8A 4GDKB 4NQLB 1WM3A 3EHVA 1LXDA 4GDKA 3ZIMA 3QK0A 3RYTA 4DHZB 4WJOA 2M0XA 4M8MA 1JRUA 3B1LX 3VTWA 3V60A 3NHEB 1WZ3A 4ICVA 3UIOB 3DBSA 3VXWA 2LRUA 2FCMA 2KQ7A 5DPWA 2ZNVB 3PGEA 4XX5A 2J7QB 4KSLC 3VUWA 5CHFA 4DK5A 4MSMB 1C1YB 1Y8RC 3SHQA 3NY5A 2IO0B 2MCNB 3ZRCA 3KH0A 4DHJB 3A9JB 5KHOA 1C3TA 3VQIA 4EOYA 1S1QB 3QHTA 1PQSA 4KDIC 5D7GA 5DPRA 3S2AA 2BF8B 3PTFC 4BVUC 2DZMA 3PV1A 5FR6A 2GBJA 4WWPA 1ISNA 2ZJDA 3GOEA 4K7UA 4M0WB 3LDZE 4B9KA 3KUDB 1WIAA 2KOXA 4K81A 4NJ6A 5IA7A 4TKNA 2G4DB 4JLCA 1V6EA 3C0RB 3PSEB 1YD8U 3RCZA 4CHKA 3CF6E 3OAWA 4GMVA 2L0FA 2I1KA 4WJPA 3AXCA 2NVUI 4RMAA 4OVUA 4FJYA 3UINB 2KJHB 3JSVA 3M95A 4HK2A 3AU5A 3DPDA 4K1RB 2G4SA 3PS6A 4MDKE 4W9EA 4MGZE 3L08A 3LJ3A 5AEKB 4NNJB 5DCNA 2XBBC 5LXIB 2DENB 1HE8A 2LASA 2GBNA 1S3SG 3V6CB 4TQ1A 3WAPA 3ZUNA 3A4RA 2AWTA 2REXA 4DHZE 4IWPA 2HJ8A 2YVCA 5AZGA 1V2YA 3A4SC 4IWQA 1P9DU 4BKTA 2FCSA 3QAQA 3L10B 4GGQA 1RAXA 2J0JA 1UELA 1LM8B 2MX2A 4LJOB 4FADA 4PYZA 2BKRB 3PT2B 4HJKA 1WE7A 2KN5A 2L00B 2WX1A 3QARA 3ECIA 3H9DA 1ZW7A 4K7WA 3VHTC 2BGFA 3L16A 2LUEA 3N32A 3PLUA 2C7NB 3HIZA 4A20A 4BFRA 5E6PA 1WJNA 1RLFA 4BOZB 3ZNZB 1WMHA 1H8CA 4BBNF 3M63B 1Q0WB 2CS4A 2RGFA 3D32A 1GJZA 2FCQA 2KDFB 2L8JA 2HE7A 4XC2A 5G2NA 4MGIE 4W9FA 4G11A 5BO4B 2JUOA 1WH3A 4ANWA 2FCNA 2LD9A 5LLIA 3TMPB 2DX5B 3NZSA 1KM7A 2CKHB 2N9XA 4FLHA 5AZHA 4RM9A 1A5RA 2LJ5A 4HDQA 5DPSA 4IG7B 2DHZA 3PHWB 2D07B 4FJZA 4K7SA 2NPTA 3KUZA 3HHMA 4AUQC 2Z0EB 4W9CA 4F1SA 3TJPA 4WQOB 4MGYE 2LRWA 2IY0B 2Z0DB 2BPSA 4WWNA 1WR6E 3ZKJC 4AJYB 3V61A 3IG3A 1RFAA 3OJ3A 4MEMA 1WX8A 3DVGX 2D2QA 2NBVB 4W9DA 2BWFA 1WX9A 4W9KA 1TZ1A 1EUVB 2O2VA 4BOSC 4FHKA 4KZCA 1LFDA 2JRHA 2WX0A 3QC8B 1EO6A 3BINA 4I6PA 3QIJA 1WY8A 2IO1B 3X23A 5E6NA 4NPNA 3VH3B 3I3TB 3N3KB 2M8SA 4LDTD 1ZKHA 2AL3A 4GXBA 1WJUA 4EKUA 1U4AA 2KWVB 2LGYA 2N7DA 3AU4A 2EKEC 5J18A 2MBOA 1WGGA 2FIDA 1Q5WB 2W9NA 5IAAC 1V80A 3VTVA 1E7UA 4AOFA 2ZZPB 1WGYA 3ZDTA 1V9JA 5E6OA 2KDIA 3A1QA 2JY6A 2UWQA 2LVPA 4RM8A 2O6VD 5C23A 2CHXA 2MBHA 2JZZA 2WYQA 5JHBA 2JRIB 2K25A 1P3QU 1E8WA 3DVNV 4JQWC 4WJQA 4AWJA 2NS5A 4ZRIA 3SD5A 2J0KA 3JYUA 2KLCA 3A9KA 3RUIB 3T9LA 1WRDB 2LVOA 3N30A 3VDZA 4DWFA 5LXHA 1GC7A 3TL5A 3NOBA 2O6VA 3PPAA 2LGDA 2GBMA 2ZNVC 4B6WA 1OEYA 2PE6B 2PPHA 3DVGY 3U8ZA 4ASWC 2L0TA 3PRZA 3RZFA 1GUAB 2K8BA 1WM2A 1E8YA 2KX3A 1WGDA 5CTRC 2A4ZA 3EECA 3PREA 4CYEA 2XK5B 3VVWB 4TQ0A 4KDLB 2JZ3B 4GDLB 3WA0A 5J2RA 2C7HA 3W1YA 2MBEA 2HD5B 3IBEA 1WX7A 1SIFA 4TV3A 2IY1B 3VH4B 3QJZA 5AZFA 3PRMB 3DOWA 5CHWA 2LXAA 2I1JA 1SGHA 2JF5A 1I42A 2RPQA 3GZNI 3HM6X 3X0WA 3ZDMC 1IYFA 2KTRB 3H7SA 3IHPC 3A33B 2L76A 3KW5B 5JHAA 4KIKA 2Y5BB 2KWUB 2BYVE 4GU2A 2C60A 1UGMA 3RULA 3ZNID 3QA8A 4WAAA 4CO7A 2MQJA 2ZVOA 1CMXB 2KFKB 2JT4B 3TIXA 4J6IA 1R4NI 4ANXA 1UH6A 1H4RA 1GC6A 1TGZB 4WWOA 2VRRB 1V5TA 1P1AA 3HK0A 3O65B 2ASQA 2NPTB 1F9JA 5DPTA 4EEWA 2EMTA 4W9GA 3B08A 1UBIA 4BKSD 2JXXA 3L0WB 3SDLC 2KQSA 1IP9A 3JVZX 4IC7B 4ZRJA 2KO3A 1OGWA 1WMHB 2CHWA 3EC8A 3P2BA 3SU8X 2K6DB 4IM0A 5D6JB 1KLVA 3R7RA 1UBQA 3WANA 1WF9A 2ZPYA 4BBNC 1QZEA 2B3AA 2KVRA 2QHOA 2K39A 1LQBA 3A9JA 4N9F4 3DBRI 4W9IA 3A9KB 3RZWC 3CSFA 1NI2A 1J19A 2WWZA 4G0NB 2KFKA 1L2NA 4PS7A 2D10A 4MM3A 3PZDA 5D94A 1YJ1A 3AULA 3ZTCA 1E7VA 3ZTDA 3Q3JA 4GSWA 2KC1A 2K1FA 4HCPB 1UZXB 2FIFA 2KD0A 2DZJA 2LZ6A 2MLBA 2L7RA 3IVFA 2L3ZA 4HPMB 4GIVA 2IZVB 4OVVA 2UYZB 2DYBA 1V86A 3OLMD 2MBBB 4II3B 1UD7A 2K6QA 2ZVNA 3UQBA 2K8HA 3NZUA 2RR9A 4LCDE 3ZLZA 1WI0A 4HVBA 1VD2A 3H6NA 2KTFA 3VUYA 3ZNGC 4A3OA 4B95A 4EUTA 2FAZA 2N9EB 4GB9A 4IM3A 1I35A 1RRBA 4LJPB 3VFKA 2NBUA 4I6NB 4IM2A 2KLGA 4P7IA 2NCNA 3M62B 1G6JA 3ML8A 5L83A 3Q3FA 4FULA 2O6VB 3DQVA 2GMIC 1XQQA 3V6EB 2N1VA 1OQYA 2ZCBA 5TR5A 2WDTB 2BYEA 1IPGA 2G45B 1FXTB 4JIOU 3PLVA 2CU1A 2ZCCA 4EZLA 2V4LA 4HLEA 4NY0A 3MHSD 2KC2A 3A1QB 2IO2B 4ZDVA 2M4NA 1WXVA 4ANVA 3TCAA 2GBKA 3QWZB 3BY4B 1WFYA 4XZ4A 2PJHA 3HM3A 4MJSA 2DAJA 1V49A 3H1UA 3L54A 4MH0E 4KZ0A 3NS8A 2DZKA 5G55A 2BKFA 2RD0A 2LGXA 1V5OA 4URKA 1KOTA 5JH5C 2KKCA 3WALA 2IBIB 3RD2A 3PVLA 5J17A 4PYUA 3VTUA 3T8MA 2XEWA 4HCNB 4W9JA 1WXMA 2C9WB 1X1MA 4AJWA 2C5LC 2V3SA 2MWSB 3QX1A 2LXCA 4NAWB 4F7ZA 1OTRB 4FA6A 4DHJD 2FUHB 3MJWA 4GOCA 1WXSA 4GDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VCB A;  2MSE D;  2KWC A;  3APC A;  2BWE S;  1P0R A;  3VUX A;  3W1S C;  1WGH A;  5L95 C;  2NBW B;  2N9P C;  3PRP B;  5EDS A;  1TBE A;  3QCA A;  4JL9 A;  3V62 A;  3R3M A;  4YL8 A;  5HKH A;  4EZJ A;  3MTN B;  4KVG B;  3L13 A;  1MG8 A;  2IO3 B;  2PEA A;  5CX3 A;  3JSV B;  2JPH A;  2LVQ A;  2KTR A;  4MSQ B;  1NBF C;  4NJ7 A;  4DDI D;  3WIM A;  2KX0 A;  4DDG D;  3ZNH B;  1E5W A;  1E90 A;  1KJT A;  3W1S A;  1WJ6 A;  2Z59 B;  1EF1 A;  2EMS A;  2LI5 A;  4HDO A;  4JGH B;  2KNB A;  4IWO A;  4MEL A;  3AI5 A;  2KK8 A;  4FBJ B;  2D3G A;  2V1Y A;  1L7Y A;  2DZI A;  2OOB B;  3UIP B;  2ZPN A;  3M3J A;  4PS3 A;  2MP2 B;  2LWP A;  2N4F A;  1ZGU B;  4ZYN A;  2MP2 A;  3CST A;  3ONS A;  4I6L B;  2PE9 A;  4DBG A;  5KHQ A;  3JW0 X;  4GN1 A;  3QQ8 B;  3U7D A;  3DCG A;  2MBQ A;  4II2 B;  3ZO5 B;  1J0G A;  1WR1 A;  2O2V B;  4LDT B;  2AEH A;  4G3X B;  1Z5S B;  4E71 A;  4IUM B;  2YLM A;  3U30 A;  3KYC D;  5D2M B;  4BKG A;  2A5U A;  1EF5 A;  2CR5 A;  2ZEQ A;  3DDC B;  2KDE B;  2GOW A;  3ZVV A;  4HXD A;  4M8N A;  1J8C A;  1T0Y A;  1OEY J;  4IW0 A;  2AL6 A;  4NAW A;  2C7M B;  2DYM A;  1M94 A;  2L05 A;  4FJV B;  3TBL D;  2DYO A;  2HTH A;  4ZRK A;  1WXA A;  2XK5 A;  4MGK E;  1P98 A;  3K9O B;  1E8X A;  1GNU A;  4W9H A;  2OJR A;  2MA9 B;  3APD A;  4PS8 A;  2K8C A;  4G50 A;  2IYD B;  3DBL I;  4FHJ A;  2MRP A;  1XT9 B;  4NQK E;  1YIW A;  3VAW A;  1NDD A;  2FNJ B;  3ML9 A;  4MJS B;  1BT0 A;  2G3Q B;  4KIK B;  3R7Q A;  1WGR A;  1GG3 A;  1Q1O A;  3DVN U;  1YX6 B;  3WAM A;  5CHV C;  1WJ4 A;  1V81 A;  3ZRF A;  1XD3 B;  4A3P A;  4EFO A;  2KJR A;  3R66 C;  4KV2 A;  2KHW B;  3CMM B;  2JVC A;  3KVF B;  2DAF A;  1WYW B;  2KMA A;  3UGB B;  4ANU A;  3APF A;  3WAO A;  1YX5 B;  3IFW B;  2D11 A;  4HWI B;  2RSU A;  5GMV A;  1E8Z A;  2AYO B;  4KSK C;  1WZ0 A;  1Z2M A;  4E74 A;  4AP4 C;  1K8R B;  4EZK A;  2M17 A;  1TTN A;  2KJ6 A;  2M1M A;  4E3C A;  2MW5 A;  2KMC A;  2CHZ A;  4X57 B;  2J0M A;  2NR2 A;  5C1Z A;  2N1W A;  3ENE A;  2KDB A;  2N7E A;  3KUC B;  3K9P B;  2KAN A;  4WJN A;  1R4M I;  4ICU A;  3PHX B;  1WE6 A;  3L17 A;  4BKS A;  2R2O A;  3OJ4 B;  3RT3 B;  4W9L A;  3KYD D;  3UQA A;  4FN2 A;  4TUU A;  3DBH I;  3ALB A;  1D3Z A;  5JZE B;  2R2Q A;  1YQB A;  4F8C B;  2GBR A;  1AAR A;  2BYF A;  3EFU A;  3H7P A;  3ZW3 A;  4DXA B;  3B0A A;  2JWZ A;  2KXJ A;  3H7P B;  2KZR A;  1SE9 A;  2KFJ A;  4HPL B;  3UF8 A;  4GDK B;  4NQL B;  1WM3 A;  3EHV A;  1LXD A;  4GDK A;  3ZIM A;  3QK0 A;  3RYT A;  4DHZ B;  4WJO A;  2M0X A;  4M8M A;  1JRU A;  3B1L X;  3VTW A;  3V60 A;  3NHE B;  1WZ3 A;  4ICV A;  3UIO B;  3DBS A;  3VXW A;  2LRU A;  2FCM A;  2KQ7 A;  5DPW A;  2ZNV B;  3PGE A;  4XX5 A;  2J7Q B;  4KSL C;  3VUW A;  5CHF A;  4DK5 A;  4MSM B;  1C1Y B;  1Y8R C;  3SHQ A;  3NY5 A;  2IO0 B;  2MCN B;  3ZRC A;  3KH0 A;  4DHJ B;  3A9J B;  5KHO A;  1C3T A;  3VQI A;  4EOY A;  1S1Q B;  3QHT A;  1PQS A;  4KDI C;  5D7G A;  5DPR A;  3S2A A;  2BF8 B;  3PTF C;  4BVU C;  2DZM A;  3PV1 A;  5FR6 A;  2GBJ A;  4WWP A;  1ISN A;  2ZJD A;  3GOE A;  4K7U A;  4M0W B;  3LDZ E;  4B9K A;  3KUD B;  1WIA A;  2KOX A;  4K81 A;  4NJ6 A;  5IA7 A;  4TKN A;  2G4D B;  4JLC A;  1V6E A;  3C0R B;  3PSE B;  1YD8 U;  3RCZ A;  4CHK A;  3CF6 E;  3OAW A;  4GMV A;  2L0F A;  2I1K A;  4WJP A;  3AXC A;  2NVU I;  4RMA A;  4OVU A;  4FJY A;  3UIN B;  2KJH B;  3JSV A;  3M95 A;  4HK2 A;  3AU5 A;  3DPD A;  4K1R B;  2G4S A;  3PS6 A;  4MDK E;  4W9E A;  4MGZ E;  3L08 A;  3LJ3 A;  5AEK B;  4NNJ B;  5DCN A;  2XBB C;  5LXI B;  2DEN B;  1HE8 A;  2LAS A;  2GBN A;  1S3S G;  3V6C B;  4TQ1 A;  3WAP A;  3ZUN A;  3A4R A;  2AWT A;  2REX A;  4DHZ E;  4IWP A;  2HJ8 A;  2YVC A;  5AZG A;  1V2Y A;  3A4S C;  4IWQ A;  1P9D U;  4BKT A;  2FCS A;  3QAQ A;  3L10 B;  4GGQ A;  1RAX A;  2J0J A;  1UEL A;  1LM8 B;  2MX2 A;  4LJO B;  4FAD A;  4PYZ A;  2BKR B;  3PT2 B;  4HJK A;  1WE7 A;  2KN5 A;  2L00 B;  2WX1 A;  3QAR A;  3ECI A;  3H9D A;  1ZW7 A;  4K7W A;  3VHT C;  2BGF A;  3L16 A;  2LUE A;  3N32 A;  3PLU A;  2C7N B;  3HIZ A;  4A20 A;  4BFR A;  5E6P A;  1WJN A;  1RLF A;  4BOZ B;  3ZNZ B;  1WMH A;  1H8C A;  4BBN F;  3M63 B;  1Q0W B;  2CS4 A;  2RGF A;  3D32 A;  1GJZ A;  2FCQ A;  2KDF B;  2L8J A;  2HE7 A;  4XC2 A;  5G2N A;  4MGI E;  4W9F A;  4G11 A;  5BO4 B;  2JUO A;  1WH3 A;  4ANW A;  2FCN A;  2LD9 A;  5LLI A;  3TMP B;  2DX5 B;  3NZS A;  1KM7 A;  2CKH B;  2N9X A;  4FLH A;  5AZH A;  4RM9 A;  1A5R A;  2LJ5 A;  4HDQ A;  5DPS A;  4IG7 B;  2DHZ A;  3PHW B;  2D07 B;  4FJZ A;  4K7S A;  2NPT A;  3KUZ A;  3HHM A;  4AUQ C;  2Z0E B;  4W9C A;  4F1S A;  3TJP A;  4WQO B;  4MGY E;  2LRW A;  2IY0 B;  2Z0D B;  2BPS A;  4WWN A;  1WR6 E;  3ZKJ C;  4AJY B;  3V61 A;  3IG3 A;  1RFA A;  3OJ3 A;  4MEM A;  1WX8 A;  3DVG X;  2D2Q A;  2NBV B;  4W9D A;  2BWF A;  1WX9 A;  4W9K A;  1TZ1 A;  1EUV B;  2O2V A;  4BOS C;  4FHK A;  4KZC A;  1LFD A;  2JRH A;  2WX0 A;  3QC8 B;  1EO6 A;  3BIN A;  4I6P A;  3QIJ A;  1WY8 A;  2IO1 B;  3X23 A;  5E6N A;  4NPN A;  3VH3 B;  3I3T B;  3N3K B;  2M8S A;  4LDT D;  1ZKH A;  2AL3 A;  4GXB A;  1WJU A;  4EKU A;  1U4A A;  2KWV B;  2LGY A;  2N7D A;  3AU4 A;  2EKE C;  5J18 A;  2MBO A;  1WGG A;  2FID A;  1Q5W B;  2W9N A;  5IAA C;  1V80 A;  3VTV A;  1E7U A;  4AOF A;  2ZZP B;  1WGY A;  3ZDT A;  1V9J A;  5E6O A;  2KDI A;  3A1Q A;  2JY6 A;  2UWQ A;  2LVP A;  4RM8 A;  2O6V D;  5C23 A;  2CHX A;  2MBH A;  2JZZ A;  2WYQ A;  5JHB A;  2JRI B;  2K25 A;  1P3Q U;  1E8W A;  3DVN V;  4JQW C;  4WJQ A;  4AWJ A;  2NS5 A;  4ZRI A;  3SD5 A;  2J0K A;  3JYU A;  2KLC A;  3A9K A;  3RUI B;  3T9L A;  1WRD B;  2LVO A;  3N30 A;  3VDZ A;  4DWF A;  5LXH A;  1GC7 A;  3TL5 A;  3NOB A;  2O6V A;  3PPA A;  2LGD A;  2GBM A;  2ZNV C;  4B6W A;  1OEY A;  2PE6 B;  2PPH A;  3DVG Y;  3U8Z A;  4ASW C;  2L0T A;  3PRZ A;  3RZF A;  1GUA B;  2K8B A;  1WM2 A;  1E8Y A;  2KX3 A;  1WGD A;  5CTR C;  2A4Z A;  3EEC A;  3PRE A;  4CYE A;  2XK5 B;  3VVW B;  4TQ0 A;  4KDL B;  2JZ3 B;  4GDL B;  3WA0 A;  5J2R A;  2C7H A;  3W1Y A;  2MBE A;  2HD5 B;  3IBE A;  1WX7 A;  1SIF A;  4TV3 A;  2IY1 B;  3VH4 B;  3QJZ A;  5AZF A;  3PRM B;  3DOW A;  5CHW A;  2LXA A;  2I1J A;  1SGH A;  2JF5 A;  1I42 A;  2RPQ A;  3GZN I;  3HM6 X;  3X0W A;  3ZDM C;  1IYF A;  2KTR B;  3H7S A;  3IHP C;  3A33 B;  2L76 A;  3KW5 B;  5JHA A;  4KIK A;  2Y5B B;  2KWU B;  2BYV E;  4GU2 A;  2C60 A;  1UGM A;  3RUL A;  3ZNI D;  3QA8 A;  4WAA A;  4CO7 A;  2MQJ A;  2ZVO A;  1CMX B;  2KFK B;  2JT4 B;  3TIX A;  4J6I A;  1R4N I;  4ANX A;  1UH6 A;  1H4R A;  1GC6 A;  1TGZ B;  4WWO A;  2VRR B;  1V5T A;  1P1A A;  3HK0 A;  3O65 B;  2ASQ A;  2NPT B;  1F9J A;  5DPT A;  4EEW A;  2EMT A;  4W9G A;  3B08 A;  1UBI A;  4BKS D;  2JXX A;  3L0W B;  3SDL C;  2KQS A;  1IP9 A;  3JVZ X;  4IC7 B;  4ZRJ A;  2KO3 A;  1OGW A;  1WMH B;  2CHW A;  3EC8 A;  3P2B A;  3SU8 X;  2K6D B;  4IM0 A;  5D6J B;  1KLV A;  3R7R A;  1UBQ A;  3WAN A;  1WF9 A;  2ZPY A;  4BBN C;  1QZE A;  2B3A A;  2KVR A;  2QHO A;  2K39 A;  1LQB A;  3A9J A;  4N9F 4;  3DBR I;  4W9I A;  3A9K B;  3RZW C;  3CSF A;  1NI2 A;  1J19 A;  2WWZ A;  4G0N B;  2KFK A;  1L2N A;  4PS7 A;  2D10 A;  4MM3 A;  3PZD A;  5D94 A;  1YJ1 A;  3AUL A;  3ZTC A;  1E7V A;  3ZTD A;  3Q3J A;  4GSW A;  2KC1 A;  2K1F A;  4HCP B;  1UZX B;  2FIF A;  2KD0 A;  2DZJ A;  2LZ6 A;  2MLB A;  2L7R A;  3IVF A;  2L3Z A;  4HPM B;  4GIV A;  2IZV B;  4OVV A;  2UYZ B;  2DYB A;  1V86 A;  3OLM D;  2MBB B;  4II3 B;  1UD7 A;  2K6Q A;  2ZVN A;  3UQB A;  2K8H A;  3NZU A;  2RR9 A;  4LCD E;  3ZLZ A;  1WI0 A;  4HVB A;  1VD2 A;  3H6N A;  2KTF A;  3VUY A;  3ZNG C;  4A3O A;  4B95 A;  4EUT A;  2FAZ A;  2N9E B;  4GB9 A;  4IM3 A;  1I35 A;  1RRB A;  4LJP B;  3VFK A;  2NBU A;  4I6N B;  4IM2 A;  2KLG A;  4P7I A;  2NCN A;  3M62 B;  1G6J A;  3ML8 A;  5L83 A;  3Q3F A;  4FUL A;  2O6V B;  3DQV A;  2GMI C;  1XQQ A;  3V6E B;  2N1V A;  1OQY A;  2ZCB A;  5TR5 A;  2WDT B;  2BYE A;  1IPG A;  2G45 B;  1FXT B;  4JIO U;  3PLV A;  2CU1 A;  2ZCC A;  4EZL A;  2V4L A;  4HLE A;  4NY0 A;  3MHS D;  2KC2 A;  3A1Q B;  2IO2 B;  4ZDV A;  2M4N A;  1WXV A;  4ANV A;  3TCA A;  2GBK A;  3QWZ B;  3BY4 B;  1WFY A;  4XZ4 A;  2PJH A;  3HM3 A;  4MJS A;  2DAJ A;  1V49 A;  3H1U A;  3L54 A;  4MH0 E;  4KZ0 A;  3NS8 A;  2DZK A;  5G55 A;  2BKF A;  2RD0 A;  2LGX A;  1V5O A;  4URK A;  1KOT A;  5JH5 C;  2KKC A;  3WAL A;  2IBI B;  3RD2 A;  3PVL A;  5J17 A;  4PYU A;  3VTU A;  3T8M A;  2XEW A;  4HCN B;  4W9J A;  1WXM A;  2C9W B;  1X1M A;  4AJW A;  2C5L C;  2V3S A;  2MWS B;  3QX1 A;  2LXC A;  4NAW B;  4F7Z A;  1OTR B;  4FA6 A;  4DHJ D;  2FUH B;  3MJW A;  4GOC A;  1WXS A;  4GDL A; 
#chains in the Genus database with same CATH topology
 2MSE D;  1P0R A;  1WGH A;  5L95 C;  1FNW A;  3ZYY X;  4A90 A;  1TBE A;  3QCA A;  4JL9 A;  3R3M A;  3P4S B;  5HKH A;  1FXA A;  4KVG B;  3L13 A;  2IO3 B;  2KX0 A;  1V1O A;  3MJ5 A;  1KJT A;  1WJ6 A;  1WSP A;  2EMS A;  3P42 A;  4HDO A;  2KNB A;  3Q8E A;  1FD6 A;  2KK8 A;  2PVG C;  2V1Y A;  4DQO C;  2DNF A;  3N1Y C;  2ZPN A;  2G9H D;  3CWI A;  2WXF A;  2MP2 A;  3CST A;  2PE9 A;  2NTS A;  3JW0 X;  3ZO5 B;  1J0G A;  3N9Y C;  4LDT B;  2XNA C;  2AEH A;  4G3X B;  2V3P A;  2YLM A;  3KYC D;  5D2M B;  2A5U A;  3ZVV A;  1WXQ A;  2GOW A;  4HXD A;  4M8N A;  5G5H A;  1OEY J;  4IW0 A;  1N5X A;  1IUE A;  3VR9 B;  2DYM A;  4FJV B;  1WXA A;  2XK5 A;  4PT5 A;  1P98 A;  1GNU A;  2IYD B;  2LGI A;  5H92 C;  4YTN B;  3DBL I;  3LXF A;  1XT9 B;  3Q8F A;  1YIW A;  2GB1 A;  2FNJ B;  2G3Q B;  4KIK B;  1XLO A;  3WAM A;  1TS3 A;  3GE8 C;  1WJ4 A;  4HKQ A;  4A3P A;  2JVC A;  1WYW B;  4HRO A;  1N61 A;  3UGB B;  2IGD A;  1JWS D;  1UWM A;  1PGX A;  1VLB A;  4AP4 C;  4EZK A;  2M17 A;  1C77 A;  2KMC A;  2CHZ A;  4X57 B;  5HG2 A;  5C1Z A;  3DBL B;  1J7A A;  4YTP B;  3KUC B;  1IBX A;  4ICU A;  4B0E A;  3L17 A;  1WRI A;  3W9C B;  1WYG A;  3UQA A;  4TUU A;  1D3Z A;  3DBH I;  2R2Q A;  2GBR A;  1AW7 A;  4DXA B;  3GS2 A;  4JE3 B;  2KZR A;  3N1Z C;  2KFJ A;  3UF8 A;  1V97 A;  1HTQ A;  4WJO A;  3AB5 A;  5BMH A;  1WWT A;  2L83 A;  2QIL A;  2FCM A;  3PGE A;  2AQ1 B;  4DK5 A;  2MCN B;  3KH0 A;  3A9J B;  4MAC A;  1S1Q B;  1PQS A;  2DZM A;  3PV1 A;  1L5P A;  3E56 A;  1FRR A;  1D6E C;  2GBJ A;  3AEC B;  3KUD B;  1WIA A;  1TKE A;  1EWY C;  2G4D B;  1YD8 U;  4CHK A;  3OAW A;  2HJ1 A;  4RMA A;  2VZK D;  4RFB A;  4HK2 A;  1GPX A;  1YNT E;  4K1R B;  2G4S A;  2KMM A;  2JU6 X;  2BS2 B;  3LJ3 A;  2WNM A;  2LAS A;  2GBN A;  1S3S G;  1E6E B;  2WXO A;  4TQ1 A;  3WAP A;  4ARC A;  2REX A;  3U2S C;  4DHZ E;  1UWX A;  3AE7 B;  4LNO A;  3NVV A;  2VZK B;  4IWQ A;  3QAQ A;  3L10 B;  1RAX A;  2J0J A;  3BII D;  2Z8L A;  2YEP B;  4PYZ A;  2KN5 A;  2WX1 A;  1HTO A;  2H88 B;  3QAR A;  2LUE A;  3PLU A;  3MC8 A;  4A20 A;  4BOZ B;  3ZNZ B;  1JCK B;  3ZQ4 A;  1H8C A;  3I5J C;  4C7Y A;  2RGF A;  3D32 A;  1GJZ A;  2FCQ A;  1PFD A;  1LGR A;  2D3C A;  2KDF B;  1HZ6 A;  2ICI A;  1TYG B;  2FCN A;  2J53 A;  4L23 A;  3TMP B;  3NZS A;  4WAF A;  2LJ5 A;  2MJ3 A;  1MVK A;  1PUT A;  5IKC M;  4XWW A;  5AUI A;  3HHM A;  3TJP A;  4YSY B;  2IY0 B;  2Z0D B;  4KX6 B;  2LUM A;  1TKG A;  2MHJ A;  3IG3 A;  4MEM A;  1WX8 A;  1CQV A;  4W9D A;  1FRD A;  1EO6 A;  3BIN A;  3X23 A;  1N62 A;  1QOF A;  4EKU A;  1U4A A;  2EKE C;  2KT7 A;  2FID A;  2MJE A;  3AE9 B;  2W9N A;  3VTV A;  1E7U A;  4AOF A;  2ZZP B;  3OG5 A;  1WGY A;  1V9J A;  2KDI A;  3A1Q A;  2K5P A;  2UWQ A;  3GZN B;  2JZZ A;  3AE4 B;  2JRI B;  2K25 A;  1VDV A;  3AEG B;  2I38 A;  1ZDV A;  2D5G A;  2NS5 A;  3AE2 B;  2KLC A;  1WRD B;  3N30 A;  2IPK D;  2O6V A;  2LGD A;  1IGC A;  4B6W A;  3DVG Y;  3RZF A;  1GUA B;  2K8B A;  1E8Y A;  5MPO A;  1DGJ A;  2W82 A;  2XK5 B;  3VVW B;  3TEW A;  2MBE A;  2HD5 B;  3IBE A;  3R2I A;  1SIF A;  3VH4 B;  3QJZ A;  5CHW A;  2I1J A;  2QC8 A;  4A55 A;  3HRD D;  3A33 B;  4KIK A;  3N20 C;  1EM7 A;  2KWU B;  2BYV E;  4OZB A;  2C60 A;  3ZNI D;  4WAA A;  2MQJ A;  3P63 A;  2ZVO A;  3LYY A;  4RNA A;  2WU5 B;  2UU7 A;  1N6Z A;  2VRR B;  1V5T A;  2ACZ B;  2BS3 B;  3W5V B;  4WIP A;  1MFW A;  4HEA 1;  4BKS D;  2TSS A;  5AUK A;  3L0W B;  4ZRP A;  2KQS A;  1UBQ A;  2QHO A;  2LHE A;  3DWM A;  3IAM 1;  4W9I A;  1VR9 A;  2D10 A;  1YJ1 A;  2CJN A;  4AS1 A;  4GSW A;  2KC1 A;  2IDY A;  2K1F A;  2L7R A;  1AYF A;  4GIV A;  4C80 A;  2V9H A;  2UYZ B;  1QOG A;  3UQB A;  2RR9 A;  3ZLZ A;  4HVB A;  3H6N A;  1JAL A;  2KTF A;  4K3B A;  4B95 A;  2N9E B;  2NBU A;  4I6N B;  1JWA D;  2NCN A;  1P7F A;  3DQV A;  1CK1 A;  2BT6 A;  1SJH D;  3PLV A;  4BAX A;  2CU1 A;  4HLE A;  2SAK A;  2M4N A;  1SB3 C;  3TCA A;  3BY4 B;  1FNV A;  2KQ4 X;  4MJS A;  2DAJ A;  1V49 A;  2Q5W D;  4P16 A;  4EE2 A;  4MH0 E;  4KZ0 A;  2DZK A;  1HXY D;  4URK A;  2KKC A;  3WAL A;  3P4Q B;  3SEB A;  1T5X D;  4WH4 A;  1EU3 A;  3T8M A;  2MEK A;  4W9J A;  2QSD A;  1YQ3 B;  2C5L C;  2Y5P A;  2LXC A;  1L0V B;  4F7Z A;  1GB1 A;  2DWQ A;  4GOC A;  1VCB A;  2WXL A;  1FEH A;  1ZOY B;  1F2R C;  2N9P C;  3PRP B;  1JWM D;  2HTM E;  4YL8 A;  2JYT A;  3MTN B;  4IOI E;  4YTM B;  1ZXH A;  3V05 A;  1NBF C;  1EWC A;  4LNI A;  4DDI D;  1KH0 A;  4DDG D;  3ZNH B;  3W1S A;  4REZ A;  4US8 A;  4JGH B;  4IWO A;  1BXT A;  3VRA B;  2D3G A;  3FKY A;  4ARI A;  2OOB B;  3UIP B;  1R4M B;  2LWP A;  1XO3 A;  4I6L B;  1YN3 A;  4DBG A;  4GN1 A;  1CZP A;  3QQ8 B;  3U7D A;  1SE4 A;  3MFG A;  3MC0 B;  1EF5 A;  2CR5 A;  1NYQ A;  2AL6 A;  1PDX A;  3R2T A;  1TKY A;  2L05 A;  4YXD B;  4ZRK A;  1E8X A;  1N63 A;  3VAW A;  3ML9 A;  1YX6 B;  3IT6 B;  4EFO A;  4KV2 A;  3Q3M C;  3CMM B;  3KVF B;  2DAF A;  1UUP A;  4YSZ B;  3HVD A;  3WAO A;  4M0W A;  3IFW B;  2D11 A;  4HWI B;  1KRH A;  1SJE D;  4IKG A;  2QIE B;  4LLG M;  3K9P B;  2KAN A;  3KQ4 A;  1R4M I;  2KAC A;  2FE8 A;  1QIL A;  3OJ4 B;  3RT3 B;  4W9L A;  2E3T A;  2WXG A;  2BYF A;  3AEB B;  3EFU A;  3H7P A;  1ZP0 B;  4OVZ A;  2JWZ A;  1SE9 A;  5E6J A;  2PW9 A;  2QMT A;  3EHV A;  1LXD A;  3RYT A;  4DHZ B;  4M8M A;  3B1L X;  2LJI A;  4ICV A;  3UIO B;  4P1B C;  2LRU A;  4XX5 A;  3VUW A;  1C1Y B;  2IO0 B;  1C3T A;  4EOY A;  2WXP A;  4KDI C;  4XGA B;  5DPR A;  3SR6 A;  2WXQ A;  2IND C;  1L4D B;  3BVZ A;  3FIL B;  4LNN A;  4WWP A;  1ISN A;  2ZJD A;  2PMV A;  1GAQ B;  1F77 A;  1QOA A;  1V6E A;  3C0R B;  3PSE B;  2KN4 A;  1KTK A;  2NMQ A;  3L4P A;  3CF6 E;  5EE9 A;  4L2Y A;  2L0F A;  4WJP A;  3AXC A;  2NVU I;  3UIN B;  2KJH B;  3JSV A;  1VRA B;  3Q8B A;  3PS6 A;  4MGZ E;  5AEK B;  3P4P B;  3DHH C;  1BML C;  4XYC A;  4MH8 A;  2L32 A;  1HZ5 A;  1MJD A;  5D3I B;  5JXV A;  3FIL A;  4IWP A;  5AZG A;  1AN8 A;  3A4S C;  1P9D U;  4KGR A;  1DOI A;  4LJO B;  4FAD A;  3PT2 B;  2I2Y A;  2L00 B;  3ECI A;  2BGF A;  3L16 A;  3N32 A;  1XEE A;  4AQ7 A;  4BFR A;  5E6P A;  1Q0W B;  4XWT A;  2L8J A;  2HE7 A;  4G11 A;  2JUO A;  1ZUD 2;  3TEZ A;  2DX5 B;  1KM7 A;  2CKH B;  2N9X A;  1A5R A;  4HDQ A;  2D07 B;  3C19 A;  3RFZ B;  4W9C A;  1NYR A;  4MGY E;  4NJC A;  4S0R A;  2MJD A;  4N58 A;  1QOB A;  2RMM A;  5FR3 A;  4S17 A;  2NBV B;  4W9K A;  1EUV B;  4BOS C;  1JQ4 A;  1EU4 A;  1LFD A;  1FMA D;  3QC8 B;  4LNF A;  4RH6 A;  1WY8 A;  2IO1 B;  2L52 A;  4XE0 A;  4MT5 A;  5E6N A;  3VH3 B;  3N3K B;  1ZKH A;  3AE3 B;  3URY A;  3Q2A C;  5J18 A;  2MBO A;  1F2R I;  1C78 A;  1V80 A;  1ET6 A;  2JY6 A;  4A6Q A;  3AE8 B;  3U7Z A;  2O6V D;  1E10 A;  2CHX A;  5JHB A;  1P3Q U;  4AWJ A;  1OQQ A;  3UI3 A;  3SD5 A;  3NJT A;  2J0K A;  3A9K A;  3T9L A;  1GC7 A;  3Q3O C;  2X38 A;  5IN7 A;  1PGB A;  1OEY A;  2PPH A;  3PRE A;  4UDU C;  3NVY A;  3WA0 A;  4GDL B;  5J2R A;  5FKA C;  5I4D A;  1RFK A;  2C7H A;  4FXC A;  3W1Y A;  1WX7 A;  2IY1 B;  5AZF A;  3PRM B;  3DOW A;  2JF5 A;  3GZN I;  3HM6 X;  1IYF A;  2QCZ A;  2L76 A;  1I4X A;  2Y5B B;  3AED B;  3IAS 1;  3O13 A;  3RUL A;  2IGH A;  1RWS A;  4CO7 A;  3TEX A;  2KFK B;  3TIX A;  4J6I A;  1R4N I;  1SEB D;  1STE A;  1UH6 A;  4OZA A;  3ZXV A;  2RDG A;  2E6X A;  5IOI A;  2NPT B;  1T0R C;  1ENF A;  3SDL C;  3JVZ X;  2KO3 A;  2LGS A;  3P2B A;  5D6J B;  4JWU C;  4RGM A;  3R7R A;  1KLV A;  1WF9 A;  4BBN C;  2K39 A;  1LQB A;  3FAH A;  3RZW C;  4G0N B;  2WWZ A;  2KFK A;  3CIR B;  4ITK A;  4RF0 A;  3PZD A;  1V1P B;  1XLN A;  3W5U B;  1E7V A;  4HCP B;  2FIF A;  1XLP A;  2KD0 A;  3PZ8 A;  2LZ6 A;  2IZV B;  1MG4 A;  4II3 B;  2WXM A;  2K6Q A;  1FCL A;  2ZVN A;  3Q8A A;  3IXS A;  4LCD E;  4ZYS A;  1N5W A;  3ZNG C;  4A3O A;  4EUT A;  4ZHO A;  4IM3 A;  4LJP B;  3VFK A;  5BMG A;  1J7B A;  1K52 A;  1G6J A;  3AM9 A;  4JWS C;  3J9C A;  2WP9 B;  1OQY A;  2ZCB A;  5TR5 A;  1FFU A;  2G45 B;  4NZL B;  4JIO U;  3MHS D;  3A1Q B;  2IO2 B;  2M19 A;  3Q8C A;  2PJH A;  3IT4 B;  2RD0 A;  2LGX A;  3RN9 C;  1KOT A;  1UGJ A;  2BQQ A;  3PVL A;  1HEZ E;  5J17 A;  4PYU A;  2XEW A;  4HCN B;  3QX1 A;  1FFV A;  4NAW B;  4FA6 A;  4DHJ D;  1IPG A;  3SU8 X;  3KWV A;  2KWC A;  3APC A;  1SSN A;  1XLQ A;  3DHG C;  3V62 A;  4EZJ A;  1JML A;  3B2G A;  2LVQ A;  2V3N A;  2KTR A;  4NJ7 A;  3BK1 A;  1HQR D;  3WIM A;  4LTU A;  5C2T B;  1XXG A;  2Z59 B;  4MM3 B;  3SFD B;  2FUG 1;  2INN E;  4HRS A;  1ACC A;  1T6B X;  5TSS A;  3ZJU A;  3AI5 A;  4FBJ B;  3NRZ A;  1ZGU B;  2VH2 A;  5KHQ A;  2G1E A;  3DCG A;  4II2 B;  4YSX B;  1WR1 A;  4LK0 M;  2YEP F;  4E71 A;  3U30 A;  1K50 A;  3DDC B;  2GI9 A;  1VZ6 A;  2ZEQ A;  4C56 C;  2C7M B;  3ABV B;  3TBL D;  2DYO A;  3K9O B;  2QDF A;  4LNK A;  4C7Z A;  1D5X C;  3APD A;  2K8C A;  4RCO A;  4FHJ A;  1YJJ A;  3R7Q A;  1WGR A;  1V81 A;  1T0S C;  1XD3 B;  1TJE A;  2KJR A;  4L1B A;  2KMA A;  2CU3 A;  2WDQ B;  4P1C C;  2J4X A;  2LHD A;  4ANU A;  2J42 A;  2PLP A;  2WXJ A;  3LB8 C;  2RSU A;  1T3Q A;  1E8Z A;  1WZ0 A;  1OFF A;  1Z2M A;  3EUB 2;  2KWD A;  1JRO A;  2J0M A;  4KKI A;  2NR2 A;  3C8Y A;  1I7H A;  2N1W A;  2KDB A;  2N7E A;  1YOV B;  4WJN A;  1K51 A;  1WE6 A;  2R2O A;  3BYY B;  4FN2 A;  3NVZ A;  2KVZ A;  3ALB A;  4YT0 B;  4B0M A;  5JZE B;  4F8C B;  1B9R A;  1R4N B;  1AAR A;  3ZW3 A;  1I4R A;  5HI1 A;  2KXJ A;  3H7P B;  1TZO A;  4GDK B;  4NQL B;  2GRI A;  1JRU A;  1RYJ A;  2WXN A;  3DBS A;  3VXW A;  1C76 A;  1Q10 A;  5DPW A;  1QQR A;  2J7Q B;  4KSL C;  4MSM B;  1Y8R C;  4NAM A;  3ZRC A;  3NY5 A;  4DHJ B;  4DXG A;  3VQI A;  3S2A A;  3QHT A;  2BF8 B;  3PTF C;  1V1P A;  3E9S A;  1OQR A;  5C3J B;  4B9K A;  4M0W B;  1FNU A;  2D3B A;  1FPY A;  4K81 A;  2PTL A;  4TKN A;  4JLC A;  3RCZ A;  5BYR A;  3ZJT A;  3GB1 A;  1ROE A;  4OVU A;  3BVG A;  4FJY A;  3M95 A;  4RGN A;  3AU5 A;  3DPD A;  2WS3 B;  3HUI A;  4W9E A;  4NNJ B;  2XBB C;  2BBC A;  5LXI B;  2DEN B;  3V6C B;  2KDM A;  3DHI C;  2RDH A;  2AWT A;  4US9 A;  3FC4 A;  4KKJ A;  2YVC A;  4BKT A;  2N7J A;  4GGQ A;  2BB5 A;  2RDB C;  1UEL A;  1LM8 B;  2MX2 A;  3DBR B;  4HJK A;  3VRB B;  2KYW A;  1K53 A;  1MI0 A;  4K7W A;  1ZW7 A;  3VHT C;  2ZW1 A;  3MC9 A;  4USA A;  3NVW A;  1WJN A;  1RLF A;  3NUH B;  1WMH A;  1L0Y B;  3EFC A;  3M63 B;  1NEN B;  2SEB D;  4XC2 A;  1SIJ A;  1TS4 A;  3RNG C;  3T3O A;  5BO4 B;  2CJO A;  2LD9 A;  1UNS A;  5AZH A;  4RM9 A;  3AEA B;  4IG7 B;  2DHZ A;  3W2D A;  4K7S A;  3KUZ A;  4AUQ C;  4KGT A;  4WQO B;  3ZKJ C;  1WR6 E;  2JXT A;  4ZOH C;  1RFA A;  2D2Q A;  2BWF A;  1TZ1 A;  2O2V A;  4FHK A;  2JRH A;  1D5M C;  4HPP A;  3EGR A;  2VH1 A;  3QIJ A;  4NPN A;  3I3T B;  2M8S A;  4LDT D;  2AL3 A;  4GXB A;  1WGK A;  2KWV B;  3AU4 A;  1WGG A;  3EA6 A;  1Q5W B;  5IAA C;  3RI7 C;  2LVP A;  2MBH A;  1LO5 D;  5EE3 A;  3BK2 A;  4DWF A;  2LVO A;  5LXH A;  3TL5 A;  3NOB A;  2GBM A;  2ZNV C;  2PE6 B;  3U8Z A;  4ASW C;  2L0T A;  3PRZ A;  1L0X B;  1WGD A;  5CTR C;  2A4Z A;  3EEC A;  4KDL B;  1RM6 C;  3DWG C;  3ZJV A;  5BMI A;  3AEE B;  2LXA A;  3X0W A;  2JZP A;  2KTR B;  3H7S A;  3KW5 B;  5JHA A;  1T0Q C;  1F52 A;  4GU2 A;  1ZDX A;  1UGM A;  3AEF B;  2Y5C A;  3BVM A;  4M02 A;  2JT4 B;  4ANX A;  1TGZ B;  1GC6 A;  1IGD A;  1ET9 A;  1P1A A;  2M0A A;  3HK0 A;  4OW0 A;  2BTE A;  5DPT A;  2EMT A;  1UBI A;  1XCT L;  2JXX A;  1QLB B;  3SFE B;  2K22 A;  5IO9 A;  3EC8 A;  1SF0 A;  3U52 E;  3N1X C;  2ZPY A;  1VZ7 A;  2B3A A;  5FK9 C;  4N9F 4;  5BYQ A;  3DBR I;  3A9K B;  1SE2 A;  3CSF A;  1F0Z A;  2K0P A;  2X8X X;  5HHD G;  4PS7 A;  5D94 A;  3ZTC A;  2Y3A A;  1UZX B;  4J3O D;  3V3X A;  2DZJ A;  3IVF A;  2L3Z A;  1YN5 A;  2MH7 A;  2DYB A;  1V86 A;  2MBB B;  1UD7 A;  1YMH E;  2K8H A;  3NZU A;  1WI0 A;  2WU2 B;  2JWU A;  1YJI A;  2H89 B;  1D4B A;  4IM2 A;  2KLG A;  2XN9 C;  2GLS A;  3ML8 A;  1BUI C;  3Q3F A;  1C4C A;  2O6V B;  2V4I B;  3RNB C;  3V6E B;  1XQQ A;  2BYE A;  4TMA B;  2JQR B;  2ZCC A;  4EZL A;  2V4L A;  3TSS A;  3VR8 B;  4ANV A;  2GBK A;  4O1N A;  1WFY A;  4XZ4 A;  3H1U A;  3L54 A;  3NS8 A;  5G55 A;  4JPS A;  5JH5 C;  1I4H A;  1L6V A;  1Y56 A;  1MHH E;  3VTU A;  1TS5 A;  1XCQ L;  1WXM A;  1QT9 A;  1X1M A;  4AJW A;  5LNK 1;  3R66 C;  1WXS A;  4GDL A;  3RMK C;  1MHX A;  1C79 A;  4Q2J A;  2BWE S;  2K9X A;  3VUX A;  3W1S C;  2NBW B;  5EDS A;  5T8I A;  4N59 A;  1MG8 A;  2PEA A;  5CX3 A;  3JSV B;  2JPH A;  4MSQ B;  4HJG E;  2WQY B;  2LFI A;  2ONQ A;  1E5W A;  1E0Z A;  1E90 A;  2BYT A;  1ESF A;  4C4V B;  1EF1 A;  2LI5 A;  4MEL A;  2HDE A;  1L7Y A;  1ZXI A;  2DZI A;  1QF6 A;  3BYT B;  3M3J A;  4PS3 A;  2MP2 B;  2N4F A;  4ZYN A;  1V8C A;  3ONS A;  2IGG A;  2W54 A;  1C4A A;  4C00 A;  1SE3 A;  2MBQ A;  1MPE A;  2O2V B;  3MP9 A;  1Z5S B;  5EE0 A;  4IUM B;  3AV8 A;  3RNF C;  4BKG A;  2KDE B;  1I4G A;  1CJE A;  2WXH A;  1J8C A;  1T0Y A;  4NAW A;  3Q69 A;  2BW2 A;  1M94 A;  2HTH A;  4MGK E;  4A8X C;  4H2A A;  4PK1 A;  4W9H A;  5HFY A;  2OJR A;  1SXT A;  2MA9 B;  4PS8 A;  4G50 A;  2ZW0 A;  2MRP A;  2N9K A;  3B9J A;  4NQK E;  1NDD A;  4MJS B;  3ZGZ A;  1BT0 A;  1C4P A;  1FIQ A;  1GG3 A;  1Q1O A;  2W55 A;  3DVN U;  5CHV C;  3ZRF A;  2KHW B;  4JX1 C;  2WDR B;  3APF A;  3Q14 C;  1YX5 B;  5GMV A;  2AYO B;  4KSK C;  4E74 A;  1K8R B;  1TS2 A;  4OHJ A;  1TTN A;  2KJ6 A;  2JX5 A;  2M1M A;  4E3C A;  2MW5 A;  2M56 B;  1E9M A;  4RGT A;  3ENE A;  2LEK A;  3RNA C;  4OZC A;  3KWL A;  2OHF A;  3PZ7 A;  3PHX B;  1A70 A;  2AQ2 B;  4BKS A;  2DLB A;  5D3D A;  2N9L A;  3KYD D;  4M01 A;  2B76 B;  2WXR A;  3NZ3 A;  2OJW A;  1YQB A;  3Q6B A;  3B0A A;  2BS4 B;  3ETR A;  1J7C A;  4HPL B;  1M4V A;  2PKO A;  1WM3 A;  1PGA A;  4GDK A;  3ZIM A;  3QK0 A;  2M0X A;  3VTW A;  3V60 A;  3NHE B;  1WZ3 A;  2KQ7 A;  2ZNV B;  5CHF A;  3NG0 A;  3SHQ A;  5KHO A;  2J52 A;  3OWE B;  5D7G A;  4BVU C;  4XDC A;  1N60 A;  5FR6 A;  1TY2 A;  3GOE A;  4K7U A;  3LDZ E;  2OED A;  4IDI A;  1FXI A;  1TY0 A;  2KOX A;  4NJ6 A;  5IA7 A;  2WXI A;  2RPV A;  4GMV A;  2JYE A;  2I1K A;  2DBY A;  3AE6 B;  4MDK E;  3L08 A;  5DCN A;  1HE8 A;  1NI3 A;  3ZUN A;  3A4R A;  3I57 A;  2BVC A;  2HJ8 A;  1V2Y A;  3RNE C;  2FCS A;  3AN1 A;  1I4P A;  3U4E G;  2BKR B;  1WE7 A;  3RNC C;  3RPF C;  1SBB B;  3AMZ A;  1AWD A;  3H9D A;  2C7N B;  3HIZ A;  2V0G A;  1KFY B;  2FBW B;  4BBN F;  1FM0 D;  3AH7 A;  3GE3 C;  1GOZ A;  2CS4 A;  1TT5 B;  4K3C A;  1L6U A;  4ZRQ A;  5G2N A;  4MGI E;  4W9F A;  1WH3 A;  4ANW A;  5LLI A;  3R8B A;  4WQM A;  4FLH A;  5DPS A;  1VZ8 A;  1B1Z A;  3PHW B;  2PVO D;  4FJZ A;  2NPT A;  1FCC C;  2INP E;  2D3A A;  3BZD B;  4ACF A;  2Z0E B;  4F1S A;  3AE1 B;  1DOY A;  1DOX A;  1XF5 L;  2LRW A;  3NS1 A;  4WUR A;  2BPS A;  4WWN A;  4AJY B;  3V61 A;  4GLS C;  3OJ3 A;  3DVG X;  1WX9 A;  2EEL A;  4CQN A;  4KZC A;  4N6E B;  2WX0 A;  3WCQ A;  4A9A A;  4I6P A;  2LMC A;  2NTT A;  3ZXR A;  4C4V A;  1HA5 A;  1WJU A;  2IJ0 A;  2ON8 A;  3DBH B;  2LGY A;  2N7D A;  3P4R B;  1I4Q A;  2AX5 A;  1NVI D;  1F1H A;  3ZDT A;  5E6O A;  1JWB D;  4RM8 A;  5C23 A;  1E7P B;  2WYQ A;  4QAY A;  5BYS A;  3HVZ A;  4HKZ E;  1E8W A;  3DVN V;  4JQW C;  4WJQ A;  4ZRI A;  3JYU A;  3RUI B;  3VDZ A;  3B2F A;  4WWM A;  3PPA A;  3I9V 1;  4ZHP A;  3KLS X;  5GXG B;  2JSV X;  4RGO S;  1JWU D;  5G5G A;  2WXK A;  1WM2 A;  2KX3 A;  1KF6 B;  5EE1 A;  4CYE A;  4M00 A;  1PYW D;  4TQ0 A;  4TSS A;  2JZ3 B;  1YN4 A;  2W3R A;  3I63 C;  4TV3 A;  1DYQ A;  1L4Z B;  1SGH A;  1I42 A;  1IBX B;  2RPQ A;  1KLU D;  2N0S B;  3ZDM C;  3IHP C;  4YWG G;  1VJK A;  1R7S A;  1ZPS A;  3QA8 A;  2WLB A;  1CMX B;  2KAJ A;  1KLG D;  1H4R A;  4WWO A;  2W3S A;  3T3N A;  3AE5 B;  2WDV B;  3O65 B;  2ASQ A;  4EEW A;  1F9J A;  4W9G A;  3B08 A;  2WHI A;  3H8H A;  3GP7 A;  3PO0 A;  1IP9 A;  4IC7 B;  4ZRJ A;  1OGW A;  1WMH B;  2CHW A;  2K6D B;  2QJL A;  4IM0 A;  3WAN A;  3BWU D;  1QZE A;  2KVR A;  1P7E A;  2BB6 A;  3A9J A;  3TEY A;  1NEK B;  1NI2 A;  1J19 A;  1L2N A;  5H8Y E;  4MM3 A;  3AUL A;  1YQ4 B;  3ZTD A;  4DXF A;  3Q3J A;  5IP4 D;  2MLB A;  4HPM B;  4OVV A;  2PIA A;  3OLM D;  1ZE3 D;  3TUO A;  1VD2 A;  2INC C;  3VUY A;  3Q3N C;  4D2K A;  2FAZ A;  4GB9 A;  1I35 A;  1RRB A;  4P7I A;  3M62 B;  1QKZ A;  5L83 A;  4FUL A;  2GMI C;  2N1V A;  2WDT B;  1JRP A;  1FXT B;  4P6V F;  4BZA A;  2EKI A;  4NY0 A;  2KC2 A;  3MHZ A;  4ZDV A;  1GB4 A;  1WXV A;  3QWZ B;  1TIF A;  3HM3 A;  1JW9 D;  1FO4 A;  1UF0 A;  2L1A A;  2BKF A;  4XDD A;  1C9F A;  1V5O A;  4KGS A;  2IBI B;  3RD2 A;  4RF1 A;  2WGS A;  2C9W B;  2AQ3 B;  2MWS B;  2V3S A;  2R61 A;  1OTR B;  4R3D A;  2K3U A;  2FUH B;  3MJW A;  2QEJ C;  1D5Z C;  3P1M A; 
#chains in the Genus database with same CATH homology
 1VCB A;  2MSE D;  2KWC A;  3APC A;  2BWE S;  1P0R A;  3VUX A;  3W1S C;  1WGH A;  5L95 C;  2NBW B;  2N9P C;  3PRP B;  5EDS A;  1TBE A;  3QCA A;  4JL9 A;  3V62 A;  3R3M A;  4YL8 A;  5HKH A;  4EZJ A;  3MTN B;  4KVG B;  3L13 A;  1MG8 A;  2IO3 B;  2PEA A;  5CX3 A;  3JSV B;  2JPH A;  2LVQ A;  2KTR A;  4MSQ B;  1NBF C;  4NJ7 A;  4DDI D;  3WIM A;  2KX0 A;  4DDG D;  3ZNH B;  1E5W A;  1E90 A;  1KJT A;  3W1S A;  1WJ6 A;  2Z59 B;  1EF1 A;  2EMS A;  2LI5 A;  4HDO A;  4JGH B;  2KNB A;  4IWO A;  4MEL A;  3AI5 A;  2KK8 A;  4FBJ B;  2D3G A;  2V1Y A;  1L7Y A;  2DZI A;  2OOB B;  3UIP B;  2ZPN A;  3M3J A;  4PS3 A;  2MP2 B;  2LWP A;  2N4F A;  1ZGU B;  4ZYN A;  2MP2 A;  3CST A;  3ONS A;  4I6L B;  2PE9 A;  4DBG A;  5KHQ A;  3JW0 X;  4GN1 A;  3QQ8 B;  3U7D A;  3DCG A;  2MBQ A;  4II2 B;  3ZO5 B;  1J0G A;  1WR1 A;  2O2V B;  4LDT B;  2AEH A;  4G3X B;  1Z5S B;  4E71 A;  4IUM B;  2YLM A;  3U30 A;  3KYC D;  5D2M B;  4BKG A;  2A5U A;  1EF5 A;  2CR5 A;  2ZEQ A;  3DDC B;  2KDE B;  2GOW A;  3ZVV A;  4HXD A;  4M8N A;  1J8C A;  1T0Y A;  1OEY J;  4IW0 A;  2AL6 A;  4NAW A;  2C7M B;  2DYM A;  1M94 A;  2L05 A;  4FJV B;  3TBL D;  2DYO A;  2HTH A;  4ZRK A;  1WXA A;  2XK5 A;  4MGK E;  1P98 A;  3K9O B;  1E8X A;  1GNU A;  4W9H A;  2OJR A;  2MA9 B;  3APD A;  4PS8 A;  2K8C A;  4G50 A;  2IYD B;  3DBL I;  4FHJ A;  2MRP A;  1XT9 B;  4NQK E;  1YIW A;  3VAW A;  1NDD A;  2FNJ B;  3ML9 A;  4MJS B;  1BT0 A;  2G3Q B;  4KIK B;  3R7Q A;  1WGR A;  1GG3 A;  1Q1O A;  3DVN U;  1YX6 B;  3WAM A;  5CHV C;  1WJ4 A;  1V81 A;  3ZRF A;  1XD3 B;  4A3P A;  4EFO A;  2KJR A;  3R66 C;  4KV2 A;  2KHW B;  3CMM B;  2JVC A;  3KVF B;  2DAF A;  1WYW B;  2KMA A;  3UGB B;  4ANU A;  3APF A;  3WAO A;  1YX5 B;  3IFW B;  2D11 A;  4HWI B;  2RSU A;  5GMV A;  1E8Z A;  2AYO B;  4KSK C;  1WZ0 A;  1Z2M A;  4E74 A;  4AP4 C;  1K8R B;  4EZK A;  2M17 A;  1TTN A;  2KJ6 A;  2M1M A;  4E3C A;  2MW5 A;  2KMC A;  2CHZ A;  4X57 B;  2J0M A;  2NR2 A;  5C1Z A;  2N1W A;  3ENE A;  2KDB A;  2N7E A;  3KUC B;  3K9P B;  2KAN A;  4WJN A;  1R4M I;  4ICU A;  3PHX B;  1WE6 A;  3L17 A;  4BKS A;  2R2O A;  3OJ4 B;  3RT3 B;  4W9L A;  3KYD D;  3UQA A;  4FN2 A;  4TUU A;  3DBH I;  3ALB A;  1D3Z A;  5JZE B;  2R2Q A;  1YQB A;  4F8C B;  2GBR A;  1AAR A;  2BYF A;  3EFU A;  3H7P A;  3ZW3 A;  4DXA B;  3B0A A;  2JWZ A;  2KXJ A;  3H7P B;  2KZR A;  1SE9 A;  2KFJ A;  4HPL B;  3UF8 A;  4GDK B;  4NQL B;  1WM3 A;  3EHV A;  1LXD A;  4GDK A;  3ZIM A;  3QK0 A;  3RYT A;  4DHZ B;  4WJO A;  2M0X A;  4M8M A;  1JRU A;  3B1L X;  3VTW A;  3V60 A;  3NHE B;  1WZ3 A;  4ICV A;  3UIO B;  3DBS A;  3VXW A;  2LRU A;  2FCM A;  2KQ7 A;  5DPW A;  2ZNV B;  3PGE A;  4XX5 A;  2J7Q B;  4KSL C;  3VUW A;  5CHF A;  4DK5 A;  4MSM B;  1C1Y B;  1Y8R C;  3SHQ A;  3NY5 A;  2IO0 B;  2MCN B;  3ZRC A;  3KH0 A;  4DHJ B;  3A9J B;  5KHO A;  1C3T A;  3VQI A;  4EOY A;  1S1Q B;  3QHT A;  1PQS A;  4KDI C;  5D7G A;  5DPR A;  3S2A A;  2BF8 B;  3PTF C;  4BVU C;  2DZM A;  3PV1 A;  5FR6 A;  2GBJ A;  4WWP A;  1ISN A;  2ZJD A;  3GOE A;  4K7U A;  4M0W B;  3LDZ E;  4B9K A;  3KUD B;  1WIA A;  2KOX A;  4K81 A;  4NJ6 A;  5IA7 A;  4TKN A;  2G4D B;  4JLC A;  1V6E A;  3C0R B;  3PSE B;  1YD8 U;  3RCZ A;  4CHK A;  3CF6 E;  3OAW A;  4GMV A;  2L0F A;  2I1K A;  4WJP A;  3AXC A;  2NVU I;  4RMA A;  4OVU A;  4FJY A;  3UIN B;  2KJH B;  3JSV A;  3M95 A;  4HK2 A;  3AU5 A;  3DPD A;  4K1R B;  2G4S A;  3PS6 A;  4MDK E;  4W9E A;  4MGZ E;  3L08 A;  3LJ3 A;  5AEK B;  4NNJ B;  5DCN A;  2XBB C;  5LXI B;  2DEN B;  1HE8 A;  2LAS A;  2GBN A;  1S3S G;  3V6C B;  4TQ1 A;  3WAP A;  3ZUN A;  3A4R A;  2AWT A;  2REX A;  4DHZ E;  4IWP A;  2HJ8 A;  2YVC A;  5AZG A;  1V2Y A;  3A4S C;  4IWQ A;  1P9D U;  4BKT A;  2FCS A;  3QAQ A;  3L10 B;  4GGQ A;  1RAX A;  2J0J A;  1UEL A;  1LM8 B;  2MX2 A;  4LJO B;  4FAD A;  4PYZ A;  2BKR B;  3PT2 B;  4HJK A;  1WE7 A;  2KN5 A;  2L00 B;  2WX1 A;  3QAR A;  3ECI A;  3H9D A;  1ZW7 A;  4K7W A;  3VHT C;  2BGF A;  3L16 A;  2LUE A;  3N32 A;  3PLU A;  2C7N B;  3HIZ A;  4A20 A;  4BFR A;  5E6P A;  1WJN A;  1RLF A;  4BOZ B;  3ZNZ B;  1WMH A;  1H8C A;  4BBN F;  3M63 B;  1Q0W B;  2CS4 A;  2RGF A;  3D32 A;  1GJZ A;  2FCQ A;  2KDF B;  2L8J A;  2HE7 A;  4XC2 A;  5G2N A;  4MGI E;  4W9F A;  4G11 A;  5BO4 B;  2JUO A;  1WH3 A;  4ANW A;  2FCN A;  2LD9 A;  5LLI A;  3TMP B;  2DX5 B;  3NZS A;  1KM7 A;  2CKH B;  2N9X A;  4FLH A;  5AZH A;  4RM9 A;  1A5R A;  2LJ5 A;  4HDQ A;  5DPS A;  4IG7 B;  2DHZ A;  3PHW B;  2D07 B;  4FJZ A;  4K7S A;  2NPT A;  3KUZ A;  3HHM A;  4AUQ C;  2Z0E B;  4W9C A;  4F1S A;  3TJP A;  4WQO B;  4MGY E;  2LRW A;  2IY0 B;  2Z0D B;  2BPS A;  4WWN A;  1WR6 E;  3ZKJ C;  4AJY B;  3V61 A;  3IG3 A;  1RFA A;  3OJ3 A;  4MEM A;  1WX8 A;  3DVG X;  2D2Q A;  2NBV B;  4W9D A;  2BWF A;  1WX9 A;  4W9K A;  1TZ1 A;  1EUV B;  2O2V A;  4BOS C;  4FHK A;  4KZC A;  1LFD A;  2JRH A;  2WX0 A;  3QC8 B;  1EO6 A;  3BIN A;  4I6P A;  3QIJ A;  1WY8 A;  2IO1 B;  3X23 A;  5E6N A;  4NPN A;  3VH3 B;  3I3T B;  3N3K B;  2M8S A;  4LDT D;  1ZKH A;  2AL3 A;  4GXB A;  1WJU A;  4EKU A;  1U4A A;  2KWV B;  2LGY A;  2N7D A;  3AU4 A;  2EKE C;  5J18 A;  2MBO A;  1WGG A;  2FID A;  1Q5W B;  2W9N A;  5IAA C;  1V80 A;  3VTV A;  1E7U A;  4AOF A;  2ZZP B;  1WGY A;  3ZDT A;  1V9J A;  5E6O A;  2KDI A;  3A1Q A;  2JY6 A;  2UWQ A;  2LVP A;  4RM8 A;  2O6V D;  5C23 A;  2CHX A;  2MBH A;  2JZZ A;  2WYQ A;  5JHB A;  2JRI B;  2K25 A;  1P3Q U;  1E8W A;  3DVN V;  4JQW C;  4WJQ A;  4AWJ A;  2NS5 A;  4ZRI A;  3SD5 A;  2J0K A;  3JYU A;  2KLC A;  3A9K A;  3RUI B;  3T9L A;  1WRD B;  2LVO A;  3N30 A;  3VDZ A;  4DWF A;  5LXH A;  1GC7 A;  3TL5 A;  3NOB A;  2O6V A;  3PPA A;  2LGD A;  2GBM A;  2ZNV C;  4B6W A;  1OEY A;  2PE6 B;  2PPH A;  3DVG Y;  3U8Z A;  4ASW C;  2L0T A;  3PRZ A;  3RZF A;  1GUA B;  2K8B A;  1WM2 A;  1E8Y A;  2KX3 A;  1WGD A;  5CTR C;  2A4Z A;  3EEC A;  3PRE A;  4CYE A;  2XK5 B;  3VVW B;  4TQ0 A;  4KDL B;  2JZ3 B;  4GDL B;  3WA0 A;  5J2R A;  2C7H A;  3W1Y A;  2MBE A;  2HD5 B;  3IBE A;  1WX7 A;  1SIF A;  4TV3 A;  2IY1 B;  3VH4 B;  3QJZ A;  5AZF A;  3PRM B;  3DOW A;  5CHW A;  2LXA A;  2I1J A;  1SGH A;  2JF5 A;  1I42 A;  2RPQ A;  3GZN I;  3HM6 X;  3X0W A;  3ZDM C;  1IYF A;  2KTR B;  3H7S A;  3IHP C;  3A33 B;  2L76 A;  3KW5 B;  5JHA A;  4KIK A;  2Y5B B;  2KWU B;  2BYV E;  4GU2 A;  2C60 A;  1UGM A;  3RUL A;  3ZNI D;  3QA8 A;  4WAA A;  4CO7 A;  2MQJ A;  2ZVO A;  1CMX B;  2KFK B;  2JT4 B;  3TIX A;  4J6I A;  1R4N I;  4ANX A;  1UH6 A;  1H4R A;  1GC6 A;  1TGZ B;  4WWO A;  2VRR B;  1V5T A;  1P1A A;  3HK0 A;  3O65 B;  2ASQ A;  2NPT B;  1F9J A;  5DPT A;  4EEW A;  2EMT A;  4W9G A;  3B08 A;  1UBI A;  4BKS D;  2JXX A;  3L0W B;  3SDL C;  2KQS A;  1IP9 A;  3JVZ X;  4IC7 B;  4ZRJ A;  2KO3 A;  1OGW A;  1WMH B;  2CHW A;  3EC8 A;  3P2B A;  3SU8 X;  2K6D B;  4IM0 A;  5D6J B;  1KLV A;  3R7R A;  1UBQ A;  3WAN A;  1WF9 A;  2ZPY A;  4BBN C;  1QZE A;  2B3A A;  2KVR A;  2QHO A;  2K39 A;  1LQB A;  3A9J A;  4N9F 4;  3DBR I;  4W9I A;  3A9K B;  3RZW C;  3CSF A;  1NI2 A;  1J19 A;  2WWZ A;  4G0N B;  2KFK A;  1L2N A;  4PS7 A;  2D10 A;  4MM3 A;  3PZD A;  5D94 A;  1YJ1 A;  3AUL A;  3ZTC A;  1E7V A;  3ZTD A;  3Q3J A;  4GSW A;  2KC1 A;  2K1F A;  4HCP B;  1UZX B;  2FIF A;  2KD0 A;  2DZJ A;  2LZ6 A;  2MLB A;  2L7R A;  3IVF A;  2L3Z A;  4HPM B;  4GIV A;  2IZV B;  4OVV A;  2UYZ B;  2DYB A;  1V86 A;  3OLM D;  2MBB B;  4II3 B;  1UD7 A;  2K6Q A;  2ZVN A;  3UQB A;  2K8H A;  3NZU A;  2RR9 A;  4LCD E;  3ZLZ A;  1WI0 A;  4HVB A;  1VD2 A;  3H6N A;  2KTF A;  3VUY A;  3ZNG C;  4A3O A;  4B95 A;  4EUT A;  2FAZ A;  2N9E B;  4GB9 A;  4IM3 A;  1I35 A;  1RRB A;  4LJP B;  3VFK A;  2NBU A;  4I6N B;  4IM2 A;  2KLG A;  4P7I A;  2NCN A;  3M62 B;  1G6J A;  3ML8 A;  5L83 A;  3Q3F A;  4FUL A;  2O6V B;  3DQV A;  2GMI C;  1XQQ A;  3V6E B;  2N1V A;  1OQY A;  2ZCB A;  5TR5 A;  2WDT B;  2BYE A;  1IPG A;  2G45 B;  1FXT B;  4JIO U;  3PLV A;  2CU1 A;  2ZCC A;  4EZL A;  2V4L A;  4HLE A;  4NY0 A;  3MHS D;  2KC2 A;  3A1Q B;  2IO2 B;  4ZDV A;  2M4N A;  1WXV A;  4ANV A;  3TCA A;  2GBK A;  3QWZ B;  3BY4 B;  1WFY A;  4XZ4 A;  2PJH A;  3HM3 A;  4MJS A;  2DAJ A;  1V49 A;  3H1U A;  3L54 A;  4MH0 E;  4KZ0 A;  3NS8 A;  2DZK A;  5G55 A;  2BKF A;  2RD0 A;  2LGX A;  1V5O A;  4URK A;  1KOT A;  5JH5 C;  2KKC A;  3WAL A;  2IBI B;  3RD2 A;  3PVL A;  5J17 A;  4PYU A;  3VTU A;  3T8M A;  2XEW A;  4HCN B;  4W9J A;  1WXM A;  2C9W B;  1X1M A;  4AJW A;  2C5L C;  2V3S A;  2MWS B;  3QX1 A;  2LXC A;  4NAW B;  4F7Z A;  1OTR B;  4FA6 A;  4DHJ D;  2FUH B;  3MJW A;  4GOC A;  1WXS A;  4GDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...