4X57B

Structure of an arabidopsis e2 / membrane-anchored ubiquitin-fold protein complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
PEEESIDIKFRLYDGSDIGPFRYSAASTVDFLKQRVVSDWPKGKTVVPKGINEVKLISSGKILENNKTVGQCKTPFGDIAGGVIVMHVVVQPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-conjugating enzyme E2 8
publication title Structure of an Arabidopsis E2 / Membrane-anchored Ubiquitin-fold ProteinComplex
rcsb
source organism Arabidopsis thaliana
molecule tags Ligase/protein binding
total genus 19
structure length 93
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13881 Rad60-SLD_2 Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4x57B00
2LVOA 2DZJA 2LGDA 1I35A 4HPLB 1WF9A 3VTUA 2DYBA 1R4MI 4II2B 5AZFA 5J2RA 1WGGA 2DAJA 2IO0B 3QK0A 3O65B 5CHFA 4DK5A 2KTRB 4OVUA 1L7YA 1YX5B 2BKFA 2NCNA 1JRUA 4ZRIA 3M95A 1E7VA 3HM3A 2ZPNA 4BOZB 2UYZB 5AZGA 2BPSA 4M8NA 2MRPA 3KW5B 3QIJA 2KMAA 1P9DU 2M8SA 2FIFA 4HCNB 2L0FA 3VQIA 3VXWA 2KLCA 3L16A 3N3KB 2ZZPB 1NI2A 2G4SA 3NZSA 3QCAA 4BBNC 4GDKA 4GN1A 3H1UA 4TQ1A 3ZNGC 4KZ0A 4IM0A 2KDIA 1AARA 3MJWA 4F8CB 1X1MA 2DYOA 2N9PC 2AEHA 2BKRB 2WYQA 1S1QB 4WJPA 2MBHA 4ICVA 4W9JA 3RCZA 1E90A 3PHXB 1PQSA 2PPHA 2G3QB 1IYFA 2L3ZA 2MSED 2EMSA 3Q3JA 4MM3A 5AZHA 5JHAA 2KMCA 2LWPA 3PV1A 3A4SC 1GJZA 1NDDA 2JWZA 1WGRA 3ZDTA 2IZVB 2J0KA 2REXA 2ZNVC 1SIFA 1RFAA 1QZEA 3BY4B 1EO6A 1RAXA 4IG7B 4P7IA 3IBEA 3KYDD 4ICUA 1ZW7A 4JLCA 5E6PA 2MCNB 4BKGA 4I6LB 3ZTCA 2GBMA 2PEAA 5CHVC 1E8WA 2GBKA 1WMHB 1WXSA 2KDBA 4IWOA 2DENB 2CR5A 3L10B 3QC8B 3UGBB 3OJ3A 2GOWA 2MX2A 2QHOA 3ONSA 3DOWA 4GXBA 5LXHA 2KNBA 3A4RA 2ZCBA 2LVPA 4KDLB 1OEYJ 3TMPB 4FJZA 4PS8A 1E5WA 2JRIB 3ECIA 4A20A 1LXDA 2FAZA 3B1LX 3UF8A 2N4FA 4II3B 4IWPA 1RLFA 4FJVB 3W1SA 2JZ3B 3ZDMC 1XQQA 2KX3A 2N1WA 3AXCA 2XK5A 4GU2A 3JYUA 5L83A 4PYUA 5JZEB 1TZ1A 4PS7A 3KH0A 2D2QA 3ML9A 4AOFA 4PYZA 3DBLI 4CYEA 2D11A 4HK2A 3ENEA 2ZCCA 3PGEA 2LRWA 4HJKA 2C60A 3WAMA 3T8MA 4ASWC 3RD2A 4MGKE 2JT4B 3TBLD 1OEYA 2JUOA 2L05A 2N1VA 3H6NA 4MGZE 5G55A 3V6CB 1H8CA 4MH0E 4E3CA 1WE7A 4GDLB 1WJ4A 5LXIB 2BYFA 1WX7A 2ZVNA 3KYCD 4IUMB 3TIXA 1WXMA 2EKEC 4DXAB 4K7SA 3LJ3A 1Q1OA 3AI5A 4J6IA 2MP2A 1WM3A 3V6EB 4W9EA 2FUHB 2JRHA 5JHBA 1UBQA 1R4NI 2JF5A 2IO1B 1HE8A 2M0XA 3RZWC 3A9KA 4MGYE 5C23A 2KJRA 5D2MB 3VH4B 1L2NA 4WJNA 2KX0A 3D32A 2I1KA 3I3TB 2DAFA 1WJNA 4KZCA 4N9F4 5DPTA 4PS3A 2K8BA 5CX3A 2AYOB 4WAAA 3L0WB 4GOCA 2O2VB 3JSVA 2NBVB 3W1YA 3SU8X 3IFWB 3B0AA 3NZUA 2VRRB 2JXXA 4F7ZA 3R3MA 3U30A 4EOYA 3APDA 4FN2A 4B9KA 4DDID 3W1SC 3V60A 4TUUA 4EFOA 2IO3B 1KJTA 2WX1A 2O2VA 4TKNA 4DHZE 1YJ1A 2O6VD 3DCGA 4MEMA 3VUXA 2IY0B 1NBFC 4MJSA 3DVNV 2R2OA 3PT2B 4NNJB 2Z59B 2RPQA 2YLMA 5DPSA 3WA0A 4DBGA 1OQYA 5CHWA 4LDTD 4I6PA 1OGWA 2DHZA 4G11A 1H4RA 3U7DA 1G6JA 2NPTA 3U8ZA 1FXTB 2A4ZA 2FIDA 3DQVA 2KZRA 2LGYA 1WGYA 3VUYA 3AU5A 3ZRFA 4WQOB 3X0WA 2C7HA 1P0RA 4IM3A 4W9GA 1Z2MA 2N7EA 4EZKA 3SDLC 2CHWA 4ZRKA 2K8CA 2KTRA 4JL9A 2K25A 2K8HA 4HWIB 4XZ4A 2N9XA 3K9OB 1V86A 4MELA 3ZNID 2HE7A 2NR2A 4KDIC 2K39A 2MW5A 2BYVE 4NQKE 5IAAC 4LJOB 2GBRA 5LLIA 4JGHB 4NAWB 3VAWA 3AULA 3MTNB 2NBUA 2DZMA 4IC7B 1V80A 4MGIE 4WJQA 3EC8A 2G45B 3M3JA 4RMAA 4E74A 1XT9B 1ZKHA 3QA8A 1V81A 1Q5WB 4ZDVA 3WAPA 2KN5A 4W9DA 3L08A 3H7PB 4DHZB 1E8XA 3SHQA 1WZ0A 3H7SA 2OOBB 4GB9A 2L00B 2L8JA 1SGHA 3CSTA 4AP4C 2MBOA 4A3PA 2KC1A 4W9IA 1V5OA 4AUQC 2RGFA 4ANVA 2ZJDA 4IWQA 2DYMA 1WI0A 2IY1B 2M1MA 1WFYA 2NBWB 3VDZA 1TGZB 3QWZB 4W9LA 2LGXA 1P98A 2KQSA 3UIPB 2DX5B 3AU4A 2J0JA 3NY5A 1CMXB 1YD8U 2KFKB 4DWFA 3PSEB 3EFUA 3PVLA 3DBRI 3H9DA 2JVCA 3M63B 2LXCA 4K1RB 2K1FA 2XBBC 1WMHA 3V61A 3HIZA 3IG3A 3L17A 4KSKC 4HPMB 4WWNA 1UGMA 4BKTA 1TBEA 2BGFA 2LRUA 1WGHA 5D6JB 3ZLZA 3PLUA 1V9JA 5TR5A 4HVBA 2ASQA 2LVQA 2V3SA 2V4LA 3QQ8B 2O6VB 4EEWA 2K6DB 1RRBA 5J18A 4XX5A 1YIWA 3QAQA 3NOBA 2RD0A 1A5RA 4WWOA 1WJUA 3OAWA 2KKCA 3APFA 2KOXA 1U4AA 3RZFA 3ZNHB 1T0YA 4LDTB 4FJYA 4EKUA 5CTRC 4X57B 3IVFA 4A3OA 2IBIB 1V49A 5JH5C 3PREA 5E6OA 3KUCB 1YQBA 3ALBA 1S3SG 3ML8A 5C1ZA 4BKSA 1Y8RC 2LASA 4GSWA 3TCAA 3A9JB 4BFRA 2KDEB 4CHKA 4GDLA 1VD2A 1IPGA 2XEWA 4W9CA 4ANWA 4NY0A 1UELA 1VCBA 2FCMA 4M8MA 3APCA 3QHTA 3ZO5B 3UIOB 2KWUB 3PRMB 3HHMA 4EZJA 2KJHB 1V5TA 3N32A 2KDFB 3ZTDA 2MQJA 3T9LA 1YX6B 1V6EA 2LZ6A 3JVZX 3KUDB 3PRZA 4FULA 3VTVA 2FCSA 4FHKA 1ZGUB 2MBEA 5DCNA 3ZW3A 2ZVOA 2MLBA 1WJ6A 4EUTA 4AJWA 2BYEA 4DHJD 1GC6A 2I1JA 2GMIC 3M62B 4MDKE 3L54A 4RM8A 2IO2B 4KIKB 2KC2A 2Z0EB 1I42A 2ZNVB 3DBSA 2CS4A 3JW0X 1V2YA 1BT0A 2LD9A 3PLVA 2RR9A 4IW0A 3VVWB 2M4NA 4B95A 2LI5A 1WE6A 1WYWB 4K81A 2KWVB 1P3QU 1WXAA 2G4DB 4I6NB 2UWQA 4LCDE 3X23A 5J17A 1J8CA 2L7RA 3VTWA 4FLHA 2PE6B 4BBNF 2D3GA 1SE9A 1MG8A 4FADA 4K7UA 4LJPB 3RT3B 2YVCA 3V62A 4FA6A 2KD0A 2PJHA 4W9HA 4ANXA 5DPWA 2JZZA 2B3AA 4ANUA 4BKSD 3RUIB 2C9WB 3UQBA 2GBJA 2CU1A 4W9FA 4TV3A 2MA9B 4NQLB 2AL6A 4GDKB 1UZXB 3GOEA 3S2AA 4KSLC 2M17A 4GGQA 3ZUNA 5D94A 3KUZA 3PS6A 4E71A 1F9JA 2HJ8A 2FCQA 3A1QB 4ZRJA 5GMVA 2KANA 4G0NB 2IYDB 2A5UA 2HD5B 4XC2A 4OVVA 4URKA 4BOSC 4GMVA 3Q3FA 1XD3B 2D07B 1E8YA 2KHWB 2LUEA 3CMMB 3QJZA 3EECA 2MBBB 4NAWA 1LFDA 2KK8A 3PTFC 2MWSB 3CF6E 4ZYNA 1D3ZA 1WM2A 3A1QA 4EZLA 2KJ6A 1P1AA 1E7UA 1E8ZA 4TQ0A 1M94A 2NS5A 2C7NB 4M0WB 3HM6X 2BWES 4K7WA 1WXVA 3R7QA 3H7PA 2CHXA 5DPRA 3VFKA 2V1YA 3VUWA 2CKHB 2JPHA 3OLMD 3R7RA 3R66C 3UINB 4G50A 3VH3B 2ZEQA 3VHTC 4WWPA 2AWTA 2C7MB 3L13A 4HXDA 1WX9A 2DZKA 3A33B 5IA7A 3UQAA 1LQBA 5FR6A 2HTHA 3LDZE 1KOTA 4IM2A 4FBJB 4KVGB 3C0RB 3TJPA 1IP9A 2Z0DB 5EDSA 3OJ4B 4HDOA 3B08A 4AJYB 4MSMB 4HCPB 4DHJB 3WIMA 3DVGX 3NS8A 2XK5B 2KFKA 1WGDA 4HDQA 4NJ7A 2L76A 3ZVVA 1J0GA 2KLGA 3DPDA 2DZIA 2PE9A 4NJ6A 1KM7A 2KXJA 1J19A 1KLVA 5E6NA 5KHQA 2LXAA 2ZPYA 3RYTA 4W9KA 2KQ7A 3ZIMA 3PPAA 3BINA 1EUVB 2D10A 2O6VA 1Z5SB 3HK0A 2WX0A 3WANA 2GBNA 3ZKJC 5HKHA 4GIVA 3DVNU 3RULA 3WALA 1GNUA 5AEKB 3MHSD 4JQWC 1UD7A 1LM8B 3NHEB 4NPNA 1UH6A 2LJ5A 2MP2B 3DVGY 2MBQA 4G3XB 5D7GA 2KO3A 1OTRB 5G2NA 4DDGD 3K9PB 1WY8A 2W9NA 2WDTB 3A9KB 3QARA 4BVUC 3DDCB 2N9EB 1ISNA 1WR1A 1TTNA 2J0MA 3N30A 2N7DA 2NVUI 3QX1A 1WR6E 3A9JA 3PZDA 2BF8B 2RSUA 1EF1A 2K6QA 3IHPC 3JSVB 1WX8A 1WZ3A 2AL3A 4RM9A 1C1YB 2KFJA 2R2QA 1GUAB 4CO7A 4WJOA 1GC7A 1WIAA 4KV2A 2OJRA 3EHVA 1Q0WB 3TL5A 4B6WA 2J7QB 2C5LC 2FCNA 3DBHI 4YL8A 2EMTA 4F1SA 4HLEA 3ZNZB 3PHWB 5KHOA 2JY6A 2KWCA 3GZNI 1UBIA 2KTFA 3PRPB 3SD5A 2Y5BB 4MJSB 3P2BA 1WRDB 3WAOA 2WWZA 1GG3A 5BO4B 1WH3A 4FHJA 3ZRCA 2FNJB 5L95C 2CHZA 2BWFA 2KVRA 1K8RB 2L0TA 3CSFA 4JIOU 4MSQB 3KVFB 4KIKA 1EF5A 4AWJA 1C3TA 2NPTB
chains in the Genus database with same CATH superfamily
1WF9A 3VTUA 2DYBA 5J2RA 2XN9C 1L7YA 4RGTA 4B0EA 2BKFA 4M8NA 2JSVX 1TJEA 2QEJC 3KW5B 3QIJA 4HCNB 3L16A 2ZZPB 3DBRB 3QCAA 4BBNC 1SE2A 2KDIA 1UUPA 4MT5A 2ACZB 2L83A 1ENFA 1X1MA 4YWGG 2AEHA 3AECB 4WJPA 1ZUD2 5EE3A 2QJLA 2G3QB 2MSED 1WYGA 2KMCA 3A4SC 3ZGZA 3AEAB 2QDFA 3FC4A 2IZVB 2SEBD 2REXA 3IBEA 3KYDD 1V1PA 1ZW7A 4ICUA 2HJ1A 4KKJA 3NZ3A 1WXSA 2DENB 4HKQA 2MX2A 3DOWA 4GXBA 5LXHA 2VH1A 4OHJA 2ZCBA 2VZKD 1E5WA 2JRIB 3TSSA 3B1LX 2FAZA 3AE4B 2V3PA 4RH6A 3W5UB 2H88B 1C77A 4OW0A 1SEBD 2WQYB 4C80A 5JZEB 2J53A 4PYZA 5AUIA 2BS3B 2SAKA 2D11A 3ENEA 2C60A 2LGIA 3T8MA 1PUTA 3RD2A 1XF5L 2JUOA 2L05A 3H6NA 4E3CA 4GDLB 1E7PB 5FK9C 2JYEA 5LXIB 1WX7A 1E9MA 3AI5A 2MP2A 4DXFA 5JHBA 1UBQA 1R4NI 3P4RB 2IO1B 4C7YA 5C23A 3MC0B 3VH4B 4WJNA 2KX0A 3D32A 3P42A 5DPTA 1FFVA 3I63C 1HTOA 3L0WB 3W1YA 3NZUA 3N20C 1TS2A 2KACA 4US8A 2AQ2B 4FN2A 4DDID 4AQ7A 2W54A 1V1OA 4N58A 4EFOA 2IO3B 1ZDVA 1B1ZA 3NVZA 2O6VD 3DCGA 3AE8B 4MJSA 4UDUC 3DVNV 2R2OA 1FFUA 2Z59B 1MHHE 2YLMA 1DYQA 3P4SB 1I4XA 5CHWA 4ZHOA 1G6JA 1KRHA 2A4ZA 3RNFC 2LHEA 3DQVA 1QOFA 2KZRA 2GRIA 1WXQA 2C7HA 1P0RA 1Z2MA 2NTTA 1C76A 1KLGD 3SDLC 2K25A 4HWIB 4XZ4A 2N9XA 2NR2A 2K39A 3E9SA 1VRAB 4NQKE 5IAAC 1D6EC 2DZMA 1V80A 4E74A 3EC8A 3MJ5A 3QA8A 4Q2JA 3TEXA 4LNFA 3H7PB 3NJTA 1FNVA 4GB9A 2L00B 3Q3NC 4AP4C 2MBOA 3VDZA 1P98A 4DQOC 2WU2B 1OQQA 3NY5A 2LHDA 4DWFA 4K3BA 3C8YA 3H9DA 3V61A 2BGFA 1MVKA 3ZLZA 2ASQA 2V3SA 3QQ8B 5J18A 1OQRA 3OAWA 4LDTB 1N6ZA 4FJYA 2MJDA 3IVFA 4LLGM 5JH5C 1YQBA 3ALBA 1S3SG 3ML8A 4BKSA 4CHKA 4BFRA 2QCZA 4GDLA 4W9CA 2KDMA 1UELA 1VCBA 3ZO5B 1JMLA 2KWUB 1QOAA 2ZW0A 3N32A 4R3DA 2J4XA 3T9LA 2LZ6A 3KUDB 4HROA 4FHKA 3ZW3A 1WJ6A 4EE2A 4DHJD 2I1JA 3VRAB 2TSSA 4HPPA 1D5XC 2IO2B 3MP9A 1I42A 2ZNVB 3DBSA 1D5MC 3NVVA 3VVWB 2M4NA 4B95A 2IDYA 1WYWB 4TMAB 2KWVB 1WXAA 1J8CA 1TY0A 1GB4A 1SE9A 4YTNB 2KVZA 1YN4A 3SFDB 4ANXA 2JZZA 2B3AA 1FNUA 4BKSD 4KGRA 2C9WB 4NQLB 2AL6A 1UZXB 2BB5A 4KSLC 4GGQA 3ZUNA 4XWWA 5EE0A 2FCQA 4XC2A 1E8YA 2LUEA 3CMMB 2LUMA 3EECA 2KK8A 3PTFC 4WQMA 3HM6X 2WDVB 3R7QA 3AE7B 3H7PA 3O13A 5DPRA 2DBYA 2CKHB 3OLMD 1YJIA 3UINB 3ZJTA 2QILA 2C7MB 3L13A 2DZKA 3A33B 4CQNA 5FR6A 3LDZE 3BK1A 4KVGB 3BVZA 2HTME 4GLSC 1TYGB 4MSMB 4HCPB 3ZJUA 3EGRA 3DVGX 2XK5B 4HDQA 1C4AA 4WIPA 2PKOA 1J0GA 1I4QA 3DPDA 2NMQA 2LMCA 1KLVA 5IOIA 5E6NA 3ZIMA 4OZCA 1TKGA 4D2KA 2WXJA 3ZKJC 4TSSA 3WANA 2GBNA 4GIVA 3RULA 5AEKB 4JQWC 1UD7A 3NHEB 4NPNA 1UH6A 2LJ5A 5D7GA 1OTRB 5FKAC 2D3CA 1JWAD 3U2SC 1WY8A 2QC8A 1HZ6A 2N9EB 4JE3B 2J0MA 2N7DA 1WR6E 3DHHC 1WX8A 4RM9A 2R2QA 1FNWA 2G1EA 2RDGA 4CO7A 1WIAA 2LFIA 4KV2A 3ZJVA 1IBXB 3B2GA 4YXDB 4F1SA 3ZNZB 3GS2A 2KTFA 2WXPA 3ZXRA 3WAOA 5BO4B 1WH3A 3IAM1 1FCLA 2KAJA 4BOSC 4AWJA 4JIOU 3KVFB 3ZTCA 2NPTB 2MH7A 1XLNA 4II2B 2CU3A 2ONQA 1WGGA 2IO0B 2WXFA 1YX5B 1JRUA 4ZRIA 2ZPNA 4BOZB 2UYZB 3HVDA 1SJHD 2KMAA 2FIFA 3VXWA 3VQIA 2KLCA 1JCKB 3N3KB 3ZNGC 4IM0A 3MJWA 2DYOA 2BKRB 1R7SA 1S1QB 3EA6A 2DWQA 2WDQB 1BMLC 3RCZA 2CJNA 1E90A 3PHXB 2ON8A 4MACA 2L3ZA 2JWUA 5AZHA 3PV1A 3U52E 1YJJA 2JWZA 1WGRA 2MEKA 1C9FA 1XXGA 1SIFA 5C2TB 1QZEA 1RAXA 4P7IA 2MCNB 5E6PA 3DWGC 1E8WA 1J7BA 2CR5A 3QC8B 3UGBB 2LEKA 1C4PA 3OJ3A 3TMPB 3ECIA 4A20A 1LXDA 3UF8A 1JALA 4FJVB 3W1SA 2JZ3B 1XQQA 3AXCA 2XK5A 4GU2A 1AW7A 2PLPA 3JYUA 3NVYA 4IKGA 3KH0A 4J3OD 2ZCCA 3Q3MC 3WAMA 2WXRA 3AE1B 1WWTA 3DWMA 4MGKE 1OEYA 2WXHA 3FILB 4MGZE 1STEA 4ZYSA 2I38A 3KYCD 2JU6X 4NJCA 1WXMA 2EKEC 3LJ3A 4L1BA 2B76B 1MHXA 4J6IA 3KLSX 2JF5A 2V0GA 1ZDXA 2QSDA 3P4QB 2DAFA 1D5ZC 4KZCA 4PS3A 2K8BA 3E56A 4FXCA 2AYOB 5CX3A 1N5WA 1IBXA 4C7ZA 2JXXA 4F7ZA 1KH0A 5HG2A 3APDA 1YMHE 4B9KA 2N7JA 2V4IB 3BZDB 1KJTA 2WX1A 4DHZE 4MEMA 5HI1A 1GB1A 3Q8FA 2WXQA 4NNJB 3I5JC 1OQYA 4I6PA 2DHZA 3Q6BA 1H4RA 3U7DA 2NPTA 3ZXVA 4XDDA 3AH7A 1FCCC 2FIDA 1IUEA 2LGYA 4M02A 1JWSD 4EZKA 3RI7C 1ACCA 4JL9A 1V86A 4MELA 2HE7A 1FXAA 4KDIC 2VH2A 1F2RC 1XEEA 1LGRA 2YEPB 3AE6B 1XLOA 1L6VA 4MGIE 4WJQA 1CZPA 3NG0A 3I9V1 1ZKHA 1V81A 2KN5A 4W9DA 5EE1A 4ITKA 3CSTA 2INCC 1TZOA 1PDXA 2RGFA 2ZJDA 3W9CB 2KN4A 1WI0A 4XWTA 4RCOA 2BYTA 4XGAB 3DHGC 1QILA 3J9CA 1CMXB 4QAYA 2JVCA 4IOIE 1FM0D 2K1FA 3HIZA 2W82A 4HPMB 3P4PB 5D6JB 2LRUA 1WGHA 1V9JA 5TR5A 1SE3A 2BS4B 1K50A 2LVQA 4ZRQA 2V4LA 3DBHB 1RRBA 4KKIA 1YIWA 3QAQA 4LNIA 4WWOA 1WJUA 1ZOYB 1A70A 2WXGA 2KOXA 1HA5A 4X57B 5BMHA 1E0ZA 3PREA 5E6OA 3KUCB 4YTPB 3BIID 1Y56A 2LASA 3FILA 3N1YC 3TCAA 2KDEB 1IPGA 4EZJA 3HHMA 2KJHB 1ZXHA 4AS1A 1YX6B 1KF6B 3JVZX 1XLPA 1JW9D 2RPVA 1EU4A 2MLBA 4AJWA 3M62B 3L54A 1KFYB 2KYWA 3URYA 1RFKA 2KC2A 2GB1A 3BK2A 3JW0X 1V2YA 1BT0A 1FD6A 5MPOA 3W2DA 4RGMA 5H8YE 4K81A 1P3QU 2G4DB 3PZ8A 2UWQA 3VTWA 2KMMA 1C78A 3MHZA 4LJPB 3V62A 2YVCA 2WXOA 4FA6A 1L0VB 3N9YC 1ZXIA 3RUIB 2G9HD 2CU1A 4REZA 2MA9B 2WHIA 3S2AA 2M17A 5D94A 3PS6A 3B2FA 3OG5A 4E71A 2HJ8A 2OJWA 2KANA 2IPKD 3Q3FA 2MBBB 4MM3B 1FRDA 4LNOA 4ZYNA 1D3ZA 2KT7A 1WM2A 2KJ6A 4USAA 1E7UA 2NS5A 4M0WB 2ICIA 4K7WA 2CHXA 2V1YA 3GB1A 2JPHA 3R66C 4G50A 5IA7A 3UQAA 1HQRD 1SJED 2K3UA 3EFCA 3TJPA 1IP9A 2Y5CA 5D3IB 5EDSA 3OJ4B 1R4NB 4HDOA 1XCQL 3MC8A 1K52A 3Q8EA 2L76A 2DZIA 1SF0A 1MI0A 2BT6A 2LXAA 2W3RA 4PT5A 3PPAA 1EUVB 1Z5SB 4JWUC 3LB8C 2X38A 3WALA 1LM8B 3KQ4A 5I4DA 1VLBA 1P7FA 2K22A 4DDGD 5E6JA 2W9NA 3A9KB 4O1NA 3RPFC 3RNGC 3N30A 2NVUI 3QX1A 1L4ZB 2RSUA 1EF1A 2K6QA 1F52A 3GP7A 1C1YB 1GUAB 4LNNA 2OJRA 2C5LC 4YL8A 3AE3B 2DLBA 4RF1A 2EMTA 1TIFA 4HLEA 3NRZA 1WGKA 1V97A 2JY6A 2D5GA 2KWCA 3GZNI 3PRPB 4OVZA 2Y5BB 1PYWD 1GG3A 4FHJA 2FNJB 5L95C 2PMVA 4MSQB 2L0TA 3CSFA 4NAMA 2DZJA 1N61A 2GLSA 2EKIA 1R4MI 5BYRA 4NZLB 1EM7A 3QK0A 3O65B 5CHFA 4DK5A 4WURA 2KTRB 2NCNA 1N60A 1E7VA 2J52A 3HM3A 2KQ4X 5AZGA 1P9DU 2M8SA 2L0FA 4GN1A 4TQ1A 1FPYA 1SE4A 2WXKA 3Q69A 2WYQA 1TKYA 1PQSA 5T8IA 2QMTA 2EMSA 4MM3A 4A9AA 5JHAA 2LWPA 1GJZA 1NDDA 3ZDTA 2X8XX 1WRIA 2J0KA 1UWMA 4IG7B 4M0WA 1EO6A 2N0SB 2PTLA 3OWEB 4MH8A 2K5PA 1WMHB 2KDBA 1E10A 3RNEC 2D3AA 2JQRB 2GOWA 4JX1C 3AEGB 4YSZB 2LVPA 4FJZA 4PS8A 3RNCC 1QQRA 2N4FA 5JXVA 1JQ4A 5BMIA 3Q8CA 1I4HA 4ZHPA 3ZDMC 2KX3A 2WLBA 4A8XC 1VZ8A 2D2QA 3ML9A 3DBLI 1JWUD 4HK2A 2LRWA 3TBLD 3V6CB 4MH0E 3VRBB 2BYFA 4IUMB 4BAXA 1PGXA 4ARCA 1Q1OA 1ROEA 2JRHA 1HE8A 2M0XA 3RZWC 3A9KA 4MGYE 2KJRA 5D2MB 2RDHA 3I3TB 4XYCA 1WJNA 3V05A 2FUG1 4GOCA 2NBVB 1F77A 3IFWB 3R3MA 2FE8A 4EOYA 3MFGA 2L32A 4KX6B 4RGNA 2O2VA 1YJ1A 3VUXA 2IY0B 2LJIA 1NBFC 3PT2B 2RPQA 5DPSA 3WA0A 4LDTD 1OGWA 2WXNA 1FXTB 1EWYC 3H8HA 3VUYA 2BB6A 3SFEB 3X0WA 4C56C 4W9GA 1UF0A 1MFWA 2CHWA 1VDVA 2KTRA 2K8HA 1FMAD 3P1MA 1HEZE 1JWBD 1PGAA 1DGJA 1ESFA 1N62A 4IDIA 2MW5A 2WU5B 4LJOB 1FXIA 4RF0A 1J7AA 5IO9A 5LLIA 4JGHB 4NAWB 3AULA 1TT5B 4YSYB 3MTNB 1L0YB 2G45B 4C4VB 1MJDA 1XT9B 1IGCA 3WCQA 1Q5WB 5IKCM 3WAPA 2IJ0A 4DHZB 1E8XA 3H7SA 2L8JA 3NUHB 1SGHA 4XDCA 2DNFA 2BS2B 1QLBB 1V5OA 2UU7A 3NS1A 1PFDA 4ANVA 2DYMA 3TEYA 2M1MA 3Q3OC 3QWZB 2KQSA 3AV8A 3UIPB 2V3NA 4XE0A 3AU4A 2IGHA 2J0JA 3KWVA 3PSEB 3PVLA 3DBRI 3M63B 2LXCA 4K1RB 2XBBC 1WMHA 3IG3A 2YEPF 1TS5A 1K53A 4KSKC 3AEEB 1TBEA 3RNBC 3PLUA 1I4RA 2Y5PA 3V3XA 3SR6A 2O6VB 4EEWA 4XX5A 3NOBA 2RD0A 3RMKC 1A5RA 1T3QA 3APFA 1CQVA 1U4AA 1L4DB 4EKUA 5CTRC 1C79A 4JPSA 4A3OA 2M56B 2IBIB 3ZQ4A 1V49A 1FRRA 4M00A 1Y8RC 3A9JB 2WDRB 1VD2A 3AEDB 4ANWA 5AUKA 2FCMA 3QHTA 3PRMB 2ZW1A 1V5TA 2KDFB 1QKZA 2MQJA 3U7ZA 4L2YA 2N9LA 3VTVA 4FULA 2FCSA 5DCNA 2PW9A 5LNK1 1TS4A 1EWCA 2GMIC 1XLQA 2WXIA 2L1AA 4KIKB 3Q8AA 2Z0EB 2OHFA 1QT9A 2CS4A 2LD9A 3PZ7A 5D3DA 1I7HA 2RR9A 4IW0A 1RWSA 1F2RI 4WWMA 1QOBA 1WE6A 3UI3A 1C4CA 1UNSA 4I6NB 1ZE3D 2MJEA 3BYTB 4BBNF 2D3GA 1MG8A 3FAHA 4FADA 2BTEA 4S0RA 2KD0A 2K9XA 4ANUA 1VZ6A 3UQBA 4W9FA 3LXFA 2XNAC 1FEHA 1T5XD 4GDKB 2WXMA 4P16A 1BUIC 1F9JA 1OFFA 4G0NB 2A5UA 2HD5B 2IYDB 4OVVA 2WXLA 4GMVA 1XD3B 2D07B 2KHWB 1FIQA 4NAWA 1GPXA 1JROA 2PIAA 1RYJA 5GXGB 3ETRA 3A1QA 4C4VA 1E8ZA 3AM9A 2C7NB 3PO0A 1GAQB 1WXVA 3W5VB 3VUWA 2INNE 4N6EB 3R7RA 2ZEQA 4WWPA 2AWTA 4ACFA 3BVMA 1PGBA 2BBCA 2MJ3A 1KOTA 1L0XB 4IM2A 3N1ZC 4FBJB 2Z0DB 1KLUD 1BXTA 4KGSA 1GOZA 4DHJB 3NS8A 1L5PA 4NJ7A 3ZVVA 1VR9A 3AEFB 2KLGA 3GE8C 4RGOS 2AQ1B 2N9KA 3RYTA 4ZRPA 1RM6C 1YQ4B 3BINA 1NYQA 2D10A 2O6VA 1C3TA 4ZOHC 3AN1A 4YTMB 3DVNU 3VR9B 2BVCA 3MHSD 1NVID 2KO3A 2Z8LA 5G2NA 1AWDA 1YN3A 3TEWA 2WDTB 1L6UA 4BVUC 3DDCB 1ISNA 1WR1A 3R8BA 1TTNA 1V8CA 3A9JA 2BF8B 3IHPC 3JSVB 1WZ3A 2KFJA 4WJOA 1VZ7A 3EHVA 3TL5A 1ZP0B 4B6WA 3PHWB 5KHOA 2E6XA 2LGSA 5BMGA 3ZYYX 3RFZB 3SD5A 1N63A 3CIRB 3P2BA 1WRDB 4BZAA 2WWZA 4PK1A 3ZRCA 2D3BA 2BW2A 2CHZA 2KVRA 1K8RB 4W9HA 4KIKA 3HRDD 2LVOA 2LGDA 4JWSC 1I35A 4HPLB 1LO5D 3U4EG 1TY2A 5AZFA 2DAJA 3P63A 4P6VF 2HDEA 3BWUD 4HRSA 4OVUA 4P1BC 3M95A 1UGJA 2BQQA 2BPSA 3TEZA 2MRPA 3HUIA 4LNKA 1NI2A 2G4SA 3NZSA 4GDKA 3H1UA 3KWLA 4KZ0A 1DOIA 4KGTA 1AARA 4F8CB 2N9PC 2M0AA 5G5GA 2MBHA 1DOYA 1VJKA 4ICVA 4W9JA 3MC9A 2PPHA 1IYFA 4A6QA 3Q3JA 1FO4A 2WGSA 1F1HA 2ZNVC 4N59A 1RFAA 3BY4B 4HEA1 2WP9B 1ZPSA 4JLCA 4BKGA 4I6LB 1YN5A 2GBMA 2PEAA 5CHVC 2GBKA 4IWOA 3Q14C 1NI3A 3L10B 2QHOA 3ONSA 2KNBA 3A4RA 2V9HA 4KDLB 1OEYJ 3R2TA 3I57A 1B9RA 2K0PA 4II3B 1AN8A 4IWPA 3AE5B 1RLFA 2N1WA 5L83A 1YNTE 4PYUA 1TZ1A 4PS7A 4AOFA 2Y3AA 4CYEA 3PGEA 4HJKA 1SSNA 4ASWC 1CJEA 1E6EB 4OZAA 2JT4B 5IN7A 2N1VA 1NYRA 1I4GA 5G55A 1H8CA 2IGGA 1WE7A 1WJ4A 1T0SC 2ZVNA 3TIXA 4DXAB 4K7SA 4YSXB 1WM3A 3V6EB 3RN9C 5IP4D 4W9EA 2FUHB 2W55A 1XCTL 3EUB2 4M01A 1DOXA 1NENB 1IGDA 3ABVB 1L2NA 3C19A 2I1KA 2GI9A 4N9F4 2JYTA 3B9JA 4WAAA 2O2VB 3JSVA 2PVGC 3SU8X 3B0AA 2KWDA 2VRRB 1XO3A 3U30A 2I2YA 3IT4B 2PVOD 4K3CA 3W1SC 3V60A 4TUUA 4TKNA 4DBGA 1QOGA 4G11A 2CJOA 5C3JB 3U8ZA 4A55A 2AX5A 4RNAA 1WGYA 3AU5A 3ZRFA 1KTKA 4WQOB 4IM3A 3BVGA 2N7EA 4ZRKA 2K8CA 3K9OB 3ZNID 1SB3C 4H2AA 1MG4A 2BYVE 1SBBB 3BYYB 2GBRA 3VAWA 2NBUA 4WAFA 4IC7B 4RMAA 3M3JA 3AEBB 4ZDVA 3LYYA 3L08A 3SHQA 1WZ0A 2OOBB 1P7EA 4A3PA 2FBWB 2KC1A 4W9IA 4AUQC 5EE9A 3AB5A 4IWQA 1UWXA 2IY1B 1WFYA 2NBWB 1TGZB 4W9LA 2LGXA 4LTUA 2INDC 2JXTA 2DX5B 3TUOA 1YD8U 2KFKB 3EFUA 2QIEB 3L17A 4WWNA 4RFBA 1T0RC 1UGMA 4BKTA 3GE3C 4HVBA 3IAS1 3Q2AC 3CWIA 2K6DB 1T6BX 4A90A 2KKCA 3GZNB 3RZFA 3ZNHB 1T0YA 2H89B 5HHDG 3HVZA 3IT6B 4HKZE 2WS3B 1Q10A 1M4VA 5FR3A 5C1ZA 3N1XC 4GSWA 3SEBA 5TSSA 2XEWA 1R4MB 4NY0A 4M8MA 3APCA 3R2IA 3UIOB 2WNMA 3ZTDA 5H92C 1V6EA 3PRZA 4LK0M 1ZGUB 2MBEA 2ZVOA 4EUTA 2BYEA 1GC6A 4MDKE 4RM8A 4S17A 3VR8B 5BYQA 4L23A 5HFYA 3PLVA 2W3SA 2AQ3B 2LI5A 3RNAC 1J7CA 4LCDE 1HTQA 3X23A 5J17A 2L7RA 1HZ5A 4FLHA 2OEDA 2PE6B 2VZKB 3AMZA 4K7UA 3RT3B 2PJHA 5DPWA 2GBJA 2E3TA 3Q8BA 4TV3A 1I4PA 1F0ZA 3GOEA 1N5XA 2INPE 4YT0B 2L52A 3KUZA 4C00A 1AYFA 1YQ3B 3A1QB 4ZRJA 5GMVA 4URKA 1QF6A 2IGDA 2Q5WD 3QJZA 1T0QC 1TS3A 3IXSA 2EELA 1MPEA 1LFDA 4ARIA 2MWSB 2JZPA 3CF6E 4EZLA 1P1AA 3DBLB 4TQ0A 1M94A 4DXGA 1V1PB 2BWES 4B0MA 3VFKA 3VH3B 3VHTC 4HXDA 1WX9A 1LQBA 2HTHA 3C0RB 3AE2B 4AJYB 3B08A 3WIMA 1YOVB 2KFKA 1WGDA 1NEKB 2PE9A 4NJ6A 1KM7A 2KXJA 1J19A 1JWMD 1EU3A 1ET6A 1D4BA 2NTSA 4HJGE 5KHQA 2ZPYA 4W9KA 2KQ7A 4OZBA 3L4PA 3FKYA 3HK0A 1K51A 5HKHA 2WX0A 3AE9B 1GNUA 1HXYD 2MHJA 2RMMA 5BYSA 2MP2B 3DVGY 2MBQA 4G3XB 4US9A 1WSPA 3T3OA 1TKEA 3K9PB 2RDBC 1JRPA 3DHIC 3T3NA 3QARA 3NVWA 3PZDA 5G5HA 1ET9A 2AL3A 1GC7A 2JX5A 1Q0WB 2R61A 2J7QB 2FCNA 3DBHI 1SXTA 1SIJA 1CK1A 1UBIA 4P1CC 2M19A 4MJSB 2J42A 4WH4A 2BWFA 1EF5A
chains in the Genus database with same CATH topology
2LVOA 2DZJA 2LGDA 1I35A 4HPLB 1WF9A 3VTUA 2DYBA 1R4MI 4II2B 5AZFA 5J2RA 1WGGA 2DAJA 2IO0B 3QK0A 3O65B 5CHFA 4DK5A 2KTRB 4OVUA 1L7YA 1YX5B 2BKFA 2NCNA 1JRUA 4ZRIA 3M95A 1E7VA 3HM3A 2ZPNA 4BOZB 2UYZB 5AZGA 2BPSA 4M8NA 2MRPA 3KW5B 3QIJA 2KMAA 1P9DU 2M8SA 2FIFA 4HCNB 2L0FA 3VQIA 3VXWA 2KLCA 3L16A 3N3KB 2ZZPB 1NI2A 2G4SA 3NZSA 3QCAA 4BBNC 4GDKA 4GN1A 3H1UA 4TQ1A 3ZNGC 4KZ0A 4IM0A 2KDIA 1AARA 3MJWA 4F8CB 1X1MA 2DYOA 2N9PC 2AEHA 2BKRB 2WYQA 1S1QB 4WJPA 2MBHA 4ICVA 4W9JA 3RCZA 1E90A 3PHXB 1PQSA 2PPHA 2G3QB 1IYFA 2L3ZA 2MSED 2EMSA 3Q3JA 4MM3A 5AZHA 5JHAA 2KMCA 2LWPA 3PV1A 3A4SC 1GJZA 1NDDA 2JWZA 1WGRA 3ZDTA 2IZVB 2J0KA 2REXA 2ZNVC 1SIFA 1RFAA 1QZEA 3BY4B 1EO6A 1RAXA 4IG7B 4P7IA 3IBEA 3KYDD 4ICUA 1ZW7A 4JLCA 5E6PA 2MCNB 4BKGA 4I6LB 3ZTCA 2GBMA 2PEAA 5CHVC 1E8WA 2GBKA 1WMHB 1WXSA 2KDBA 4IWOA 2DENB 2CR5A 3L10B 3QC8B 3UGBB 3OJ3A 2GOWA 2MX2A 2QHOA 3ONSA 3DOWA 4GXBA 5LXHA 2KNBA 3A4RA 2ZCBA 2LVPA 4KDLB 1OEYJ 3TMPB 4FJZA 4PS8A 1E5WA 2JRIB 3ECIA 4A20A 1LXDA 2FAZA 3B1LX 3UF8A 2N4FA 4II3B 4IWPA 1RLFA 4FJVB 3W1SA 2JZ3B 3ZDMC 1XQQA 2KX3A 2N1WA 3AXCA 2XK5A 4GU2A 3JYUA 5L83A 4PYUA 5JZEB 1TZ1A 4PS7A 3KH0A 2D2QA 3ML9A 4AOFA 4PYZA 3DBLI 4CYEA 2D11A 4HK2A 3ENEA 2ZCCA 3PGEA 2LRWA 4HJKA 2C60A 3WAMA 3T8MA 4ASWC 3RD2A 4MGKE 2JT4B 3TBLD 1OEYA 2JUOA 2L05A 2N1VA 3H6NA 4MGZE 5G55A 3V6CB 1H8CA 4MH0E 4E3CA 1WE7A 4GDLB 1WJ4A 5LXIB 2BYFA 1WX7A 2ZVNA 3KYCD 4IUMB 3TIXA 1WXMA 2EKEC 4DXAB 4K7SA 3LJ3A 1Q1OA 3AI5A 4J6IA 2MP2A 1WM3A 3V6EB 4W9EA 2FUHB 2JRHA 5JHBA 1UBQA 1R4NI 2JF5A 2IO1B 1HE8A 2M0XA 3RZWC 3A9KA 4MGYE 5C23A 2KJRA 5D2MB 3VH4B 1L2NA 4WJNA 2KX0A 3D32A 2I1KA 3I3TB 2DAFA 1WJNA 4KZCA 4N9F4 5DPTA 4PS3A 2K8BA 5CX3A 2AYOB 4WAAA 3L0WB 4GOCA 2O2VB 3JSVA 2NBVB 3W1YA 3SU8X 3IFWB 3B0AA 3NZUA 2VRRB 2JXXA 4F7ZA 3R3MA 3U30A 4EOYA 3APDA 4FN2A 4B9KA 4DDID 3W1SC 3V60A 4TUUA 4EFOA 2IO3B 1KJTA 2WX1A 2O2VA 4TKNA 4DHZE 1YJ1A 2O6VD 3DCGA 4MEMA 3VUXA 2IY0B 1NBFC 4MJSA 3DVNV 2R2OA 3PT2B 4NNJB 2Z59B 2RPQA 2YLMA 5DPSA 3WA0A 4DBGA 1OQYA 5CHWA 4LDTD 4I6PA 1OGWA 2DHZA 4G11A 1H4RA 3U7DA 1G6JA 2NPTA 3U8ZA 1FXTB 2A4ZA 2FIDA 3DQVA 2KZRA 2LGYA 1WGYA 3VUYA 3AU5A 3ZRFA 4WQOB 3X0WA 2C7HA 1P0RA 4IM3A 4W9GA 1Z2MA 2N7EA 4EZKA 3SDLC 2CHWA 4ZRKA 2K8CA 2KTRA 4JL9A 2K25A 2K8HA 4HWIB 4XZ4A 2N9XA 3K9OB 1V86A 4MELA 3ZNID 2HE7A 2NR2A 4KDIC 2K39A 2MW5A 2BYVE 4NQKE 5IAAC 4LJOB 2GBRA 5LLIA 4JGHB 4NAWB 3VAWA 3AULA 3MTNB 2NBUA 2DZMA 4IC7B 1V80A 4MGIE 4WJQA 3EC8A 2G45B 3M3JA 4RMAA 4E74A 1XT9B 1ZKHA 3QA8A 1V81A 1Q5WB 4ZDVA 3WAPA 2KN5A 4W9DA 3L08A 3H7PB 4DHZB 1E8XA 3SHQA 1WZ0A 3H7SA 2OOBB 4GB9A 2L00B 2L8JA 1SGHA 3CSTA 4AP4C 2MBOA 4A3PA 2KC1A 4W9IA 1V5OA 4AUQC 2RGFA 4ANVA 2ZJDA 4IWQA 2DYMA 1WI0A 2IY1B 2M1MA 1WFYA 2NBWB 3VDZA 1TGZB 3QWZB 4W9LA 2LGXA 1P98A 2KQSA 3UIPB 2DX5B 3AU4A 2J0JA 3NY5A 1CMXB 1YD8U 2KFKB 4DWFA 3PSEB 3EFUA 3PVLA 3DBRI 3H9DA 2JVCA 3M63B 2LXCA 4K1RB 2K1FA 2XBBC 1WMHA 3V61A 3HIZA 3IG3A 3L17A 4KSKC 4HPMB 4WWNA 1UGMA 4BKTA 1TBEA 2BGFA 2LRUA 1WGHA 5D6JB 3ZLZA 3PLUA 1V9JA 5TR5A 4HVBA 2ASQA 2LVQA 2V3SA 2V4LA 3QQ8B 2O6VB 4EEWA 2K6DB 1RRBA 5J18A 4XX5A 1YIWA 3QAQA 3NOBA 2RD0A 1A5RA 4WWOA 1WJUA 3OAWA 2KKCA 3APFA 2KOXA 1U4AA 3RZFA 3ZNHB 1T0YA 4LDTB 4FJYA 4EKUA 5CTRC 4X57B 3IVFA 4A3OA 2IBIB 1V49A 5JH5C 3PREA 5E6OA 3KUCB 1YQBA 3ALBA 1S3SG 3ML8A 5C1ZA 4BKSA 1Y8RC 2LASA 4GSWA 3TCAA 3A9JB 4BFRA 2KDEB 4CHKA 4GDLA 1VD2A 1IPGA 2XEWA 4W9CA 4ANWA 4NY0A 1UELA 1VCBA 2FCMA 4M8MA 3APCA 3QHTA 3ZO5B 3UIOB 2KWUB 3PRMB 3HHMA 4EZJA 2KJHB 1V5TA 3N32A 2KDFB 3ZTDA 2MQJA 3T9LA 1YX6B 1V6EA 2LZ6A 3JVZX 3KUDB 3PRZA 4FULA 3VTVA 2FCSA 4FHKA 1ZGUB 2MBEA 5DCNA 3ZW3A 2ZVOA 2MLBA 1WJ6A 4EUTA 4AJWA 2BYEA 4DHJD 1GC6A 2I1JA 2GMIC 3M62B 4MDKE 3L54A 4RM8A 2IO2B 4KIKB 2KC2A 2Z0EB 1I42A 2ZNVB 3DBSA 2CS4A 3JW0X 1V2YA 1BT0A 2LD9A 3PLVA 2RR9A 4IW0A 3VVWB 2M4NA 4B95A 2LI5A 1WE6A 1WYWB 4K81A 2KWVB 1P3QU 1WXAA 2G4DB 4I6NB 2UWQA 4LCDE 3X23A 5J17A 1J8CA 2L7RA 3VTWA 4FLHA 2PE6B 4BBNF 2D3GA 1SE9A 1MG8A 4FADA 4K7UA 4LJPB 3RT3B 2YVCA 3V62A 4FA6A 2KD0A 2PJHA 4W9HA 4ANXA 5DPWA 2JZZA 2B3AA 4ANUA 4BKSD 3RUIB 2C9WB 3UQBA 2GBJA 2CU1A 4W9FA 4TV3A 2MA9B 4NQLB 2AL6A 4GDKB 1UZXB 3GOEA 3S2AA 4KSLC 2M17A 4GGQA 3ZUNA 5D94A 3KUZA 3PS6A 4E71A 1F9JA 2HJ8A 2FCQA 3A1QB 4ZRJA 5GMVA 2KANA 4G0NB 2IYDB 2A5UA 2HD5B 4XC2A 4OVVA 4URKA 4BOSC 4GMVA 3Q3FA 1XD3B 2D07B 1E8YA 2KHWB 2LUEA 3CMMB 3QJZA 3EECA 2MBBB 4NAWA 1LFDA 2KK8A 3PTFC 2MWSB 3CF6E 4ZYNA 1D3ZA 1WM2A 3A1QA 4EZLA 2KJ6A 1P1AA 1E7UA 1E8ZA 4TQ0A 1M94A 2NS5A 2C7NB 4M0WB 3HM6X 2BWES 4K7WA 1WXVA 3R7QA 3H7PA 2CHXA 5DPRA 3VFKA 2V1YA 3VUWA 2CKHB 2JPHA 3OLMD 3R7RA 3R66C 3UINB 4G50A 3VH3B 2ZEQA 3VHTC 4WWPA 2AWTA 2C7MB 3L13A 4HXDA 1WX9A 2DZKA 3A33B 5IA7A 3UQAA 1LQBA 5FR6A 2HTHA 3LDZE 1KOTA 4IM2A 4FBJB 4KVGB 3C0RB 3TJPA 1IP9A 2Z0DB 5EDSA 3OJ4B 4HDOA 3B08A 4AJYB 4MSMB 4HCPB 4DHJB 3WIMA 3DVGX 3NS8A 2XK5B 2KFKA 1WGDA 4HDQA 4NJ7A 2L76A 3ZVVA 1J0GA 2KLGA 3DPDA 2DZIA 2PE9A 4NJ6A 1KM7A 2KXJA 1J19A 1KLVA 5E6NA 5KHQA 2LXAA 2ZPYA 3RYTA 4W9KA 2KQ7A 3ZIMA 3PPAA 3BINA 1EUVB 2D10A 2O6VA 1Z5SB 3HK0A 2WX0A 3WANA 2GBNA 3ZKJC 5HKHA 4GIVA 3DVNU 3RULA 3WALA 1GNUA 5AEKB 3MHSD 4JQWC 1UD7A 1LM8B 3NHEB 4NPNA 1UH6A 2LJ5A 2MP2B 3DVGY 2MBQA 4G3XB 5D7GA 2KO3A 1OTRB 5G2NA 4DDGD 3K9PB 1WY8A 2W9NA 2WDTB 3A9KB 3QARA 4BVUC 3DDCB 2N9EB 1ISNA 1WR1A 1TTNA 2J0MA 3N30A 2N7DA 2NVUI 3QX1A 1WR6E 3A9JA 3PZDA 2BF8B 2RSUA 1EF1A 2K6QA 3IHPC 3JSVB 1WX8A 1WZ3A 2AL3A 4RM9A 1C1YB 2KFJA 2R2QA 1GUAB 4CO7A 4WJOA 1GC7A 1WIAA 4KV2A 2OJRA 3EHVA 1Q0WB 3TL5A 4B6WA 2J7QB 2C5LC 2FCNA 3DBHI 4YL8A 2EMTA 4F1SA 4HLEA 3ZNZB 3PHWB 5KHOA 2JY6A 2KWCA 3GZNI 1UBIA 2KTFA 3PRPB 3SD5A 2Y5BB 4MJSB 3P2BA 1WRDB 3WAOA 2WWZA 1GG3A 5BO4B 1WH3A 4FHJA 3ZRCA 2FNJB 5L95C 2CHZA 2BWFA 2KVRA 1K8RB 2L0TA 3CSFA 4JIOU 4MSQB 3KVFB 4KIKA 1EF5A 4AWJA 1C3TA 2NPTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVO A;  2DZJ A;  2LGD A;  1I35 A;  4HPL B;  1WF9 A;  3VTU A;  2DYB A;  1R4M I;  4II2 B;  5AZF A;  5J2R A;  1WGG A;  2DAJ A;  2IO0 B;  3QK0 A;  3O65 B;  5CHF A;  4DK5 A;  2KTR B;  4OVU A;  1L7Y A;  1YX5 B;  2BKF A;  2NCN A;  1JRU A;  4ZRI A;  3M95 A;  1E7V A;  3HM3 A;  2ZPN A;  4BOZ B;  2UYZ B;  5AZG A;  2BPS A;  4M8N A;  2MRP A;  3KW5 B;  3QIJ A;  2KMA A;  1P9D U;  2M8S A;  2FIF A;  4HCN B;  2L0F A;  3VQI A;  3VXW A;  2KLC A;  3L16 A;  3N3K B;  2ZZP B;  1NI2 A;  2G4S A;  3NZS A;  3QCA A;  4BBN C;  4GDK A;  4GN1 A;  3H1U A;  4TQ1 A;  3ZNG C;  4KZ0 A;  4IM0 A;  2KDI A;  1AAR A;  3MJW A;  4F8C B;  1X1M A;  2DYO A;  2N9P C;  2AEH A;  2BKR B;  2WYQ A;  1S1Q B;  4WJP A;  2MBH A;  4ICV A;  4W9J A;  3RCZ A;  1E90 A;  3PHX B;  1PQS A;  2PPH A;  2G3Q B;  1IYF A;  2L3Z A;  2MSE D;  2EMS A;  3Q3J A;  4MM3 A;  5AZH A;  5JHA A;  2KMC A;  2LWP A;  3PV1 A;  3A4S C;  1GJZ A;  1NDD A;  2JWZ A;  1WGR A;  3ZDT A;  2IZV B;  2J0K A;  2REX A;  2ZNV C;  1SIF A;  1RFA A;  1QZE A;  3BY4 B;  1EO6 A;  1RAX A;  4IG7 B;  4P7I A;  3IBE A;  3KYD D;  4ICU A;  1ZW7 A;  4JLC A;  5E6P A;  2MCN B;  4BKG A;  4I6L B;  3ZTC A;  2GBM A;  2PEA A;  5CHV C;  1E8W A;  2GBK A;  1WMH B;  1WXS A;  2KDB A;  4IWO A;  2DEN B;  2CR5 A;  3L10 B;  3QC8 B;  3UGB B;  3OJ3 A;  2GOW A;  2MX2 A;  2QHO A;  3ONS A;  3DOW A;  4GXB A;  5LXH A;  2KNB A;  3A4R A;  2ZCB A;  2LVP A;  4KDL B;  1OEY J;  3TMP B;  4FJZ A;  4PS8 A;  1E5W A;  2JRI B;  3ECI A;  4A20 A;  1LXD A;  2FAZ A;  3B1L X;  3UF8 A;  2N4F A;  4II3 B;  4IWP A;  1RLF A;  4FJV B;  3W1S A;  2JZ3 B;  3ZDM C;  1XQQ A;  2KX3 A;  2N1W A;  3AXC A;  2XK5 A;  4GU2 A;  3JYU A;  5L83 A;  4PYU A;  5JZE B;  1TZ1 A;  4PS7 A;  3KH0 A;  2D2Q A;  3ML9 A;  4AOF A;  4PYZ A;  3DBL I;  4CYE A;  2D11 A;  4HK2 A;  3ENE A;  2ZCC A;  3PGE A;  2LRW A;  4HJK A;  2C60 A;  3WAM A;  3T8M A;  4ASW C;  3RD2 A;  4MGK E;  2JT4 B;  3TBL D;  1OEY A;  2JUO A;  2L05 A;  2N1V A;  3H6N A;  4MGZ E;  5G55 A;  3V6C B;  1H8C A;  4MH0 E;  4E3C A;  1WE7 A;  4GDL B;  1WJ4 A;  5LXI B;  2BYF A;  1WX7 A;  2ZVN A;  3KYC D;  4IUM B;  3TIX A;  1WXM A;  2EKE C;  4DXA B;  4K7S A;  3LJ3 A;  1Q1O A;  3AI5 A;  4J6I A;  2MP2 A;  1WM3 A;  3V6E B;  4W9E A;  2FUH B;  2JRH A;  5JHB A;  1UBQ A;  1R4N I;  2JF5 A;  2IO1 B;  1HE8 A;  2M0X A;  3RZW C;  3A9K A;  4MGY E;  5C23 A;  2KJR A;  5D2M B;  3VH4 B;  1L2N A;  4WJN A;  2KX0 A;  3D32 A;  2I1K A;  3I3T B;  2DAF A;  1WJN A;  4KZC A;  4N9F 4;  5DPT A;  4PS3 A;  2K8B A;  5CX3 A;  2AYO B;  4WAA A;  3L0W B;  4GOC A;  2O2V B;  3JSV A;  2NBV B;  3W1Y A;  3SU8 X;  3IFW B;  3B0A A;  3NZU A;  2VRR B;  2JXX A;  4F7Z A;  3R3M A;  3U30 A;  4EOY A;  3APD A;  4FN2 A;  4B9K A;  4DDI D;  3W1S C;  3V60 A;  4TUU A;  4EFO A;  2IO3 B;  1KJT A;  2WX1 A;  2O2V A;  4TKN A;  4DHZ E;  1YJ1 A;  2O6V D;  3DCG A;  4MEM A;  3VUX A;  2IY0 B;  1NBF C;  4MJS A;  3DVN V;  2R2O A;  3PT2 B;  4NNJ B;  2Z59 B;  2RPQ A;  2YLM A;  5DPS A;  3WA0 A;  4DBG A;  1OQY A;  5CHW A;  4LDT D;  4I6P A;  1OGW A;  2DHZ A;  4G11 A;  1H4R A;  3U7D A;  1G6J A;  2NPT A;  3U8Z A;  1FXT B;  2A4Z A;  2FID A;  3DQV A;  2KZR A;  2LGY A;  1WGY A;  3VUY A;  3AU5 A;  3ZRF A;  4WQO B;  3X0W A;  2C7H A;  1P0R A;  4IM3 A;  4W9G A;  1Z2M A;  2N7E A;  4EZK A;  3SDL C;  2CHW A;  4ZRK A;  2K8C A;  2KTR A;  4JL9 A;  2K25 A;  2K8H A;  4HWI B;  4XZ4 A;  2N9X A;  3K9O B;  1V86 A;  4MEL A;  3ZNI D;  2HE7 A;  2NR2 A;  4KDI C;  2K39 A;  2MW5 A;  2BYV E;  4NQK E;  5IAA C;  4LJO B;  2GBR A;  5LLI A;  4JGH B;  4NAW B;  3VAW A;  3AUL A;  3MTN B;  2NBU A;  2DZM A;  4IC7 B;  1V80 A;  4MGI E;  4WJQ A;  3EC8 A;  2G45 B;  3M3J A;  4RMA A;  4E74 A;  1XT9 B;  1ZKH A;  3QA8 A;  1V81 A;  1Q5W B;  4ZDV A;  3WAP A;  2KN5 A;  4W9D A;  3L08 A;  3H7P B;  4DHZ B;  1E8X A;  3SHQ A;  1WZ0 A;  3H7S A;  2OOB B;  4GB9 A;  2L00 B;  2L8J A;  1SGH A;  3CST A;  4AP4 C;  2MBO A;  4A3P A;  2KC1 A;  4W9I A;  1V5O A;  4AUQ C;  2RGF A;  4ANV A;  2ZJD A;  4IWQ A;  2DYM A;  1WI0 A;  2IY1 B;  2M1M A;  1WFY A;  2NBW B;  3VDZ A;  1TGZ B;  3QWZ B;  4W9L A;  2LGX A;  1P98 A;  2KQS A;  3UIP B;  2DX5 B;  3AU4 A;  2J0J A;  3NY5 A;  1CMX B;  1YD8 U;  2KFK B;  4DWF A;  3PSE B;  3EFU A;  3PVL A;  3DBR I;  3H9D A;  2JVC A;  3M63 B;  2LXC A;  4K1R B;  2K1F A;  2XBB C;  1WMH A;  3V61 A;  3HIZ A;  3IG3 A;  3L17 A;  4KSK C;  4HPM B;  4WWN A;  1UGM A;  4BKT A;  1TBE A;  2BGF A;  2LRU A;  1WGH A;  5D6J B;  3ZLZ A;  3PLU A;  1V9J A;  5TR5 A;  4HVB A;  2ASQ A;  2LVQ A;  2V3S A;  2V4L A;  3QQ8 B;  2O6V B;  4EEW A;  2K6D B;  1RRB A;  5J18 A;  4XX5 A;  1YIW A;  3QAQ A;  3NOB A;  2RD0 A;  1A5R A;  4WWO A;  1WJU A;  3OAW A;  2KKC A;  3APF A;  2KOX A;  1U4A A;  3RZF A;  3ZNH B;  1T0Y A;  4LDT B;  4FJY A;  4EKU A;  5CTR C;  4X57 B;  3IVF A;  4A3O A;  2IBI B;  1V49 A;  5JH5 C;  3PRE A;  5E6O A;  3KUC B;  1YQB A;  3ALB A;  1S3S G;  3ML8 A;  5C1Z A;  4BKS A;  1Y8R C;  2LAS A;  4GSW A;  3TCA A;  3A9J B;  4BFR A;  2KDE B;  4CHK A;  4GDL A;  1VD2 A;  1IPG A;  2XEW A;  4W9C A;  4ANW A;  4NY0 A;  1UEL A;  1VCB A;  2FCM A;  4M8M A;  3APC A;  3QHT A;  3ZO5 B;  3UIO B;  2KWU B;  3PRM B;  3HHM A;  4EZJ A;  2KJH B;  1V5T A;  3N32 A;  2KDF B;  3ZTD A;  2MQJ A;  3T9L A;  1YX6 B;  1V6E A;  2LZ6 A;  3JVZ X;  3KUD B;  3PRZ A;  4FUL A;  3VTV A;  2FCS A;  4FHK A;  1ZGU B;  2MBE A;  5DCN A;  3ZW3 A;  2ZVO A;  2MLB A;  1WJ6 A;  4EUT A;  4AJW A;  2BYE A;  4DHJ D;  1GC6 A;  2I1J A;  2GMI C;  3M62 B;  4MDK E;  3L54 A;  4RM8 A;  2IO2 B;  4KIK B;  2KC2 A;  2Z0E B;  1I42 A;  2ZNV B;  3DBS A;  2CS4 A;  3JW0 X;  1V2Y A;  1BT0 A;  2LD9 A;  3PLV A;  2RR9 A;  4IW0 A;  3VVW B;  2M4N A;  4B95 A;  2LI5 A;  1WE6 A;  1WYW B;  4K81 A;  2KWV B;  1P3Q U;  1WXA A;  2G4D B;  4I6N B;  2UWQ A;  4LCD E;  3X23 A;  5J17 A;  1J8C A;  2L7R A;  3VTW A;  4FLH A;  2PE6 B;  4BBN F;  2D3G A;  1SE9 A;  1MG8 A;  4FAD A;  4K7U A;  4LJP B;  3RT3 B;  2YVC A;  3V62 A;  4FA6 A;  2KD0 A;  2PJH A;  4W9H A;  4ANX A;  5DPW A;  2JZZ A;  2B3A A;  4ANU A;  4BKS D;  3RUI B;  2C9W B;  3UQB A;  2GBJ A;  2CU1 A;  4W9F A;  4TV3 A;  2MA9 B;  4NQL B;  2AL6 A;  4GDK B;  1UZX B;  3GOE A;  3S2A A;  4KSL C;  2M17 A;  4GGQ A;  3ZUN A;  5D94 A;  3KUZ A;  3PS6 A;  4E71 A;  1F9J A;  2HJ8 A;  2FCQ A;  3A1Q B;  4ZRJ A;  5GMV A;  2KAN A;  4G0N B;  2IYD B;  2A5U A;  2HD5 B;  4XC2 A;  4OVV A;  4URK A;  4BOS C;  4GMV A;  3Q3F A;  1XD3 B;  2D07 B;  1E8Y A;  2KHW B;  2LUE A;  3CMM B;  3QJZ A;  3EEC A;  2MBB B;  4NAW A;  1LFD A;  2KK8 A;  3PTF C;  2MWS B;  3CF6 E;  4ZYN A;  1D3Z A;  1WM2 A;  3A1Q A;  4EZL A;  2KJ6 A;  1P1A A;  1E7U A;  1E8Z A;  4TQ0 A;  1M94 A;  2NS5 A;  2C7N B;  4M0W B;  3HM6 X;  2BWE S;  4K7W A;  1WXV A;  3R7Q A;  3H7P A;  2CHX A;  5DPR A;  3VFK A;  2V1Y A;  3VUW A;  2CKH B;  2JPH A;  3OLM D;  3R7R A;  3R66 C;  3UIN B;  4G50 A;  3VH3 B;  2ZEQ A;  3VHT C;  4WWP A;  2AWT A;  2C7M B;  3L13 A;  4HXD A;  1WX9 A;  2DZK A;  3A33 B;  5IA7 A;  3UQA A;  1LQB A;  5FR6 A;  2HTH A;  3LDZ E;  1KOT A;  4IM2 A;  4FBJ B;  4KVG B;  3C0R B;  3TJP A;  1IP9 A;  2Z0D B;  5EDS A;  3OJ4 B;  4HDO A;  3B08 A;  4AJY B;  4MSM B;  4HCP B;  4DHJ B;  3WIM A;  3DVG X;  3NS8 A;  2XK5 B;  2KFK A;  1WGD A;  4HDQ A;  4NJ7 A;  2L76 A;  3ZVV A;  1J0G A;  2KLG A;  3DPD A;  2DZI A;  2PE9 A;  4NJ6 A;  1KM7 A;  2KXJ A;  1J19 A;  1KLV A;  5E6N A;  5KHQ A;  2LXA A;  2ZPY A;  3RYT A;  4W9K A;  2KQ7 A;  3ZIM A;  3PPA A;  3BIN A;  1EUV B;  2D10 A;  2O6V A;  1Z5S B;  3HK0 A;  2WX0 A;  3WAN A;  2GBN A;  3ZKJ C;  5HKH A;  4GIV A;  3DVN U;  3RUL A;  3WAL A;  1GNU A;  5AEK B;  3MHS D;  4JQW C;  1UD7 A;  1LM8 B;  3NHE B;  4NPN A;  1UH6 A;  2LJ5 A;  2MP2 B;  3DVG Y;  2MBQ A;  4G3X B;  5D7G A;  2KO3 A;  1OTR B;  5G2N A;  4DDG D;  3K9P B;  1WY8 A;  2W9N A;  2WDT B;  3A9K B;  3QAR A;  4BVU C;  3DDC B;  2N9E B;  1ISN A;  1WR1 A;  1TTN A;  2J0M A;  3N30 A;  2N7D A;  2NVU I;  3QX1 A;  1WR6 E;  3A9J A;  3PZD A;  2BF8 B;  2RSU A;  1EF1 A;  2K6Q A;  3IHP C;  3JSV B;  1WX8 A;  1WZ3 A;  2AL3 A;  4RM9 A;  1C1Y B;  2KFJ A;  2R2Q A;  1GUA B;  4CO7 A;  4WJO A;  1GC7 A;  1WIA A;  4KV2 A;  2OJR A;  3EHV A;  1Q0W B;  3TL5 A;  4B6W A;  2J7Q B;  2C5L C;  2FCN A;  3DBH I;  4YL8 A;  2EMT A;  4F1S A;  4HLE A;  3ZNZ B;  3PHW B;  5KHO A;  2JY6 A;  2KWC A;  3GZN I;  1UBI A;  2KTF A;  3PRP B;  3SD5 A;  2Y5B B;  4MJS B;  3P2B A;  1WRD B;  3WAO A;  2WWZ A;  1GG3 A;  5BO4 B;  1WH3 A;  4FHJ A;  3ZRC A;  2FNJ B;  5L95 C;  2CHZ A;  2BWF A;  2KVR A;  1K8R B;  2L0T A;  3CSF A;  4JIO U;  4MSQ B;  3KVF B;  4KIK A;  1EF5 A;  4AWJ A;  1C3T A;  2NPT B; 
#chains in the Genus database with same CATH topology
 1WF9 A;  3VTU A;  2DYB A;  5J2R A;  2XN9 C;  1L7Y A;  4RGT A;  4B0E A;  2BKF A;  4M8N A;  2JSV X;  1TJE A;  2QEJ C;  3KW5 B;  3QIJ A;  4HCN B;  3L16 A;  2ZZP B;  3DBR B;  3QCA A;  4BBN C;  1SE2 A;  2KDI A;  1UUP A;  4MT5 A;  2ACZ B;  2L83 A;  1ENF A;  1X1M A;  4YWG G;  2AEH A;  3AEC B;  4WJP A;  1ZUD 2;  5EE3 A;  2QJL A;  2G3Q B;  2MSE D;  1WYG A;  2KMC A;  3A4S C;  3ZGZ A;  3AEA B;  2QDF A;  3FC4 A;  2IZV B;  2SEB D;  2REX A;  3IBE A;  3KYD D;  1V1P A;  1ZW7 A;  4ICU A;  2HJ1 A;  4KKJ A;  3NZ3 A;  1WXS A;  2DEN B;  4HKQ A;  2MX2 A;  3DOW A;  4GXB A;  5LXH A;  2VH1 A;  4OHJ A;  2ZCB A;  2VZK D;  1E5W A;  2JRI B;  3TSS A;  3B1L X;  2FAZ A;  3AE4 B;  2V3P A;  4RH6 A;  3W5U B;  2H88 B;  1C77 A;  4OW0 A;  1SEB D;  2WQY B;  4C80 A;  5JZE B;  2J53 A;  4PYZ A;  5AUI A;  2BS3 B;  2SAK A;  2D11 A;  3ENE A;  2C60 A;  2LGI A;  3T8M A;  1PUT A;  3RD2 A;  1XF5 L;  2JUO A;  2L05 A;  3H6N A;  4E3C A;  4GDL B;  1E7P B;  5FK9 C;  2JYE A;  5LXI B;  1WX7 A;  1E9M A;  3AI5 A;  2MP2 A;  4DXF A;  5JHB A;  1UBQ A;  1R4N I;  3P4R B;  2IO1 B;  4C7Y A;  5C23 A;  3MC0 B;  3VH4 B;  4WJN A;  2KX0 A;  3D32 A;  3P42 A;  5DPT A;  1FFV A;  3I63 C;  1HTO A;  3L0W B;  3W1Y A;  3NZU A;  3N20 C;  1TS2 A;  2KAC A;  4US8 A;  2AQ2 B;  4FN2 A;  4DDI D;  4AQ7 A;  2W54 A;  1V1O A;  4N58 A;  4EFO A;  2IO3 B;  1ZDV A;  1B1Z A;  3NVZ A;  2O6V D;  3DCG A;  3AE8 B;  4MJS A;  4UDU C;  3DVN V;  2R2O A;  1FFU A;  2Z59 B;  1MHH E;  2YLM A;  1DYQ A;  3P4S B;  1I4X A;  5CHW A;  4ZHO A;  1G6J A;  1KRH A;  2A4Z A;  3RNF C;  2LHE A;  3DQV A;  1QOF A;  2KZR A;  2GRI A;  1WXQ A;  2C7H A;  1P0R A;  1Z2M A;  2NTT A;  1C76 A;  1KLG D;  3SDL C;  2K25 A;  4HWI B;  4XZ4 A;  2N9X A;  2NR2 A;  2K39 A;  3E9S A;  1VRA B;  4NQK E;  5IAA C;  1D6E C;  2DZM A;  1V80 A;  4E74 A;  3EC8 A;  3MJ5 A;  3QA8 A;  4Q2J A;  3TEX A;  4LNF A;  3H7P B;  3NJT A;  1FNV A;  4GB9 A;  2L00 B;  3Q3N C;  4AP4 C;  2MBO A;  3VDZ A;  1P98 A;  4DQO C;  2WU2 B;  1OQQ A;  3NY5 A;  2LHD A;  4DWF A;  4K3B A;  3C8Y A;  3H9D A;  3V61 A;  2BGF A;  1MVK A;  3ZLZ A;  2ASQ A;  2V3S A;  3QQ8 B;  5J18 A;  1OQR A;  3OAW A;  4LDT B;  1N6Z A;  4FJY A;  2MJD A;  3IVF A;  4LLG M;  5JH5 C;  1YQB A;  3ALB A;  1S3S G;  3ML8 A;  4BKS A;  4CHK A;  4BFR A;  2QCZ A;  4GDL A;  4W9C A;  2KDM A;  1UEL A;  1VCB A;  3ZO5 B;  1JML A;  2KWU B;  1QOA A;  2ZW0 A;  3N32 A;  4R3D A;  2J4X A;  3T9L A;  2LZ6 A;  3KUD B;  4HRO A;  4FHK A;  3ZW3 A;  1WJ6 A;  4EE2 A;  4DHJ D;  2I1J A;  3VRA B;  2TSS A;  4HPP A;  1D5X C;  2IO2 B;  3MP9 A;  1I42 A;  2ZNV B;  3DBS A;  1D5M C;  3NVV A;  3VVW B;  2M4N A;  4B95 A;  2IDY A;  1WYW B;  4TMA B;  2KWV B;  1WXA A;  1J8C A;  1TY0 A;  1GB4 A;  1SE9 A;  4YTN B;  2KVZ A;  1YN4 A;  3SFD B;  4ANX A;  2JZZ A;  2B3A A;  1FNU A;  4BKS D;  4KGR A;  2C9W B;  4NQL B;  2AL6 A;  1UZX B;  2BB5 A;  4KSL C;  4GGQ A;  3ZUN A;  4XWW A;  5EE0 A;  2FCQ A;  4XC2 A;  1E8Y A;  2LUE A;  3CMM B;  2LUM A;  3EEC A;  2KK8 A;  3PTF C;  4WQM A;  3HM6 X;  2WDV B;  3R7Q A;  3AE7 B;  3H7P A;  3O13 A;  5DPR A;  2DBY A;  2CKH B;  3OLM D;  1YJI A;  3UIN B;  3ZJT A;  2QIL A;  2C7M B;  3L13 A;  2DZK A;  3A33 B;  4CQN A;  5FR6 A;  3LDZ E;  3BK1 A;  4KVG B;  3BVZ A;  2HTM E;  4GLS C;  1TYG B;  4MSM B;  4HCP B;  3ZJU A;  3EGR A;  3DVG X;  2XK5 B;  4HDQ A;  1C4A A;  4WIP A;  2PKO A;  1J0G A;  1I4Q A;  3DPD A;  2NMQ A;  2LMC A;  1KLV A;  5IOI A;  5E6N A;  3ZIM A;  4OZC A;  1TKG A;  4D2K A;  2WXJ A;  3ZKJ C;  4TSS A;  3WAN A;  2GBN A;  4GIV A;  3RUL A;  5AEK B;  4JQW C;  1UD7 A;  3NHE B;  4NPN A;  1UH6 A;  2LJ5 A;  5D7G A;  1OTR B;  5FKA C;  2D3C A;  1JWA D;  3U2S C;  1WY8 A;  2QC8 A;  1HZ6 A;  2N9E B;  4JE3 B;  2J0M A;  2N7D A;  1WR6 E;  3DHH C;  1WX8 A;  4RM9 A;  2R2Q A;  1FNW A;  2G1E A;  2RDG A;  4CO7 A;  1WIA A;  2LFI A;  4KV2 A;  3ZJV A;  1IBX B;  3B2G A;  4YXD B;  4F1S A;  3ZNZ B;  3GS2 A;  2KTF A;  2WXP A;  3ZXR A;  3WAO A;  5BO4 B;  1WH3 A;  3IAM 1;  1FCL A;  2KAJ A;  4BOS C;  4AWJ A;  4JIO U;  3KVF B;  3ZTC A;  2NPT B;  2MH7 A;  1XLN A;  4II2 B;  2CU3 A;  2ONQ A;  1WGG A;  2IO0 B;  2WXF A;  1YX5 B;  1JRU A;  4ZRI A;  2ZPN A;  4BOZ B;  2UYZ B;  3HVD A;  1SJH D;  2KMA A;  2FIF A;  3VXW A;  3VQI A;  2KLC A;  1JCK B;  3N3K B;  3ZNG C;  4IM0 A;  3MJW A;  2DYO A;  2BKR B;  1R7S A;  1S1Q B;  3EA6 A;  2DWQ A;  2WDQ B;  1BML C;  3RCZ A;  2CJN A;  1E90 A;  3PHX B;  2ON8 A;  4MAC A;  2L3Z A;  2JWU A;  5AZH A;  3PV1 A;  3U52 E;  1YJJ A;  2JWZ A;  1WGR A;  2MEK A;  1C9F A;  1XXG A;  1SIF A;  5C2T B;  1QZE A;  1RAX A;  4P7I A;  2MCN B;  5E6P A;  3DWG C;  1E8W A;  1J7B A;  2CR5 A;  3QC8 B;  3UGB B;  2LEK A;  1C4P A;  3OJ3 A;  3TMP B;  3ECI A;  4A20 A;  1LXD A;  3UF8 A;  1JAL A;  4FJV B;  3W1S A;  2JZ3 B;  1XQQ A;  3AXC A;  2XK5 A;  4GU2 A;  1AW7 A;  2PLP A;  3JYU A;  3NVY A;  4IKG A;  3KH0 A;  4J3O D;  2ZCC A;  3Q3M C;  3WAM A;  2WXR A;  3AE1 B;  1WWT A;  3DWM A;  4MGK E;  1OEY A;  2WXH A;  3FIL B;  4MGZ E;  1STE A;  4ZYS A;  2I38 A;  3KYC D;  2JU6 X;  4NJC A;  1WXM A;  2EKE C;  3LJ3 A;  4L1B A;  2B76 B;  1MHX A;  4J6I A;  3KLS X;  2JF5 A;  2V0G A;  1ZDX A;  2QSD A;  3P4Q B;  2DAF A;  1D5Z C;  4KZC A;  4PS3 A;  2K8B A;  3E56 A;  4FXC A;  2AYO B;  5CX3 A;  1N5W A;  1IBX A;  4C7Z A;  2JXX A;  4F7Z A;  1KH0 A;  5HG2 A;  3APD A;  1YMH E;  4B9K A;  2N7J A;  2V4I B;  3BZD B;  1KJT A;  2WX1 A;  4DHZ E;  4MEM A;  5HI1 A;  1GB1 A;  3Q8F A;  2WXQ A;  4NNJ B;  3I5J C;  1OQY A;  4I6P A;  2DHZ A;  3Q6B A;  1H4R A;  3U7D A;  2NPT A;  3ZXV A;  4XDD A;  3AH7 A;  1FCC C;  2FID A;  1IUE A;  2LGY A;  4M02 A;  1JWS D;  4EZK A;  3RI7 C;  1ACC A;  4JL9 A;  1V86 A;  4MEL A;  2HE7 A;  1FXA A;  4KDI C;  2VH2 A;  1F2R C;  1XEE A;  1LGR A;  2YEP B;  3AE6 B;  1XLO A;  1L6V A;  4MGI E;  4WJQ A;  1CZP A;  3NG0 A;  3I9V 1;  1ZKH A;  1V81 A;  2KN5 A;  4W9D A;  5EE1 A;  4ITK A;  3CST A;  2INC C;  1TZO A;  1PDX A;  2RGF A;  2ZJD A;  3W9C B;  2KN4 A;  1WI0 A;  4XWT A;  4RCO A;  2BYT A;  4XGA B;  3DHG C;  1QIL A;  3J9C A;  1CMX B;  4QAY A;  2JVC A;  4IOI E;  1FM0 D;  2K1F A;  3HIZ A;  2W82 A;  4HPM B;  3P4P B;  5D6J B;  2LRU A;  1WGH A;  1V9J A;  5TR5 A;  1SE3 A;  2BS4 B;  1K50 A;  2LVQ A;  4ZRQ A;  2V4L A;  3DBH B;  1RRB A;  4KKI A;  1YIW A;  3QAQ A;  4LNI A;  4WWO A;  1WJU A;  1ZOY B;  1A70 A;  2WXG A;  2KOX A;  1HA5 A;  4X57 B;  5BMH A;  1E0Z A;  3PRE A;  5E6O A;  3KUC B;  4YTP B;  3BII D;  1Y56 A;  2LAS A;  3FIL A;  3N1Y C;  3TCA A;  2KDE B;  1IPG A;  4EZJ A;  3HHM A;  2KJH B;  1ZXH A;  4AS1 A;  1YX6 B;  1KF6 B;  3JVZ X;  1XLP A;  1JW9 D;  2RPV A;  1EU4 A;  2MLB A;  4AJW A;  3M62 B;  3L54 A;  1KFY B;  2KYW A;  3URY A;  1RFK A;  2KC2 A;  2GB1 A;  3BK2 A;  3JW0 X;  1V2Y A;  1BT0 A;  1FD6 A;  5MPO A;  3W2D A;  4RGM A;  5H8Y E;  4K81 A;  1P3Q U;  2G4D B;  3PZ8 A;  2UWQ A;  3VTW A;  2KMM A;  1C78 A;  3MHZ A;  4LJP B;  3V62 A;  2YVC A;  2WXO A;  4FA6 A;  1L0V B;  3N9Y C;  1ZXI A;  3RUI B;  2G9H D;  2CU1 A;  4REZ A;  2MA9 B;  2WHI A;  3S2A A;  2M17 A;  5D94 A;  3PS6 A;  3B2F A;  3OG5 A;  4E71 A;  2HJ8 A;  2OJW A;  2KAN A;  2IPK D;  3Q3F A;  2MBB B;  4MM3 B;  1FRD A;  4LNO A;  4ZYN A;  1D3Z A;  2KT7 A;  1WM2 A;  2KJ6 A;  4USA A;  1E7U A;  2NS5 A;  4M0W B;  2ICI A;  4K7W A;  2CHX A;  2V1Y A;  3GB1 A;  2JPH A;  3R66 C;  4G50 A;  5IA7 A;  3UQA A;  1HQR D;  1SJE D;  2K3U A;  3EFC A;  3TJP A;  1IP9 A;  2Y5C A;  5D3I B;  5EDS A;  3OJ4 B;  1R4N B;  4HDO A;  1XCQ L;  3MC8 A;  1K52 A;  3Q8E A;  2L76 A;  2DZI A;  1SF0 A;  1MI0 A;  2BT6 A;  2LXA A;  2W3R A;  4PT5 A;  3PPA A;  1EUV B;  1Z5S B;  4JWU C;  3LB8 C;  2X38 A;  3WAL A;  1LM8 B;  3KQ4 A;  5I4D A;  1VLB A;  1P7F A;  2K22 A;  4DDG D;  5E6J A;  2W9N A;  3A9K B;  4O1N A;  3RPF C;  3RNG C;  3N30 A;  2NVU I;  3QX1 A;  1L4Z B;  2RSU A;  1EF1 A;  2K6Q A;  1F52 A;  3GP7 A;  1C1Y B;  1GUA B;  4LNN A;  2OJR A;  2C5L C;  4YL8 A;  3AE3 B;  2DLB A;  4RF1 A;  2EMT A;  1TIF A;  4HLE A;  3NRZ A;  1WGK A;  1V97 A;  2JY6 A;  2D5G A;  2KWC A;  3GZN I;  3PRP B;  4OVZ A;  2Y5B B;  1PYW D;  1GG3 A;  4FHJ A;  2FNJ B;  5L95 C;  2PMV A;  4MSQ B;  2L0T A;  3CSF A;  4NAM A;  2DZJ A;  1N61 A;  2GLS A;  2EKI A;  1R4M I;  5BYR A;  4NZL B;  1EM7 A;  3QK0 A;  3O65 B;  5CHF A;  4DK5 A;  4WUR A;  2KTR B;  2NCN A;  1N60 A;  1E7V A;  2J52 A;  3HM3 A;  2KQ4 X;  5AZG A;  1P9D U;  2M8S A;  2L0F A;  4GN1 A;  4TQ1 A;  1FPY A;  1SE4 A;  2WXK A;  3Q69 A;  2WYQ A;  1TKY A;  1PQS A;  5T8I A;  2QMT A;  2EMS A;  4MM3 A;  4A9A A;  5JHA A;  2LWP A;  1GJZ A;  1NDD A;  3ZDT A;  2X8X X;  1WRI A;  2J0K A;  1UWM A;  4IG7 B;  4M0W A;  1EO6 A;  2N0S B;  2PTL A;  3OWE B;  4MH8 A;  2K5P A;  1WMH B;  2KDB A;  1E10 A;  3RNE C;  2D3A A;  2JQR B;  2GOW A;  4JX1 C;  3AEG B;  4YSZ B;  2LVP A;  4FJZ A;  4PS8 A;  3RNC C;  1QQR A;  2N4F A;  5JXV A;  1JQ4 A;  5BMI A;  3Q8C A;  1I4H A;  4ZHP A;  3ZDM C;  2KX3 A;  2WLB A;  4A8X C;  1VZ8 A;  2D2Q A;  3ML9 A;  3DBL I;  1JWU D;  4HK2 A;  2LRW A;  3TBL D;  3V6C B;  4MH0 E;  3VRB B;  2BYF A;  4IUM B;  4BAX A;  1PGX A;  4ARC A;  1Q1O A;  1ROE A;  2JRH A;  1HE8 A;  2M0X A;  3RZW C;  3A9K A;  4MGY E;  2KJR A;  5D2M B;  2RDH A;  3I3T B;  4XYC A;  1WJN A;  3V05 A;  2FUG 1;  4GOC A;  2NBV B;  1F77 A;  3IFW B;  3R3M A;  2FE8 A;  4EOY A;  3MFG A;  2L32 A;  4KX6 B;  4RGN A;  2O2V A;  1YJ1 A;  3VUX A;  2IY0 B;  2LJI A;  1NBF C;  3PT2 B;  2RPQ A;  5DPS A;  3WA0 A;  4LDT D;  1OGW A;  2WXN A;  1FXT B;  1EWY C;  3H8H A;  3VUY A;  2BB6 A;  3SFE B;  3X0W A;  4C56 C;  4W9G A;  1UF0 A;  1MFW A;  2CHW A;  1VDV A;  2KTR A;  2K8H A;  1FMA D;  3P1M A;  1HEZ E;  1JWB D;  1PGA A;  1DGJ A;  1ESF A;  1N62 A;  4IDI A;  2MW5 A;  2WU5 B;  4LJO B;  1FXI A;  4RF0 A;  1J7A A;  5IO9 A;  5LLI A;  4JGH B;  4NAW B;  3AUL A;  1TT5 B;  4YSY B;  3MTN B;  1L0Y B;  2G45 B;  4C4V B;  1MJD A;  1XT9 B;  1IGC A;  3WCQ A;  1Q5W B;  5IKC M;  3WAP A;  2IJ0 A;  4DHZ B;  1E8X A;  3H7S A;  2L8J A;  3NUH B;  1SGH A;  4XDC A;  2DNF A;  2BS2 B;  1QLB B;  1V5O A;  2UU7 A;  3NS1 A;  1PFD A;  4ANV A;  2DYM A;  3TEY A;  2M1M A;  3Q3O C;  3QWZ B;  2KQS A;  3AV8 A;  3UIP B;  2V3N A;  4XE0 A;  3AU4 A;  2IGH A;  2J0J A;  3KWV A;  3PSE B;  3PVL A;  3DBR I;  3M63 B;  2LXC A;  4K1R B;  2XBB C;  1WMH A;  3IG3 A;  2YEP F;  1TS5 A;  1K53 A;  4KSK C;  3AEE B;  1TBE A;  3RNB C;  3PLU A;  1I4R A;  2Y5P A;  3V3X A;  3SR6 A;  2O6V B;  4EEW A;  4XX5 A;  3NOB A;  2RD0 A;  3RMK C;  1A5R A;  1T3Q A;  3APF A;  1CQV A;  1U4A A;  1L4D B;  4EKU A;  5CTR C;  1C79 A;  4JPS A;  4A3O A;  2M56 B;  2IBI B;  3ZQ4 A;  1V49 A;  1FRR A;  4M00 A;  1Y8R C;  3A9J B;  2WDR B;  1VD2 A;  3AED B;  4ANW A;  5AUK A;  2FCM A;  3QHT A;  3PRM B;  2ZW1 A;  1V5T A;  2KDF B;  1QKZ A;  2MQJ A;  3U7Z A;  4L2Y A;  2N9L A;  3VTV A;  4FUL A;  2FCS A;  5DCN A;  2PW9 A;  5LNK 1;  1TS4 A;  1EWC A;  2GMI C;  1XLQ A;  2WXI A;  2L1A A;  4KIK B;  3Q8A A;  2Z0E B;  2OHF A;  1QT9 A;  2CS4 A;  2LD9 A;  3PZ7 A;  5D3D A;  1I7H A;  2RR9 A;  4IW0 A;  1RWS A;  1F2R I;  4WWM A;  1QOB A;  1WE6 A;  3UI3 A;  1C4C A;  1UNS A;  4I6N B;  1ZE3 D;  2MJE A;  3BYT B;  4BBN F;  2D3G A;  1MG8 A;  3FAH A;  4FAD A;  2BTE A;  4S0R A;  2KD0 A;  2K9X A;  4ANU A;  1VZ6 A;  3UQB A;  4W9F A;  3LXF A;  2XNA C;  1FEH A;  1T5X D;  4GDK B;  2WXM A;  4P16 A;  1BUI C;  1F9J A;  1OFF A;  4G0N B;  2A5U A;  2HD5 B;  2IYD B;  4OVV A;  2WXL A;  4GMV A;  1XD3 B;  2D07 B;  2KHW B;  1FIQ A;  4NAW A;  1GPX A;  1JRO A;  2PIA A;  1RYJ A;  5GXG B;  3ETR A;  3A1Q A;  4C4V A;  1E8Z A;  3AM9 A;  2C7N B;  3PO0 A;  1GAQ B;  1WXV A;  3W5V B;  3VUW A;  2INN E;  4N6E B;  3R7R A;  2ZEQ A;  4WWP A;  2AWT A;  4ACF A;  3BVM A;  1PGB A;  2BBC A;  2MJ3 A;  1KOT A;  1L0X B;  4IM2 A;  3N1Z C;  4FBJ B;  2Z0D B;  1KLU D;  1BXT A;  4KGS A;  1GOZ A;  4DHJ B;  3NS8 A;  1L5P A;  4NJ7 A;  3ZVV A;  1VR9 A;  3AEF B;  2KLG A;  3GE8 C;  4RGO S;  2AQ1 B;  2N9K A;  3RYT A;  4ZRP A;  1RM6 C;  1YQ4 B;  3BIN A;  1NYQ A;  2D10 A;  2O6V A;  1C3T A;  4ZOH C;  3AN1 A;  4YTM B;  3DVN U;  3VR9 B;  2BVC A;  3MHS D;  1NVI D;  2KO3 A;  2Z8L A;  5G2N A;  1AWD A;  1YN3 A;  3TEW A;  2WDT B;  1L6U A;  4BVU C;  3DDC B;  1ISN A;  1WR1 A;  3R8B A;  1TTN A;  1V8C A;  3A9J A;  2BF8 B;  3IHP C;  3JSV B;  1WZ3 A;  2KFJ A;  4WJO A;  1VZ7 A;  3EHV A;  3TL5 A;  1ZP0 B;  4B6W A;  3PHW B;  5KHO A;  2E6X A;  2LGS A;  5BMG A;  3ZYY X;  3RFZ B;  3SD5 A;  1N63 A;  3CIR B;  3P2B A;  1WRD B;  4BZA A;  2WWZ A;  4PK1 A;  3ZRC A;  2D3B A;  2BW2 A;  2CHZ A;  2KVR A;  1K8R B;  4W9H A;  4KIK A;  3HRD D;  2LVO A;  2LGD A;  4JWS C;  1I35 A;  4HPL B;  1LO5 D;  3U4E G;  1TY2 A;  5AZF A;  2DAJ A;  3P63 A;  4P6V F;  2HDE A;  3BWU D;  4HRS A;  4OVU A;  4P1B C;  3M95 A;  1UGJ A;  2BQQ A;  2BPS A;  3TEZ A;  2MRP A;  3HUI A;  4LNK A;  1NI2 A;  2G4S A;  3NZS A;  4GDK A;  3H1U A;  3KWL A;  4KZ0 A;  1DOI A;  4KGT A;  1AAR A;  4F8C B;  2N9P C;  2M0A A;  5G5G A;  2MBH A;  1DOY A;  1VJK A;  4ICV A;  4W9J A;  3MC9 A;  2PPH A;  1IYF A;  4A6Q A;  3Q3J A;  1FO4 A;  2WGS A;  1F1H A;  2ZNV C;  4N59 A;  1RFA A;  3BY4 B;  4HEA 1;  2WP9 B;  1ZPS A;  4JLC A;  4BKG A;  4I6L B;  1YN5 A;  2GBM A;  2PEA A;  5CHV C;  2GBK A;  4IWO A;  3Q14 C;  1NI3 A;  3L10 B;  2QHO A;  3ONS A;  2KNB A;  3A4R A;  2V9H A;  4KDL B;  1OEY J;  3R2T A;  3I57 A;  1B9R A;  2K0P A;  4II3 B;  1AN8 A;  4IWP A;  3AE5 B;  1RLF A;  2N1W A;  5L83 A;  1YNT E;  4PYU A;  1TZ1 A;  4PS7 A;  4AOF A;  2Y3A A;  4CYE A;  3PGE A;  4HJK A;  1SSN A;  4ASW C;  1CJE A;  1E6E B;  4OZA A;  2JT4 B;  5IN7 A;  2N1V A;  1NYR A;  1I4G A;  5G55 A;  1H8C A;  2IGG A;  1WE7 A;  1WJ4 A;  1T0S C;  2ZVN A;  3TIX A;  4DXA B;  4K7S A;  4YSX B;  1WM3 A;  3V6E B;  3RN9 C;  5IP4 D;  4W9E A;  2FUH B;  2W55 A;  1XCT L;  3EUB 2;  4M01 A;  1DOX A;  1NEN B;  1IGD A;  3ABV B;  1L2N A;  3C19 A;  2I1K A;  2GI9 A;  4N9F 4;  2JYT A;  3B9J A;  4WAA A;  2O2V B;  3JSV A;  2PVG C;  3SU8 X;  3B0A A;  2KWD A;  2VRR B;  1XO3 A;  3U30 A;  2I2Y A;  3IT4 B;  2PVO D;  4K3C A;  3W1S C;  3V60 A;  4TUU A;  4TKN A;  4DBG A;  1QOG A;  4G11 A;  2CJO A;  5C3J B;  3U8Z A;  4A55 A;  2AX5 A;  4RNA A;  1WGY A;  3AU5 A;  3ZRF A;  1KTK A;  4WQO B;  4IM3 A;  3BVG A;  2N7E A;  4ZRK A;  2K8C A;  3K9O B;  3ZNI D;  1SB3 C;  4H2A A;  1MG4 A;  2BYV E;  1SBB B;  3BYY B;  2GBR A;  3VAW A;  2NBU A;  4WAF A;  4IC7 B;  4RMA A;  3M3J A;  3AEB B;  4ZDV A;  3LYY A;  3L08 A;  3SHQ A;  1WZ0 A;  2OOB B;  1P7E A;  4A3P A;  2FBW B;  2KC1 A;  4W9I A;  4AUQ C;  5EE9 A;  3AB5 A;  4IWQ A;  1UWX A;  2IY1 B;  1WFY A;  2NBW B;  1TGZ B;  4W9L A;  2LGX A;  4LTU A;  2IND C;  2JXT A;  2DX5 B;  3TUO A;  1YD8 U;  2KFK B;  3EFU A;  2QIE B;  3L17 A;  4WWN A;  4RFB A;  1T0R C;  1UGM A;  4BKT A;  3GE3 C;  4HVB A;  3IAS 1;  3Q2A C;  3CWI A;  2K6D B;  1T6B X;  4A90 A;  2KKC A;  3GZN B;  3RZF A;  3ZNH B;  1T0Y A;  2H89 B;  5HHD G;  3HVZ A;  3IT6 B;  4HKZ E;  2WS3 B;  1Q10 A;  1M4V A;  5FR3 A;  5C1Z A;  3N1X C;  4GSW A;  3SEB A;  5TSS A;  2XEW A;  1R4M B;  4NY0 A;  4M8M A;  3APC A;  3R2I A;  3UIO B;  2WNM A;  3ZTD A;  5H92 C;  1V6E A;  3PRZ A;  4LK0 M;  1ZGU B;  2MBE A;  2ZVO A;  4EUT A;  2BYE A;  1GC6 A;  4MDK E;  4RM8 A;  4S17 A;  3VR8 B;  5BYQ A;  4L23 A;  5HFY A;  3PLV A;  2W3S A;  2AQ3 B;  2LI5 A;  3RNA C;  1J7C A;  4LCD E;  1HTQ A;  3X23 A;  5J17 A;  2L7R A;  1HZ5 A;  4FLH A;  2OED A;  2PE6 B;  2VZK B;  3AMZ A;  4K7U A;  3RT3 B;  2PJH A;  5DPW A;  2GBJ A;  2E3T A;  3Q8B A;  4TV3 A;  1I4P A;  1F0Z A;  3GOE A;  1N5X A;  2INP E;  4YT0 B;  2L52 A;  3KUZ A;  4C00 A;  1AYF A;  1YQ3 B;  3A1Q B;  4ZRJ A;  5GMV A;  4URK A;  1QF6 A;  2IGD A;  2Q5W D;  3QJZ A;  1T0Q C;  1TS3 A;  3IXS A;  2EEL A;  1MPE A;  1LFD A;  4ARI A;  2MWS B;  2JZP A;  3CF6 E;  4EZL A;  1P1A A;  3DBL B;  4TQ0 A;  1M94 A;  4DXG A;  1V1P B;  2BWE S;  4B0M A;  3VFK A;  3VH3 B;  3VHT C;  4HXD A;  1WX9 A;  1LQB A;  2HTH A;  3C0R B;  3AE2 B;  4AJY B;  3B08 A;  3WIM A;  1YOV B;  2KFK A;  1WGD A;  1NEK B;  2PE9 A;  4NJ6 A;  1KM7 A;  2KXJ A;  1J19 A;  1JWM D;  1EU3 A;  1ET6 A;  1D4B A;  2NTS A;  4HJG E;  5KHQ A;  2ZPY A;  4W9K A;  2KQ7 A;  4OZB A;  3L4P A;  3FKY A;  3HK0 A;  1K51 A;  5HKH A;  2WX0 A;  3AE9 B;  1GNU A;  1HXY D;  2MHJ A;  2RMM A;  5BYS A;  2MP2 B;  3DVG Y;  2MBQ A;  4G3X B;  4US9 A;  1WSP A;  3T3O A;  1TKE A;  3K9P B;  2RDB C;  1JRP A;  3DHI C;  3T3N A;  3QAR A;  3NVW A;  3PZD A;  5G5H A;  1ET9 A;  2AL3 A;  1GC7 A;  2JX5 A;  1Q0W B;  2R61 A;  2J7Q B;  2FCN A;  3DBH I;  1SXT A;  1SIJ A;  1CK1 A;  1UBI A;  4P1C C;  2M19 A;  4MJS B;  2J42 A;  4WH4 A;  2BWF A;  1EF5 A; 
#chains in the Genus database with same CATH homology
 2LVO A;  2DZJ A;  2LGD A;  1I35 A;  4HPL B;  1WF9 A;  3VTU A;  2DYB A;  1R4M I;  4II2 B;  5AZF A;  5J2R A;  1WGG A;  2DAJ A;  2IO0 B;  3QK0 A;  3O65 B;  5CHF A;  4DK5 A;  2KTR B;  4OVU A;  1L7Y A;  1YX5 B;  2BKF A;  2NCN A;  1JRU A;  4ZRI A;  3M95 A;  1E7V A;  3HM3 A;  2ZPN A;  4BOZ B;  2UYZ B;  5AZG A;  2BPS A;  4M8N A;  2MRP A;  3KW5 B;  3QIJ A;  2KMA A;  1P9D U;  2M8S A;  2FIF A;  4HCN B;  2L0F A;  3VQI A;  3VXW A;  2KLC A;  3L16 A;  3N3K B;  2ZZP B;  1NI2 A;  2G4S A;  3NZS A;  3QCA A;  4BBN C;  4GDK A;  4GN1 A;  3H1U A;  4TQ1 A;  3ZNG C;  4KZ0 A;  4IM0 A;  2KDI A;  1AAR A;  3MJW A;  4F8C B;  1X1M A;  2DYO A;  2N9P C;  2AEH A;  2BKR B;  2WYQ A;  1S1Q B;  4WJP A;  2MBH A;  4ICV A;  4W9J A;  3RCZ A;  1E90 A;  3PHX B;  1PQS A;  2PPH A;  2G3Q B;  1IYF A;  2L3Z A;  2MSE D;  2EMS A;  3Q3J A;  4MM3 A;  5AZH A;  5JHA A;  2KMC A;  2LWP A;  3PV1 A;  3A4S C;  1GJZ A;  1NDD A;  2JWZ A;  1WGR A;  3ZDT A;  2IZV B;  2J0K A;  2REX A;  2ZNV C;  1SIF A;  1RFA A;  1QZE A;  3BY4 B;  1EO6 A;  1RAX A;  4IG7 B;  4P7I A;  3IBE A;  3KYD D;  4ICU A;  1ZW7 A;  4JLC A;  5E6P A;  2MCN B;  4BKG A;  4I6L B;  3ZTC A;  2GBM A;  2PEA A;  5CHV C;  1E8W A;  2GBK A;  1WMH B;  1WXS A;  2KDB A;  4IWO A;  2DEN B;  2CR5 A;  3L10 B;  3QC8 B;  3UGB B;  3OJ3 A;  2GOW A;  2MX2 A;  2QHO A;  3ONS A;  3DOW A;  4GXB A;  5LXH A;  2KNB A;  3A4R A;  2ZCB A;  2LVP A;  4KDL B;  1OEY J;  3TMP B;  4FJZ A;  4PS8 A;  1E5W A;  2JRI B;  3ECI A;  4A20 A;  1LXD A;  2FAZ A;  3B1L X;  3UF8 A;  2N4F A;  4II3 B;  4IWP A;  1RLF A;  4FJV B;  3W1S A;  2JZ3 B;  3ZDM C;  1XQQ A;  2KX3 A;  2N1W A;  3AXC A;  2XK5 A;  4GU2 A;  3JYU A;  5L83 A;  4PYU A;  5JZE B;  1TZ1 A;  4PS7 A;  3KH0 A;  2D2Q A;  3ML9 A;  4AOF A;  4PYZ A;  3DBL I;  4CYE A;  2D11 A;  4HK2 A;  3ENE A;  2ZCC A;  3PGE A;  2LRW A;  4HJK A;  2C60 A;  3WAM A;  3T8M A;  4ASW C;  3RD2 A;  4MGK E;  2JT4 B;  3TBL D;  1OEY A;  2JUO A;  2L05 A;  2N1V A;  3H6N A;  4MGZ E;  5G55 A;  3V6C B;  1H8C A;  4MH0 E;  4E3C A;  1WE7 A;  4GDL B;  1WJ4 A;  5LXI B;  2BYF A;  1WX7 A;  2ZVN A;  3KYC D;  4IUM B;  3TIX A;  1WXM A;  2EKE C;  4DXA B;  4K7S A;  3LJ3 A;  1Q1O A;  3AI5 A;  4J6I A;  2MP2 A;  1WM3 A;  3V6E B;  4W9E A;  2FUH B;  2JRH A;  5JHB A;  1UBQ A;  1R4N I;  2JF5 A;  2IO1 B;  1HE8 A;  2M0X A;  3RZW C;  3A9K A;  4MGY E;  5C23 A;  2KJR A;  5D2M B;  3VH4 B;  1L2N A;  4WJN A;  2KX0 A;  3D32 A;  2I1K A;  3I3T B;  2DAF A;  1WJN A;  4KZC A;  4N9F 4;  5DPT A;  4PS3 A;  2K8B A;  5CX3 A;  2AYO B;  4WAA A;  3L0W B;  4GOC A;  2O2V B;  3JSV A;  2NBV B;  3W1Y A;  3SU8 X;  3IFW B;  3B0A A;  3NZU A;  2VRR B;  2JXX A;  4F7Z A;  3R3M A;  3U30 A;  4EOY A;  3APD A;  4FN2 A;  4B9K A;  4DDI D;  3W1S C;  3V60 A;  4TUU A;  4EFO A;  2IO3 B;  1KJT A;  2WX1 A;  2O2V A;  4TKN A;  4DHZ E;  1YJ1 A;  2O6V D;  3DCG A;  4MEM A;  3VUX A;  2IY0 B;  1NBF C;  4MJS A;  3DVN V;  2R2O A;  3PT2 B;  4NNJ B;  2Z59 B;  2RPQ A;  2YLM A;  5DPS A;  3WA0 A;  4DBG A;  1OQY A;  5CHW A;  4LDT D;  4I6P A;  1OGW A;  2DHZ A;  4G11 A;  1H4R A;  3U7D A;  1G6J A;  2NPT A;  3U8Z A;  1FXT B;  2A4Z A;  2FID A;  3DQV A;  2KZR A;  2LGY A;  1WGY A;  3VUY A;  3AU5 A;  3ZRF A;  4WQO B;  3X0W A;  2C7H A;  1P0R A;  4IM3 A;  4W9G A;  1Z2M A;  2N7E A;  4EZK A;  3SDL C;  2CHW A;  4ZRK A;  2K8C A;  2KTR A;  4JL9 A;  2K25 A;  2K8H A;  4HWI B;  4XZ4 A;  2N9X A;  3K9O B;  1V86 A;  4MEL A;  3ZNI D;  2HE7 A;  2NR2 A;  4KDI C;  2K39 A;  2MW5 A;  2BYV E;  4NQK E;  5IAA C;  4LJO B;  2GBR A;  5LLI A;  4JGH B;  4NAW B;  3VAW A;  3AUL A;  3MTN B;  2NBU A;  2DZM A;  4IC7 B;  1V80 A;  4MGI E;  4WJQ A;  3EC8 A;  2G45 B;  3M3J A;  4RMA A;  4E74 A;  1XT9 B;  1ZKH A;  3QA8 A;  1V81 A;  1Q5W B;  4ZDV A;  3WAP A;  2KN5 A;  4W9D A;  3L08 A;  3H7P B;  4DHZ B;  1E8X A;  3SHQ A;  1WZ0 A;  3H7S A;  2OOB B;  4GB9 A;  2L00 B;  2L8J A;  1SGH A;  3CST A;  4AP4 C;  2MBO A;  4A3P A;  2KC1 A;  4W9I A;  1V5O A;  4AUQ C;  2RGF A;  4ANV A;  2ZJD A;  4IWQ A;  2DYM A;  1WI0 A;  2IY1 B;  2M1M A;  1WFY A;  2NBW B;  3VDZ A;  1TGZ B;  3QWZ B;  4W9L A;  2LGX A;  1P98 A;  2KQS A;  3UIP B;  2DX5 B;  3AU4 A;  2J0J A;  3NY5 A;  1CMX B;  1YD8 U;  2KFK B;  4DWF A;  3PSE B;  3EFU A;  3PVL A;  3DBR I;  3H9D A;  2JVC A;  3M63 B;  2LXC A;  4K1R B;  2K1F A;  2XBB C;  1WMH A;  3V61 A;  3HIZ A;  3IG3 A;  3L17 A;  4KSK C;  4HPM B;  4WWN A;  1UGM A;  4BKT A;  1TBE A;  2BGF A;  2LRU A;  1WGH A;  5D6J B;  3ZLZ A;  3PLU A;  1V9J A;  5TR5 A;  4HVB A;  2ASQ A;  2LVQ A;  2V3S A;  2V4L A;  3QQ8 B;  2O6V B;  4EEW A;  2K6D B;  1RRB A;  5J18 A;  4XX5 A;  1YIW A;  3QAQ A;  3NOB A;  2RD0 A;  1A5R A;  4WWO A;  1WJU A;  3OAW A;  2KKC A;  3APF A;  2KOX A;  1U4A A;  3RZF A;  3ZNH B;  1T0Y A;  4LDT B;  4FJY A;  4EKU A;  5CTR C;  4X57 B;  3IVF A;  4A3O A;  2IBI B;  1V49 A;  5JH5 C;  3PRE A;  5E6O A;  3KUC B;  1YQB A;  3ALB A;  1S3S G;  3ML8 A;  5C1Z A;  4BKS A;  1Y8R C;  2LAS A;  4GSW A;  3TCA A;  3A9J B;  4BFR A;  2KDE B;  4CHK A;  4GDL A;  1VD2 A;  1IPG A;  2XEW A;  4W9C A;  4ANW A;  4NY0 A;  1UEL A;  1VCB A;  2FCM A;  4M8M A;  3APC A;  3QHT A;  3ZO5 B;  3UIO B;  2KWU B;  3PRM B;  3HHM A;  4EZJ A;  2KJH B;  1V5T A;  3N32 A;  2KDF B;  3ZTD A;  2MQJ A;  3T9L A;  1YX6 B;  1V6E A;  2LZ6 A;  3JVZ X;  3KUD B;  3PRZ A;  4FUL A;  3VTV A;  2FCS A;  4FHK A;  1ZGU B;  2MBE A;  5DCN A;  3ZW3 A;  2ZVO A;  2MLB A;  1WJ6 A;  4EUT A;  4AJW A;  2BYE A;  4DHJ D;  1GC6 A;  2I1J A;  2GMI C;  3M62 B;  4MDK E;  3L54 A;  4RM8 A;  2IO2 B;  4KIK B;  2KC2 A;  2Z0E B;  1I42 A;  2ZNV B;  3DBS A;  2CS4 A;  3JW0 X;  1V2Y A;  1BT0 A;  2LD9 A;  3PLV A;  2RR9 A;  4IW0 A;  3VVW B;  2M4N A;  4B95 A;  2LI5 A;  1WE6 A;  1WYW B;  4K81 A;  2KWV B;  1P3Q U;  1WXA A;  2G4D B;  4I6N B;  2UWQ A;  4LCD E;  3X23 A;  5J17 A;  1J8C A;  2L7R A;  3VTW A;  4FLH A;  2PE6 B;  4BBN F;  2D3G A;  1SE9 A;  1MG8 A;  4FAD A;  4K7U A;  4LJP B;  3RT3 B;  2YVC A;  3V62 A;  4FA6 A;  2KD0 A;  2PJH A;  4W9H A;  4ANX A;  5DPW A;  2JZZ A;  2B3A A;  4ANU A;  4BKS D;  3RUI B;  2C9W B;  3UQB A;  2GBJ A;  2CU1 A;  4W9F A;  4TV3 A;  2MA9 B;  4NQL B;  2AL6 A;  4GDK B;  1UZX B;  3GOE A;  3S2A A;  4KSL C;  2M17 A;  4GGQ A;  3ZUN A;  5D94 A;  3KUZ A;  3PS6 A;  4E71 A;  1F9J A;  2HJ8 A;  2FCQ A;  3A1Q B;  4ZRJ A;  5GMV A;  2KAN A;  4G0N B;  2IYD B;  2A5U A;  2HD5 B;  4XC2 A;  4OVV A;  4URK A;  4BOS C;  4GMV A;  3Q3F A;  1XD3 B;  2D07 B;  1E8Y A;  2KHW B;  2LUE A;  3CMM B;  3QJZ A;  3EEC A;  2MBB B;  4NAW A;  1LFD A;  2KK8 A;  3PTF C;  2MWS B;  3CF6 E;  4ZYN A;  1D3Z A;  1WM2 A;  3A1Q A;  4EZL A;  2KJ6 A;  1P1A A;  1E7U A;  1E8Z A;  4TQ0 A;  1M94 A;  2NS5 A;  2C7N B;  4M0W B;  3HM6 X;  2BWE S;  4K7W A;  1WXV A;  3R7Q A;  3H7P A;  2CHX A;  5DPR A;  3VFK A;  2V1Y A;  3VUW A;  2CKH B;  2JPH A;  3OLM D;  3R7R A;  3R66 C;  3UIN B;  4G50 A;  3VH3 B;  2ZEQ A;  3VHT C;  4WWP A;  2AWT A;  2C7M B;  3L13 A;  4HXD A;  1WX9 A;  2DZK A;  3A33 B;  5IA7 A;  3UQA A;  1LQB A;  5FR6 A;  2HTH A;  3LDZ E;  1KOT A;  4IM2 A;  4FBJ B;  4KVG B;  3C0R B;  3TJP A;  1IP9 A;  2Z0D B;  5EDS A;  3OJ4 B;  4HDO A;  3B08 A;  4AJY B;  4MSM B;  4HCP B;  4DHJ B;  3WIM A;  3DVG X;  3NS8 A;  2XK5 B;  2KFK A;  1WGD A;  4HDQ A;  4NJ7 A;  2L76 A;  3ZVV A;  1J0G A;  2KLG A;  3DPD A;  2DZI A;  2PE9 A;  4NJ6 A;  1KM7 A;  2KXJ A;  1J19 A;  1KLV A;  5E6N A;  5KHQ A;  2LXA A;  2ZPY A;  3RYT A;  4W9K A;  2KQ7 A;  3ZIM A;  3PPA A;  3BIN A;  1EUV B;  2D10 A;  2O6V A;  1Z5S B;  3HK0 A;  2WX0 A;  3WAN A;  2GBN A;  3ZKJ C;  5HKH A;  4GIV A;  3DVN U;  3RUL A;  3WAL A;  1GNU A;  5AEK B;  3MHS D;  4JQW C;  1UD7 A;  1LM8 B;  3NHE B;  4NPN A;  1UH6 A;  2LJ5 A;  2MP2 B;  3DVG Y;  2MBQ A;  4G3X B;  5D7G A;  2KO3 A;  1OTR B;  5G2N A;  4DDG D;  3K9P B;  1WY8 A;  2W9N A;  2WDT B;  3A9K B;  3QAR A;  4BVU C;  3DDC B;  2N9E B;  1ISN A;  1WR1 A;  1TTN A;  2J0M A;  3N30 A;  2N7D A;  2NVU I;  3QX1 A;  1WR6 E;  3A9J A;  3PZD A;  2BF8 B;  2RSU A;  1EF1 A;  2K6Q A;  3IHP C;  3JSV B;  1WX8 A;  1WZ3 A;  2AL3 A;  4RM9 A;  1C1Y B;  2KFJ A;  2R2Q A;  1GUA B;  4CO7 A;  4WJO A;  1GC7 A;  1WIA A;  4KV2 A;  2OJR A;  3EHV A;  1Q0W B;  3TL5 A;  4B6W A;  2J7Q B;  2C5L C;  2FCN A;  3DBH I;  4YL8 A;  2EMT A;  4F1S A;  4HLE A;  3ZNZ B;  3PHW B;  5KHO A;  2JY6 A;  2KWC A;  3GZN I;  1UBI A;  2KTF A;  3PRP B;  3SD5 A;  2Y5B B;  4MJS B;  3P2B A;  1WRD B;  3WAO A;  2WWZ A;  1GG3 A;  5BO4 B;  1WH3 A;  4FHJ A;  3ZRC A;  2FNJ B;  5L95 C;  2CHZ A;  2BWF A;  2KVR A;  1K8R B;  2L0T A;  3CSF A;  4JIO U;  4MSQ B;  3KVF B;  4KIK A;  1EF5 A;  4AWJ A;  1C3T A;  2NPT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...