4X59A

Anthranilate phosphoribosyltransferase variant p180a from mycobacterium tuberculosis in complex with prpp and mg
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
347
structure length
344
Chain Sequence
b'VPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAARFHPSYRHAAAVRREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Structures of Mycobacterium tuberculosis Anthranilate Phosphoribosyltransferase Variants Reveal the Conformational Changes That Facilitate Delivery of the Substrate to the Active Site.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 118
structure length 344
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 4x59A01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 4x59A02
3QS8A 4GIUA 5BYTA 1VQUA 4N93A 3UU1A 4IJ1A 1KHDA 1KGZA 3R6CA 4OWUA 2WK6A 5EP8A 3QR9A 4X59A 4N5VA 1V8GA 4GKMA 4XR5A 4X58A 4GA6A 2TPTA 4X5AA 4N8QA 4GA4A 1ZVWA 1O17A 5C2LA 4MUOA 4X46A 4ZOFA 2J0FA 2WK5A 1AZYA 2GVQA 4ZOJA 4OWVA 4YI7A 1ZYKA 4OWNA 4X5CA 4YYYA 3TWPA 5BNEA 4X5DA 4OWQA 4ZOKA 4ZTVA 4GA5A 4HKMA 5C1RA 5EY3A 4X5EA 2BPQA 4GTNA 3H5QA 4YEKA 1BRWA 3QSAA 2DSJA 4EAFA 4LHMA 4OWSA 5BO2A 3GBRA 2ELCA 4X5BA 4EADA 4OWMA 3R88A 1ZXYA 5BO3A 1UOUA 1OTPA 1GXBA 5C7SA 4M0RA 3QQSA 4OWOA
chains in the Genus database with same CATH superfamily
3QS8A 4GIUA 5BYTA 1VQUA 4N93A 3UU1A 4IJ1A 1RRZA 1KHDA 1KGZA 3R6CA 4OWUA 2WK6A 5EP8A 3QR9A 4X59A 4N5VA 1V8GA 4GKMA 4XR5A 4X58A 4GA6A 2TPTA 4X5AA 4N8QA 4GA4A 4F3FC 1ZVWA 1O17A 5C2LA 4MUOA 4X46A 4ZOFA 2J0FA 2WK5A 1AZYA 2GVQA 4ZOJA 4OWVA 4YI7A 1ZYKA 4OWNA 4X5CA 4YYYA 3TWPA 5BNEA 4X5DA 4OWQA 4ZOKA 4ZTVA 4GA5A 4HKMA 5C1RA 5EY3A 4X5EA 2BPQA 4GTNA 3H5QA 4YEKA 1BRWA 3QSAA 2DSJA 4EAFA 4LHMA 4OWSA 5BO2A 3GBRA 2ELCA 4X5BA 4EADA 4OWMA 3R88A 1ZXYA 5BO3A 1UOUA 1OTPA 1GXBA 1RF8B 5C7SA 4M0RA 3QQSA 4OWOA
chains in the Genus database with same CATH topology
3QS8A 4GIUA 5BYTA 1VQUA 4N93A 3UU1A 4IJ1A 1KHDA 1KGZA 3R6CA 4OWUA 2WK6A 5EP8A 3QR9A 4X59A 4N5VA 1V8GA 4GKMA 4XR5A 4X58A 4GA6A 2TPTA 4X5AA 4N8QA 4GA4A 1ZVWA 1O17A 5C2LA 4MUOA 4X46A 4ZOFA 2J0FA 2WK5A 1AZYA 2GVQA 4ZOJA 4OWVA 4YI7A 1ZYKA 4OWNA 4X5CA 4YYYA 3TWPA 5BNEA 4X5DA 4OWQA 4ZOKA 4ZTVA 4GA5A 4HKMA 5C1RA 5EY3A 4X5EA 2BPQA 4GTNA 3H5QA 4YEKA 1BRWA 3QSAA 2DSJA 4EAFA 4LHMA 4OWSA 5BO2A 3GBRA 2ELCA 4X5BA 4EADA 4OWMA 3R88A 1ZXYA 5BO3A 1UOUA 1OTPA 1GXBA 5C7SA 4M0RA 3QQSA 4OWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QS8 A;  4GIU A;  5BYT A;  1VQU A;  4N93 A;  3UU1 A;  4IJ1 A;  1KHD A;  1KGZ A;  3R6C A;  4OWU A;  2WK6 A;  5EP8 A;  3QR9 A;  4X59 A;  4N5V A;  1V8G A;  4GKM A;  4XR5 A;  4X58 A;  4GA6 A;  2TPT A;  4X5A A;  4N8Q A;  4GA4 A;  1ZVW A;  1O17 A;  5C2L A;  4MUO A;  4X46 A;  4ZOF A;  2J0F A;  2WK5 A;  1AZY A;  2GVQ A;  4ZOJ A;  4OWV A;  4YI7 A;  1ZYK A;  4OWN A;  4X5C A;  4YYY A;  3TWP A;  5BNE A;  4X5D A;  4OWQ A;  4ZOK A;  4ZTV A;  4GA5 A;  4HKM A;  5C1R A;  5EY3 A;  4X5E A;  2BPQ A;  4GTN A;  3H5Q A;  4YEK A;  1BRW A;  3QSA A;  2DSJ A;  4EAF A;  4LHM A;  4OWS A;  5BO2 A;  3GBR A;  2ELC A;  4X5B A;  4EAD A;  4OWM A;  3R88 A;  1ZXY A;  5BO3 A;  1UOU A;  1OTP A;  1GXB A;  5C7S A;  4M0R A;  3QQS A;  4OWO A; 
#chains in the Genus database with same CATH topology
 3QS8 A;  4GIU A;  5BYT A;  1VQU A;  4N93 A;  3UU1 A;  4IJ1 A;  1RRZ A;  1KHD A;  1KGZ A;  3R6C A;  4OWU A;  2WK6 A;  5EP8 A;  3QR9 A;  4X59 A;  4N5V A;  1V8G A;  4GKM A;  4XR5 A;  4X58 A;  4GA6 A;  2TPT A;  4X5A A;  4N8Q A;  4GA4 A;  4F3F C;  1ZVW A;  1O17 A;  5C2L A;  4MUO A;  4X46 A;  4ZOF A;  2J0F A;  2WK5 A;  1AZY A;  2GVQ A;  4ZOJ A;  4OWV A;  4YI7 A;  1ZYK A;  4OWN A;  4X5C A;  4YYY A;  3TWP A;  5BNE A;  4X5D A;  4OWQ A;  4ZOK A;  4ZTV A;  4GA5 A;  4HKM A;  5C1R A;  5EY3 A;  4X5E A;  2BPQ A;  4GTN A;  3H5Q A;  4YEK A;  1BRW A;  3QSA A;  2DSJ A;  4EAF A;  4LHM A;  4OWS A;  5BO2 A;  3GBR A;  2ELC A;  4X5B A;  4EAD A;  4OWM A;  3R88 A;  1ZXY A;  5BO3 A;  1UOU A;  1OTP A;  1GXB A;  1RF8 B;  5C7S A;  4M0R A;  3QQS A;  4OWO A; 
#chains in the Genus database with same CATH homology
 3QS8 A;  4GIU A;  5BYT A;  1VQU A;  4N93 A;  3UU1 A;  4IJ1 A;  1KHD A;  1KGZ A;  3R6C A;  4OWU A;  2WK6 A;  5EP8 A;  3QR9 A;  4X59 A;  4N5V A;  1V8G A;  4GKM A;  4XR5 A;  4X58 A;  4GA6 A;  2TPT A;  4X5A A;  4N8Q A;  4GA4 A;  1ZVW A;  1O17 A;  5C2L A;  4MUO A;  4X46 A;  4ZOF A;  2J0F A;  2WK5 A;  1AZY A;  2GVQ A;  4ZOJ A;  4OWV A;  4YI7 A;  1ZYK A;  4OWN A;  4X5C A;  4YYY A;  3TWP A;  5BNE A;  4X5D A;  4OWQ A;  4ZOK A;  4ZTV A;  4GA5 A;  4HKM A;  5C1R A;  5EY3 A;  4X5E A;  2BPQ A;  4GTN A;  3H5Q A;  4YEK A;  1BRW A;  3QSA A;  2DSJ A;  4EAF A;  4LHM A;  4OWS A;  5BO2 A;  3GBR A;  2ELC A;  4X5B A;  4EAD A;  4OWM A;  3R88 A;  1ZXY A;  5BO3 A;  1UOU A;  1OTP A;  1GXB A;  5C7S A;  4M0R A;  3QQS A;  4OWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...