4X5AA

Anthranilate phosphoribosyltransferase variant r193a from mycobacterium tuberculosis remains ligand-free when co-crystallised with prpp and mg
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
348
structure length
345
Chain Sequence
b'SVPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVAREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Structures of Mycobacterium tuberculosis Anthranilate Phosphoribosyltransferase Variants Reveal the Conformational Changes That Facilitate Delivery of the Substrate to the Active Site.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 119
structure length 345
sequence length 348
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 4x5aA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 4x5aA02
4OWVA 4X5BA 2ELCA 4LHMA 5BO3A 4XR5A 1V8GA 1GXBA 4ZOFA 3QSAA 4X5AA 3UU1A 1ZXYA 2DSJA 3QQSA 5C2LA 2GVQA 4OWQA 4X5CA 1ZVWA 1UOUA 4YEKA 4GKMA 4ZOKA 4N5VA 4OWUA 4X46A 3R88A 4HKMA 1BRWA 4GA5A 4GA6A 3TWPA 2TPTA 5C1RA 4OWOA 4GA4A 4OWNA 4YI7A 5EP8A 5C7SA 3H5QA 4X59A 4M0RA 2BPQA 4GIUA 1AZYA 1O17A 2J0FA 3QS8A 2WK6A 2WK5A 1VQUA 5EY3A 5BNEA 4GTNA 1OTPA 4OWMA 4N8QA 4X5DA 3QR9A 1KHDA 4N93A 4EAFA 3GBRA 4ZOJA 4OWSA 1ZYKA 4YYYA 5BO2A 4ZTVA 1KGZA 3R6CA 4X58A 4IJ1A 5BYTA 4MUOA 4X5EA 4EADA
chains in the Genus database with same CATH superfamily
4OWVA 4X5BA 2ELCA 4LHMA 5BO3A 4XR5A 1V8GA 1GXBA 4ZOFA 1RRZA 3QSAA 4X5AA 3UU1A 1ZXYA 2DSJA 3QQSA 5C2LA 2GVQA 4OWQA 4X5CA 1ZVWA 1UOUA 4YEKA 4GKMA 4ZOKA 4F3FC 4N5VA 4OWUA 4X46A 3R88A 4HKMA 1BRWA 4GA5A 4GA6A 3TWPA 2TPTA 5C1RA 4OWOA 4GA4A 4OWNA 4YI7A 5EP8A 5C7SA 3H5QA 4X59A 4M0RA 2BPQA 4GIUA 1AZYA 1O17A 2J0FA 3QS8A 2WK6A 2WK5A 1VQUA 5EY3A 5BNEA 4GTNA 1OTPA 4OWMA 4N8QA 4X5DA 3QR9A 1KHDA 4N93A 4EAFA 3GBRA 4ZOJA 4OWSA 1ZYKA 4YYYA 5BO2A 4ZTVA 1KGZA 1RF8B 3R6CA 4X58A 4IJ1A 5BYTA 4MUOA 4X5EA 4EADA
chains in the Genus database with same CATH topology
4OWVA 4X5BA 2ELCA 4LHMA 5BO3A 4XR5A 1V8GA 1GXBA 4ZOFA 3QSAA 4X5AA 3UU1A 1ZXYA 2DSJA 3QQSA 5C2LA 2GVQA 4OWQA 4X5CA 1ZVWA 1UOUA 4YEKA 4GKMA 4ZOKA 4N5VA 4OWUA 4X46A 3R88A 4HKMA 1BRWA 4GA5A 4GA6A 3TWPA 2TPTA 5C1RA 4OWOA 4GA4A 4OWNA 4YI7A 5EP8A 5C7SA 3H5QA 4X59A 4M0RA 2BPQA 4GIUA 1AZYA 1O17A 2J0FA 3QS8A 2WK6A 2WK5A 1VQUA 5EY3A 5BNEA 4GTNA 1OTPA 4OWMA 4N8QA 4X5DA 3QR9A 1KHDA 4N93A 4EAFA 3GBRA 4ZOJA 4OWSA 1ZYKA 4YYYA 5BO2A 4ZTVA 1KGZA 3R6CA 4X58A 4IJ1A 5BYTA 4MUOA 4X5EA 4EADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWV A;  4X5B A;  2ELC A;  4LHM A;  5BO3 A;  4XR5 A;  1V8G A;  1GXB A;  4ZOF A;  3QSA A;  4X5A A;  3UU1 A;  1ZXY A;  2DSJ A;  3QQS A;  5C2L A;  2GVQ A;  4OWQ A;  4X5C A;  1ZVW A;  1UOU A;  4YEK A;  4GKM A;  4ZOK A;  4N5V A;  4OWU A;  4X46 A;  3R88 A;  4HKM A;  1BRW A;  4GA5 A;  4GA6 A;  3TWP A;  2TPT A;  5C1R A;  4OWO A;  4GA4 A;  4OWN A;  4YI7 A;  5EP8 A;  5C7S A;  3H5Q A;  4X59 A;  4M0R A;  2BPQ A;  4GIU A;  1AZY A;  1O17 A;  2J0F A;  3QS8 A;  2WK6 A;  2WK5 A;  1VQU A;  5EY3 A;  5BNE A;  4GTN A;  1OTP A;  4OWM A;  4N8Q A;  4X5D A;  3QR9 A;  1KHD A;  4N93 A;  4EAF A;  3GBR A;  4ZOJ A;  4OWS A;  1ZYK A;  4YYY A;  5BO2 A;  4ZTV A;  1KGZ A;  3R6C A;  4X58 A;  4IJ1 A;  5BYT A;  4MUO A;  4X5E A;  4EAD A; 
#chains in the Genus database with same CATH topology
 4OWV A;  4X5B A;  2ELC A;  4LHM A;  5BO3 A;  4XR5 A;  1V8G A;  1GXB A;  4ZOF A;  1RRZ A;  3QSA A;  4X5A A;  3UU1 A;  1ZXY A;  2DSJ A;  3QQS A;  5C2L A;  2GVQ A;  4OWQ A;  4X5C A;  1ZVW A;  1UOU A;  4YEK A;  4GKM A;  4ZOK A;  4F3F C;  4N5V A;  4OWU A;  4X46 A;  3R88 A;  4HKM A;  1BRW A;  4GA5 A;  4GA6 A;  3TWP A;  2TPT A;  5C1R A;  4OWO A;  4GA4 A;  4OWN A;  4YI7 A;  5EP8 A;  5C7S A;  3H5Q A;  4X59 A;  4M0R A;  2BPQ A;  4GIU A;  1AZY A;  1O17 A;  2J0F A;  3QS8 A;  2WK6 A;  2WK5 A;  1VQU A;  5EY3 A;  5BNE A;  4GTN A;  1OTP A;  4OWM A;  4N8Q A;  4X5D A;  3QR9 A;  1KHD A;  4N93 A;  4EAF A;  3GBR A;  4ZOJ A;  4OWS A;  1ZYK A;  4YYY A;  5BO2 A;  4ZTV A;  1KGZ A;  1RF8 B;  3R6C A;  4X58 A;  4IJ1 A;  5BYT A;  4MUO A;  4X5E A;  4EAD A; 
#chains in the Genus database with same CATH homology
 4OWV A;  4X5B A;  2ELC A;  4LHM A;  5BO3 A;  4XR5 A;  1V8G A;  1GXB A;  4ZOF A;  3QSA A;  4X5A A;  3UU1 A;  1ZXY A;  2DSJ A;  3QQS A;  5C2L A;  2GVQ A;  4OWQ A;  4X5C A;  1ZVW A;  1UOU A;  4YEK A;  4GKM A;  4ZOK A;  4N5V A;  4OWU A;  4X46 A;  3R88 A;  4HKM A;  1BRW A;  4GA5 A;  4GA6 A;  3TWP A;  2TPT A;  5C1R A;  4OWO A;  4GA4 A;  4OWN A;  4YI7 A;  5EP8 A;  5C7S A;  3H5Q A;  4X59 A;  4M0R A;  2BPQ A;  4GIU A;  1AZY A;  1O17 A;  2J0F A;  3QS8 A;  2WK6 A;  2WK5 A;  1VQU A;  5EY3 A;  5BNE A;  4GTN A;  1OTP A;  4OWM A;  4N8Q A;  4X5D A;  3QR9 A;  1KHD A;  4N93 A;  4EAF A;  3GBR A;  4ZOJ A;  4OWS A;  1ZYK A;  4YYY A;  5BO2 A;  4ZTV A;  1KGZ A;  3R6C A;  4X58 A;  4IJ1 A;  5BYT A;  4MUO A;  4X5E A;  4EAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...