4X5CA

Anthranilate phosphoribosyltransferase variant r193l from mycobacterium tuberculosis with pyrophosphate/prpp and mg2+ bound
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
347
structure length
347
Chain Sequence
b'VPSWPQILGRLTDNRDLARGQAAWAMDQIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPLPADTVPDDAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADTLEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVLREIGVPTVFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGLDELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAAVRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAAIDTGAAEQLLARWVRFGRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anthranilate phosphoribosyltransferase
publication title Structures of Mycobacterium tuberculosis Anthranilate Phosphoribosyltransferase Variants Reveal the Conformational Changes That Facilitate Delivery of the Substrate to the Active Site.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 115
structure length 347
sequence length 347
chains with identical sequence B
ec nomenclature ec 2.4.2.18: Anthranilate phosphoribosyltransferase.
pdb deposition date 2014-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00591 Glycos_transf_3 Glycosyl transferase family, a/b domain
A PF02885 Glycos_trans_3N Glycosyl transferase family, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.970.10 Mainly Alpha Up-down Bundle Transferase, Pyrimidine Nucleoside Phosphorylase; Chain A, domain 3 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C 4x5cA01
3.40.1030.10 Alpha Beta 3-Layer(aba) Sandwich Pyrimidine Nucleoside Phosphorylase; Chain A, domain 2 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain 4x5cA02
4LHMA 2ELCA 4YEKA 3R88A 3QS8A 1O17A 1BRWA 5BO3A 4GA4A 1ZXYA 4HKMA 4X46A 4OWUA 4OWNA 5BYTA 1AZYA 5C7SA 4OWOA 4IJ1A 4ZOFA 3QR9A 4N8QA 1ZYKA 2DSJA 4X59A 3TWPA 2TPTA 1KGZA 1V8GA 3H5QA 4X58A 4OWSA 4MUOA 3QQSA 4EAFA 4GTNA 3R6CA 5C1RA 5BO2A 4YYYA 4M0RA 4OWMA 4EADA 2GVQA 5EY3A 3GBRA 4OWQA 1KHDA 2BPQA 2J0FA 4X5DA 4OWVA 3UU1A 4GA6A 4YI7A 3QSAA 2WK6A 4N5VA 4X5BA 4X5CA 4GA5A 4X5EA 1OTPA 4X5AA 4ZOJA 4ZOKA 1ZVWA 4GKMA 1UOUA 4N93A 2WK5A 1VQUA 5EP8A 5BNEA 5C2LA 4XR5A 4ZTVA 1GXBA 4GIUA
chains in the Genus database with same CATH superfamily
4LHMA 2ELCA 4YEKA 1RRZA 3R88A 3QS8A 1O17A 1BRWA 5BO3A 4GA4A 1ZXYA 4HKMA 4X46A 4OWUA 4OWNA 5BYTA 1AZYA 5C7SA 4OWOA 4IJ1A 4ZOFA 3QR9A 4N8QA 1ZYKA 4F3FC 2DSJA 4X59A 3TWPA 2TPTA 1KGZA 1V8GA 3H5QA 4X58A 4OWSA 4MUOA 3QQSA 4EAFA 4GTNA 3R6CA 5C1RA 5BO2A 4YYYA 4M0RA 4OWMA 4EADA 2GVQA 5EY3A 3GBRA 4OWQA 1KHDA 2BPQA 2J0FA 4X5DA 4OWVA 1RF8B 3UU1A 4GA6A 4YI7A 3QSAA 2WK6A 4N5VA 4X5BA 4X5CA 4GA5A 4X5EA 1OTPA 4X5AA 4ZOJA 4ZOKA 1ZVWA 4GKMA 1UOUA 4N93A 2WK5A 1VQUA 5EP8A 5BNEA 5C2LA 4XR5A 4ZTVA 1GXBA 4GIUA
chains in the Genus database with same CATH topology
4LHMA 2ELCA 4YEKA 3R88A 3QS8A 1O17A 1BRWA 5BO3A 4GA4A 1ZXYA 4HKMA 4X46A 4OWUA 4OWNA 5BYTA 1AZYA 5C7SA 4OWOA 4IJ1A 4ZOFA 3QR9A 4N8QA 1ZYKA 2DSJA 4X59A 3TWPA 2TPTA 1KGZA 1V8GA 3H5QA 4X58A 4OWSA 4MUOA 3QQSA 4EAFA 4GTNA 3R6CA 5C1RA 5BO2A 4YYYA 4M0RA 4OWMA 4EADA 2GVQA 5EY3A 3GBRA 4OWQA 1KHDA 2BPQA 2J0FA 4X5DA 4OWVA 3UU1A 4GA6A 4YI7A 3QSAA 2WK6A 4N5VA 4X5BA 4X5CA 4GA5A 4X5EA 1OTPA 4X5AA 4ZOJA 4ZOKA 1ZVWA 4GKMA 1UOUA 4N93A 2WK5A 1VQUA 5EP8A 5BNEA 5C2LA 4XR5A 4ZTVA 1GXBA 4GIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LHM A;  2ELC A;  4YEK A;  3R88 A;  3QS8 A;  1O17 A;  1BRW A;  5BO3 A;  4GA4 A;  1ZXY A;  4HKM A;  4X46 A;  4OWU A;  4OWN A;  5BYT A;  1AZY A;  5C7S A;  4OWO A;  4IJ1 A;  4ZOF A;  3QR9 A;  4N8Q A;  1ZYK A;  2DSJ A;  4X59 A;  3TWP A;  2TPT A;  1KGZ A;  1V8G A;  3H5Q A;  4X58 A;  4OWS A;  4MUO A;  3QQS A;  4EAF A;  4GTN A;  3R6C A;  5C1R A;  5BO2 A;  4YYY A;  4M0R A;  4OWM A;  4EAD A;  2GVQ A;  5EY3 A;  3GBR A;  4OWQ A;  1KHD A;  2BPQ A;  2J0F A;  4X5D A;  4OWV A;  3UU1 A;  4GA6 A;  4YI7 A;  3QSA A;  2WK6 A;  4N5V A;  4X5B A;  4X5C A;  4GA5 A;  4X5E A;  1OTP A;  4X5A A;  4ZOJ A;  4ZOK A;  1ZVW A;  4GKM A;  1UOU A;  4N93 A;  2WK5 A;  1VQU A;  5EP8 A;  5BNE A;  5C2L A;  4XR5 A;  4ZTV A;  1GXB A;  4GIU A; 
#chains in the Genus database with same CATH topology
 4LHM A;  2ELC A;  4YEK A;  1RRZ A;  3R88 A;  3QS8 A;  1O17 A;  1BRW A;  5BO3 A;  4GA4 A;  1ZXY A;  4HKM A;  4X46 A;  4OWU A;  4OWN A;  5BYT A;  1AZY A;  5C7S A;  4OWO A;  4IJ1 A;  4ZOF A;  3QR9 A;  4N8Q A;  1ZYK A;  4F3F C;  2DSJ A;  4X59 A;  3TWP A;  2TPT A;  1KGZ A;  1V8G A;  3H5Q A;  4X58 A;  4OWS A;  4MUO A;  3QQS A;  4EAF A;  4GTN A;  3R6C A;  5C1R A;  5BO2 A;  4YYY A;  4M0R A;  4OWM A;  4EAD A;  2GVQ A;  5EY3 A;  3GBR A;  4OWQ A;  1KHD A;  2BPQ A;  2J0F A;  4X5D A;  4OWV A;  1RF8 B;  3UU1 A;  4GA6 A;  4YI7 A;  3QSA A;  2WK6 A;  4N5V A;  4X5B A;  4X5C A;  4GA5 A;  4X5E A;  1OTP A;  4X5A A;  4ZOJ A;  4ZOK A;  1ZVW A;  4GKM A;  1UOU A;  4N93 A;  2WK5 A;  1VQU A;  5EP8 A;  5BNE A;  5C2L A;  4XR5 A;  4ZTV A;  1GXB A;  4GIU A; 
#chains in the Genus database with same CATH homology
 4LHM A;  2ELC A;  4YEK A;  3R88 A;  3QS8 A;  1O17 A;  1BRW A;  5BO3 A;  4GA4 A;  1ZXY A;  4HKM A;  4X46 A;  4OWU A;  4OWN A;  5BYT A;  1AZY A;  5C7S A;  4OWO A;  4IJ1 A;  4ZOF A;  3QR9 A;  4N8Q A;  1ZYK A;  2DSJ A;  4X59 A;  3TWP A;  2TPT A;  1KGZ A;  1V8G A;  3H5Q A;  4X58 A;  4OWS A;  4MUO A;  3QQS A;  4EAF A;  4GTN A;  3R6C A;  5C1R A;  5BO2 A;  4YYY A;  4M0R A;  4OWM A;  4EAD A;  2GVQ A;  5EY3 A;  3GBR A;  4OWQ A;  1KHD A;  2BPQ A;  2J0F A;  4X5D A;  4OWV A;  3UU1 A;  4GA6 A;  4YI7 A;  3QSA A;  2WK6 A;  4N5V A;  4X5B A;  4X5C A;  4GA5 A;  4X5E A;  1OTP A;  4X5A A;  4ZOJ A;  4ZOK A;  1ZVW A;  4GKM A;  1UOU A;  4N93 A;  2WK5 A;  1VQU A;  5EP8 A;  5BNE A;  5C2L A;  4XR5 A;  4ZTV A;  1GXB A;  4GIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...