4X60A

Crystal structure of prmt5:mep50 with epz015666 and sinefungin
Total Genus 203
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
203
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 203
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4x60A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4x60A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4x60A02
4NECA 2OKCA 5DTRA 4GJIA 5FTWA 4E2YA 4YTUA 1EJ6A 1SG9A 3VNIA 4RTMA 3ERCA 4QQNA 4X61A 2QRVB 4M7RA 1CLKA 1XLGA 2HK1A 3M0MA 1EQAA 2VDUE 3G8BA 3GRYA 3HCEA 1XLBA 1NE2A 2XINA 3BGDA 4C4AA 3DMHA 5GM1A 3T7TA 4EQZA 2PX5A 2UYHA 5XIAA 3OZSA 1BXCA 4QEEA 3EVCA 2FK8A 2YTZA 4E32A 4AUKA 3R0QA 1VLMA 5XINA 2P7IA 3UZUA 8XIAA 2AN3A 4E31A 2P35A 3HP7A 1L3IA 4R6WA 1S5NA 1H1DA 1KPHA 5JR3A 2PX2A 1WY7A 3MCZA 4PYLA 2E5WA 2YXDA 4EK9A 2VP3A 5IKMA 2ERCA 3HEMA 2G1PA 4FGZA 3FRHA 4DZRA 3NMUF 4KW7A 1JR4A 3GRRA 1ZHFA 2BM8A 4PGHA 2NQJA 5CM2Z 5DM4A 5GWXA 4HNOA 1XIIA 3JU2A 2GLUA 3TM4A 4PGLA 2HWKA 3DR5A 3FUWA 4QEHA 2BM9A 2PT9A 3G2PA 3QOXA 4MQ4A 4XIAA 1QYRA 1XTPA 3BZBA 3FZGA 2F8LA 1NW3A 5FWAA 1XCLA 2ZW9A 3CGGA 1KP9A 4FZVA 4X1OA 3DOUA 3GCZA 3UFBA 1NBHA 2H1RA 1XIBA 2B9EA 4XUDA 1B42A 5E9QA 4YUVA 3K6RA 3MB5A 4PFHA 3JWGA 5FHQA 3IYLW 3G89A 5EMLA 3VNLA 1QAQA 2AN5A 5ICCA 3LCUA 5XIMA 4ER5A 1P91A 4OBWA 4RTRA 5P8WA 3LL7A 3LBYA 4EKIA 1DIEA 2YX1A 4P58A 3RW9A 2OB1A 2PX8A 1XDZA 5FCDA 1JTFA 2GUBA 4AZSA 2J6VA 2PWPA 3KR0A 3VNKA 1JQEA 5EKXA 2ONZA 2HTEA 3G7UA 2AVNA 4CKCA 4HHMA 3ITOA 1ZGAA 3KBWA 2ZTHA 2GAFA 4X41A 2ZWAA 5DTQA 3EVBA 4HTFB 3BDKA 1XLAA 3LKZA 3DBNA 1EJ0A 3I64A 3KPWA 4PWYA 3VYWA 3IUDA 1FPQA 4FSXA 2P7HA 1XICA 3LMZA 5K0LA 4HC4A 4LNCA 5LQKA 1RI3A 1JTEA 3JWJA 2ZLBA 1XYCA 3HA7A 1XVAA 5DSXA 4AZTA 1UIRA 3KQOA 3BWMA 2FK7A 1XYAA 3UXIA 2PY6A 5CVJA 2OYRA 4A8RA 4FT4A 2PJDA 3SVZA 3TKYA 4DF3A 5LQAA 5HIKA 4YTRA 5C1IA 1IM8A 4YUXA 1A0DA 3ITXA 1QT1A 5DSTA 3CQJA 2AOTA 3CJQA 4IWNA 5K0JA 1G38A 1XLFA 5EKUA 4MWZA 1KIAA 3LGAA 3FPJA 1NBIA 3NVKI 3ITLA 2XVMA 3T7SA 3FTFA 4QE1A 1YZ3A 3AYVA 3JWHA 2FRXA 1I60A 1XCJA 2BR3A 3M6UA 3ORHA 3UU0A 1KYWA 4ER7A 5DT2A 5BXYA 5K09A 2C7OA 2Y1WA 1GW9A 1F38A 4BLUA 3NVMB 4EVIA 2XYVA 3B3JA 3R9XB 3BZJA 3A26A 1KPGA 3KBVA 9XIAA 2PXCA 1XIGA 4RVDA 4RTNA 2AOUB 2P3OA 2VDVE 3LHDA 5K0BA 2I62A 3DXXA 3TPZA 4HH4A 1R18A 2ZDSA 3M70A 3PLAE 4PYQA 4YMGA 1AQJA 5K0NA 4QDKA 2I57A 3C3YA 1RI1A 3LSTA 4PYMA 5EMKA 4LWOA 3FUTA 4CWAA 3FPEA 5K0FA 5HFJA 3THRA 1XYBA 1P39A 1DIDA 4BP3A 4OX9Y 5ICEA 1ZG3A 1M6EX 1JSZA 5DM1A 1D2CA 2GPYA 3P6LA 4K1GA 1MUWA 3HA3A 3MQ2A 4AZWA 4HRAA 3SR4A 5EZSA 5FULA 4QVGA 4E2ZA 1AF7A 4XUCA 1XLLA 8MHTA 4WVLA 3UJ9A 3IUIA 3FUVA 3I53A 1YB2A 2NXNA 2QUMA 5HIJA 4GF5A 2XYRA 5GIOE 5FQOA 3BXOA 5E1MA 3BANA 2ONYA 4QTTB 2C7PA 2JH9A 2NXJA 9XIMA 2VS1A 3VNMA 4KVZA 4EKGA 1JSXA 1YFLA 4XSLA 4E70A 3I5UA 1FJXA 2IBSA 1EIZA 3AY0A 3KBJA 5B7YA 3KCLA 1WG8A 3KQQA 5FUBA 3GXOA 3M4XA 6XIMA 1G8SA 1O54A 3PX3A 4QTUB 4A6EA 4X60A 3KCOA 3G2OA 5BW5A 2P40A 5K0CA 3ID6C 3R24A 5E2AA 4GOOD 3HCCA 3EEOA 3KKZA 2QM3A 3AALA 2JHPA 2I56A 2CMHA 5KQSA 4CKBA 1VP9A 2WA1A 2EG5A 3ELWA 4JXJA 3M0LA 3DTNA 5M5BA 3LDUA 3E23A 4RTSA 3IUHA 2WA2A 2AVDA 3V97A 1Q0SA 4ER6A 2B78A 3HCAA 4OVXA 1NKVA 3VYLA 1I1NA 4ISCA 7XIMA 1TZ9A 3KCJA 1O1HA 2H00A 3P8ZA 4Q7IA 3FTEA 2AOWA 1OR8A 2BR4A 4XKMA 3KPUA 5C9ZA 4QE5A 3OBEA 3EMBA 5B1SA 4GEKA 3LBFA 3TRKA 6XIAA 1D2HA 2KW5A 3IV6A 3OE5A 4GC5A 1YFJA 2Z6AA 4HGXA 1BKYA 1NT2A 1HNNA 1L3BA 4E33A 3S68A 3BUSA 1KHHA 3EGIA 5EC8A 1NV8A 3KWSA 3X0DA 1XLHA 3EVFA 1XLCA 2AS0A 3CKKA 4YUWA 4BY9E 3P2IA 2ZVJA 3OFJA 5CIYA 2IH4A 2ZULA 2I6GA 5HOQA 5DPMA 1NV9A 5DM2A 1XLKA 5C0OE 4LG1A 3G2QA 2P1DA 4U7TB 2Z6QA 3U3HA 3NW9A 2IIPA 4ZBCA 3GRUA 3M0HA 3XISA 1JG2A 2YXEA 3KQVA 4PYIA 4C03A 3ER8A 5ICFA 4C07A 3CJRA 3E8SA 2OY0A 3SMQA 2PX4A 3FTDA 2B25A 3CCFA 1X1CA 3OPNA 3MGGA 5GP1A 3KQMA 5CVUA 3LDFA 5FHRA 4HHLA 3CBGA 4PIPA 5EMMA 2BZGA 4LWPA 3HCBA 3NWBA 2GH1A 3PS9A 3SXJA 4K3ZA 5K03A 5GIPE 3TM5A 4PNEA 1ZQ9A 2PWYA 3IEIA 4PYKA 4DMGA 2VDWA 5CVEA 5K01A 3P71T 2GLKA 2ZZNA 3P9IA 3VSEA 4R6XA 4ZB5A 4C08A 4YTTA 3BKXA 5EPEA 5K8VA 2IDKA 3FTCA 2YVLA 3ME5A 1SQGA 1YX1A 1XDSA 1X1AA 3KR1A 4KDRA 3N4AA 5D1NA 5F2KA 1P1BA 5K0GA 3UBTA 3A25A 3CVOA 4YTSA 1RI2A 1T43A 3Q7EA 1U2ZA 3NDIA 5DWQA 4AZVA 3MERA 1YUBA 4HGZA 3R6TA 3NGFA 5EG5A 3KBSA 3A4TA 4R8RA 3REOA 1G55A 3CJTA 3QYSA 5U4XA 4Y2HA 1VQ1A 5GINE 2FYTA 4M36A 5B80A 2YQZA 2JH8A 3GGDA 3SSNA 3NDJA 3U0HA 1R00A 2FCAA 1RJGA 2V7EA 5CCXA 4V0RA 5HILA 5T6BA 2O05A 5CVVA 2OB2A 1NW7A 3OE4A 4BP1A 3SX0A 8XIMA 4FP9A 3WSTA 5DTMA 2CMGA 2N47A 2WK1A 3QV2A 3TQSA 2IDJA 2R6ZA 2OZVA 3CNYA 1RJDA 2PSSA 4HG2A 2BR5A 3MAGA 1DE6A 4OBXA 4DQ0A 2LD4A 3AXTA 3EVGA 3KPYA 2BH2A 1XIDA 2JJQA 1XIJA 3WQOA 1SUIA 3NWEA 4M38A 4O29A 1QAOA 4IV8A 4F86A 1YZHA 3C3PA 5EEHA 5HIIA 4PGGA 1VE3A 1WXXA 2NXEA 3K0BA 2H11A 3KQPA 3NJRA 3TKAA 2AR0A 3QZAA 3R3HA 5FA8A 4R05A 3I9FA 5BW4A 5CCBA 2G4JA 3P14A 1EG2A 2IBTA 4YMHA 4XUEA 4RVGA 2ZVRA 2P8JA 4GOMD 3DLIA 4ATNA 3AAMA 2NP6A 2OU4A 3DMGA 3DUWA 1BXBA 1RI5A 5DM0A 3TMAA 3BWCA 1RJFA 3PTAA 4RTOA 2EJUA 2NNWB 5EMJA 3BZGA 1WZNA 3CWHA 2AOUA 2HNKA 3B5IA 1NW5A 3BWYA 3FPHA 2QW5A 5B7ZA 1VP3A 1P1CA 1ZKDA 3DH0A 3ELDA 3OU6A 3AYTA 2DULA 3HVKA 4GOND 4YUZA 2V74B 3UA4A 1Y8CA 2AZTA 10MHA 3HVIA 3V8VA 3GIWA 3A7EA 2EFJA 1QZZA 3BGIA 5LQNA 1DE5A 4QDJA 3KQYA 3UJBA 5LSAA 4YV2A 4KRGA 4RVFA 1G6Q1 2HMYB 3M6VA 5EHGA 3RODA 4DUOA 3M0VA 2AOTB 1JQDA 3E7PA 5D1HA 4GC9A 2O57A 5E9JA 1WS6A 3GWZA 3DP7A 5KS2A 1I4WA 2G72A 4QQKA 3ANXA 2PVCA 2P3LA 2UZ4A 1VIDA 4LECA 3C6KA 5EIFA 3BKWA 2AN4A 3P9KA 4GLEA 1NW6A 2IFTA 4P7KA 4UOEA 3BGVA 3KBMA 1VL5A 3SSMA 4KIFA 4A8IA 2PLWA 2UYQA 4PONA 1RJEA 2IGTA 1XJ5A 4IKPA 2JHCA 3UJDA 3TOSA 2B2CA 3LX6A 3I58A 4C05A 5I7GA 2G8NA 4XCXA 3KHKA 5E9WA 2XVAA 2XIMA 3M0YA 1SUSA 3DX5A 2IP2A 2P41A 3PT9A 1Q0TA 4Y30A 1MJFA 3KBNA 5BP7A 2HV9A 1KR5A 2QRVA 3AWIA 2G71A 4ZB0A 4GBED 4PCAA 2DPMA 1DUSA 2ZZMA 2EJTA 2GVEA 4RTLA 1DL5A 4A8NA 3PB3A 3DMFA 4OA5A 1FP1D 2X7WA 3OZTA 5E1OA 4QVKA 5G02A 2IPXA 3KQSA 4CKEA 5E1DA 4OQEA 5DX8A 3O4FA 1KXZA 1DXIA 5HZMA 2GA9A 3HM2A 3O31A 2ZBQA 4OA8A 3DULA 3UJ6A 5AVHA 1IXKA 3HA5A 3C0QA 3KU1A 4RYLA 1IY9A 3TVAA 4MTLA 4RWZA 5EEGA 3IHTA 2QE6A 3SSOA 4RTQA 5LR6A 1XLDA 1BC5A 1N7IA 2G70A 3HCFA 3M33A 3MTEA 3PFGA 1X1BA 4R8SA 5KVAA 1SKMA 1X19A 4OQDA 4KW2A 3CQHA 4A8LA 1JG3A 3BWBA 5CUQA 3LDGA 4EMSA 3LKDA 4C04A 1SQFA 4G56A 1JQ3A 1BOOA 4YV1A 2VZ9A 2ZCJA 1AV6A 3VC1A 3GRVA 5FQNA 1XXLA 2Y1XA 3M6XA 3OFKA 3JWIA 4KIGA 3ITTA 4KWCA 1R74A 3SGLA 4POOA 3LECA 4XISA 1A0EA 1BHJA 3T7RA 1KPIA 3MCTA 3PX2A 3ELYA 1K77A 1L3CA 1D8WA 1ORIA 1FP2A 2QYOA 5HIMA 4C06A 1M6YA 3EGEA 3THSA 3UJAA 2X7VA 3EVZA 4K6MA 4PYJA 3HTXA 3B3FA 3CC8A 3DLCA 3ELUA 3KPVA 3KR2A 4E30A 5F2NA 3G88A 3ITVA 4ZB2A 3ITYA 4CXMA 2UYCA 1SVUA 5HEKA 5ERGB 4BLVA 2JG3A 1M0EA 3D2LA 5DXJA 1XLEA 3NTVA 4F85A 4QDPA 2IH5A 1XINA 3H2BA 1XISA 1PJZA 3FPFA 2ORED 5LQUA 3OCJA 4A6DA 1XYMA 1XLMA 5CD1A 1TW2A 4DA4A 2HR1A 1DCTA 1Z3CA 2OO3A 3GU3A 2Q02A 4U7PB 4HTFA 2YXLA 2YUIA 3UWPA 1QANA 5LQRA 3M0XA 1WXWA 2PXAA 4PYNA 3EVAA 3VNJA 2K4MA 4US6A 1XYLA 4EACA 2ZSUA 1XIHA 5FA5A 2O0LA 1XIEA 4L7VA 3SM3A 2NQ9A 2Z6UA 1XIMA 2FPOA 5E2BA 4DCMA 2GYIA 4EAYA 1QAMA 2O06A 4CTJA 3EVEA 4MHTA 2NQHA 4FSDA 5ICGA 4P7JA 3B3GA 2OXTA 4WXHA 5MHTA 5DXAA 2ZFUA 2ZIEA 1FBNA 2QY6A 5DRTA 4RTJA 5DX0A 2CL5A 3HVJA 5TNVA 2CKDA 2ESRA 3KQTA 5K0EA 3TFWA 4IV0A 5DRYA 3EGVA 3OU7A 5GOZA 1TPYA 5T67A 2CWWA 4H0NA 4KDCA 3QC0A 3FVMA 5H6HA 5EGSA 1PRYA 1O9GA 1MNZA 3AJDA 1NW8A 3EPPA 2PKWA 1QTWA 3OU2A 1O9HA 4DVOA 2JHAA 3P9CA 3HNRA 3XIMA 1QUMA 5AVNA 4XSMA 3GDHA 3BT7A 5J8LA 3O7WA 3UA3A 3KTCA 5GM2A 5KQRA 2QULA 4PCLA 4YTQA 3P2KA 5EIWA 1RI4A 5E8RA 3FYCA 4J4KA 1N2XA 2P3QA 3TC3A 3F4KA 2C7QA 5DX1A 3LCCA 3UJ8A 4DKJA 3FUUA 5H1WA 4RTKA 1I9GA 1D2GA 2ZIGA 1ORHA 1AQIA 3G5LA 5LQCA 3DXZA 4RV9A 4QPNA 1UFKA 3QOWA 3VC2A 3A27A 3GO4A 3DXYA 5FADA 3C6MA 3RIEA 2NXCA 2PT6A 5EOVA 3EVDA 5JUWA 2ZWVA 3ER9A 3XINA 2ZBRA 3EEYA 3PVCA 4HGYA 2AOXA 4RTPA 4RSRA 4Z2YA 4GUAA 4FR0A 2I7CA 3GRZA 3M6WA 4GQBA 1V39A 1L9KA 4P7GA 2B3TA 3TLJA 1OADA 1MHTA 2I9KA 1A0CA 1G8AA 2XISA 4B17A 4M37A 1L1EA 3GNLA 3FUXA 3UVAA 3C0SA 2GS9A 4P7FA 3UJCA 3Q87B 2R3SA 4ER0A 1N7JA 2OPBA 5EHIA 3B7PA 3G8AA 3U81A 7MHTA 1XDUA 2UYOA 4V0QA 4PIMA 1INLA 4YV0A 3KPJA 5K05A 4QPPA 2C7RA 3EMDA 4XIMA 3C0LA 2ZZKA 5KYGA 2XYQA 3QXBA 1UWVA 5EZQA 3L23A 4W4QA 3B89A 3FRIA 9MHTA 1VPTA 3MHTA 4F84A 3HVHA 3L8DA 4BLWA 4X63A 5CVDA 5E1BA 5IH3A 3T0IA 4AX8A 5F2OA 2ADMA 4FT2A 2QUNA 1F3LA 1XLJA 1HMYA 3FPGA 1JG1A 3OZRA 4MIKA 4QDWA 3LCVB 4PYOA 5H02A 2NP7A 2FHPA 2HK0A 5LQJA 4PINA 3PFHA 3FYDA 5T64A 3CQIA 1I6NA 5FWDA 1R6AA 3A7DA 4E2XA 2O07A 1R8YA 2YR0A 4YUYA 1XIFA 2IH2A 2OBFA 5E8JA 3AXSA 3G5TA 4E2WA 3CQKA 2GB4A 4CTKA 4DM3A 4HSGA 1VBFA 2NYUA 2PXXA 4ZTBA 3UJ7A 3P9NA 1YF3A 2A14A 3G2MA 3KQWA 2Q41A 4FS8A 2G0WA 1JG4A 1XP3A 1EAMA 1S5MA 3LPMA 4RVHA 3E05A 5DLYA 2PV0A 3KR9A 3MTIA 4RX1A 4GOLD 3C0KA 5EQJB 2PBFA 3P2EA 2ZBPA 1X1DA 1KYZA 3HCDA 2PGXA 2ZIFA 4E3VA 5EVJA 1TW3A 4QE4A 2EX4A 3GNXA 1ZGJA 3GJYA 1R8XA 3TR6A 1XLIA 4GJJA 2AOVA 4ER3A 3P97A 2XBMA 1G60A 3BWWA 4DCGA 2HCVA
chains in the Genus database with same CATH superfamily
3WLQA 1QONA 4FKMA 1RLCL 2FDCA 3NM4A 2XADA 5EBAA 4GM1A 2C13A 3GRYA 4GI1A 2W66A 4P36A 4W86A 1JKJB 4C6LA 1OV6A 3FLMA 3LO8A 3UZUA 3PQ4A 1O08A 1H1TA 5AJTA 3W77A 4R6WA 1V4NA 2FJUA 4A3RA 5MKGA 2X0RA 2BN4A 3AQ4A 1Y82A 3O16A 3IJ6A 1ZHOA 1R85A 2B1IA 2Q07A 4RGQA 1OAAA 1WUKS 4B32A 4F4RA 3EB3A 1T3ZA 2AAAA 1Q17A 3GRAA 3OQBA 3FOZA 3ACBA 1JQEA 3D6HA 4NAEA 2VNIA 3PPVA 4Q5IA 3DBNA 1E2UA 1UHVA 1IPFA 5G0SA 4QUIA 1QHYA 1G38A 5SYAA 1ONPA 3S2IA 2G37A 4DWSB 2C7OA 4BMSA 4HN9A 4PPQA 1HWYA 1I10A 3GRKA 2QMQA 3UG4A 4KG7A 4G7EA 4AWTA 2ZRCA 2VDOB 3ZJVA 2D5AA 4OX9Y 1OASA 1OINA 2NU6A 3TSDA 1PTJA 1QP8A 2YCKX 5IKXA 1C0KA 4AZ7A 3SCNA 4CG2A 2Z1BA 2ZI6A 3BA1A 3FSTA 4WY0B 4D4MA 2E9MA 3GXOA 4HN4B 1B2LA 3DTYA 5D87A 2P50A 2XIIA 4GVFA 1WZUA 4FHDA 1ZBVA 2DEPA 1SO5A 1GQQA 4JZKA 5ILOA 1ZH2A 2NN3C 4Y6RA 3KPUA 1W29A 4ZK2A 1D2HA 3BW2A 3GAFA 3VGGA 4CLEA 2CLKB 1GVNB 1DRKA 2QOEA 2YL6A 3EPHA 3JQ8A 2E1DA 5BSFA 1FDIA 1A9XB 2ZWYA 1Q1GA 2VP5A 1DCKA 5JS2A 3QMRA 1A9XA 3SDSA 2RDXA 4QELA 4AKSA 3BGWA 3FXYA 3W5HA 3LK7A 3QLJA 3PY2A 1FP4B 5H80A 3RW9A 5JDIA 3C41J 2OESA 3M6MD 1E72M 4FBGA 5IKOA 2E09A 2GI4A 2ZIVB 1TM2A 3RU8X 5AC6A 4NCAA 3ONBA 1ZBDA 2G3NA 1OX4B 1V4VA 1TMGE 1YZVA 5CH5A 1TTHA 3AIUA 1UOEA 5C8YB 1RJDA 1VB5A 1RD4A 2QN1A 1JIQA 3RADC 4C5CA 3PV0A 4XUEA 3BWEA 1M75A 4UFMA 2F3QA 3BWCA 3WZ0E 5T57A 4Q05A 4QYIB 4QYWA 3R40A 1ZINA 4P93A 4J3TA 3L0DA 5DELA 3BGIA 3IDAA 4QDJA 1EB9A 2X41A 2AOTB 2F55A 3I6MA 4AU0A 4G5RA 1QRAA 4TVUA 1GPNA 5BQ5A 3WDJA 2HPMA 2G5GX 2I78A 2XDWA 4ROQA 5GVRA 2VUIB 4RVSA 4UATA 3WDLA 4LKOA 5KHAA 2HYIC 1JPIA 2ECOA 3WIJA 4EUHA 5AHEA 5F1VA 2X7WA 1E6PA 3RGWS 2VEIA 4OWGA 5C8BB 3J7TA 4B4KA 4K40A 2M98A 3MTEA 1UBMS 1VE9A 4ZZ0A 4D8AA 3GOHA 4Y0NA 4CKYA 4OQQA 5KZ6A 3BE8A 2AV6A 5FLXA 4A0QA 2QNRA 1L3CA 5L7YA 3W8EA 621PA 3RU6A 2ICSA 4JLKA 1E2LA 2I54A 4OGGA 1LL4A 1SVUA 2W9XA 3DOOA 4KSBA 5J4KA 3I3SR 3PJUA 2V6GA 4B4WA 2H1OA 2D0GA 4U7PB 4JYAB 3FVTA 1PL9A 1C7QA 4I90A 2ZRLA 1Z4QA 1US8B 4LCJA 1TCCA 1XYYA 3EDYA 2ZRWA 3D6FA 3P5YA 5DCUA 4NYMR 3CZLA 5IXJA 3ZDCA 3S42A 1XFBA 4JYDA 2R5WA 3WDKA 2YNMA 4REQB 5ALRA 1P5BA 5EIWA 2GBIA 1MB3A 3FUUA 1B0PA 4NE7A 1FCUA 4O15A 4Q8QA 2J59A 2EG7A 2FFIA 3OLYA 4QM6A 5BYKA 2BFEB 4F3TA 3E9RA 2OKGA 3UAVA 2FMOA 2PKQO 4C9BA 3UWMA 3AW8A 3HFJA 4EHNA 1ZI8A 3R3ZA 1U3FA 2ZZKA 1UJBA 4EW6A 3TFQA 1IATA 4X63A 1F3TA 5CVDA 4QJ4A 1P7TA 4RV5A 1L4MA 1CV2A 1X87A 4RPIA 1VGQA 3SLKA 5E8JA 2F6KA 3OHMA 5GOTA 1H85A 3G68A 3FMFA 4KR0A 4XYBA 1QF6A 1OG0A 1VBKA 1EP1B 4UCQA 4F97A 4ENRA 1F6BA 4DC0A 2V2CA 4G7FA 4PULA 4OHUA 1CENA 4HNTA 3ZGNA 1V1RA 2PTXA 3PJDA 4FE4A 1H8HA 1S8AA 4XQ9A 2UDPA 3NR2A 1L2TA 4E4TA 1WD7A 4GXWA 3N28A 2H0QA 1JXJA 4GG9A 1W8DA 1DLIA 5KMGA 5EJ4A 3EA1A 1W75A 4FI4A 4CDNA 4RW3A 1K7EB 4J2PA 4WMLA 1XB2A 2Z8ZA 2IOFK 4O08A 5J2UF 1P3JA 1ENYA 1IWOA 1R0KA 4GSLA 5KVVA 2SCUB 2ZREA 2AXQA 2I16A 4G1NA 3O9ZA 2Z43A 2BDUA 4YJFB 5AYXA 5CXUA 3NQ7A 1N6RA 5ALTA 3C1TA 2D54A 3DKLA 3HQPA 4DIUA 4AS2A 5K4HA 1Y8ZA 4QG3A 3UF0A 5A4MS 3F6SA 2DHEA 3RMJA 1UJ6A 4O25A 3C6XA 1FMFA 4EF4A 5EY5A 1U1FA 2PK3A 1M41A 4XKYA 3NAZA 4RE0A 1O7AA 1M03A 3W9SA 2GM4A 5K0BA 5I7VA 3R79A 1NSJA 3DOJA 3IRSA 3D5QA 3GPIA 3THRA 2ACKA 2Q0SA 4PXAA 1JSZA 3N9RA 4C4OA 721PA 2X2OA 3RDPA 4JP3A 4WK6A 1CR4A 3H1BA 3ORFA 2V59A 4E70A 5MGNA 1A4UA 2BY1A 1ZP4A 2HOQA 2O23A 1TE1A 1OF6A 3W5CA 4ACZA 4BMZA 1E3ZA 3P74A 1VP9A 5LIXX 3EPRA 4KIJA 3N39C 4F8EA 1FFEA 1UBCA 3GD6A 4GEKA 1P73A 5IAKA 3WGJA 1H4SA 5D6NA 4YL2A 5CX1A 4EW2A 3A9TA 1CB2A 5K8IA 4IDEA 2O5RA 2Z1SA 1UMDA 2QM8A 3RG6A 1B2RA 2WIBA 5D8WA 4K9NA 2AGVA 1E1CB 2PWYA 2IXGA 1Q22A 2W2NA 1YOBA 1JKMA 1SCNE 2WTEA 3LY5A 3ANVA 2HO5A 2D00A 2WUVA 4LX8A 2Y88A 4WGHA 3RFAA 3X1DA 1WXZA 2I7XA 2DSZA 3DZJA 2IKSA 3L8HA 3CN9A 5DO8A 4DUGA 4XZ9A 2R25B 1Y9JA 2YMMA 2XXAA 2ODBA 4KXWA 4L56A 5EWLA 1OXXK 1KC1A 4YJGA 2G08A 1V7CA 3OO1A 5AW4A 1TKKA 2XUIA 1WKCA 2Q28A 1RC8A 2G3JA 3P0FA 5FA8A 2ZA3A 4GUFA 1CJBA 1HFJA 1QCCA 2XUPA 3CWHA 1T6YA 1XGKA 3TN7A 2CLMA 1OK4A 2VF5X 2D5BA 2R751 2IQ5A 3ZGLA 3V8VA 2YXNA 3KQYA 5BSEA 1X14A 3S83A 4GI5A 1DAGA 2DGAA 1XQWA 4INJA 4CM3A 3UHFA 3HNPA 4AHOA 4DDWA 4O2BB 4S3JA 4NE2A 3R74A 3NONA 4HVTA 4I1PA 4CLRA 3LY9A 5TT1A 2XIMA 3VUEA 4GW3A 4HPJB 3T9BA 4N7JA 3MJFA 2XWEA 1ODZA 1G20E 5JBFA 3N11A 4Z8XA 3I6RA 1GU7A 4W93A 5L3RA 3PDUA 2Q3HA 3K0HA 4JVMA 2ZCJA 5A8QA 1KVRA 4JEUA 4XISA 3TZNA 2CXSA 5CIWA 5HZHA 4JP1A 4NI3A 4J3ZA 3LUGA 2PTYA 3MI2A 1QTIA 1F8YA 4RCVA 3D6MA 2C8VA 2VEKA 1SVNA 4Y9NA 2JI4A 4AWUA 1BHSA 5I8PA 3U0BA 4F4JA 4KXNA 3EVNA 4AZCA 5HBFA 3I45A 3MMUA 3CRQA 3M9LA 4ZENA 1QTWA 5AI9A 1EGVA 3KLPX 5D86A 3NTLA 4NV1A 1WW8A 3GW8A 3B1XA 1X1EA 1XVUA 3RUBL 3VH2A 1NY6A 2IYXA 1ICQA 4ZAXA 3IOBA 5IMSA 2GPTA 1OI7A 4ETNA 3ZSSA 2WJZB 3OPSA 5F1UA 2OZKA 5IUKC 5A02A 2CFRA 4U6NA 4QD3A 3TSAA 3IDOA 4MWAB 3H9JA 2H90A 3L7JA 1W1WA 3N12A 1MW3A 1UBNA 3FUXA 1XW8A 3IA2A 1NJGA 3BMOA 5K05A 4M4SA 4S3CA 1U04A 3ICVA 4UTTA 4WR3A 3MTJA 3H4GA 4KFUA 1TMLA 3MLBA 3A14A 4Q22A 3OZRA 2PQ0A 4QAIA 2YJNA 3NHUA 1AFSA 4RZ2A 2R8WA 1JR3A 2Q1WA 4Y1EA 2OODA 4D02A 2OOFA 4YCSA 2G80A 2CDCA 3CLMA 1P4AA 3FCAA 4ZR8A 3BMWA 6ADHA 1HH4A 5HFAA 4QG8A 4UEQA 4B48A 3TR2A 3O2LA 4D8LA 2AI1A 1LJLA 5K9ZA 2DWQA 2CHUA 4GIAA 4XBSA 1GGKA 1EP9A 4DZHA 4JI2B 1XEXB 3FPCA 4HQNA 2CSXA 2GJXA 3IKJA 2PCLA 2JCYA 5XIAA 3H4VA 4KWTA 3OPYA 3HKCB 1GORA 3DVSX 4ENLA 2HNBA 5CC3A 1E3DA 2QTVB 3H6OA 3PHLA 5IX8A 2HMVA 3WQ5A 2NWRA 4NBNA 3EKLA 2NX1A 2B9EA 4KR3A 1QHNA 3K6RA 1CGVA 4NNJA 3LRMA 2ABWA 2B8WA 3H0KA 4UARA 2GUBA 4BLQA 2CNLA 5DI3A 4DG8A 3N53A 2Y1KA 4M7TA 1T1EA 2DUZA 3FFTA 3OQHA 3WNKA 2VVTA 4MKRA 6AT1A 2H8GA 1RD5A 2JEZA 3HE3A 1FFGA 2AIRA 1XU7A 4IQLA 3ITLA 4TPKA 5ECUA 2FFCA 1A98A 3DCIA 1F38A 4OREX 3MMXA 5KYKA 1H66A 4H7FA 2HVMA 2ISSD 2P3OA 1M8JA 3C7TA 4Q48A 1EGHA 4EWLA 1UDWA 1V9CA 4DOMA 3GGOA 3GEGA 1H2XA 2VJPA 5JXWA 3J7AC 2YBVA 3AUAA 3LBMA 2FZ8A 4XYMA 3FCUB 5B2EA 1ZA1A 1NI3A 2I8CA 3KOWA 3LHFA 3Q0TA 2P40A 3HUFA 1K8ZB 2XA9A 3RJYA 5KITA 3M81A 1EX5A 5KQSA 3EZGA 1S2AA 3ED5A 3W7IA 3IBCA 4L0CA 3ECSA 3P8ZA 1J0YA 1ZD9A 5CAHA 1UD8A 3CZJA 3WGHA 5LMCA 4UTFA 4GQQA 1N7GA 2NVDA 1GQRA 1ISHA 1KSHA 2VHTA 1KERA 1LV7A 1NPDA 4Z1MA 2UUAB 4RK6A 2HBRA 5BN5B 4MP6A 4OLHA 3GDFA 2DR0A 2H07A 3LQ2A 3D43A 1AK1A 1D9ZA 2Y9MB 2PLNA 4J4TA 2HROA 1ZQ1A 4PO3X 2H7CA 5LWHA 5BCAA 2DKNA 1FA2A 4HYEA 1ZGBA 2OJPA 2ONEA 3LNPA 4MZ1A 4AXBA 3TEVA 3WK5A 3BFJA 1AMUA 3BJSA 1T41A 4TN5A 1NYRA 5AJHA 1TYZA 1BKSB 2GN1A 1X7FA 3OQPA 6CHYA 4HPXB 2FPPA 3OHMB 3BFXA 5T4FA 2ZVRA 4URUR 2A85A 2BEUA 4J6EA 5JH1A 3OEHA 2IIQA 4LJ5A 5K20A 4WH0A 4IIJF 1JHUA 3OTQA 4EY5A 4WDXA 2HE8A 3HG7A 1ADSA 3I83A 1K70A 1BXZA 3K09A 3GMSA 1MC5A 1KCXA 3WF4A 1OTHA 2EFHB 4NBWA 3A0RB 2AN4A 2X2PA 1DIRA 2CKSA 3SSMA 5MDHA 2V63A 1J2RA 2O19A 4DR6B 3ID7A 1E1LA 2OWDA 2XW6A 4P8RA 1IF2A 1RC1A 4B7AA 3M0YA 1XXXA 4RE2A 3RS4A 5LOVF 4D97A 5L4SA 3RANA 4KEUA 1IR2A 1G291 5E7IA 3ZU5A 5E1OA 4D8XA 1RVDA 3NALA 4B87A 3C3DA 3OCYA 4CHGA 2ANBA 1DJNA 1GKUB 4MVJH 1WHSA 2G70A 1ZJYA 3WH8A 3BVJA 1XEWX 4WKHA 1FSSA 4ADSG 1WB4A 3DDWA 2E48A 3CU5A 4URHA 4GMFA 4WRHA 3M4NA 2WG2A 4MAMA 4MW6A 3GG0A 2X2GA 2VIIA 2WWTA 3HCOA 4KXUA 4YRFA 3BS4A 4IDAA 1NUSA 4TUYA 1W2PA 4BQEA 4NU8X 3HNOA 4PYNA 5DXFA 3BG3A 3WP0A 3WTBA 4PVCA 5C6MA 2E4XA 2C82A 1VJDA 3OPQA 2R8RA 1T6XA 3A6PC 1XU9A 5BRAA 4MUZA 5JNUA 1YRYE 3OX4A 4CCCA 4CEHB 3TNOA 4ZARA 1D0SA 3CRVA 1JAKA 1QI2A 4YMIA 4NRRA 3Q6MA 5JMTA 4Q4SA 3IAEA 1W5PA 3E9QA 3HPQA 2C5FA 2JZNA 1DCMA 1THFD 4L4XA 2ASVA 1UIOA 5BOVA 3A31A 3QXBA 3HVHA 3GXDA 2XPCA 4IILA 2QUNA 3GJ0A 1W48A 2RCNA 3HH8A 4TYNA 4MR7B 4PRWA 2QDGA 3OZDA 1ZX1A 2ALDA 4EBBA 1KZYC 2PCEA 2JDIA 4OXRA 3C0KA 1JAYA 1CFZA 2JD2A 4YLEA 1CJMA 3ZZTA 1ZEMA 1RQLA 2Q29A 4UUIA 3N8KA 3AM1A 4IXHA 3ETHA 2VCBA 3H6KA 221PA 4TV8B 4FM9A 1FWAC 1N8KA 5ESRA 5IM4A 1TCVA 2CUKA 4J16A 1YZTA 2BF4A 4TVKA 4I9FA 4JJ8A 1SURA 4FCWA 4CNOA 3W7GA 1J5SA 2MSNA 3GDRA 3JU2A 4GXTA 5JJKA 3BOXA 1L7NA 4X1OA 1S2LA 5TQ0A 1NLZA 2H1RA 4GYYA 1YKFA 5M29A 3LCGA 3H2IA 8ADHA 3BCDA 1N2CE 4R9RA 4GVIA 4KLAA 1BRTA 4LDJA 1ZUD1 4WCVA 1P7ZA 4X7PA 1JJAA 3G7UA 5IS2A 5DTQA 3WGZA 4QUEA 3ZH2A 2D73A 3U4CA 1P43A 3QTPA 1JKIA 1RYDA 2RFGA 3H99A 4MYUA 4N9QA 4PMDA 4WD3A 4BZQA 2VDIA 4A6GA 3AYVA 5DTEA 1QBGA 3WRYA 1XD9A 3DBIA 3X1XA 4HWPA 3TQTA 1KV5A 1OF1A 4PS1A 4YACA 1IU9A 2JD1A 4J3UA 4YMGA 3DG9A 3IAXA 3VILA 4KQFA 1YMVA 4H6PA 1RWPA 1ICSA 3MQFA 3JQCA 4QTZA 4XAQA 2WBLC 3REQA 2Q6VA 1YB2A 2YWBA 4DA6A 2K7ZA 1MIOB 1GVRA 5H9VA 2J09A 3UG8A 3BOFA 3L6BA 2QRUA 3R4CA 4HHEA 1VXRA 2W2MA 1YZUA 1GZUA 5E70A 4WY8A 4RGVA 4MWCA 3IFSA 1Q0QA 4PB5A 2WA2A 1W5EA 1SA0B 4FYXA 3MTGA 1TZ9A 3L41A 3T7DA 2JF6A 2M2IA 4JI8B 4V33A 3HV9A 1VHNA 2QM7A 3TJIA 2QV7A 2WABA 5E6UB 1SU7A 4G23A 4O18A 4XX6A 4D99A 3THCA 1OXKB 1DKUA 2P6RA 4JIIX 5D84A 3DHNA 5FHRA 1L1FA 1RJPA 2BH9A 4RV8A 1NAHA 3HKEB 1DADA 1ISSA 2VPQA 4LJSA 5EPEA 4HDKB 4RF5A 4AROA 2RJHA 4LQ1A 3EXEA 3UK0A 3VJKA 3JQFC 1DJWA 3WBEA 2ZE8A 5G5IA 1TMOA 3HL4A 1IHUA 1CDZA 3H55A 2Y99A 1H7WA 4R8KA 1QYDA 2J30A 1SFLA 2DV0A 2X5NA 4R05A 1KTCA 1NSFA 3TLBA 3C56A 2FN7A 3PTAA 4FNRA 4BFLA 5JTUA 3HXMA 4H6EA 5BN3B 3ZHCA 3RH0A 5HQ3A 4PR0A 4CQLA 2NQZA 3UV3A 3D0CA 3W7DA 3VOTA 3AL0C 5IM4F 4WKCA 2F62A 2X2EA 3NPUA 3ANXA 3FJLA 3KZ1E 5A5GA 4UC5A 1C1DA 3UPMA 2IX9A 3OPYB 1MNQA 1VBGA 4W99A 1RBZA 3W2JA 1DKRA 4D57A 4BF7A 3UC9A 5FI0B 3FXAA 2GZXA 1N9ZA 3KT6A 4KWSA 3SGUA 2PWGA 2AQ8A 4BC1A 3EZ9A 4ADSA 5I9SA 1XQYA 1F6KA 3GG7A 4A3UA 5KVAA 1U9JA 1KZ1A 1K3TA 5BMOA 1KXTA 1QOPB 3MCVA 4ND6A 4MYCA 5GJNA 1QFJA 4RL6A 2O3SA 2A3EA 5BRPA 4LHYA 1JZ5A 1PNTA 3C43A 3DECA 2V6MA 4FPSA 1EFRD 3K35A 2IPJA 1QPZA 2C14A 3M0XA 3ZYCA 4EACA 3FHQA 1ULTA 2D0IA 3NSNA 1C92A 2PMBA 5AK0A 3IVSA 4M98A 1J2JA 1RRVA 4LC9A 1QYIA 3VOHA 3BAKA 1EVZA 5CH8A 1J0KA 2Z27A 5LD2C 2FP3A 4F1WA 4IQEA 5F7JA 4UZUA 4KQCA 3O75A 4I7UA 5IRPA 2PS9A 3CINA 1MFUA 2KE5A 5KJ1A 1C1HA 3EHDA 3HPSA 2WTXA 2V82A 5A1AA 1V5XA 1GLVA 2VEFA 4K05A 1V39A 2WIJA 3DSRA 1UC9A 3HURA 1U2GA 3OSZA 1VJZA 4KQWA 1FW6A 4S2UA 2J6HA 2PRZA 2HPAA 4HB4A 1PSCA 3QHPA 1Q2UA 1FXPA 1HL8A 1ZK1A 1DEDA 1SPXA 2WC1A 2FKAA 4EP8C 1F3LA 3QUQA 3W1PA 3IMKA 4I5UA 4TKVB 4CF6A 3N74A 1CUCA 1T0IA 3W2EA 5CTAA 3GJTA 5HJLA 2J8ZA 2F9MA 3SE0A 4KR6A 4QHSA 1ES9A 2AL1A 1VHJA 1J24A 1E0TA 2EL9A 3O73A 5IANA 1UUQA 5HJXA 4M0DA 1ZGJA 1XLIA 3BD7A 4GPBA 2EGHA 1ZB5A 4FK8A 1CGYA 1ZM7A 3GZNB 3JQRA 3NRJA 4E2YA 1MOPA 1WHTB 3ETDA 1BWLA 3G8BA 4CV0A 3DE0X 2WW8A 3W6ZA 4E1AA 1Q0ZA 3ONVA 2FI1A 1H11A 5TMBA 1TPB1 4MYXA 1G5PA 3BERA 1EFZA 3C8ZA 1PL7A 2A79A 5CMLA 1GVSA 3WK9A 2XQIA 3C3UA 3QV1A 2CXPA 4OL0A 3NBFA 3O26A 2JARA 1Z5WA 1G18A 3VO0A 4AUMA 3MF4A 4X94A 2QM0A 1H7XA 3EBLA 1T8RA 2GJ4A 2PX8A 3LC2O 3IVTA 4GMGA 4LAOA 3WNLA 1AURA 3EFHA 5IZ4A 2P7HA 3LMZA 4OG2A 4UQOA 3PDIB 4PLYA 4QG7A 3EOZA 5BNWA 4F3KA 3TZBA 1S1CA 3JD0A 3HBMA 1R0BA 2UBPC 1SKAA 4RFLA 2HDNB 2QTLA 1IJEA 3O4JA 1BXRB 4M0PA 3WYEA 4XM2A 3I52A 4LX4A 2HAEA 2W2LD 3IQXA 3LAWA 4MKSA 4DEVA 5ICEA 2ZBTA 5DMXA 4DAFA 1TJ1A 5FULA 1LFAA 1RQHA 3BHIA 4MW1A 1Y4AE 5E4YA 3LCXA 4LS0A 1UZMA 3N2LA 2E7ZA 2IQDA 3GQVA 3CO4A 4YQEA 2WHPB 3PUJA 4TRNA 4R2KA 3DZ8A 2V3WA 2YH2A 4ZAGA 3QX9A 2Z0IA 1MEJA 1WB5A 4JXJA 4O54A 1ZNYA 4GM4A 1G3IA 1C80A 1T2VA 1EJXC 3WL4A 6XIAA 4TLLB 1KFJB 3C8DA 4MI6A 1PL8A 1WSDA 3K4PA 6PFKA 1XJQA 4DR3B 4C03A 3CWOX 4FZ5A 3E8SA 1FKXA 4U1RA 4TT3D 2WJEA 1Z0AA 2W00A 4RZSA 4U0JA 1T0HB 1U3UA 3P9IA 1PV2A 3INYA 3WY9A 4KGJA 4GBUA 4PG8A 5CG0A 2HQ1A 3NGFA 1HOXA 3QYSA 4JKYA 3QLVA 3ZT5A 1C3EA 3U4MA 1XMSA 2ZTKA 1W96A 3GRPA 2Q9BA 2FGKA 2O05A 3EEFA 4E8DA 1O57A 2XN2A 1U6JA 2IY9A 3HF3A 3UAOA 1L4HA 4AISA 5HATA 3ELFA 3KLKA 1TCUA 1VKOA 4G4SO 3WK1A 3R7DA 4NI5A 4RQTA 3LHWA 4TVBA 4TS4A 4DLYA 2DUNA 2GKSA 3QKUA 4F8XA 3VO8A 4HLUA 1O6ZA 4OGFA 1QP4A 1HJSA 3QF0A 3R75A 1H0GA 5K3EA 2QTGA 3BK1A 4UTVA 5IK2A 4RQAA 1MJNA 3AF1A 2H17A 2P3LA 1JKFA 3SYLA 4E5TA 2Y5SA 4CPDA 1JG9A 4LUTB 4GXNA 2ZB7A 5DE3A 4EZIA 4FIRA 3IEBA 1QHHB 1LOLA 1MFVA 3NEAA 5KTKA 4IIVA 3LCHA 1W0MA 5BP7A 1FNBA 4L95C 2OOKA 3SP1A 1SGJA 3AO0A 3T3OA 3AW9A 1FYFA 1KZ6A 4O4HF 1Q0LA 2QYGA 4PBTA 3RIGA 4PY2A 5ALYA 4TSFD 3OQ1A 1XMQB 1WZLA 4F3HA 2ZSBA 2ZITA 3MP5A 2F3RA 2II6A 1EEPA 3PFGA 4L0QA 5LXTF 3EG5A 4FX8A 3JQGA 1VGRA 5U9CA 3ITCA 3MWLA 4PXSA 3H0EA 4HQFA 1RPXA 1GTJ1 4KQ2A 4KWCA 5J04A 1KPIA 1ORIA 4O4IB 2VTVA 3T0DA 4MYRA 3QPVA 1GQFA 4J35A 3TQ0A 3REFA 4E08A 4GZIA 4CQ9A 3CL6A 4EX7A 1DFHA 1VFNA 5IBPA 3IO3A 4FO4A 2Q3LA 4YNGA 4OECA 5BR7A 4NDAA 2I17A 4LOCA 2GN0A 3UZZA 3WL3A 4B71A 4GLBA 2ZWIA 5MHTA 2CLSA 2QY6A 2XB6A 3QWAA 1L5HB 3L0OA 1CRPA 1TPYA 2FFRA 3RVBA 2LKDA 4R7TA 3O0FA 1L7XA 3UMRA 1P8JA 5IW8A 1DJYA 2QT3A 1BEUB 2GJSA 1KGUA 4UM8B 1TC1A 2FOLA 3CLSC 3HQOA 4PTZA 3ENWA 2FXIA 1MPXA 3NQ8A 1N3LA 2I7CA 4IBOA 4IV5A 1T2CA 2XISA 3FAXA 5IXSA 4J4HA 3N2XA 4Q3DA 3SQMA 4KTVE 4HEA6 3PVFA 4INPA 1GCGA 2AEFA 3VR1A 1Z8FA 1P7YA 1XTUA 3JVUA 5BRBA 3PGMA 1QIIA 5FDFA 5IYZB 4UOJA 4FW9A 5FJUA 1E3QA 2HK6A 3B7WA 2FUKA 4QPCA 1KYTA 4Y9MA 3G5TA 1G64A 1GQ2A 4ATDA 5C8XA 3M43A 3L0YA 1Q85A 4HXEB 3WK7A 5IULC 2V7WA 3HU2A 4CMEA 5H82A 2B36A 4MKVA 3QVGB 1GU1A 5G4KB 3V2UA 5IAOA 2FPMA 1EVIA 3RNDA 1F4VA 4EPYA 5SZJA 2GUUA 5DMHA 1W44A 1KEEA 3V1PA 2PX5A 3APGA 1GZHB 2YV5A 4R0MA 4YRGA 2NU9A 1FFBA 3AKCA 3S5UA 2C31A 3LNTA 2RKOA 4KVFA 2IK8A 5J23A 4OV4A 1BEUA 1M1XB 2DY1A 2HU8A 4OHRA 4ABYA 4IEIA 1AM4D 4D6YA 4M0XA 3PIRA 1ULSA 4UHKA 3W5SA 3D02A 2QV5A 4TYMA 3OPYI 4NCJA 1EC7A 4AZSA 2F1RA 2Y1OA 3DFHA 4OQMA 4LVNA 5LP6F 4IYJA 2VBFA 3M5DA 4BR1A 3KW3A 4AY7A 4UC0A 1NDQA 3EPMA 2REQA 4WXZA 3LPGA 3RQIA 1E0XA 2HT1A 1NVKA 3MY9A 2ZUWA 1JJ7A 3HG3A 1KL7A 3QQ1A 2W4QA 3E02A 1U4NA 3BFVA 2FWBA 2PIAA 5C8ZA 1R18A 3KELA 3QVLA 2OILA 2OK8A 3MOGA 5EMKA 3ISTA 2EG6A 4PFMA 4KVGA 3DC8A 5LIYX 3ZZ1A 4CJXA 4HAZA 1U7PA 3R25A 4FFLA 4FW8A 2PL5A 3LPNA 2QJIA 4HMEA 4CQJA 4C7OB 2GDZA 5WRFA 3VTFA 3MHPA 4NILA 3AFHA 1RY0A 2ANUA 3BTSA 1QNLA 5LZ2A 5I9MA 1WAUA 4J1OA 5B7YA 2ZR9A 5T3UA 2VPXA 1PQPA 4M60A 4EABA 1RPAA 1JQXA 5I4BA 5JXQA 4ZU1X 4GY0A 1ITCA 4HF7A 1JA1A 1V4YA 2QG9A 3O4IA 3W05A 1O1HA 5H81A 4CMIB 1DJZA 4DXAA 3CAWA 2OV8A 5CTJA 4K88A 1U8CB 1X1OA 4IEEA 1O89A 3X1YA 1MQPA 3LCJA 4TMBA 1T96A 2QBYB 4PUNA 3HJBA 1XRTA 2PCJA 1YDGA 3NWBA 4K3ZA 1JZ4A 4Q7KA 1NF9A 1R4NB 1E8DA 2XD4A 3GFPA 3RC8A 1X1AA 5JWHA 3HXTA 3FTEA 4MDPA 3H4XA 2IUEA 3CJTA 5CW2A 1IR1A 5IKEA 1ZL2A 3HN3A 1ZBQA 7ABPA 4K9PA 4OLFA 4A6PA 5CZKA 4ML4A 1IE3A 4FS9A 4GG1A 4Y7DA 1KSJA 4UTPA 4LVGA 4BFUA 3B9NA 3AFMA 1SM4A 2DH5A 3FMVA 5IARA 1S3SA 1P1CA 4ESHA 2C96A 2WZBA 2D3LA 1A5AA 1GCAA 2DUJA 3B40A 3IJLA 3DU0A 3HP4A 3T7IA 4QQKA 1LDEA 4QM7A 4MWAA 4YS6A 1UR9A 1XJ5A 3KLMX 4N3BA 4F11A 3B8VA 1ZESA 2ZIUB 1SG6A 3UXMA 4Y30A 2P75A 4LMBA 2WSSA 3Q4GA 1KDVA 4A8NA 3H7RA 4AKGA 3A1TA 4ENUA 4G63A 3ZUPA 4JUBA 1J9YA 2NYRA 2GEJA 1GIAA 3KFXA 2WOOA 3EAFA 3ROPA 4MJ3A 3MHGA 5AC4A 3A9CA 5K3BA 5I3FA 4WBNA 1H94A 4B3TB 4AUBA 4OYLA 1XH0A 3BF8A 4YECA 4EPEC 1ORRA 2IIVA 4V27A 4CMHA 1QASA 5LM3A 3NNTA 1SD2A 4PPFA 2GZHA 4FXJA 4MJ2A 3DLBA 1WZ2A 3ZJ6A 1F4PA 2CCKA 3GWQA 1SAYA 1T2DA 3HJRA 1JN0A 1N1MA 3M5YA 3RBXA 3EVAA 1PK8A 4GE0A 3AG5A 4QDMA 4U02A 4UUMA 3ADBA 1G17A 3KK0A 2WT8A 1BDMA 2P5TB 4FMPA 4RAQA 1RUSA 2E85A 5AVTA 3PHAA 3GXNA 1R9JA 2AD5A 4KFCA 4YRCA 3TR5A 1XEWY 4FNOA 1FTNA 2NSXA 2AXPA 1E79D 3TCEA 3DKRA 1A3HA 4EYGA 3PE4A 1NF3A 4OHCA 1E73M 1N1DA 4PF1A 3BOSA 5GPRA 1XCBA 3RUFA 4O8ZA 1N6PA 4GR5A 4N7MA 3MWJA 1M8GA 3C4UA 3KS5A 3U19A 2EGGA 1DOAA 1W59A 3BN3A 4O5OA 3CPUA 4F0RA 3FW6A 4R1LA 2AX4A 4BAZA 4G3XA 5BNFA 2ATSA 5B30A 4O2LA 4M1SA 3ZEAA 4DZTA 5ELMA 4JLBA 3TS1A 4V02A 1GVFA 3SGZA 3UTDA 2KBEA 3WLNA 1DXQA 1ZCAA 3STFA 2ZIFA 2OFXA 2BFDB 4XPIA 4HCLA 4LB4A 1U2RA 1CUUA 4YI3A 4IJCA 4FEYA 4R5HA 1JDDA 4IMRA 5HIAA 1RE1A 4MV6A 1W0CA 3KKQA 1GSOA 3UK1A 3M89A 1B9BA 1X97A 3VR4D 1LDBA 3SUVA 1OFDA 4FE7A 2FHBA 3APTA 2ZCVA 1PS0A 3C3KA 1VI6A 3W3ZB 3ZVNA 2P1FA 1ZGDA 1XIBA 2YYSA 2D2FA 1HEYA 3FGPA 4OFZA 3LIPA 2JAXA 1TM4E 1CNVA 1SYTA 1DHTA 2W5UA 4GQGA 1Y8RB 1NQXA 1BXGB 3A11A 1SUWA 2OXIA 4W6QA 5F9MA 3KE8A 2VK8A 3MBDA 4AZIA 1HE8B 3NDPA 1GWJA 4MWAE 1JTEA 4BEQA 4NZZA 3T35A 4HI0E 2GCPA 4OYYA 2AL7A 4V0MA 3W79A 2GWRA 3W34A 1RWKA 4BY3A 1VGVA 4DLZA 3N15A 4BWLA 3FPEA 2PRHA 4B3DA 3DYOA 4L27A 1E64A 2AN9A 1OU4A 1YTEA 2DT5A 3UJ9A 3K0EA 3DB2A 3OA0A 5D3MA 4CN8A 1NY5A 3F2BA 2QXYA 4H0FA 3DAOA 3JZAA 4BE4A 1QH8B 3LTNC 1FLAA 4MUKA 2YHIB 3W4IA 3TMQA 3PULA 4C1BA 2PHZA 1M65A 2WA1A 2WFLB 3W81A 2G5WA 3RMEA 5IJZA 4GP6A 4HB2A 4FGKA 2PZFA 3QKEA 4MAFA 3PSHA 3IPWA 1UR2A 4E33A 1DEHA 4HD5A 4B5NA 3URAA 2IPGA 3I6QA 4ZI5A 1F74A 4N48A 3KKMA 1EIWA 3I62A 4NZ5A 2FEKA 1I0DA 1Z6ZA 1V2HE 4IMAA 4W87A 2FSHA 1Z5OA 4JQAA 4S1OA 1VCHA 5HWJA 4LF2A 4PQFA 3IJQA 1XOIA 4MXDA 1OWOA 2NZ8A 1MC1A 4FF7A 4UHDA 1SO3A 4RK8A 3NDIA 3T06B 4NQZA 1LWJA 1PVOA 3D3QA 5A1JA 3SNHA 1FBAA 4XAYA 4WY5A 1OAOC 3T3IA 3TZHA 1ZLXA 4Z1AA 2JFXA 3OE4A 1A3CA 8XIMA 4E5UA 3TINA 5IVIA 3A3HA 3DXIA 1LXCA 3LYUA 3S1AB 1M1YA 3AFOA 4QE3A 3H9EO 1HF6A 2CLHB 4BQ5A 4XO7A 1U7TA 1OC5A 4Y9AA 1S3TC 2WQDA 4UNIA 1NAL1 1WMDA 3U4QB 2HX1A 5CPSA 3G2GA 4LFAB 3UJNA 2IW1A 2YR1A 3VNZA 2DP3A 2Y85A 3QW3A 1XM3A 4R54A 2W27A 3UEOA 4MGKR 4CEUC 4ZXOA 5IBRA 2VWGA 3V3TA 2RB4A 4WESB 4YDHB 3QH2A 4CI9A 5I9IA 4NZ1A 2BMAA 2ATVA 2YXOA 3GHHA 2OQHA 1LJUA 3DH7A 1IY9A 4HEJA 5LSAA 2I5GA 3GRFA 2ZEJA 3DT6A 4CQMA 4L5ZA 3P0EA 3UMMA 4TMVA 1S2NA 1E20A 3W27A 1YK0A 4B5SA 1HK7A 1QFSA 4QFBA 1EZ4A 3DLCA 1KO0A 1Z38A 3WUEA 1C9JA 1OYWA 2H92A 2XNHA 1HNWB 2ZBFA 1XX1A 3M4ZA 2CF6A 4L08A 1F7BA 5CBBA 1HE2A 4JXXA 2UXDB 4M80A 1S8FA 2BY4A 3VNJA 3VNBA 4B9AA 1E4LA 3QMTA 2GK7A 3OVMA 3WK4A 1L7OA 3A28A 4NHOA 1JZ6A 3LHKA 2CBUA 4JOCA 4CIVA 1FCVA 2JI9A 1E2MA 1PRYA 1WOMA 4D9HA 4PEVA 3D0RA 4XSMA 5AVJA 3AKYA 7AT1A 3GK3A 2VX4A 2V8BA 4PPYA 5GAJA 2OFWA 5HWNA 2JFHA 1H51A 3NQ6A 5HUOA 4D1JA 2XGJA 5TRTA 1CY7A 4Q24A 4HGYA 1C14A 3SOPA 3ZPXA 5CDHA 1DP4A 4H4IA 1CJVC 1MHTA 1UMYA 4LSMA 3T9AA 1R7OA 1BWRA 3F6PA 3GHRA 3TYEA 2YDQA 2PRSA 4RJIA 4RETA 4NV3A 2PH7A 2RH9B 3FI9A 1FP7A 1V5WA 4XXHA 2NP7A 1NYLA 1JXMA 3ADCA 3EIFA 5DWVA 4B16A 1USGA 4HSGA 2Z4RA 4ZJYA 1X8JA 2R62A 3G2MA 3RUDA 3N2KB 1QCZA 4EAAA 3W5IA 3UD6A 1W4CA 2W7TA 4F1JA 3BJTA 4WD0A 3TIGA 1TW3A 3T3EA 4DA0A 3OVQA 1Z0SA 4XJVA 2EJVA 1K89A 3TQQA 4UR9A 4HK5A 3G0BA 2CXGA 4D3SA 1LYXA 2A30A 5DCWA 1EOKA 3HP1A 4HMOA 3AXHA 1QK2A 4ZHQA 3CUVA 2EPMX 3OCUA 3E1F1 3QW2A 4KRUA 1JQJC 1AW5A 1KO8A 1DX6A 1K2VN 1FTYA 5L40A 9LDTA 1L5QA 5EJ5A 3TXVA 1YR3A 1RXVA 3G1FA 2KYRA 3MKVA 5DP1A 2EKDA 5CQ1A 3U4QA 4LRSA 2CXUA 4JUCA 3WSWA 3HWX1 2QW1A 1H2BA 3S9YA 3I6EA 3VMNA 3L04A 3IQIX 3E22B 4EKIA 5BVHA 4B6GA 2BHUA 4HZ8A 1MO4A 4LTMA 3DEKA 5E4FA 4ZEWA 1DGQA 1U5BB 2R85A 2O6LA 1HJQA 2W6JA 4HPXA 4TM7A 4YWHA 1R7AA 3HA7A 5FEXA 3A32A 3M1IA 3LHZA 1X74A 2ZSDA 4HLQB 3CQJA 3ANLA 3RF9A 1E2HA 1NLMA 2PZ8A 4XIFA 4NC9A 5BYAA 4QU5A 1VE1A 5CSRA 2GN8A 3TOPA 1RI1A 1GFIA 5DV9A 4OB6A 4FXOA 1FHVA 4HRAA 1EJ7L 2DLDA 4XUCA 1CQJA 2BFGA 2VJDA 3D9QX 3T9CA 4QTYA 3CZPA 4KVZA 4B3FX 4UXHA 4U7FA 1IWBB 3KQQA 3NYDA 4K6KA 3ETLA 3CX7A 2X6RA 3ZS8A 3ZIUA 4KMOA 2DPGA 1UMLA 4HYVA 1G2OA 1UINA 2OHHA 4A5SA 4ACZB 1EFPB 3IIKA 4WIAA 5CYGA 7REQA 4XOUA 1WXGA 4KPGA 3F5DA 5DLCA 3D6UA 4DCUA 2CD7A 1FCJA 5B53A 4PL2A 3KT0A 4RKQA 4OUDA 1I01A 2R6FA 2GGEA 2XUAA 3VZQA 4BBPA 3UEQA 4YBRA 4ACAA 1PD1A 2Y67A 4HHLA 5LSMA 3CIFA 2LE0A 2BZGA 4M1KA 2RAVA 3CLSD 4A21A 3OWHA 1NELA 3P71T 4QC2A 5THXA 3UAYA 4XK2A 1M7BA 3ZWXA 1T43A 5DWQA 5E6UA 5KYWB 1Y7VA 3WGIA 5JCJA 2PURA 4K2AA 3VDXA 1D3AA 5K6AC 5TQ0B 2WM8A 3PQ5A 3PFRA 4JV5B 4ZI2A 2QL5A 3FDXA 2PSSA 4U00A 3PJGA 3GLGE 2DB3A 1OBOA 4JXCA 4XQ6A 3NIFB 1PI3A 6YASA 3UNTA 2BWJA 2MYNA 1IWBA 1M66A 2VDGA 2RHTA 1WKYA 2PXHA 4YUZA 4TZKA 4EYOA 2J46A 4BVAA 3THWA 3O1HB 1WNTA 4G0OA 3S5JA 2WWRA 1E4VA 4QGGA 1L4LA 4HTYA 3L8MA 4I50B 1H2WA 1MBZA 1Y8AA 2ETXA 4QNEA 2XUCA 4C05A 4TLMB 1MP0A 1DOHA 1G20A 4B7XA 1VCGA 1QS0B 3EY9A 1E0JA 3LW7A 4BFAA 1R9YA 1KFLA 3ZJKA 4HA4A 2R2AA 4C0LA 5IOBA 2CHQA 4QDUA 1UP4A 2XRMA 1Q66A 3M6YA 4WZBE 1ZJ5A 2UZ3A 1O6IA 4OUIA 3Q9UA 3FFWA 4TQUS 4NNOA 4DB4A 1RLUA 5AFDA 1BWVA 1ZS2A 4ZDJA 3QEJA 3KTXA 1SSDA 3L5MA 2OBXA 1Q0PA 4ROTA 1HDYA 3QSGA 4WZAB 1S4MA 3G2KA 3Q2IA 1K66A 1DKMA 3WH5A 4ZPJA 2A1IA 3HKBA 5A4IS 2JLBA 1Q19A 3KUMA 5C8DA 3E0WA 3CU2A 4RDHA 1SM9A 1X96A 2VXNA 5B3JC 3D3NA 4BKOA 3V16A 4AZBA 4IXMA 1G7SA 1EBBA 2J9YB 3UHOA 4O8RA 3LCMA 1I4EB 4N41A 1V02A 3O3CA 4F5YA 2CV2A 3DDSA 2B7BA 4GWGA 3SHWA 4F38A 2QLMA 3HFGA 1BU5A 4IDFA 4H6RA 1VMKA 5A7HA 3P9CA 1O66A 4AJIA 2EJBA 4JEHA 2BG5A 3VD3A 3W72A 3L6UA 3ZW9A 1UFKA 5TEVA 4GUGA 1ZM4A 5HTKA 1KEUA 4XD3A 4AWEA 4HX2A 3SVTA 2QPLA 4KIRA 4GVLA 4G5OA 3IIOA 4MS3A 4DV5B 4IGSA 1TTQA 3TA6A 1JG1A 4PX2A 2OEKA 2VR2A 3VCNA 4LMAA 2VDNB 4DZ5A 1DBQA 4PZUA 2C2WA 1UQRA 1X0VA 3IQWA 1VE5A 4LQLA 4AYWA 3R11A 3HGQA 4KFPA 1RACA 3ISJA 4CIBA 1JCXA 1Z0FA 1M54A 3ZQ9A 4H19A 1PV8A 1ZXLA 1TA9A 3V7YA 4QYXA 5HSGA 5SYNA 3AIIA 2XIOA 5D5HA 5F2IA 4NUWA 4QOEA 2OSWA 4RC9A 1JILA 5I8ZA 2NW0A 3O5AA 1K86A 2EKLA 3JR7A 3VZRA 1FK8A 1FUIA 1ZQ5A 2MANA 2A6LA 5CYOA 4E5MA 3QE0A 4R1SA 4EUFA 4BBJA 3CPGA 3II1A 3MUEA 4HQ6A 3VPHA 4ALDA 2IS6A 1PJSA 1J9ZA 3UESA 2Z56A 5AKEA 1H0IA 2X4IA 5H8MA 5DJ5A 4JZYA 3JQQA 5CK4A 2EBWA 1XZQA 2HWYA 4H1UA 4F2GA 4CLOA 1AHIA 1J4AA 3H2JA 1FNCA 3ILYA 3IAHA 1M7XA 1Z17A 3B2EA 4BN0A 2ODPA 5KSOA 1T0JB 4I2NA 3BWMA 3FCOA 3OCXA 4IMEA 2OFJA 3VIFA 2CNBA 4B8ZA 3NYQA 4NK5A 2Q1TA 4ND8B 3T3DA 4YAIA 2ST1A 1GR0A 1ZDMA 2WJ6A 3ZWSA 1IT8A 3ROTA 2O8CB 3D2BA 2V45A 5E6YA 2ZI7A 5ITVA 3P32A 2BGGA 3SG0A 1J5EB 5IJWA 4HUTA 2LUOA 1WUEA 4Q6JA 3MVIA 4LN1A 4LYGA 1XMXA 4IOKA 3AESB 1U8YA 5DBOA 4B3BA 3SN1A 4I4IA 4MQFB 1G8HA 4JCLA 3G0OA 3RN6A 5LUBA 2I3GA 3NM5A 4JEQA 5GJBA 3T54A 2AJCA 4ZQIA 1NBMD 3GDGA 3GUVA 3G13A 3ATYA 5FUMA 5M2FX 2P9CA 3EZNA 1HY3A 3UC5A 4FMVA 1KI3A 4B5VA 1PKMA 3QMMA 1HQCA 3PK0A 1E9IA 1GQJA 3I65A 4HSOA 5CJ2A 2PD4A 2OCIA 2R1MA 5TARA 1KM4A 2C83A 4B35A 4IG2A 1PGQA 4L5AA 4CKQA 3IHLA 3MZ0A 2MSKA 1DL3A 4JB3A 2YFQA 1I2CA 1YCHA 3F98A 2DUMA 3BG9A 4RDZA 4DIBA 1PGNA 3R6TA 1CQPA 2VC6A 1WBBA 3HB9A 1N2SA 3L6CA 2DHCA 1W1UA 1MXHA 3ZTYA 2B82A 2CJXA 2BR5A 3WWZA 4F71A 3HPFA 1XTIA 2EXXA 4LHXA 5A62A 1XBVA 1AHNA 3OF2A 5HS4A 1OXBB 4NZNA 2I4LA 1W581 3TJXA 1VIAA 1NOIA 3C3BA 2BJVA 3B13B 4QG6A 4O1FA 2BZ0A 4LTDA 1USWA 1Y5MA 3CTPA 4ENSA 1G0NA 1TYAE 2X58A 2X9LA 3KOFA 1TE2A 3B82A 2PA6A 1IDOA 1VL5A 1XGEA 2JB9A 2AZMA 3U4GA 4IPTA 3CNLA 4OBBA 4EHKA 5EGNA 2Y7EA 1ORVA 2ZQ0A 3JZUA 1L6GA 4ZB0A 3OZGA 4L76A 2NV2B 3K3PA 4FJ0A 3BJZA 1KJZA 3WFJA 2FEPA 1NWRA 3EX6A 1U0JA 3U7IA 3ECQA 1P5JA 2QW8A 5EEGA 5HUQA 1YDHA 3ESYA 2P6UA 2PSHA 3HIJA 1IWPB 3WYNA 3I9KA 4HRVA 5HQTA 3DEIA 4IJQA 4CD4A 3THSA 2VKQA 1CZKA 2IZ5A 2CJPA 4IL0A 1ZCFA 1M2FA 5F2NA 3G88A 4CU6A 1CZHA 4JHLA 4QLOA 4XDYA 1BEZA 3W06A 3A3XA 4RIGA 3TMYA 4BJ5A 1TRKA 3OCJA 3BBLA 1R2TA 1X7ZB 2PXAA 1N3IA 5CGQA 1SW3A 1D8AA 2Y63A 3B3QA 4H8UA 1B8NA 1CEXA 1ZN7A 2WUGA 5LKYA 4V0LA 3AKEA 3PITA 1H9CA 3AJDA 3D7RA 3W1XA 2GDJA 5HMFA 1RCFA 4D8VA 1A8PA 1V02E 3NRBA 4MR9A 3CR3C 4W1PA 3IP9A 1AQIA 3UMCA 1M7OA 1ZAKA 1ISFA 2D2EA 2N42A 3RIEA 2O2EA 3LN3A 3ESAA 3N2YA 2B21A 4H6QA 2ZWPA 5J4YA 1SD1A 1H49A 3TAOA 4ZIRA 1JCNA 1GSIA 1EDTA 4E4UA 4R27A 1I7PA 4AX8A 4HS9A 3S5YA 4BVHA 3CQIA 5KSZA 4OMUA 2I1QA 3GFRA 4ZZ3A 5D5QA 4M56A 3ICPA 3K15A 1XRNA 4J76A 4JFWA 3D3WA 5LP1A 3PUWA 3VUSA 1MQRA 2C7VA 1L4GA 3KDOA 4NOMA 2XDYA 1SXJB 1VIZA 2QDKA 2A9OA 4GMKA 2XBMA 4IH4A 2VUNA 3G0HA 1VKFA 4ENTA 3GNSA 2LBPA 5HP4A 2A2ZA 3QKSB 2GCGA 4M7WA 1M0WA 4ENPA 3URNA 4ZRDA 1WUYA 4MB1A 3PJXA 1XMJA 4ARAA 4TKLA 4B0OA 1YRBA 3KE9A 2I76A 3HXLA 6REQA 2TYSA 1HE1C 2BGIA 1WY7A 4F0KA 2ERCA 4PG5A 4HA1A 1UBKS 2PUHA 2J31A 2OBLA 1CTQA 1Z4KA 1EFAA 4IF2A 4F5ZA 2Y1GA 1QAQA 2Y4SA 2WSKA 3LMKA 5EKXA 3OZMA 5A8GA 2ZTHA 4U5QA 5AHWA 4WDTA 2V03A 2X5JO 3I64A 4NLLA 3JQAD 4EUSA 3CO5A 2Q6IA 3CZAA 1KYWA 2INGX 5DT2A 4KESA 2SBTA 3UANA 1ZGHA 1FWIC 3S9ZA 2AOUB 4K2SA 4N3CA 1N4AA 4DN1A 4OI4A 5U4NA 2WPGA 4DUVA 3WMCA 1Q15A 3DWEX 3OZ7A 4HQVA 2EAUA 3AUJB 1NOJA 5DN6A 5CBJA 4YS1A 2FHCA 4BUCA 2CBZA 1ZUIA 4RZHA 1JPVA 4D1YA 2J7CA 2C2KA 3EFBA 4UUBA 2GXSA 4HN2A 3RQSA 4AIOA 4JDBA 1M72A 3N25A 3EGDA 2JJ8A 3V1NA 1O5QA 2IYQA 2EG5A 1D09A 2F2KA 4MW0A 1A47A 1XMPA 3QE9Y 4YC7A 2PDIA 3MDWA 1BXGA 8CGTA 3OZBA 1HP5A 1GQKA 1T1RA 5J58A 1KP2A 1M01A 4QTGA 3VR6H 3WWYA 3FSRA 3VSDA 4EW3A 2DPEA 4R3WA 1DMRA 4JEMA 1UKBA 1GPAA 2BD0A 4XKYB 4R98A 1EUZA 4ZBCA 1OWNA 2XH2A 5JQGA 3NHSA 4PHCA 3S1UA 1HX7A 4Q8PA 3QHAA 2IEYA 2C9CA 2OGJA 4P80A 4TL6A 4D3ZA 1RI2A 2FB3A 3AZSA 1Y3IA 2E2WA 2VPPA 2FH6A 3W2HA 3C97A 421PA 2SHKA 4UMAA 3PHCA 3WZ2A 2OECA 3HBAA 3GAAA 2Q8ZA 4IP0A 1E9FA 4BB5A 1Q45A 1KQZA 4J0DA 3FA2A 1YJBA 4XD7D 3IQFA 2DT3A 2YYAA 5ECYA 4NJMA 3WNDA 1W5BA 4F9GA 3D8HA 5ALPA 1N1EA 3R8XA 5FLKA 3LWDA 4UMCA 4HEHA 3VBEA 1YL6A 1R0MA 3PM6A 3GU2A 3CH0A 2BOVA 3SJZA 1EP1A 3W5AA 1TWSA 3OTGA 4UWMA 3DCNA 5HR6A 1IMOA 2PA3A 4PSVA 4BMYA 1OYBA 4PSAA 4RL3A 1CT5A 4G8TA 5AM3A 4Q3AA 4S3BA 3TEMA 2HLPA 5KVSA 2QZRA 1PCKA 3O3RA 3IJ8A 4DF1A 4ZT7A 1EGVB 2Z2AA 1U9YA 3K2QA 1RXCA 3C3NA 4QEDA 1R6VA 3RVQA 2AN1A 1I6LA 1TGVA 4J1TC 3VPLA 3VC3A 2A78A 4EA7A 1RLDA 3GR7A 4O0LA 2Z4GA 3P8JA 4D9BA 1SQFA 4L75A 1N5MA 4QISA 4KGZA 3M6XA 3JWIA 2ZS9A 3EJWA 5F1KA 4GFDA 4DMRA 3MSXA 3QF7A 3B3FA 3ASUA 2GILA 3SYKA 3L9CA 5KZEA 3TTVA 1MO3A 2XCTB 3ZWCA 2DPLA 1XLEA 3MI6A 5CA0B 1Q6YA 2NIPA 3LU2A 1N6NA 3SJNA 3QU9A 3G18A 3PX7A 2Z1MA 2OX1A 1II9A 3EPOA 1K08A 4OXNA 3N13A 4DEYA 4Q34A 3KZNA 3KJHA 3ZCTA 4O1DA 2HE5A 4LYKA 3FVMA 1ZGZA 2PC4A 4GP7A 2HSWA 3UP8A 1OLXA 3VHXA 1T8PA 4LUCA 3IV8A 3MC5A 4R4JA 5I3HA 1JHMA 3SF8B 1ZWKA 3GH3A 4QZVA 4ZE5A 1ECQA 2J9FB 2J8GA 4F2UA 1OIWA 3FS2A 3EVDA 3NHRA 1U8EA 3KETA 4EOGA 4LFYA 1CR2A 5IDVA 3BDAA 2IHUA 4QHTA 4P2VA 1XN4A 1RAAA 3Q1LA 3WGQA 1XDUA 2VCHA 2PUFA 1B8VA 3C0LA 4LYFA 1KMIY 3WKCA 2WVSA 1W37A 1GAXA 3ILXA 4B6OA 3Q65A 4Z49A 2C7BA 5TQLA 1L7PA 2FLWA 3QGKC 1HURA 1MV8A 4NJGA 2QJGA 1TZMA 1NJJA 4RA6A 4CE6A 1UOOA 3CZ5A 2PZBA 2HXUA 2WSQA 2CJWA 2VYNA 5FOVA 3R5TA 3W9UA 4YXFA 7TAAA 3HDQA 2HK8A 1OV4A 3KRBA 1AZSC 4EJSB 4EHDA 4J3WA 1L7RA 2ZE3A 4DLPA 3EG9A 2BODX 2YWDA 5XINA 4KQNA 4IXXA 1CQXA 4UFNA 2OUKA 2AEJA 4XH9B 5JZOA 4XTIA 3NL3A 2W93A 1H0KA 3A5FA 4LBYA 1OX4A 1NBHA 2Z98A 5EXEA 1KJIA 3JVAA 3W9YA 1ADYA 1KYYA 4HAXA 1XBXA 4F66A 4MVJF 4MADA 2GQ0A 2G3MA 5EUMA 3WS7A 1XTQA 1C3OA 4PHGA 2O8DB 2C4KA 2POCA 4QSHA 3UFXB 1XICA 5L9FA 4C4RA 3M1ZA 4NX2A 3S4YA 2BM1A 1UAAA 3ARUA 4A2SA 4KRYA 2DTXA 1CUZA 2ADOA 4CLHA 2PH1A 2FRVA 3R9XB 5JJCA 9XIAA 3PPHA 1E4MM 5IZCC 3ZNQA 4AP5A 2QMYA 3HSYA 2IWRA 4TZ6A 3C5EA 4GCAA 5JNRA 3V8EA 4S39A 1I14A 1VL2A 1W4AA 3DYMA 4M9SA 4U33A 4M83A 3DBRB 3FUVA 2GNPA 2YW9A 4GNRA 5KREA 3LOTA 2FSIA 3FWNA 3KCLA 4RVCA 2TSYB 1SKYE 2ZJ3A 1ZH8A 3HLYA 3PFNA 3Q7RA 3WQ8A 1FXSA 1QK5A 1DELA 2XEXA 4J0QA 4E5PA 3LBHA 4Y1GA 2O7QA 2P5NA 5FOQA 4Q32A 1GGVA 2G50A 5ECGC 5DNWA 2KW5A 4NU5A 4WA8A 4G7EB 4EB6B 1ECFA 4IF4A 5K6TA 2QR2A 2QGNA 2FPSA 3ENZA 4AVNA 5CIYA 4QPZA 4OF4A 2XA1A 5IRCD 1B4DA 3Q7PA 1K98A 4Q9NA 4ESEA 3V4OA 3DZ1A 1U3WA 2KB0A 3LDFA 2NYAA 3PJFA 4MWBA 2BPOA 4LZOA 5EHZA 2NWQA 2C7GA 1OT5A 2JFVA 3BAJA 1V3TA 1ORWA 2YJ3A 3HB1A 1HLDA 1JYXA 1IQUA 1PUDA 1E4YA 2XD9A 4L1GA 4S23A 3FYHA 3NDJA 1C9WA 3GR6A 4FLFA 1C9NA 5CSSA 3E6EA 4FP9A 3BXWA 3JD4A 4MIYA 1BH6A 4PHHA 1VJGA 2NU8B 3LRPA 5JEDA 2WPDA 1GHTA 4OKDA 3VZXA 3AF4A 3TKAA 1XG4A 4TR9A 4JXZA 3H6HA 1A8SA 3KL2A 4RUBA 2RHGA 3WRVA 2JEQA 4OFXA 5LA1A 1AZLA 1EUDB 1ZKDA 2O9JA 3NKFA 4ERGA 1XMIA 3A70A 2XMCA 3LS2A 2HBXA 1JS1X 4ZI7F 1ST3A 4BMDA 2WD8A 3KL5A 4P7KA 1S39A 3KBMA 1KM5A 4A23A 2BCEA 3NTOA 3TOSA 4UASA 2XLCA 2AK3A 1YR7A 4KQMA 4R2MA 4ZVLA 1AV7A 4OOFA 4BFZA 4KYIB 1NDVA 3WKAA 1K0FA 4H7PA 3HM2A 3O31A 2J9RA 4GMHA 2N9UA 4NAUA 3FVRA 3IS4A 4XBJA 1TO2E 3OOWA 4KW2A 2VBCA 1ZBKA 4FC7A 5C34B 1OJLA 1OFUA 3B6EA 1AV6A 3DGBA 3UFYA 2FJ0A 2HT6A 2WCAA 1FDVA 4MG4A 1LQ0A 3L7YA 3EVZA 4K6MA 4WBXC 4CV2A 1V95A 3VJMA 4ETMA 5A9SA 4HR7A 3ITVA 1H8EA 3VHQA 2V5VA 5BNKA 5D51S 1MZHA 4OOZA 2VZ0A 2J0SA 3THDA 3ALGA 4XX1A 2ZOXA 1T34A 2Q02A 1Q13A 1T9GS 2PTDA 1KO5A 2XMZA 3BGSA 1U1HA 3CONA 4JL1A 2DW7A 1Y1KE 2QVYX 2FJKA 2O52A 1E4EB 3V3WA 2P9TA 1ZSXA 3ABIA 3T09A 1YB1A 2Q7DA 4JP8A 3OW1A 5KWVA 2IU0A 2VTBA 1AODA 1BVUA 1W46A 3VJRA 1KM3A 5CA1A 3ZDBA 2P9HA 1PXGA 1NWHA 3BDVA 2R44A 5LUAA 4ND4A 2HU7A 3PKZA 2XDFA 4RMHA 4BNUA 4GU5A 1K8QA 1RQPA 4NFYA 2D7DA 3W7LA 3UT5A 2FGJA 5EHIA 5D09A 2BMBA 2VLIA 1QE0A 2WJPA 3EKGA 2O59A 2VYCA 2J27A 4AO7A 4RE3A 3C5WP 4WBNB 1KYQA 1JIUA 5ALXA 2WPDD 1D7OA 3QXSA 4RLSA 4JGDA 2J3HA 4R2IA 4E8CA 4OYRA 1Z4MA 3BXZA 4CEJB 1E5NA 5JBEA 3N6JA 1DEXA 4XVHA 4N0EA 5FNVF 1YIOA 1OAKA 3ZV6A 1C8VB 3G7NA 4CI0B 4ER3A 3ND5A 3NLLA 3TRKA 2OBBA 2CL6X 3QUBA 5M3WA 3WMFA 1HKVA 1UJ2A 4WESA 2WJVA 4P3YA 4C6HA 1Y9DA 2RG1A 1TFRA 5JY6A 4NF7A 4HK7A 2A88A 3FVWA 5KNBH 3G6KA 3WMGA 3N1AA 5D3ZA 1FP4A 2GMWA 4PSKA 4AY1A 3V34A 4FB7A 4K9KA 4Z1BA 2ICAA 5JJLA 3INGA 2YY5A 2NQJA 2ZZ3A 1NJ5A 2Q4BA 4FFDA 1FDYA 2B8TA 2Y5EA 2V54A 3D7SA 1BCRA 3WH9A 1UC5A 3GXPA 3O4VA 4AWAA 5BN4A 4B5TA 3A1EA 4MJ4A 3AYSA 1T2NA 1J2TA 3NCTA 4UEOA 5GV8A 3G8CA 2WWYA 4K3VA 3TZCA 3O8OA 5LQKA 2ZLBA 2Q5QA 3EX1A 3JRWA 3MIZA 5F1YA 2OQ2A 3BD8A 2I03A 3ANMA 5AO9A 3V1MA 1ZOOA 4UFOA 5A0FA 3LT2A 4Z0NA 4DB2A 3ILVA 2Z9DA 3P0IA 4FFMA 3R09A 2QF7A 4F4UA 1N5KA 3L1UA 4W9TA 4FHEA 4H15A 1C4OA 2W48A 2XCOA 3O8CA 2XUHA 1M5WA 3RM8A 1D2CA 3DFFA 4QLBA 5JRJA 3BQ6A 4D2JA 4X95A 5FI3A 5F4SA 5JAQA 4DWDA 1CK4A 1GRRA 1SZNA 3PFWO 2BGRA 1KRHA 4X60A 5B7PA 3CASA 3GP8A 1UK8A 4JTAA 4R41A 3M8KA 4NKRA 3L1IA 1LTQA 4BLPA 3KCJA 4L64A 4J7UA 1XZCA 1YOVA 3ES8A 4C3ZA 1GV1A 3NGLA 3EWZA 5HA5A 1RAHA 3PXXA 4MRNA 2CBXA 1SCBA 1VBHA 2ZOSA 4R83A 1TCAA 1DJQA 2D3WA 3HKEA 4FGUA 2AMFA 3GJ7A 3MT8A 5K4AA 3RLVA 4DQLA 1MR3F 4IWYA 1G0CA 2BY0A 3OQEA 1LM1A 4RUKA 4FE3A 5K01A 1Q6LA 3DC2A 4AC7C 3KTFA 1PTJC 2D1TA 2WO5A 1YX1A 3VHLB 1P1BA 1UKEA 4EGAA 4C0QC 1A5ZA 1LTHR 1JZTA 3I4FA 2VJXA 3EOBI 1W1PA 2C0PA 2X09A 3PHIA 3GBDA 1IYZA 3KUDA 2LCQA 5FI1B 4A82A 2GBLC 5KSYA 2QJOA 3V5NA 1KSGA 2YJZA 3O9VA 3MWYW 5TX7A 3RR2A 1XZMA 3NR0A 5AXBA 3VC6A 1RABA 4KDFA 1QPNA 3U9IA 3O1IC 3IQHX 1QGOA 3KHSA 1ZL0A 2YIDA 4I36A 5CDYA 4EUEA 2EBHX 1SU6A 2AOUA 4WKOA 1W5QA 2GYYA 4L3VA 2C4VA 5CSUA 3OTIA 3FNBA 4PZEA 3BCFA 1XZAA 3PG9A 3L2LA 4YAEA 1Q7TA 3BKWA 3ZKAA 1OGYA 1JBEA 3W1VA 5A7FA 4FF5A 2J6IA 3PT9A 2Z2UA 4R9UC 1GRNA 3IIXA 1KLZA 5KHOC 3EGJA 4XEUA 3I2GA 3D6TB 1XQXA 3GVGA 1UXHA 4XRRA 2DQZA 2PE4A 4KUEA 1T8XA 5EJAA 4BZWA 3Q5GA 3EWDA 3CNOA 1AHPA 4H60A 3G3MA 2NV0A 5JSZB 2PLMA 1U90A 2NV9A 2ZXDA 1Y6JA 2VZ8A 3SGLA 2X4GA 2QQGA 4A2RA 1YZYA 3QKSA 1JIBA 3NIBA 3BCJA 1G7RA 1IXYA 2JFPA 2W37A 3PEYA 2QWXA 3U1BA 3R0ZA 3AI1A 3Q3VA 5KAPA 2A5GA 2Q6LA 3PFFA 5CPBA 1ZJHA 3IVCA 5JAOA 1KYIA 2ONCA 2ON6A 3COYA 3U1TA 5AZ0A 1TTQB 1I2PA 1Q6FA 4QAQA 4D0RA 2FZKA 4EGFA 4OBSA 1FP6A 3ODPA 3QWHA 3C14C 2OV6A 3B85A 2AMGA 1KOFA 3HZ3A 1F2TB 1WSBA 2QDXA 1RI4A 3F4KA 1W3HA 1GUVA 3WYCA 3TN6A 1TNDA 3W3AH 2XT6A 2XQFA 4AQ7A 1IXRC 3MEQA 5IHPA 2OWEA 2PI6A 1W91A 3SZMA 4UTUA 1IV8A 3OAAD 1R46A 2HXGA 5FTNA 9GPBA 4XD5A 3SCPA 1R6AA 2H1WA 3IBYA 4LV8B 2B69A 2VMFA 3IIJA 2HREA 4LGYA 2DZAA 4BVBA 1FSGA 2BC9A 5DLPA 4IFOA 4TKUB 2FWAA 3WQHA 1KYZA 1J93A 2I33A 3NV7A 3MT7A 4C2AA 3KSUA 2QSZA 2ZB8A 2BASA 4JQZA 4B5XA 3ANNA 2QZSA 4ZDWA 1K1DA 2HLDD 3B4UA 4TRMA 3ERCA 3PRKE 4MJZA 4C5ZA 3I34X 4JFRA 2H8KA 3CISA 1VG9B 1YJAA 4O1IA 3OF3A 3KWMA 4HWRA 3MGBA 4WY0F 5JIPA 4PGHA 1P1MA 4DR4B 2AMVA 2DH3A 3V5CA 1CIUA 1CY6A 3Q7QA 4C6CA 3QQWA 2ZGVA 4B6RA 2OORC 4B46A 1U5HA 4YRZA 3HVRA 4HYTA 1SKQA 1PB0A 3P9XA 2O7VA 2J7PA 2UUPA 2VDJA 3F8TA 2GDQA 5DIZA 2NQ5A 2H4WA 1YC5A 4YNBA 1OABA 4LNUA 4C0AC 4LYRA 4ORIA 1WD5A 2VOEA 2QJWA 2VRQA 2JAOA 3A9IA 1LF5A 1PG0A 1BU8A 2GOYA 2WWHA 3GFXA 3LV5A 3M41A 3W6UA 4DYVA 2R4TA 1E62A 1T4MA 4IPIA 3GAZA 3NIWA 4DI9A 1V8ZA 3R7MA 3OBKA 2XDAA 4WKFA 6GPBA 1ZMTA 5SV2A 5L3QB 3CMFA 3H0CA 3BXOA 1KEPA 4CBVA 4EI9A 1G9HA 3WBKA 3BJIC 1DAOA 4QATA 3HPXA 3L8FA 3QNUA 2VQFB 1WXFA 3FZEA 3T5DA 1YMYA 4TTGA 4PRTA 1B8OA 4YRQA 1MAVA 5C2CA 1CGTA 3PEWA 3JTEA 4OVXA 3UJRA 4P4GA 4R2WA 3PXCX 1UKTA 3WO8A 4KGVA 4KCTA 1GG0A 3I7QA 4F48A 4Q4AA 4IQFA 2HBZA 3CKKA 2AGKA