4X60B

Crystal structure of prmt5:mep50 with epz015666 and sinefungin
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
310
Chain Sequence
b'LPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 5
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
total genus 86
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4x60B00
2HESX 2G99A 4A09B 4FHLA 3DXMC 2H6QA 4O3TB 3SHFA 2J55H 2BCJB 1MG3A 5EMKB 3IIYA 4BUJC 3AL9A 5C2VB 1Q47A 4QT8A 5A2Qg 4GZ8A 3GFCA 3I8EA 4J8BA 1GP2B 2OK6A 3JZHA 4CY5A 5HE3B 3SFZA 2HJBA 4J84A 3RFHA 2CE8A 1JMXB 3EG6A 3UKUC 3UR4A 2AGLA 3C9CA 5EARA 5AMSA 2B5MA 4Z8LA 4LG9A 3ULEC 2H13A 1FWXA 2H68A 1TYQC 4PSWB 1MG2A 2I3TA 3W15A 4AOWA 2OIZA 3MMYA 5JWZA 2H9PA 4PBZA 3AH8B 5C9ZB 1L0QA 2IUPA 5FKTA 4GM3A 3DXKC 4L1QD 5IC7A 4A11B 5FKRA 3BWSA 2PM9A 1NR0A 4J86A 3RMZD 3UVLA 3V5WB 3NVXA 1XIPA 3EI2B 5HE2B 3NVQA 4A08A 4H5JA 2H6KA 3DM0A 2J57G 3F3FA 4D6VA 4GQBB 5HYNB 3EI4A 2XYIA 2AGZA 4XYHA 2YMUA 4FA9D 4FAND 5GXHA 2I0SA 5CXCA 5EMLB 3PXWD 4K3JB 2P9KC 5GSAA 4XYIA 4ERQA 2YB8B 2AGXA 4JT5C 1S4UX 4CI2A 3OKYB 2UZXB 4X3EA 4CI1A 3SJLD 3RSEC 2J56H 2PM9B 3PVWB 2OVQB 5HE1B 1SHYB 2GC4A 2HKRA 5I5IA 2H9NA 4QRJA 3OKWA 3I7KA 3EI3A 4ZN4A 1A0RB 2OVRB 4ERYA 3JZNA 1GXRA 2CO0A 1N6EA 4CI3A 4ZOZA 5CXCB 3IJ0A 3OL2B 2CN3A 4ES0A 4CZXA 3EI4B 3FRXA 2XL2A 3EI1B 4BH6A 3EI2A 3AFCA 3BG1A 3JRPA 3RN0D 1K32A 5I5JA 2B4EA 2YNNA 5CXBB 2CE9A 3I7HA 3MKQA 3IIWA 4O1QD 4U1EI 4J77A 5IGOA 5EAPA 3V9FA 4OZUA 3L4MD 2I0TA 2H14A 4MK0B 3MZKA 2YNPA 5CYKB 4A0AA 3A0FA 3N0DA 2CO0C 4ZOYA 1OLZA 2GC7A 3FM0A 2O9KA 1GG2B 3DWLC 3HFQA 2PBIB 4Y7RA 4YVDA 2I3SA 3JAMg 3UVOA 4TZ4A 1SQJA 3OKTA 3OL2A 3C99A 3SCYA 5H14A 2B5NA 3KRWB 4X60B 3I7LA 2MTAH 2P9LC 4JSVC 3I8CA 3EWEA 2AH0A 2H47A 2UZYB 3ODTA 4L9OA 3E0CA 5HQGA 2OJYA 2IAAA 3SXTD 4A7JA 4GM8A 4CZYA 5FA5B 3SMRA 4J0XA 2EBSA 3JB9L 2G9AA 4FB1D 3SWSD 4J78A 1XKSA 1PGUA 4J73A 3BG0A 5FXYA 3UVKA 5FLXg 4L3HD 1PBYB 2CN2A 4J82A 3PXSD 5H1MA 1RI6A 3RN1D 3IKOA 4N14A 4A09A 4GQ2P 5TDHB 3ORVD 3PSLA 3IJCA 2IURA 4JSXC 1N6FA 2XL3A 2P9IC 4H5IA 2B5LA 2AH1A 4UI9R 4A0BA 4GGDA 4JSPC 3NVNA 4CC9A 4ZOVA 5THAA 3SLED 3UVNA 4ESGA 4OWRA 4X61B 3B7FA 5IJ7E 4X63B 1U2VC 5AJAA 4HDJA 3CIKB 2CNXA 4AEZA 4E5ZB 4LGNA 3I2NA 4XEIC 2I0RA 4FA5D 3JROA 2YBAA 4LG8A 3AL8A 4CI8A 1JJUB 4O3UB 4J79A 4GGCA 2IWFA 3F3PA 2PM6B 4CY1A 4PC0A 5EM2A 4A2MA 4QL1A 5CYKA 4A0AB 5EMJB 4A0BB 5H17A 2Q7QA 5GXIA 1K8KC 2BBKH 5SXMA 3SVWD 2IUQA 1ERJA 4J0WA 4Y5RD 3MZLA 2H3XA 3PSCB 3N0EA 3J81g 3FGBA 4J81A 5AFU3 5IGQA 4ZOXA 3RLMD 3I7NA 2H6NA 5CXBA 4FA4D 5HE0B 3PXTD 4JXMA 4GQ1A 3ZWLB 3P4FA 3PE7A 1JMZB 3IJ1A 4E54B 1YFQA 3AL8B 5K19A 2Z2NA 3EI3B 3CFSB 5TF2A 2Z2PA 4JT6C 2GNQA 5IT9g 4FAVD 3PVUB 4A2LA 3JPXA 5FQDA 3MXXA 5EM2B 4J87A 4PBYA 2AQ5A 3OTTA 2HXCA 4JD2C 5TEFA 3SBQA 4EWRA 2PM7B 4CY2A 4FWWA 3GREA 3OW8A 2XU7A 4GM9A 4CY3A 4IMMA 3RRMC 3VA6A 4L3GD 1PI6A 5FKQA 3MKSB 4R7AB 1N6DA 4GGAA 3KRXB 2HKMA 1GOTB 2HYEA 1R5MA 4PSXB 2P9SC 4GMBA 3SBPA 1NEXB 4D0KA 4O45A 5K1CC 4E54A 4PXWA 3C5MA 3JZGA 2AGWA 2QC5A 5TEEA 3C75H 3EU7A 3J80g 3I7PA 3F3GA 2P9UC 1SQ9A 4K3ID 2YNOA 4U7AA 4KFMB 2H9MA 3VGZA 4A11A 2OK4A 3UKRC 4E5ZA 2OVPB 1OMWB 5FKSA 3I7OA 1P22A 1XHMA 3EMHA 3K26A 1B9YA 3RFGA 3L4OD 4A08B 1QNIA 4CZVA 4O9DA 5EAMA 4G56B 3U4YA 2QXVA 3EI1A 1JOFA 3OKYA 4FA1D 2Z2OA 5GMKn 4PNKB 1MDAH 2P9PC 1PEVA 4JSNC 4IA9A 3SN6B 4ERZA 5KDOB 4J8GA 5C2WB 2TRCB 1B9XA 1VYHC 3I89A 4QQEA 5EMMB 3K27A 2P9NC 4I79A 3V7DB 5EALA 2IUVA 2AGYA 5I5MA 4NSXA 3SBRA 5IJ8E 3VH0A 3CFVA 3DSMA 1TBGA 2H9LA 3UVMA 2HJ4A 1U4CA 4BL0A 5B4WA 2IWKA 2W18A
chains in the Genus database with same CATH superfamily
2HESX 2G99A 3EQ9A 4A09B 4FHLA 3DXMC 2H6QA 5C92A 4O3TB 3SHFA 2J55H 2BCJB 4G1MA 1MG3A 5EMKB 3IIYA 4BUJC 3AL9A 1E8MA 5C2VB 1Q47A 4QT8A 5A2Qg 4GZ8A 3GFCA 3I8EA 4J8BA 1GP2B 1C9LA 2OK6A 3JZHA 4CY5A 5HE3B 1GOGA 2HU5A 1UOQA 3SFZA 2HJBA 1L5GA 1GOFA 4J84A 3RFHA 2XZGA 2CE8A 1JMXB 3EG6A 3UKUC 3MUNA 3UR4A 2AGLA 3C9CA 5EARA 5AMSA 2B5MA 4Z8LA 4LG9A 3ULEC 2QR5A 2H13A 1FWXA 2H68A 4AN0A 1TYQC 4PSWB 1MG2A 2I3TA 3W15A 4AOWA 2OIZA 3MMYA 5JWZA 2H9PA 3GC3B 4PBZA 3AH8B 5C9ZB 1L0QA 1UOOA 2IUPA 5FKTA 3K72A 4GM3A 3DXKC 4L1QD 4MMZA 5IC7A 4A11B 1H2WA 3KCIA 5FKRA 3BWSA 2PM9A 1H2ZA 3O4IA 1NR0A 4J86A 4IRZA 3RMZD 3UVLA 3FCUA 3V5WB 3NVXA 4G55A 1XIPA 3O4GA 5HE2B 3EI2B 5E6UA 3NVQA 4A08A 4H5JA 2H6KA 3DM0A 2J57G 3F3FA 4D6VA 4GQBB 4Z7OA 5HYNB 3EI4A 2XYIA 2AGZA 4XYHA 2YMUA 4FA9D 1VZ3A 4FAND 5GXHA 3IUQA 5M5SA 2I0SA 4DNVA 5CXCA 5EMLB 3PXWD 4K3JB 2P9KC 5GSAA 4XYIA 4ERQA 2YB8B 2AGXA 3NIFA 4JT5C 1S4UX 4CI2A 3OKYB 2UZXB 2BKLA 4X3EA 4CI1A 3SJLD 3RSEC 2VDLA 2J56H 2PM9B 3PVWB 4D9SA 1VE7A 2OVQB 5HE1B 1SHYB 2VDMA 1A12A 2GC4A 4BCBA 2HKRA 5I5IA 2H9NA 4QRJA 3OKWA 3I7KA 3EI3A 4ZN4A 1A0RB 2OVRB 4ERYA 3IJEA 2VDKA 3JZNA 1GXRA 2CO0A 1N6EA 4CI3A 1JTDB 5M5UA 4ZOZA 5CXCB 3IJ0A 3OL2B 2HU7A 2CN3A 4ES0A 4CZXA 3EI4B 3GD1I 3FRXA 2XL2A 3EI1B 4BP8A 4BH6A 4JHNA 3EI2A 3AFCA 4RE5A 3BG1A 3JRPA 3RN0D 1K32A 5I5JA 3T3MA 2B4EA 4BCDA 2YNNA 5CXBB 2CE9A 3I7HA 1VZ2A 3MKQA 3IIWA 4O1QD 4J77A 4U1EI 5IGOA 5EAPA 3V9FA 4OZUA 3L4MD 1UTCA 2I0TA 2H14A 4MK0B 3MZKA 3IULA 2YNPA 3ZE1A 2WQ8A 5CYKB 4A0AA 5E6RA 3A0FA 4Z7NA 3N0DA 2CO0C 4ZOYA 1OLZA 2GC7A 3FM0A 2O9KA 1GG2B 3DWLC 3HFQA 3O4JA 2PBIB 4Y7RA 4YVDA 2I3SA 3JAMg 1H2YA 3UVOA 4TZ4A 3NIDA 1SQJA 3OKTA 3OL2A 3C99A 3SCYA 4UM9A 2B5NA 5H14A 3KRWB 4X60B 3I7LA 2MTAH 2P9LC 4JSVC 3I8CA 3EWEA 2AH0A 2H47A 1BPOA 2UZYB 2VZ1A 2VZ3A 3ODTA 3E0CA 4L9OA 5HQGA 2OJYA 2IAAA 3QI0A 3SXTD 4G1EA 3T3PA 4A7JA 4GM8A 4CZYA 1E5TA 3V4PA 3EQ7A 2VDRA 4BP9A 5FA5B 3SMRA 1O6FA 4J0XA 2EBSA 3JB9L 2G9AA 4FB1D 3SWSD 4J78A 1XKSA 1PGUA 3DDUA 4J73A 4AMYA 3BG0A 5FXYA 3UVKA 5FLXg 4AN1A 3FCSA 4L3HD 2EICA 1PBYB 2CN2A 4J82A 3PXSD 4L1MA 5H1MA 1RI6A 3RN1D 1QFSA 3IKOA 1O6GA 4N14A 1U8CA 3ZDZA 4GQ2P 4A09A 5TDHB 3ORVD 1C9IA 3PSLA 3IJCA 3O4HA 1GOHA 2IURA 4JSXC 1N6FA 2XL3A 2P9IC 4H5IA 2B5LA 2AH1A 1JV2A 4NENA 4UI9R 4A0BA 4GGDA 4JSPC 3NVNA 2EIDA 4CC9A 4ZOVA 5THAA 3SLED 3UVNA 4ESGA 4OWRA 3ZDXA 5M61A 4X61B 3B7FA 1H2XA 5IJ7E 3EQ8A 1U2VC 4X63B 5AJAA 4BCCA 4HDJA 3CIKB 5HDBA 2CNXA 4AEZA 4E5ZB 4LGNA 3I2NA 4XEIC 2I0RA 4FA5D 3JROA 4MMXA 2YBAA 2XDWA 4LG8A 3AL8A 4CI8A 1JJUB 4O3UB 5E6SA 2EIEA 4J79A 4GGCA 2IWFA 3F3PA 2PM6B 4CY1A 4PC0A 5EM2A 3IURA 1I2MB 1UOPA 4A2MA 2QZPA 4QL1A 2VDQA 5CYKA 4A0AB 2VDOA 3V4VA 5EMJB 4A0BB 1T2XA 5H17A 2Q7QA 5GXIA 1K8KC 2BBKH 5FFGA 5SXMA 3SVWD 2IUQA 1ERJA 4J0WA 4Y5RD 3MZLA 2H3XA 3PSCB 3N0EA 3J81g 3FGBA 4J81A 5AFU3 5IGQA 4ZOXA 3RLMD 3I7NA 2H6NA 5CXBA 4FA4D 5HE0B 5C86A 2XE4A 3PXTD 4JXMA 4GQ1A 2VC2A 3ZWLB 3P4FA 3PE7A 1JMZB 3IJ1A 4E54B 1YFQA 3AL8B 5K19A 2Z2NA 3EI3B 4WK0A 3CFSB 4WK2A 5TF2A 4AX4A 2Z2PA 4JT6C 3ZDYA 3IUMA 2GNQA 5IT9g 4FAVD 3ZE0A 3PVUB 4A2LA 3IUJA 3JPXA 5FQDA 5M5TA 3MXXA 3K71A 3NIGA 5EM2B 4J87A 2JKXA 5M5RA 2AQ5A 4NAAA 3OTTA 2HXCA 4JD2C 4PBYA 5TEFA 3SBQA 5M5VA 4EWRA 2PM7B 4CY2A 4FWWA 3IVMA 3GREA 3OW8A 4MMYA 3K6SA 2XU7A 4GM9A 4CY3A 4IMMA 3RRMC 3VA6A 4L3GD 4NBMA 1PI6A 1YR2A 3MKSB 4R7AB 5FKQA 1N6DA 4GGAA 3KRXB 2HKMA 1GOTB 2HYEA 1R5MA 3MVDK 4PSXB 2P9SC 4GMBA 3SBPA 1NEXB 4D0KA 4O45A 3OF7A 5K1CC 4RE6A 3ZE2A 4E54A 4PXWA 2HU8A 3C5MA 3JZGA 2AGWA 2EIBA 2QC5A 4JHPC 5TEEA 3C75H 3EU7A 3J80g 3I7PA 3F3GA 2P9UC 1SQ9A 4K3ID 2YNOA 4U7AA 4KFMB 3VI4A 2H9MA 5FFOA 3VGZA 4O02A 4A11A 2OK4A 3UKRC 4E5ZA 2OVPB 1OMWB 5FKSA 3I7OA 4O2WA 1P22A 1XHMA 3EMHA 3K26A 1B9YA 3RFGA 3L4OD 4A08B 1QNIA 4CZVA 4O9DA 5EAMA 1M1XA 3IUNA 4G56B 1VE6A 3U4YA 3MUOA 2QXVA 4Z7QA 3EI1A 2VDNA 1JOFA 4DNWA 3OKYA 4FA1D 2Z2OA 5GMKn 4PNKB 1MDAH 2P9PC 1PEVA 4JSNC 4QAMA 4IA9A 3SN6B 4ERZA 5KDOB 4J8GA 5C2WB 4WJKA 2TRCB 1B9XA 1QFMA 1VYHC 3I89A 4QQEA 5EMMB 3K27A 3QHYB 2P9NC 1TYEA 4I79A 3V7DB 5EALA 3VI3A 4AMZA 4UM8A 2IUVA 2AGYA 4DNUA 5I5MA 4NSXA 3SBRA 5IJ8E 3VH0A 3CFVA 3DSMA 1TBGA 2H9LA 3UVMA 2HJ4A 1U4CA 4WK4A 4BL0A 5B4WA 1K3IA 2VDPA 2IWKA 1E8NA 4NC4A 2W18A
chains in the Genus database with same CATH topology
2HESX 2G99A 4A09B 4FHLA 3DXMC 2H6QA 4O3TB 3SHFA 2J55H 2BCJB 1MG3A 5EMKB 3IIYA 4BUJC 3AL9A 5C2VB 1Q47A 4QT8A 5A2Qg 4GZ8A 3GFCA 3I8EA 4J8BA 1GP2B 2OK6A 3JZHA 4CY5A 5HE3B 3SFZA 2HJBA 4J84A 3RFHA 2CE8A 1JMXB 3EG6A 3UKUC 3UR4A 2AGLA 3C9CA 5EARA 5AMSA 2B5MA 4Z8LA 4LG9A 3ULEC 2H13A 1FWXA 2H68A 1TYQC 4PSWB 1MG2A 2I3TA 3W15A 4AOWA 2OIZA 3MMYA 5JWZA 2H9PA 4PBZA 3AH8B 5C9ZB 1L0QA 2IUPA 5FKTA 4GM3A 3DXKC 4L1QD 5IC7A 4A11B 5FKRA 3BWSA 2PM9A 1NR0A 4J86A 3RMZD 3UVLA 3V5WB 3NVXA 1XIPA 3EI2B 5HE2B 3NVQA 4A08A 4H5JA 2H6KA 3DM0A 2J57G 3F3FA 4D6VA 4GQBB 5HYNB 3EI4A 2XYIA 2AGZA 4XYHA 2YMUA 4FA9D 4FAND 5GXHA 2I0SA 5CXCA 5EMLB 3PXWD 4K3JB 2P9KC 5GSAA 4XYIA 4ERQA 2YB8B 2AGXA 4JT5C 1S4UX 4CI2A 3OKYB 2UZXB 4X3EA 4CI1A 3SJLD 3RSEC 2J56H 2PM9B 3PVWB 2OVQB 5HE1B 1SHYB 2GC4A 2HKRA 5I5IA 2H9NA 4QRJA 3OKWA 3I7KA 3EI3A 4ZN4A 1A0RB 2OVRB 4ERYA 3JZNA 1GXRA 2CO0A 1N6EA 4CI3A 4ZOZA 5CXCB 3IJ0A 3OL2B 2CN3A 4ES0A 4CZXA 3EI4B 3FRXA 2XL2A 3EI1B 4BH6A 3EI2A 3AFCA 3BG1A 3JRPA 3RN0D 1K32A 5I5JA 2B4EA 2YNNA 5CXBB 2CE9A 3I7HA 3MKQA 3IIWA 4O1QD 4U1EI 4J77A 5IGOA 5EAPA 3V9FA 4OZUA 3L4MD 2I0TA 2H14A 4MK0B 3MZKA 2YNPA 5CYKB 4A0AA 3A0FA 3N0DA 2CO0C 4ZOYA 1OLZA 2GC7A 3FM0A 2O9KA 1GG2B 3DWLC 3HFQA 2PBIB 4Y7RA 4YVDA 2I3SA 3JAMg 3UVOA 4TZ4A 1SQJA 3OKTA 3OL2A 3C99A 3SCYA 5H14A 2B5NA 3KRWB 4X60B 3I7LA 2MTAH 2P9LC 4JSVC 3I8CA 3EWEA 2AH0A 2H47A 2UZYB 3ODTA 4L9OA 3E0CA 5HQGA 2OJYA 2IAAA 3SXTD 4A7JA 4GM8A 4CZYA 5FA5B 3SMRA 4J0XA 2EBSA 3JB9L 2G9AA 4FB1D 3SWSD 4J78A 1XKSA 1PGUA 4J73A 3BG0A 5FXYA 3UVKA 5FLXg 4L3HD 1PBYB 2CN2A 4J82A 3PXSD 5H1MA 1RI6A 3RN1D 3IKOA 4N14A 4A09A 4GQ2P 5TDHB 3ORVD 3PSLA 3IJCA 2IURA 4JSXC 1N6FA 2XL3A 2P9IC 4H5IA 2B5LA 2AH1A 4UI9R 4A0BA 4GGDA 4JSPC 3NVNA 4CC9A 4ZOVA 5THAA 3SLED 3UVNA 4ESGA 4OWRA 4X61B 3B7FA 5IJ7E 4X63B 1U2VC 5AJAA 4HDJA 3CIKB 2CNXA 4AEZA 4E5ZB 4LGNA 3I2NA 4XEIC 2I0RA 4FA5D 3JROA 2YBAA 4LG8A 3AL8A 4CI8A 1JJUB 4O3UB 4J79A 4GGCA 2IWFA 3F3PA 2PM6B 4CY1A 4PC0A 5EM2A 4A2MA 4QL1A 5CYKA 4A0AB 5EMJB 4A0BB 5H17A 2Q7QA 5GXIA 1K8KC 2BBKH 5SXMA 3SVWD 2IUQA 1ERJA 4J0WA 4Y5RD 3MZLA 2H3XA 3PSCB 3N0EA 3J81g 3FGBA 4J81A 5AFU3 5IGQA 4ZOXA 3RLMD 3I7NA 2H6NA 5CXBA 4FA4D 5HE0B 3PXTD 4JXMA 4GQ1A 3ZWLB 3P4FA 3PE7A 1JMZB 3IJ1A 4E54B 1YFQA 3AL8B 5K19A 2Z2NA 3EI3B 3CFSB 5TF2A 2Z2PA 4JT6C 2GNQA 5IT9g 4FAVD 3PVUB 4A2LA 3JPXA 5FQDA 3MXXA 5EM2B 4J87A 4PBYA 2AQ5A 3OTTA 2HXCA 4JD2C 5TEFA 3SBQA 4EWRA 2PM7B 4CY2A 4FWWA 3GREA 3OW8A 2XU7A 4GM9A 4CY3A 4IMMA 3RRMC 3VA6A 4L3GD 1PI6A 5FKQA 3MKSB 4R7AB 1N6DA 4GGAA 3KRXB 2HKMA 1GOTB 2HYEA 1R5MA 4PSXB 2P9SC 4GMBA 3SBPA 1NEXB 4D0KA 4O45A 5K1CC 4E54A 4PXWA 3C5MA 3JZGA 2AGWA 2QC5A 5TEEA 3C75H 3EU7A 3J80g 3I7PA 3F3GA 2P9UC 1SQ9A 4K3ID 2YNOA 4U7AA 4KFMB 2H9MA 3VGZA 4A11A 2OK4A 3UKRC 4E5ZA 2OVPB 1OMWB 5FKSA 3I7OA 1P22A 1XHMA 3EMHA 3K26A 1B9YA 3RFGA 3L4OD 4A08B 1QNIA 4CZVA 4O9DA 5EAMA 4G56B 3U4YA 2QXVA 3EI1A 1JOFA 3OKYA 4FA1D 2Z2OA 5GMKn 4PNKB 1MDAH 2P9PC 1PEVA 4JSNC 4IA9A 3SN6B 4ERZA 5KDOB 4J8GA 5C2WB 2TRCB 1B9XA 1VYHC 3I89A 4QQEA 5EMMB 3K27A 2P9NC 4I79A 3V7DB 5EALA 2IUVA 2AGYA 5I5MA 4NSXA 3SBRA 5IJ8E 3VH0A 3CFVA 3DSMA 1TBGA 2H9LA 3UVMA 2HJ4A 1U4CA 4BL0A 5B4WA 2IWKA 2W18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HES X;  2G99 A;  4A09 B;  4FHL A;  3DXM C;  2H6Q A;  4O3T B;  3SHF A;  2J55 H;  2BCJ B;  1MG3 A;  5EMK B;  3IIY A;  4BUJ C;  3AL9 A;  5C2V B;  1Q47 A;  4QT8 A;  5A2Q g;  4GZ8 A;  3GFC A;  3I8E A;  4J8B A;  1GP2 B;  2OK6 A;  3JZH A;  4CY5 A;  5HE3 B;  3SFZ A;  2HJB A;  4J84 A;  3RFH A;  2CE8 A;  1JMX B;  3EG6 A;  3UKU C;  3UR4 A;  2AGL A;  3C9C A;  5EAR A;  5AMS A;  2B5M A;  4Z8L A;  4LG9 A;  3ULE C;  2H13 A;  1FWX A;  2H68 A;  1TYQ C;  4PSW B;  1MG2 A;  2I3T A;  3W15 A;  4AOW A;  2OIZ A;  3MMY A;  5JWZ A;  2H9P A;  4PBZ A;  3AH8 B;  5C9Z B;  1L0Q A;  2IUP A;  5FKT A;  4GM3 A;  3DXK C;  4L1Q D;  5IC7 A;  4A11 B;  5FKR A;  3BWS A;  2PM9 A;  1NR0 A;  4J86 A;  3RMZ D;  3UVL A;  3V5W B;  3NVX A;  1XIP A;  3EI2 B;  5HE2 B;  3NVQ A;  4A08 A;  4H5J A;  2H6K A;  3DM0 A;  2J57 G;  3F3F A;  4D6V A;  4GQB B;  5HYN B;  3EI4 A;  2XYI A;  2AGZ A;  4XYH A;  2YMU A;  4FA9 D;  4FAN D;  5GXH A;  2I0S A;  5CXC A;  5EML B;  3PXW D;  4K3J B;  2P9K C;  5GSA A;  4XYI A;  4ERQ A;  2YB8 B;  2AGX A;  4JT5 C;  1S4U X;  4CI2 A;  3OKY B;  2UZX B;  4X3E A;  4CI1 A;  3SJL D;  3RSE C;  2J56 H;  2PM9 B;  3PVW B;  2OVQ B;  5HE1 B;  1SHY B;  2GC4 A;  2HKR A;  5I5I A;  2H9N A;  4QRJ A;  3OKW A;  3I7K A;  3EI3 A;  4ZN4 A;  1A0R B;  2OVR B;  4ERY A;  3JZN A;  1GXR A;  2CO0 A;  1N6E A;  4CI3 A;  4ZOZ A;  5CXC B;  3IJ0 A;  3OL2 B;  2CN3 A;  4ES0 A;  4CZX A;  3EI4 B;  3FRX A;  2XL2 A;  3EI1 B;  4BH6 A;  3EI2 A;  3AFC A;  3BG1 A;  3JRP A;  3RN0 D;  1K32 A;  5I5J A;  2B4E A;  2YNN A;  5CXB B;  2CE9 A;  3I7H A;  3MKQ A;  3IIW A;  4O1Q D;  4U1E I;  4J77 A;  5IGO A;  5EAP A;  3V9F A;  4OZU A;  3L4M D;  2I0T A;  2H14 A;  4MK0 B;  3MZK A;  2YNP A;  5CYK B;  4A0A A;  3A0F A;  3N0D A;  2CO0 C;  4ZOY A;  1OLZ A;  2GC7 A;  3FM0 A;  2O9K A;  1GG2 B;  3DWL C;  3HFQ A;  2PBI B;  4Y7R A;  4YVD A;  2I3S A;  3JAM g;  3UVO A;  4TZ4 A;  1SQJ A;  3OKT A;  3OL2 A;  3C99 A;  3SCY A;  5H14 A;  2B5N A;  3KRW B;  4X60 B;  3I7L A;  2MTA H;  2P9L C;  4JSV C;  3I8C A;  3EWE A;  2AH0 A;  2H47 A;  2UZY B;  3ODT A;  4L9O A;  3E0C A;  5HQG A;  2OJY A;  2IAA A;  3SXT D;  4A7J A;  4GM8 A;  4CZY A;  5FA5 B;  3SMR A;  4J0X A;  2EBS A;  3JB9 L;  2G9A A;  4FB1 D;  3SWS D;  4J78 A;  1XKS A;  1PGU A;  4J73 A;  3BG0 A;  5FXY A;  3UVK A;  5FLX g;  4L3H D;  1PBY B;  2CN2 A;  4J82 A;  3PXS D;  5H1M A;  1RI6 A;  3RN1 D;  3IKO A;  4N14 A;  4A09 A;  4GQ2 P;  5TDH B;  3ORV D;  3PSL A;  3IJC A;  2IUR A;  4JSX C;  1N6F A;  2XL3 A;  2P9I C;  4H5I A;  2B5L A;  2AH1 A;  4UI9 R;  4A0B A;  4GGD A;  4JSP C;  3NVN A;  4CC9 A;  4ZOV A;  5THA A;  3SLE D;  3UVN A;  4ESG A;  4OWR A;  4X61 B;  3B7F A;  5IJ7 E;  4X63 B;  1U2V C;  5AJA A;  4HDJ A;  3CIK B;  2CNX A;  4AEZ A;  4E5Z B;  4LGN A;  3I2N A;  4XEI C;  2I0R A;  4FA5 D;  3JRO A;  2YBA A;  4LG8 A;  3AL8 A;  4CI8 A;  1JJU B;  4O3U B;  4J79 A;  4GGC A;  2IWF A;  3F3P A;  2PM6 B;  4CY1 A;  4PC0 A;  5EM2 A;  4A2M A;  4QL1 A;  5CYK A;  4A0A B;  5EMJ B;  4A0B B;  5H17 A;  2Q7Q A;  5GXI A;  1K8K C;  2BBK H;  5SXM A;  3SVW D;  2IUQ A;  1ERJ A;  4J0W A;  4Y5R D;  3MZL A;  2H3X A;  3PSC B;  3N0E A;  3J81 g;  3FGB A;  4J81 A;  5AFU 3;  5IGQ A;  4ZOX A;  3RLM D;  3I7N A;  2H6N A;  5CXB A;  4FA4 D;  5HE0 B;  3PXT D;  4JXM A;  4GQ1 A;  3ZWL B;  3P4F A;  3PE7 A;  1JMZ B;  3IJ1 A;  4E54 B;  1YFQ A;  3AL8 B;  5K19 A;  2Z2N A;  3EI3 B;  3CFS B;  5TF2 A;  2Z2P A;  4JT6 C;  2GNQ A;  5IT9 g;  4FAV D;  3PVU B;  4A2L A;  3JPX A;  5FQD A;  3MXX A;  5EM2 B;  4J87 A;  4PBY A;  2AQ5 A;  3OTT A;  2HXC A;  4JD2 C;  5TEF A;  3SBQ A;  4EWR A;  2PM7 B;  4CY2 A;  4FWW A;  3GRE A;  3OW8 A;  2XU7 A;  4GM9 A;  4CY3 A;  4IMM A;  3RRM C;  3VA6 A;  4L3G D;  1PI6 A;  5FKQ A;  3MKS B;  4R7A B;  1N6D A;  4GGA A;  3KRX B;  2HKM A;  1GOT B;  2HYE A;  1R5M A;  4PSX B;  2P9S C;  4GMB A;  3SBP A;  1NEX B;  4D0K A;  4O45 A;  5K1C C;  4E54 A;  4PXW A;  3C5M A;  3JZG A;  2AGW A;  2QC5 A;  5TEE A;  3C75 H;  3EU7 A;  3J80 g;  3I7P A;  3F3G A;  2P9U C;  1SQ9 A;  4K3I D;  2YNO A;  4U7A A;  4KFM B;  2H9M A;  3VGZ A;  4A11 A;  2OK4 A;  3UKR C;  4E5Z A;  2OVP B;  1OMW B;  5FKS A;  3I7O A;  1P22 A;  1XHM A;  3EMH A;  3K26 A;  1B9Y A;  3RFG A;  3L4O D;  4A08 B;  1QNI A;  4CZV A;  4O9D A;  5EAM A;  4G56 B;  3U4Y A;  2QXV A;  3EI1 A;  1JOF A;  3OKY A;  4FA1 D;  2Z2O A;  5GMK n;  4PNK B;  1MDA H;  2P9P C;  1PEV A;  4JSN C;  4IA9 A;  3SN6 B;  4ERZ A;  5KDO B;  4J8G A;  5C2W B;  2TRC B;  1B9X A;  1VYH C;  3I89 A;  4QQE A;  5EMM B;  3K27 A;  2P9N C;  4I79 A;  3V7D B;  5EAL A;  2IUV A;  2AGY A;  5I5M A;  4NSX A;  3SBR A;  5IJ8 E;  3VH0 A;  3CFV A;  3DSM A;  1TBG A;  2H9L A;  3UVM A;  2HJ4 A;  1U4C A;  4BL0 A;  5B4W A;  2IWK A;  2W18 A; 
#chains in the Genus database with same CATH topology
 2HES X;  2G99 A;  3EQ9 A;  4A09 B;  4FHL A;  3DXM C;  2H6Q A;  5C92 A;  4O3T B;  3SHF A;  2J55 H;  2BCJ B;  4G1M A;  1MG3 A;  5EMK B;  3IIY A;  4BUJ C;  3AL9 A;  1E8M A;  5C2V B;  1Q47 A;  4QT8 A;  5A2Q g;  4GZ8 A;  3GFC A;  3I8E A;  4J8B A;  1GP2 B;  1C9L A;  2OK6 A;  3JZH A;  4CY5 A;  5HE3 B;  1GOG A;  2HU5 A;  1UOQ A;  3SFZ A;  2HJB A;  1L5G A;  1GOF A;  4J84 A;  3RFH A;  2XZG A;  2CE8 A;  1JMX B;  3EG6 A;  3UKU C;  3MUN A;  3UR4 A;  2AGL A;  3C9C A;  5EAR A;  5AMS A;  2B5M A;  4Z8L A;  4LG9 A;  3ULE C;  2QR5 A;  2H13 A;  1FWX A;  2H68 A;  4AN0 A;  1TYQ C;  4PSW B;  1MG2 A;  2I3T A;  3W15 A;  4AOW A;  2OIZ A;  3MMY A;  5JWZ A;  2H9P A;  3GC3 B;  4PBZ A;  3AH8 B;  5C9Z B;  1L0Q A;  1UOO A;  2IUP A;  5FKT A;  3K72 A;  4GM3 A;  3DXK C;  4L1Q D;  4MMZ A;  5IC7 A;  4A11 B;  1H2W A;  3KCI A;  5FKR A;  3BWS A;  2PM9 A;  1H2Z A;  3O4I A;  1NR0 A;  4J86 A;  4IRZ A;  3RMZ D;  3UVL A;  3FCU A;  3V5W B;  3NVX A;  4G55 A;  1XIP A;  3O4G A;  5HE2 B;  3EI2 B;  5E6U A;  3NVQ A;  4A08 A;  4H5J A;  2H6K A;  3DM0 A;  2J57 G;  3F3F A;  4D6V A;  4GQB B;  4Z7O A;  5HYN B;  3EI4 A;  2XYI A;  2AGZ A;  4XYH A;  2YMU A;  4FA9 D;  1VZ3 A;  4FAN D;  5GXH A;  3IUQ A;  5M5S A;  2I0S A;  4DNV A;  5CXC A;  5EML B;  3PXW D;  4K3J B;  2P9K C;  5GSA A;  4XYI A;  4ERQ A;  2YB8 B;  2AGX A;  3NIF A;  4JT5 C;  1S4U X;  4CI2 A;  3OKY B;  2UZX B;  2BKL A;  4X3E A;  4CI1 A;  3SJL D;  3RSE C;  2VDL A;  2J56 H;  2PM9 B;  3PVW B;  4D9S A;  1VE7 A;  2OVQ B;  5HE1 B;  1SHY B;  2VDM A;  1A12 A;  2GC4 A;  4BCB A;  2HKR A;  5I5I A;  2H9N A;  4QRJ A;  3OKW A;  3I7K A;  3EI3 A;  4ZN4 A;  1A0R B;  2OVR B;  4ERY A;  3IJE A;  2VDK A;  3JZN A;  1GXR A;  2CO0 A;  1N6E A;  4CI3 A;  1JTD B;  5M5U A;  4ZOZ A;  5CXC B;  3IJ0 A;  3OL2 B;  2HU7 A;  2CN3 A;  4ES0 A;  4CZX A;  3EI4 B;  3GD1 I;  3FRX A;  2XL2 A;  3EI1 B;  4BP8 A;  4BH6 A;  4JHN A;  3EI2 A;  3AFC A;  4RE5 A;  3BG1 A;  3JRP A;  3RN0 D;  1K32 A;  5I5J A;  3T3M A;  2B4E A;  4BCD A;  2YNN A;  5CXB B;  2CE9 A;  3I7H A;  1VZ2 A;  3MKQ A;  3IIW A;  4O1Q D;  4J77 A;  4U1E I;  5IGO A;  5EAP A;  3V9F A;  4OZU A;  3L4M D;  1UTC A;  2I0T A;  2H14 A;  4MK0 B;  3MZK A;  3IUL A;  2YNP A;  3ZE1 A;  2WQ8 A;  5CYK B;  4A0A A;  5E6R A;  3A0F A;  4Z7N A;  3N0D A;  2CO0 C;  4ZOY A;  1OLZ A;  2GC7 A;  3FM0 A;  2O9K A;  1GG2 B;  3DWL C;  3HFQ A;  3O4J A;  2PBI B;  4Y7R A;  4YVD A;  2I3S A;  3JAM g;  1H2Y A;  3UVO A;  4TZ4 A;  3NID A;  1SQJ A;  3OKT A;  3OL2 A;  3C99 A;  3SCY A;  4UM9 A;  2B5N A;  5H14 A;  3KRW B;  4X60 B;  3I7L A;  2MTA H;  2P9L C;  4JSV C;  3I8C A;  3EWE A;  2AH0 A;  2H47 A;  1BPO A;  2UZY B;  2VZ1 A;  2VZ3 A;  3ODT A;  3E0C A;  4L9O A;  5HQG A;  2OJY A;  2IAA A;  3QI0 A;  3SXT D;  4G1E A;  3T3P A;  4A7J A;  4GM8 A;  4CZY A;  1E5T A;  3V4P A;  3EQ7 A;  2VDR A;  4BP9 A;  5FA5 B;  3SMR A;  1O6F A;  4J0X A;  2EBS A;  3JB9 L;  2G9A A;  4FB1 D;  3SWS D;  4J78 A;  1XKS A;  1PGU A;  3DDU A;  4J73 A;  4AMY A;  3BG0 A;  5FXY A;  3UVK A;  5FLX g;  4AN1 A;  3FCS A;  4L3H D;  2EIC A;  1PBY B;  2CN2 A;  4J82 A;  3PXS D;  4L1M A;  5H1M A;  1RI6 A;  3RN1 D;  1QFS A;  3IKO A;  1O6G A;  4N14 A;  1U8C A;  3ZDZ A;  4GQ2 P;  4A09 A;  5TDH B;  3ORV D;  1C9I A;  3PSL A;  3IJC A;  3O4H A;  1GOH A;  2IUR A;  4JSX C;  1N6F A;  2XL3 A;  2P9I C;  4H5I A;  2B5L A;  2AH1 A;  1JV2 A;  4NEN A;  4UI9 R;  4A0B A;  4GGD A;  4JSP C;  3NVN A;  2EID A;  4CC9 A;  4ZOV A;  5THA A;  3SLE D;  3UVN A;  4ESG A;  4OWR A;  3ZDX A;  5M61 A;  4X61 B;  3B7F A;  1H2X A;  5IJ7 E;  3EQ8 A;  1U2V C;  4X63 B;  5AJA A;  4BCC A;  4HDJ A;  3CIK B;  5HDB A;  2CNX A;  4AEZ A;  4E5Z B;  4LGN A;  3I2N A;  4XEI C;  2I0R A;  4FA5 D;  3JRO A;  4MMX A;  2YBA A;  2XDW A;  4LG8 A;  3AL8 A;  4CI8 A;  1JJU B;  4O3U B;  5E6S A;  2EIE A;  4J79 A;  4GGC A;  2IWF A;  3F3P A;  2PM6 B;  4CY1 A;  4PC0 A;  5EM2 A;  3IUR A;  1I2M B;  1UOP A;  4A2M A;  2QZP A;  4QL1 A;  2VDQ A;  5CYK A;  4A0A B;  2VDO A;  3V4V A;  5EMJ B;  4A0B B;  1T2X A;  5H17 A;  2Q7Q A;  5GXI A;  1K8K C;  2BBK H;  5FFG A;  5SXM A;  3SVW D;  2IUQ A;  1ERJ A;  4J0W A;  4Y5R D;  3MZL A;  2H3X A;  3PSC B;  3N0E A;  3J81 g;  3FGB A;  4J81 A;  5AFU 3;  5IGQ A;  4ZOX A;  3RLM D;  3I7N A;  2H6N A;  5CXB A;  4FA4 D;  5HE0 B;  5C86 A;  2XE4 A;  3PXT D;  4JXM A;  4GQ1 A;  2VC2 A;  3ZWL B;  3P4F A;  3PE7 A;  1JMZ B;  3IJ1 A;  4E54 B;  1YFQ A;  3AL8 B;  5K19 A;  2Z2N A;  3EI3 B;  4WK0 A;  3CFS B;  4WK2 A;  5TF2 A;  4AX4 A;  2Z2P A;  4JT6 C;  3ZDY A;  3IUM A;  2GNQ A;  5IT9 g;  4FAV D;  3ZE0 A;  3PVU B;  4A2L A;  3IUJ A;  3JPX A;  5FQD A;  5M5T A;  3MXX A;  3K71 A;  3NIG A;  5EM2 B;  4J87 A;  2JKX A;  5M5R A;  2AQ5 A;  4NAA A;  3OTT A;  2HXC A;  4JD2 C;  4PBY A;  5TEF A;  3SBQ A;  5M5V A;  4EWR A;  2PM7 B;  4CY2 A;  4FWW A;  3IVM A;  3GRE A;  3OW8 A;  4MMY A;  3K6S A;  2XU7 A;  4GM9 A;  4CY3 A;  4IMM A;  3RRM C;  3VA6 A;  4L3G D;  4NBM A;  1PI6 A;  1YR2 A;  3MKS B;  4R7A B;  5FKQ A;  1N6D A;  4GGA A;  3KRX B;  2HKM A;  1GOT B;  2HYE A;  1R5M A;  3MVD K;  4PSX B;  2P9S C;  4GMB A;  3SBP A;  1NEX B;  4D0K A;  4O45 A;  3OF7 A;  5K1C C;  4RE6 A;  3ZE2 A;  4E54 A;  4PXW A;  2HU8 A;  3C5M A;  3JZG A;  2AGW A;  2EIB A;  2QC5 A;  4JHP C;  5TEE A;  3C75 H;  3EU7 A;  3J80 g;  3I7P A;  3F3G A;  2P9U C;  1SQ9 A;  4K3I D;  2YNO A;  4U7A A;  4KFM B;  3VI4 A;  2H9M A;  5FFO A;  3VGZ A;  4O02 A;  4A11 A;  2OK4 A;  3UKR C;  4E5Z A;  2OVP B;  1OMW B;  5FKS A;  3I7O A;  4O2W A;  1P22 A;  1XHM A;  3EMH A;  3K26 A;  1B9Y A;  3RFG A;  3L4O D;  4A08 B;  1QNI A;  4CZV A;  4O9D A;  5EAM A;  1M1X A;  3IUN A;  4G56 B;  1VE6 A;  3U4Y A;  3MUO A;  2QXV A;  4Z7Q A;  3EI1 A;  2VDN A;  1JOF A;  4DNW A;  3OKY A;  4FA1 D;  2Z2O A;  5GMK n;  4PNK B;  1MDA H;  2P9P C;  1PEV A;  4JSN C;  4QAM A;  4IA9 A;  3SN6 B;  4ERZ A;  5KDO B;  4J8G A;  5C2W B;  4WJK A;  2TRC B;  1B9X A;  1QFM A;  1VYH C;  3I89 A;  4QQE A;  5EMM B;  3K27 A;  3QHY B;  2P9N C;  1TYE A;  4I79 A;  3V7D B;  5EAL A;  3VI3 A;  4AMZ A;  4UM8 A;  2IUV A;  2AGY A;  4DNU A;  5I5M A;  4NSX A;  3SBR A;  5IJ8 E;  3VH0 A;  3CFV A;  3DSM A;  1TBG A;  2H9L A;  3UVM A;  2HJ4 A;  1U4C A;  4WK4 A;  4BL0 A;  5B4W A;  1K3I A;  2VDP A;  2IWK A;  1E8N A;  4NC4 A;  2W18 A; 
#chains in the Genus database with same CATH homology
 2HES X;  2G99 A;  4A09 B;  4FHL A;  3DXM C;  2H6Q A;  4O3T B;  3SHF A;  2J55 H;  2BCJ B;  1MG3 A;  5EMK B;  3IIY A;  4BUJ C;  3AL9 A;  5C2V B;  1Q47 A;  4QT8 A;  5A2Q g;  4GZ8 A;  3GFC A;  3I8E A;  4J8B A;  1GP2 B;  2OK6 A;  3JZH A;  4CY5 A;  5HE3 B;  3SFZ A;  2HJB A;  4J84 A;  3RFH A;  2CE8 A;  1JMX B;  3EG6 A;  3UKU C;  3UR4 A;  2AGL A;  3C9C A;  5EAR A;  5AMS A;  2B5M A;  4Z8L A;  4LG9 A;  3ULE C;  2H13 A;  1FWX A;  2H68 A;  1TYQ C;  4PSW B;  1MG2 A;  2I3T A;  3W15 A;  4AOW A;  2OIZ A;  3MMY A;  5JWZ A;  2H9P A;  4PBZ A;  3AH8 B;  5C9Z B;  1L0Q A;  2IUP A;  5FKT A;  4GM3 A;  3DXK C;  4L1Q D;  5IC7 A;  4A11 B;  5FKR A;  3BWS A;  2PM9 A;  1NR0 A;  4J86 A;  3RMZ D;  3UVL A;  3V5W B;  3NVX A;  1XIP A;  3EI2 B;  5HE2 B;  3NVQ A;  4A08 A;  4H5J A;  2H6K A;  3DM0 A;  2J57 G;  3F3F A;  4D6V A;  4GQB B;  5HYN B;  3EI4 A;  2XYI A;  2AGZ A;  4XYH A;  2YMU A;  4FA9 D;  4FAN D;  5GXH A;  2I0S A;  5CXC A;  5EML B;  3PXW D;  4K3J B;  2P9K C;  5GSA A;  4XYI A;  4ERQ A;  2YB8 B;  2AGX A;  4JT5 C;  1S4U X;  4CI2 A;  3OKY B;  2UZX B;  4X3E A;  4CI1 A;  3SJL D;  3RSE C;  2J56 H;  2PM9 B;  3PVW B;  2OVQ B;  5HE1 B;  1SHY B;  2GC4 A;  2HKR A;  5I5I A;  2H9N A;  4QRJ A;  3OKW A;  3I7K A;  3EI3 A;  4ZN4 A;  1A0R B;  2OVR B;  4ERY A;  3JZN A;  1GXR A;  2CO0 A;  1N6E A;  4CI3 A;  4ZOZ A;  5CXC B;  3IJ0 A;  3OL2 B;  2CN3 A;  4ES0 A;  4CZX A;  3EI4 B;  3FRX A;  2XL2 A;  3EI1 B;  4BH6 A;  3EI2 A;  3AFC A;  3BG1 A;  3JRP A;  3RN0 D;  1K32 A;  5I5J A;  2B4E A;  2YNN A;  5CXB B;  2CE9 A;  3I7H A;  3MKQ A;  3IIW A;  4O1Q D;  4U1E I;  4J77 A;  5IGO A;  5EAP A;  3V9F A;  4OZU A;  3L4M D;  2I0T A;  2H14 A;  4MK0 B;  3MZK A;  2YNP A;  5CYK B;  4A0A A;  3A0F A;  3N0D A;  2CO0 C;  4ZOY A;  1OLZ A;  2GC7 A;  3FM0 A;  2O9K A;  1GG2 B;  3DWL C;  3HFQ A;  2PBI B;  4Y7R A;  4YVD A;  2I3S A;  3JAM g;  3UVO A;  4TZ4 A;  1SQJ A;  3OKT A;  3OL2 A;  3C99 A;  3SCY A;  5H14 A;  2B5N A;  3KRW B;  4X60 B;  3I7L A;  2MTA H;  2P9L C;  4JSV C;  3I8C A;  3EWE A;  2AH0 A;  2H47 A;  2UZY B;  3ODT A;  4L9O A;  3E0C A;  5HQG A;  2OJY A;  2IAA A;  3SXT D;  4A7J A;  4GM8 A;  4CZY A;  5FA5 B;  3SMR A;  4J0X A;  2EBS A;  3JB9 L;  2G9A A;  4FB1 D;  3SWS D;  4J78 A;  1XKS A;  1PGU A;  4J73 A;  3BG0 A;  5FXY A;  3UVK A;  5FLX g;  4L3H D;  1PBY B;  2CN2 A;  4J82 A;  3PXS D;  5H1M A;  1RI6 A;  3RN1 D;  3IKO A;  4N14 A;  4A09 A;  4GQ2 P;  5TDH B;  3ORV D;  3PSL A;  3IJC A;  2IUR A;  4JSX C;  1N6F A;  2XL3 A;  2P9I C;  4H5I A;  2B5L A;  2AH1 A;  4UI9 R;  4A0B A;  4GGD A;  4JSP C;  3NVN A;  4CC9 A;  4ZOV A;  5THA A;  3SLE D;  3UVN A;  4ESG A;  4OWR A;  4X61 B;  3B7F A;  5IJ7 E;  4X63 B;  1U2V C;  5AJA A;  4HDJ A;  3CIK B;  2CNX A;  4AEZ A;  4E5Z B;  4LGN A;  3I2N A;  4XEI C;  2I0R A;  4FA5 D;  3JRO A;  2YBA A;  4LG8 A;  3AL8 A;  4CI8 A;  1JJU B;  4O3U B;  4J79 A;  4GGC A;  2IWF A;  3F3P A;  2PM6 B;  4CY1 A;  4PC0 A;  5EM2 A;  4A2M A;  4QL1 A;  5CYK A;  4A0A B;  5EMJ B;  4A0B B;  5H17 A;  2Q7Q A;  5GXI A;  1K8K C;  2BBK H;  5SXM A;  3SVW D;  2IUQ A;  1ERJ A;  4J0W A;  4Y5R D;  3MZL A;  2H3X A;  3PSC B;  3N0E A;  3J81 g;  3FGB A;  4J81 A;  5AFU 3;  5IGQ A;  4ZOX A;  3RLM D;  3I7N A;  2H6N A;  5CXB A;  4FA4 D;  5HE0 B;  3PXT D;  4JXM A;  4GQ1 A;  3ZWL B;  3P4F A;  3PE7 A;  1JMZ B;  3IJ1 A;  4E54 B;  1YFQ A;  3AL8 B;  5K19 A;  2Z2N A;  3EI3 B;  3CFS B;  5TF2 A;  2Z2P A;  4JT6 C;  2GNQ A;  5IT9 g;  4FAV D;  3PVU B;  4A2L A;  3JPX A;  5FQD A;  3MXX A;  5EM2 B;  4J87 A;  4PBY A;  2AQ5 A;  3OTT A;  2HXC A;  4JD2 C;  5TEF A;  3SBQ A;  4EWR A;  2PM7 B;  4CY2 A;  4FWW A;  3GRE A;  3OW8 A;  2XU7 A;  4GM9 A;  4CY3 A;  4IMM A;  3RRM C;  3VA6 A;  4L3G D;  1PI6 A;  5FKQ A;  3MKS B;  4R7A B;  1N6D A;  4GGA A;  3KRX B;  2HKM A;  1GOT B;  2HYE A;  1R5M A;  4PSX B;  2P9S C;  4GMB A;  3SBP A;  1NEX B;  4D0K A;  4O45 A;  5K1C C;  4E54 A;  4PXW A;  3C5M A;  3JZG A;  2AGW A;  2QC5 A;  5TEE A;  3C75 H;  3EU7 A;  3J80 g;  3I7P A;  3F3G A;  2P9U C;  1SQ9 A;  4K3I D;  2YNO A;  4U7A A;  4KFM B;  2H9M A;  3VGZ A;  4A11 A;  2OK4 A;  3UKR C;  4E5Z A;  2OVP B;  1OMW B;  5FKS A;  3I7O A;  1P22 A;  1XHM A;  3EMH A;  3K26 A;  1B9Y A;  3RFG A;  3L4O D;  4A08 B;  1QNI A;  4CZV A;  4O9D A;  5EAM A;  4G56 B;  3U4Y A;  2QXV A;  3EI1 A;  1JOF A;  3OKY A;  4FA1 D;  2Z2O A;  5GMK n;  4PNK B;  1MDA H;  2P9P C;  1PEV A;  4JSN C;  4IA9 A;  3SN6 B;  4ERZ A;  5KDO B;  4J8G A;  5C2W B;  2TRC B;  1B9X A;  1VYH C;  3I89 A;  4QQE A;  5EMM B;  3K27 A;  2P9N C;  4I79 A;  3V7D B;  5EAL A;  2IUV A;  2AGY A;  5I5M A;  4NSX A;  3SBR A;  5IJ8 E;  3VH0 A;  3CFV A;  3DSM A;  1TBG A;  2H9L A;  3UVM A;  2HJ4 A;  1U4C A;  4BL0 A;  5B4W A;  2IWK A;  2W18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...