4X60B

Crystal structure of prmt5:mep50 with epz015666 and sinefungin
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
310
Chain Sequence
LPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 86
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4x60B00
3UKRC 4A2MA 2P9KC 5FKRA 2HJBA 4LG9A 2HYEA 2Z2NA 3PXSD 1OLZA 3UVMA 1SHYB 5HE3B 2B5MA 3I8CA 2P9SC 4A08B 1NEXB 3MZKA 5FKSA 4OZUA 4MK0B 5EMJB 5GXIA 1B9YA 3A0FA 5CXCA 3SCYA 2H9MA 2OIZA 1SQ9A 3SHFA 2Z2PA 3IIWA 3GREA 3VGZA 3IJCA 4J86A 3N0EA 2MTAH 3EI1B 5C2WB 3P4FA 4E5ZB 2H9PA 4FA4D 2G99A 5H17A 2PM7B 3NVQA 1JMZB 2B5NA 4PBZA 3EG6A 4IA9A 3RN0D 1GOTB 4JSVC 4CI8A 5AJAA 1NR0A 3PE7A 1PEVA 3SLED 1GXRA 4BH6A 2XL3A 3AFCA 4J87A 2CO0A 2H68A 2OK6A 3UVLA 4J79A 3VA6A 3W15A 2AGZA 1XKSA 2XU7A 5KDOB 3FM0A 3RRMC 4FB1D 5H1MA 4X60B 4L1QD 5FKQA 3JZGA 3EWEA 2XL2A 3MXXA 5CYKB 4N14A 5C2VB 3CIKB 4CC9A 3IJ0A 4CZYA 2OVPB 4A0BB 3DWLC 5EALA 5IT9g 3EI1A 2J56H 4ZOXA 4ERYA 2GC7A 3KRWB 5CXCB 3RFHA 3E0CA 3OW8A 4JSPC 3SBQA 3UKUC 4JSXC 2H6QA 3MMYA 4CI2A 4GZ8A 3JROA 4HDJA 3EI3B 1ERJA 4O1QD 2IWKA 4A7JA 4A08A 5TF2A 4QRJA 3C9CA 2CO0C 2PM6B 3I7HA 5TEEA 4ZN4A 2QC5A 3FGBA 4GGDA 3RN1D 4KFMB 3AH8B 3RSEC 4H5JA 4Y5RD 4ZOZA 4ERZA 4ESGA 4JT6C 3PSCB 3SBRA 3V7DB 3VH0A 4A0AB 2HKRA 4XYHA 2YNOA 3SN6B 3ORVD 5FQDA 4L3GD 3HFQA 5TDHB 2P9NC 1JOFA 3DXMC 2YNPA 2IURA 3SMRA 3EMHA 3V5WB 3JPXA 3JRPA 2H6KA 2H6NA 4X63B 2PM9A 4FAND 4QL1A 4JSNC 2HJ4A 4PSWB 3ZWLB 4PBYA 2CNXA 2P9LC 3MKSB 5HYNB 1TYQC 4J0XA 4E54A 3BWSA 2P9PC 4O9DA 4UI9R 4FHLA 3C99A 3DSMA 3MKQA 3OKYA 4LGNA 2I0TA 4JD2C 5K1CC 2OK4A 3BG0A 4GQ2P 5GMKn 4H5IA 1XIPA 3I7LA 3JZHA 3L4OD 5I5MA 4Y7RA 4U1EI 4GGAA 3C75H 4CY2A 4CY3A 5A2Qg 3PXTD 4CZXA 2UZYB 3SXTD 2OVRB 1FWXA 3FRXA 4LG8A 3I8EA 3UR4A 2GC4A 4XEIC 4GQ1A 1GP2B 5H14A 3J80g 2W18A 5EM2B 5IC7A 3PVUB 3F3FA 4G56B 4O3UB 4GM3A 2H3XA 4L3HD 3JAMg 4FA1D 2QXVA 3RMZD 3PVWB 2I3TA 3RLMD 5C9ZB 1U2VC 3OL2B 4FA5D 3JB9L 2H47A 3OL2A 4ZOYA 5GXHA 2OVQB 3I89A 4FA9D 2PM9B 5AFU3 1VYHC 5AMSA 4J0WA 5HE1B 5IJ7E 1Q47A 4U7AA 3SJLD 2XYIA 3OKTA 4IMMA 3CFSB 2YNNA 1R5MA 3DXKC 3U4YA 4PXWA 2H13A 3JZNA 2Z2OA 3KRXB 5EM2A 5EAPA 2H9NA 3SVWD 3ULEC 2I0SA 1RI6A 5HE2B 3PSLA 1QNIA 3J81g 2B4EA 3SFZA 4CI3A 4JXMA 5I5JA 4CZVA 5FLXg 5EMMB 2HKMA 4J8GA 4J82A 3OTTA 2G9AA 2H9LA 4J77A 3AL8B 5EARA 2P9UC 1PBYB 4GMBA 1L0QA 1MG3A 3OKYB 4QQEA 2EBSA 2YBAA 3RFGA 2CE8A 4GM9A 1MG2A 3IIYA 4GGCA 3EI2A 5EMLB 2GNQA 3AL9A 3IJ1A 4QT8A 4L9OA 4A11B 4J84A 4A11A 4GM8A 2YMUA 2IUVA 1U4CA 5HE0B 2O9KA 3SWSD 4A0BA 1PGUA 3EI2B 3SBPA 1XHMA 1N6DA 3EU7A 4R7AB 5JWZA 2AGWA 2YB8B 4Z8LA 2HESX 2I0RA 2I3SA 4BUJC 4E54B 1K8KC 2AGYA 5IGQA 3BG1A 3V9FA 5IJ8E 5I5IA 1K32A 3EI4A 2HXCA 4EWRA 4AEZA 3EI4B 4J78A 5FKTA 4PNKB 1PI6A 5B4WA 4J73A 5K19A 3F3PA 5TEFA 4OWRA 2UZXB 5EAMA 1GG2B 1YFQA 2IUQA 5FA5B 2IUPA 2Q7QA 5THAA 2CN2A 2B5LA 4FWWA 4K3JB 3UVNA 3EI3A 4K3ID 4CY1A 4FAVD 3I7PA 5SXMA 4D0KA 4A09B 3GFCA 3I7OA 3F3GA 4ES0A 4I79A 1OMWB 4J8BA 4CY5A 3I7NA 1N6EA 4A2LA 2AH0A 2AH1A 4TZ4A 1TBGA 3I7KA 4AOWA 3CFVA 2CN3A 5IGOA 1JMXB 1N6FA 2J57G 1P22A 4JT5C 2BCJB 4NSXA 4O45A 3NVNA 1JJUB 5HQGA 3AL8A 3UVKA 3UVOA 2J55H 3PXWD 1B9XA 3B7FA 4PSXB 5CYKA 4J81A 4BL0A 4GQBB 4A0AA 5GSAA 3ODTA 2AGXA 3L4MD 3K27A 2AGLA 2AQ5A 2PBIB 2TRCB 3C5MA 4X3EA 4ZOVA 4D6VA 3OKWA 2P9IC 3K26A 2CE9A 2IWFA 5FXYA 3NVXA 5CXBB 3IKOA 4E5ZA 3MZLA 1S4UX 4ERQA 4A09A 4CI1A 1SQJA 4XYIA 2H14A 4X61B 5EMKB 3N0DA 3DM0A 4O3TB 1MDAH 2IAAA 3I2NA 4YVDA 5CXBA 1A0RB 2OJYA 2BBKH 4PC0A
chains in the Genus database with same CATH superfamily
3UKRC 4A2MA 3V4VA 4O02A 2P9KC 5FKRA 2HJBA 2HU5A 4LG9A 2HYEA 2Z2NA 1VZ2A 3IUQA 3PXSD 4DNVA 1OLZA 3UVMA 1SHYB 5HE3B 2B5MA 3I8CA 2P9SC 4A08B 1NEXB 3MZKA 1UOPA 5FKSA 4OZUA 4MK0B 5EMJB 5GXIA 1B9YA 3A0FA 5CXCA 5M5TA 3SCYA 2H9MA 2OIZA 1SQ9A 1VE6A 3SHFA 3KCIA 3OF7A 2Z2PA 3IIWA 3GREA 3VGZA 2VDMA 3IJCA 4J86A 3N0EA 3ZDYA 4AN0A 2MTAH 3O4IA 3EI1B 5C2WB 3P4FA 4E5ZB 2H9PA 4FA4D 1QFSA 2G99A 5H17A 2PM7B 3NVQA 1JMZB 1JV2A 2B5NA 2XZGA 4PBZA 3EG6A 4IA9A 3RN0D 1GOTB 4JSVC 4CI8A 1H2WA 2VZ3A 5AJAA 1NR0A 3PE7A 1PEVA 3K6SA 3SLED 2XE4A 1GXRA 4BH6A 2XL3A 2VZ1A 3AFCA 4J87A 2CO0A 2H68A 2OK6A 3UVLA 4J79A 3VA6A 4DNUA 3W15A 2AGZA 2JKXA 1XKSA 2XU7A 5KDOB 1E5TA 1H2YA 3FM0A 3RRMC 4FB1D 3ZDZA 5H1MA 4X60B 4L1QD 5FKQA 3JZGA 3EWEA 2XL2A 3MXXA 5CYKB 4QAMA 4N14A 2QZPA 3CIKB 5C2VB 4CC9A 2EIEA 3IJ0A 4CZYA 1M1XA 2OVPB 4A0BB 3DWLC 5EALA 5IT9g 3EI1A 2J56H 2VDPA 4ZOXA 4ERYA 2GC7A 3KRWB 5M5RA 5CXCB 3RFHA 3E0CA 4Z7NA 2VDOA 4WJKA 3OW8A 4JSPC 3SBQA 4WK4A 3UKUC 4JSXC 2H6QA 3MMYA 1E8NA 4CI2A 4GZ8A 3JROA 1U8CA 4HDJA 3EI3B 1ERJA 4O1QD 2IWKA 4A7JA 4A08A 5TF2A 4QRJA 3C9CA 4JHPC 2CO0C 3GD1I 2PM6B 3I7HA 5TEEA 4ZN4A 3MUOA 2QC5A 3FGBA 4GGDA 3RN1D 4DNWA 4KFMB 4G55A 3AH8B 3RSEC 4H5JA 4BP8A 4Y5RD 4ZOZA 4ERZA 4ESGA 4IRZA 4JT6C 3PSCB 3SBRA 3V7DB 3VH0A 4A0AB 2HKRA 4Z7QA 4XYHA 2YNOA 3SN6B 3ORVD 5FQDA 1UOQA 1K3IA 4L3GD 1BPOA 3HFQA 2EICA 5TDHB 2P9NC 3K71A 1JOFA 3DXMC 2YNPA 2IURA 1A12A 3SMRA 3EMHA 5C92A 3V5WB 3JPXA 3JRPA 2H6KA 2H6NA 4X63B 2PM9A 4FAND 4JSNC 2HJ4A 4QL1A 4PSWB 3ZWLB 4BCCA 4PBYA 2CNXA 1GOGA 2P9LC 2QR5A 3MKSB 5HYNB 1TYQC 4J0XA 4E54A 3BWSA 4AMYA 2P9PC 4O9DA 4UI9R 4FHLA 3C99A 3DSMA 1E8MA 3MKQA 3OKYA 4LGNA 2I0TA 4JD2C 5K1CC 2OK4A 1O6FA 3BG0A 4GQ2P 5GMKn 4H5IA 3O4JA 1XIPA 4AN1A 1QFMA 3I7LA 3JZHA 3L4OD 5I5MA 4Y7RA 1T2XA 4U1EI 5E6RA 4GGAA 2VC2A 4BCBA 3C75H 4CY2A 2VDNA 4MMXA 4CY3A 3NIDA 5A2Qg 3PXTD 4CZXA 2UZYB 4MMZA 3SXTD 2OVRB 1FWXA 3FRXA 4LG8A 3I8EA 3K72A 3UR4A 2GC4A 3ZE0A 4XEIC 1UTCA 3IUMA 1GP2B 4GQ1A 5H14A 3J80g 2W18A 5EM2B 5IC7A 3PVUB 3F3FA 4G56B 4O3UB 4GM3A 2H3XA 4L3HD 3JAMg 4FA1D 2QXVA 3DDUA 3RMZD 3PVWB 2I3TA 3RLMD 5C9ZB 1U2VC 4MMYA 1VZ3A 3OL2B 4FA5D 3JB9L 2H47A 3OL2A 4ZOYA 5GXHA 5E6UA 2OVQB 4NENA 3I89A 4FA9D 3IUNA 2PM9B 5AFU3 1VYHC 3EQ7A 5AMSA 4J0WA 5FFOA 5HE1B 5IJ7E 1Q47A 4U7AA 3SJLD 2VDLA 2XYIA 3OKTA 4IMMA 3CFSB 1C9LA 2YNNA 3O4HA 1R5MA 3DXKC 3FCUA 4PXWA 3U4YA 3QHYB 4G1EA 4Z7OA 2H13A 3JZNA 2VDQA 2Z2OA 4NBMA 3KRXB 5EM2A 5EAPA 2H9NA 4WK2A 3SVWD 3ULEC 2I0SA 1RI6A 5HE2B 3PSLA 1QNIA 3J81g 2B4EA 3SFZA 4CI3A 4JXMA 5I5JA 4CZVA 5FLXg 5EMMB 2HKMA 4J8GA 4J82A 3OTTA 3NIGA 4NAAA 3EQ9A 2G9AA 2H9LA 4J77A 3T3MA 3AL8B 5M5VA 5EARA 2P9UC 1PBYB 4GMBA 1L0QA 1MG3A 3OKYB 4QQEA 2EBSA 2YBAA 3RFGA 2CE8A 4GM9A 1MG2A 3IIYA 4GGCA 3EI2A 5EMLB 3T3PA 2GNQA 1O6GA 3AL9A 3FCSA 3IJ1A 4QT8A 4L9OA 1GOHA 4A11B 4J84A 4A11A 4GM8A 2HU8A 2YMUA 1UOOA 2IUVA 1U4CA 5HE0B 2O9KA 3SWSD 4A0BA 1PGUA 3EI2B 3SBPA 4D9SA 1XHMA 5HDBA 1N6DA 3EU7A 4R7AB 2VDKA 5JWZA 2AGWA 3IVMA 4AX4A 2YB8B 4Z8LA 2HESX 2I0RA 1H2ZA 2I3SA 4BUJC 4E54B 1K8KC 2AGYA 5IGQA 5M5UA 3BG1A 3V9FA 5IJ8E 5I5IA 1K32A 3EI4A 3MUNA 2HXCA 4EWRA 3ZE1A 1H2XA 4AEZA 3EI4B 4J78A 5FKTA 4PNKB 3VI3A 1PI6A 5B4WA 4BCDA 3EQ8A 4J73A 4JHNA 5K19A 1L5GA 3F3PA 5TEFA 4OWRA 2UZXB 5EAMA 1GG2B 1YFQA 2IUQA 5FA5B 2IUPA 2EIDA 2Q7QA 5THAA 4RE6A 2CN2A 2B5LA 4FWWA 4K3JB 2BKLA 3UVNA 3EI3A 4K3ID 4CY1A 3IUJA 4FAVD 3I7PA 5SXMA 4D0KA 4A09B 3GFCA 3I7OA 3F3GA 4ES0A 4I79A 1OMWB 3ZDXA 4J8BA 4L1MA 3I7NA 4CY5A 1N6EA 4RE5A 4A2LA 1C9IA 2AH0A 2AH1A 4TZ4A 1TBGA 3I7KA 5C86A 4AOWA 3CFVA 2CN3A 5IGOA 1JMXB 1N6FA 2J57G 1P22A 4JT5C 2VDRA 2BCJB 4NSXA 4O45A 4UM8A 3NVNA 1JJUB 1VE7A 5HQGA 3QI0A 3AL8A 3UVKA 3IURA 3O4GA 3PXWD 2J55H 3UVOA 1B9XA 3B7FA 4WK0A 4PSXB 1YR2A 1TYEA 5CYKA 5M61A 3IJEA 4J81A 4BL0A 4GQBB 4A0AA 5GSAA 3VI4A 4UM9A 3ODTA 2AGXA 3L4MD 3K27A 4BP9A 2AGLA 5FFGA 2AQ5A 2PBIB 2TRCB 3ZE2A 3C5MA 4X3EA 2HU7A 3IULA 4ZOVA 3OKWA 1GOFA 4D6VA 2P9IC 3GC3B 3K26A 2CE9A 2IWFA 4AMZA 5FXYA 3NVXA 5CXBB 3MVDK 3IKOA 3NIFA 5M5SA 4E5ZA 3MZLA 3V4PA 1S4UX 4ERQA 1JTDB 2EIBA 4CI1A 4A09A 1SQJA 4NC4A 4XYIA 2H14A 4G1MA 4X61B 4O2WA 5EMKB 1I2MB 2XDWA 3N0DA 3DM0A 4O3TB 1MDAH 2IAAA 3I2NA 4YVDA 5E6SA 2WQ8A 1A0RB 5CXBA 2OJYA 2BBKH 4PC0A
chains in the Genus database with same CATH topology
3UKRC 4A2MA 2P9KC 5FKRA 2HJBA 4LG9A 2HYEA 2Z2NA 3PXSD 1OLZA 3UVMA 1SHYB 5HE3B 2B5MA 3I8CA 2P9SC 4A08B 1NEXB 3MZKA 5FKSA 4OZUA 4MK0B 5EMJB 5GXIA 1B9YA 3A0FA 5CXCA 3SCYA 2H9MA 2OIZA 1SQ9A 3SHFA 2Z2PA 3IIWA 3GREA 3VGZA 3IJCA 4J86A 3N0EA 2MTAH 3EI1B 5C2WB 3P4FA 4E5ZB 2H9PA 4FA4D 2G99A 5H17A 2PM7B 3NVQA 1JMZB 2B5NA 4PBZA 3EG6A 4IA9A 3RN0D 1GOTB 4JSVC 4CI8A 5AJAA 1NR0A 3PE7A 1PEVA 3SLED 1GXRA 4BH6A 2XL3A 3AFCA 4J87A 2CO0A 2H68A 2OK6A 3UVLA 4J79A 3VA6A 3W15A 2AGZA 1XKSA 2XU7A 5KDOB 3FM0A 3RRMC 4FB1D 5H1MA 4X60B 4L1QD 5FKQA 3JZGA 3EWEA 2XL2A 3MXXA 5CYKB 4N14A 5C2VB 3CIKB 4CC9A 3IJ0A 4CZYA 2OVPB 4A0BB 3DWLC 5EALA 5IT9g 3EI1A 2J56H 4ZOXA 4ERYA 2GC7A 3KRWB 5CXCB 3RFHA 3E0CA 3OW8A 4JSPC 3SBQA 3UKUC 4JSXC 2H6QA 3MMYA 4CI2A 4GZ8A 3JROA 4HDJA 3EI3B 1ERJA 4O1QD 2IWKA 4A7JA 4A08A 5TF2A 4QRJA 3C9CA 2CO0C 2PM6B 3I7HA 5TEEA 4ZN4A 2QC5A 3FGBA 4GGDA 3RN1D 4KFMB 3AH8B 3RSEC 4H5JA 4Y5RD 4ZOZA 4ERZA 4ESGA 4JT6C 3PSCB 3SBRA 3V7DB 3VH0A 4A0AB 2HKRA 4XYHA 2YNOA 3SN6B 3ORVD 5FQDA 4L3GD 3HFQA 5TDHB 2P9NC 1JOFA 3DXMC 2YNPA 2IURA 3SMRA 3EMHA 3V5WB 3JPXA 3JRPA 2H6KA 2H6NA 4X63B 2PM9A 4FAND 4QL1A 4JSNC 2HJ4A 4PSWB 3ZWLB 4PBYA 2CNXA 2P9LC 3MKSB 5HYNB 1TYQC 4J0XA 4E54A 3BWSA 2P9PC 4O9DA 4UI9R 4FHLA 3C99A 3DSMA 3MKQA 3OKYA 4LGNA 2I0TA 4JD2C 5K1CC 2OK4A 3BG0A 4GQ2P 5GMKn 4H5IA 1XIPA 3I7LA 3JZHA 3L4OD 5I5MA 4Y7RA 4U1EI 4GGAA 3C75H 4CY2A 4CY3A 5A2Qg 3PXTD 4CZXA 2UZYB 3SXTD 2OVRB 1FWXA 3FRXA 4LG8A 3I8EA 3UR4A 2GC4A 4XEIC 4GQ1A 1GP2B 5H14A 3J80g 2W18A 5EM2B 5IC7A 3PVUB 3F3FA 4G56B 4O3UB 4GM3A 2H3XA 4L3HD 3JAMg 4FA1D 2QXVA 3RMZD 3PVWB 2I3TA 3RLMD 5C9ZB 1U2VC 3OL2B 4FA5D 3JB9L 2H47A 3OL2A 4ZOYA 5GXHA 2OVQB 3I89A 4FA9D 2PM9B 5AFU3 1VYHC 5AMSA 4J0WA 5HE1B 5IJ7E 1Q47A 4U7AA 3SJLD 2XYIA 3OKTA 4IMMA 3CFSB 2YNNA 1R5MA 3DXKC 3U4YA 4PXWA 2H13A 3JZNA 2Z2OA 3KRXB 5EM2A 5EAPA 2H9NA 3SVWD 3ULEC 2I0SA 1RI6A 5HE2B 3PSLA 1QNIA 3J81g 2B4EA 3SFZA 4CI3A 4JXMA 5I5JA 4CZVA 5FLXg 5EMMB 2HKMA 4J8GA 4J82A 3OTTA 2G9AA 2H9LA 4J77A 3AL8B 5EARA 2P9UC 1PBYB 4GMBA 1L0QA 1MG3A 3OKYB 4QQEA 2EBSA 2YBAA 3RFGA 2CE8A 4GM9A 1MG2A 3IIYA 4GGCA 3EI2A 5EMLB 2GNQA 3AL9A 3IJ1A 4QT8A 4L9OA 4A11B 4J84A 4A11A 4GM8A 2YMUA 2IUVA 1U4CA 5HE0B 2O9KA 3SWSD 4A0BA 1PGUA 3EI2B 3SBPA 1XHMA 1N6DA 3EU7A 4R7AB 5JWZA 2AGWA 2YB8B 4Z8LA 2HESX 2I0RA 2I3SA 4BUJC 4E54B 1K8KC 2AGYA 5IGQA 3BG1A 3V9FA 5IJ8E 5I5IA 1K32A 3EI4A 2HXCA 4EWRA 4AEZA 3EI4B 4J78A 5FKTA 4PNKB 1PI6A 5B4WA 4J73A 5K19A 3F3PA 5TEFA 4OWRA 2UZXB 5EAMA 1GG2B 1YFQA 2IUQA 5FA5B 2IUPA 2Q7QA 5THAA 2CN2A 2B5LA 4FWWA 4K3JB 3UVNA 3EI3A 4K3ID 4CY1A 4FAVD 3I7PA 5SXMA 4D0KA 4A09B 3GFCA 3I7OA 3F3GA 4ES0A 4I79A 1OMWB 4J8BA 4CY5A 3I7NA 1N6EA 4A2LA 2AH0A 2AH1A 4TZ4A 1TBGA 3I7KA 4AOWA 3CFVA 2CN3A 5IGOA 1JMXB 1N6FA 2J57G 1P22A 4JT5C 2BCJB 4NSXA 4O45A 3NVNA 1JJUB 5HQGA 3AL8A 3UVKA 3UVOA 2J55H 3PXWD 1B9XA 3B7FA 4PSXB 5CYKA 4J81A 4BL0A 4GQBB 4A0AA 5GSAA 3ODTA 2AGXA 3L4MD 3K27A 2AGLA 2AQ5A 2PBIB 2TRCB 3C5MA 4X3EA 4ZOVA 4D6VA 3OKWA 2P9IC 3K26A 2CE9A 2IWFA 5FXYA 3NVXA 5CXBB 3IKOA 4E5ZA 3MZLA 1S4UX 4ERQA 4A09A 4CI1A 1SQJA 4XYIA 2H14A 4X61B 5EMKB 3N0DA 3DM0A 4O3TB 1MDAH 2IAAA 3I2NA 4YVDA 5CXBA 1A0RB 2OJYA 2BBKH 4PC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKR C;  4A2M A;  2P9K C;  5FKR A;  2HJB A;  4LG9 A;  2HYE A;  2Z2N A;  3PXS D;  1OLZ A;  3UVM A;  1SHY B;  5HE3 B;  2B5M A;  3I8C A;  2P9S C;  4A08 B;  1NEX B;  3MZK A;  5FKS A;  4OZU A;  4MK0 B;  5EMJ B;  5GXI A;  1B9Y A;  3A0F A;  5CXC A;  3SCY A;  2H9M A;  2OIZ A;  1SQ9 A;  3SHF A;  2Z2P A;  3IIW A;  3GRE A;  3VGZ A;  3IJC A;  4J86 A;  3N0E A;  2MTA H;  3EI1 B;  5C2W B;  3P4F A;  4E5Z B;  2H9P A;  4FA4 D;  2G99 A;  5H17 A;  2PM7 B;  3NVQ A;  1JMZ B;  2B5N A;  4PBZ A;  3EG6 A;  4IA9 A;  3RN0 D;  1GOT B;  4JSV C;  4CI8 A;  5AJA A;  1NR0 A;  3PE7 A;  1PEV A;  3SLE D;  1GXR A;  4BH6 A;  2XL3 A;  3AFC A;  4J87 A;  2CO0 A;  2H68 A;  2OK6 A;  3UVL A;  4J79 A;  3VA6 A;  3W15 A;  2AGZ A;  1XKS A;  2XU7 A;  5KDO B;  3FM0 A;  3RRM C;  4FB1 D;  5H1M A;  4X60 B;  4L1Q D;  5FKQ A;  3JZG A;  3EWE A;  2XL2 A;  3MXX A;  5CYK B;  4N14 A;  5C2V B;  3CIK B;  4CC9 A;  3IJ0 A;  4CZY A;  2OVP B;  4A0B B;  3DWL C;  5EAL A;  5IT9 g;  3EI1 A;  2J56 H;  4ZOX A;  4ERY A;  2GC7 A;  3KRW B;  5CXC B;  3RFH A;  3E0C A;  3OW8 A;  4JSP C;  3SBQ A;  3UKU C;  4JSX C;  2H6Q A;  3MMY A;  4CI2 A;  4GZ8 A;  3JRO A;  4HDJ A;  3EI3 B;  1ERJ A;  4O1Q D;  2IWK A;  4A7J A;  4A08 A;  5TF2 A;  4QRJ A;  3C9C A;  2CO0 C;  2PM6 B;  3I7H A;  5TEE A;  4ZN4 A;  2QC5 A;  3FGB A;  4GGD A;  3RN1 D;  4KFM B;  3AH8 B;  3RSE C;  4H5J A;  4Y5R D;  4ZOZ A;  4ERZ A;  4ESG A;  4JT6 C;  3PSC B;  3SBR A;  3V7D B;  3VH0 A;  4A0A B;  2HKR A;  4XYH A;  2YNO A;  3SN6 B;  3ORV D;  5FQD A;  4L3G D;  3HFQ A;  5TDH B;  2P9N C;  1JOF A;  3DXM C;  2YNP A;  2IUR A;  3SMR A;  3EMH A;  3V5W B;  3JPX A;  3JRP A;  2H6K A;  2H6N A;  4X63 B;  2PM9 A;  4FAN D;  4QL1 A;  4JSN C;  2HJ4 A;  4PSW B;  3ZWL B;  4PBY A;  2CNX A;  2P9L C;  3MKS B;  5HYN B;  1TYQ C;  4J0X A;  4E54 A;  3BWS A;  2P9P C;  4O9D A;  4UI9 R;  4FHL A;  3C99 A;  3DSM A;  3MKQ A;  3OKY A;  4LGN A;  2I0T A;  4JD2 C;  5K1C C;  2OK4 A;  3BG0 A;  4GQ2 P;  5GMK n;  4H5I A;  1XIP A;  3I7L A;  3JZH A;  3L4O D;  5I5M A;  4Y7R A;  4U1E I;  4GGA A;  3C75 H;  4CY2 A;  4CY3 A;  5A2Q g;  3PXT D;  4CZX A;  2UZY B;  3SXT D;  2OVR B;  1FWX A;  3FRX A;  4LG8 A;  3I8E A;  3UR4 A;  2GC4 A;  4XEI C;  4GQ1 A;  1GP2 B;  5H14 A;  3J80 g;  2W18 A;  5EM2 B;  5IC7 A;  3PVU B;  3F3F A;  4G56 B;  4O3U B;  4GM3 A;  2H3X A;  4L3H D;  3JAM g;  4FA1 D;  2QXV A;  3RMZ D;  3PVW B;  2I3T A;  3RLM D;  5C9Z B;  1U2V C;  3OL2 B;  4FA5 D;  3JB9 L;  2H47 A;  3OL2 A;  4ZOY A;  5GXH A;  2OVQ B;  3I89 A;  4FA9 D;  2PM9 B;  5AFU 3;  1VYH C;  5AMS A;  4J0W A;  5HE1 B;  5IJ7 E;  1Q47 A;  4U7A A;  3SJL D;  2XYI A;  3OKT A;  4IMM A;  3CFS B;  2YNN A;  1R5M A;  3DXK C;  3U4Y A;  4PXW A;  2H13 A;  3JZN A;  2Z2O A;  3KRX B;  5EM2 A;  5EAP A;  2H9N A;  3SVW D;  3ULE C;  2I0S A;  1RI6 A;  5HE2 B;  3PSL A;  1QNI A;  3J81 g;  2B4E A;  3SFZ A;  4CI3 A;  4JXM A;  5I5J A;  4CZV A;  5FLX g;  5EMM B;  2HKM A;  4J8G A;  4J82 A;  3OTT A;  2G9A A;  2H9L A;  4J77 A;  3AL8 B;  5EAR A;  2P9U C;  1PBY B;  4GMB A;  1L0Q A;  1MG3 A;  3OKY B;  4QQE A;  2EBS A;  2YBA A;  3RFG A;  2CE8 A;  4GM9 A;  1MG2 A;  3IIY A;  4GGC A;  3EI2 A;  5EML B;  2GNQ A;  3AL9 A;  3IJ1 A;  4QT8 A;  4L9O A;  4A11 B;  4J84 A;  4A11 A;  4GM8 A;  2YMU A;  2IUV A;  1U4C A;  5HE0 B;  2O9K A;  3SWS D;  4A0B A;  1PGU A;  3EI2 B;  3SBP A;  1XHM A;  1N6D A;  3EU7 A;  4R7A B;  5JWZ A;  2AGW A;  2YB8 B;  4Z8L A;  2HES X;  2I0R A;  2I3S A;  4BUJ C;  4E54 B;  1K8K C;  2AGY A;  5IGQ A;  3BG1 A;  3V9F A;  5IJ8 E;  5I5I A;  1K32 A;  3EI4 A;  2HXC A;  4EWR A;  4AEZ A;  3EI4 B;  4J78 A;  5FKT A;  4PNK B;  1PI6 A;  5B4W A;  4J73 A;  5K19 A;  3F3P A;  5TEF A;  4OWR A;  2UZX B;  5EAM A;  1GG2 B;  1YFQ A;  2IUQ A;  5FA5 B;  2IUP A;  2Q7Q A;  5THA A;  2CN2 A;  2B5L A;  4FWW A;  4K3J B;  3UVN A;  3EI3 A;  4K3I D;  4CY1 A;  4FAV D;  3I7P A;  5SXM A;  4D0K A;  4A09 B;  3GFC A;  3I7O A;  3F3G A;  4ES0 A;  4I79 A;  1OMW B;  4J8B A;  4CY5 A;  3I7N A;  1N6E A;  4A2L A;  2AH0 A;  2AH1 A;  4TZ4 A;  1TBG A;  3I7K A;  4AOW A;  3CFV A;  2CN3 A;  5IGO A;  1JMX B;  1N6F A;  2J57 G;  1P22 A;  4JT5 C;  2BCJ B;  4NSX A;  4O45 A;  3NVN A;  1JJU B;  5HQG A;  3AL8 A;  3UVK A;  3UVO A;  2J55 H;  3PXW D;  1B9X A;  3B7F A;  4PSX B;  5CYK A;  4J81 A;  4BL0 A;  4GQB B;  4A0A A;  5GSA A;  3ODT A;  2AGX A;  3L4M D;  3K27 A;  2AGL A;  2AQ5 A;  2PBI B;  2TRC B;  3C5M A;  4X3E A;  4ZOV A;  4D6V A;  3OKW A;  2P9I C;  3K26 A;  2CE9 A;  2IWF A;  5FXY A;  3NVX A;  5CXB B;  3IKO A;  4E5Z A;  3MZL A;  1S4U X;  4ERQ A;  4A09 A;  4CI1 A;  1SQJ A;  4XYI A;  2H14 A;  4X61 B;  5EMK B;  3N0D A;  3DM0 A;  4O3T B;  1MDA H;  2IAA A;  3I2N A;  4YVD A;  5CXB A;  1A0R B;  2OJY A;  2BBK H;  4PC0 A; 
#chains in the Genus database with same CATH topology
 3UKR C;  4A2M A;  3V4V A;  4O02 A;  2P9K C;  5FKR A;  2HJB A;  2HU5 A;  4LG9 A;  2HYE A;  2Z2N A;  1VZ2 A;  3IUQ A;  3PXS D;  4DNV A;  1OLZ A;  3UVM A;  1SHY B;  5HE3 B;  2B5M A;  3I8C A;  2P9S C;  4A08 B;  1NEX B;  3MZK A;  1UOP A;  5FKS A;  4OZU A;  4MK0 B;  5EMJ B;  5GXI A;  1B9Y A;  3A0F A;  5CXC A;  5M5T A;  3SCY A;  2H9M A;  2OIZ A;  1SQ9 A;  1VE6 A;  3SHF A;  3KCI A;  3OF7 A;  2Z2P A;  3IIW A;  3GRE A;  3VGZ A;  2VDM A;  3IJC A;  4J86 A;  3N0E A;  3ZDY A;  4AN0 A;  2MTA H;  3O4I A;  3EI1 B;  5C2W B;  3P4F A;  4E5Z B;  2H9P A;  4FA4 D;  1QFS A;  2G99 A;  5H17 A;  2PM7 B;  3NVQ A;  1JMZ B;  1JV2 A;  2B5N A;  2XZG A;  4PBZ A;  3EG6 A;  4IA9 A;  3RN0 D;  1GOT B;  4JSV C;  4CI8 A;  1H2W A;  2VZ3 A;  5AJA A;  1NR0 A;  3PE7 A;  1PEV A;  3K6S A;  3SLE D;  2XE4 A;  1GXR A;  4BH6 A;  2XL3 A;  2VZ1 A;  3AFC A;  4J87 A;  2CO0 A;  2H68 A;  2OK6 A;  3UVL A;  4J79 A;  3VA6 A;  4DNU A;  3W15 A;  2AGZ A;  2JKX A;  1XKS A;  2XU7 A;  5KDO B;  1E5T A;  1H2Y A;  3FM0 A;  3RRM C;  4FB1 D;  3ZDZ A;  5H1M A;  4X60 B;  4L1Q D;  5FKQ A;  3JZG A;  3EWE A;  2XL2 A;  3MXX A;  5CYK B;  4QAM A;  4N14 A;  2QZP A;  3CIK B;  5C2V B;  4CC9 A;  2EIE A;  3IJ0 A;  4CZY A;  1M1X A;  2OVP B;  4A0B B;  3DWL C;  5EAL A;  5IT9 g;  3EI1 A;  2J56 H;  2VDP A;  4ZOX A;  4ERY A;  2GC7 A;  3KRW B;  5M5R A;  5CXC B;  3RFH A;  3E0C A;  4Z7N A;  2VDO A;  4WJK A;  3OW8 A;  4JSP C;  3SBQ A;  4WK4 A;  3UKU C;  4JSX C;  2H6Q A;  3MMY A;  1E8N A;  4CI2 A;  4GZ8 A;  3JRO A;  1U8C A;  4HDJ A;  3EI3 B;  1ERJ A;  4O1Q D;  2IWK A;  4A7J A;  4A08 A;  5TF2 A;  4QRJ A;  3C9C A;  4JHP C;  2CO0 C;  3GD1 I;  2PM6 B;  3I7H A;  5TEE A;  4ZN4 A;  3MUO A;  2QC5 A;  3FGB A;  4GGD A;  3RN1 D;  4DNW A;  4KFM B;  4G55 A;  3AH8 B;  3RSE C;  4H5J A;  4BP8 A;  4Y5R D;  4ZOZ A;  4ERZ A;  4ESG A;  4IRZ A;  4JT6 C;  3PSC B;  3SBR A;  3V7D B;  3VH0 A;  4A0A B;  2HKR A;  4Z7Q A;  4XYH A;  2YNO A;  3SN6 B;  3ORV D;  5FQD A;  1UOQ A;  1K3I A;  4L3G D;  1BPO A;  3HFQ A;  2EIC A;  5TDH B;  2P9N C;  3K71 A;  1JOF A;  3DXM C;  2YNP A;  2IUR A;  1A12 A;  3SMR A;  3EMH A;  5C92 A;  3V5W B;  3JPX A;  3JRP A;  2H6K A;  2H6N A;  4X63 B;  2PM9 A;  4FAN D;  4JSN C;  2HJ4 A;  4QL1 A;  4PSW B;  3ZWL B;  4BCC A;  4PBY A;  2CNX A;  1GOG A;  2P9L C;  2QR5 A;  3MKS B;  5HYN B;  1TYQ C;  4J0X A;  4E54 A;  3BWS A;  4AMY A;  2P9P C;  4O9D A;  4UI9 R;  4FHL A;  3C99 A;  3DSM A;  1E8M A;  3MKQ A;  3OKY A;  4LGN A;  2I0T A;  4JD2 C;  5K1C C;  2OK4 A;  1O6F A;  3BG0 A;  4GQ2 P;  5GMK n;  4H5I A;  3O4J A;  1XIP A;  4AN1 A;  1QFM A;  3I7L A;  3JZH A;  3L4O D;  5I5M A;  4Y7R A;  1T2X A;  4U1E I;  5E6R A;  4GGA A;  2VC2 A;  4BCB A;  3C75 H;  4CY2 A;  2VDN A;  4MMX A;  4CY3 A;  3NID A;  5A2Q g;  3PXT D;  4CZX A;  2UZY B;  4MMZ A;  3SXT D;  2OVR B;  1FWX A;  3FRX A;  4LG8 A;  3I8E A;  3K72 A;  3UR4 A;  2GC4 A;  3ZE0 A;  4XEI C;  1UTC A;  3IUM A;  1GP2 B;  4GQ1 A;  5H14 A;  3J80 g;  2W18 A;  5EM2 B;  5IC7 A;  3PVU B;  3F3F A;  4G56 B;  4O3U B;  4GM3 A;  2H3X A;  4L3H D;  3JAM g;  4FA1 D;  2QXV A;  3DDU A;  3RMZ D;  3PVW B;  2I3T A;  3RLM D;  5C9Z B;  1U2V C;  4MMY A;  1VZ3 A;  3OL2 B;  4FA5 D;  3JB9 L;  2H47 A;  3OL2 A;  4ZOY A;  5GXH A;  5E6U A;  2OVQ B;  4NEN A;  3I89 A;  4FA9 D;  3IUN A;  2PM9 B;  5AFU 3;  1VYH C;  3EQ7 A;  5AMS A;  4J0W A;  5FFO A;  5HE1 B;  5IJ7 E;  1Q47 A;  4U7A A;  3SJL D;  2VDL A;  2XYI A;  3OKT A;  4IMM A;  3CFS B;  1C9L A;  2YNN A;  3O4H A;  1R5M A;  3DXK C;  3FCU A;  4PXW A;  3U4Y A;  3QHY B;  4G1E A;  4Z7O A;  2H13 A;  3JZN A;  2VDQ A;  2Z2O A;  4NBM A;  3KRX B;  5EM2 A;  5EAP A;  2H9N A;  4WK2 A;  3SVW D;  3ULE C;  2I0S A;  1RI6 A;  5HE2 B;  3PSL A;  1QNI A;  3J81 g;  2B4E A;  3SFZ A;  4CI3 A;  4JXM A;  5I5J A;  4CZV A;  5FLX g;  5EMM B;  2HKM A;  4J8G A;  4J82 A;  3OTT A;  3NIG A;  4NAA A;  3EQ9 A;  2G9A A;  2H9L A;  4J77 A;  3T3M A;  3AL8 B;  5M5V A;  5EAR A;  2P9U C;  1PBY B;  4GMB A;  1L0Q A;  1MG3 A;  3OKY B;  4QQE A;  2EBS A;  2YBA A;  3RFG A;  2CE8 A;  4GM9 A;  1MG2 A;  3IIY A;  4GGC A;  3EI2 A;  5EML B;  3T3P A;  2GNQ A;  1O6G A;  3AL9 A;  3FCS A;  3IJ1 A;  4QT8 A;  4L9O A;  1GOH A;  4A11 B;  4J84 A;  4A11 A;  4GM8 A;  2HU8 A;  2YMU A;  1UOO A;  2IUV A;  1U4C A;  5HE0 B;  2O9K A;  3SWS D;  4A0B A;  1PGU A;  3EI2 B;  3SBP A;  4D9S A;  1XHM A;  5HDB A;  1N6D A;  3EU7 A;  4R7A B;  2VDK A;  5JWZ A;  2AGW A;  3IVM A;  4AX4 A;  2YB8 B;  4Z8L A;  2HES X;  2I0R A;  1H2Z A;  2I3S A;  4BUJ C;  4E54 B;  1K8K C;  2AGY A;  5IGQ A;  5M5U A;  3BG1 A;  3V9F A;  5IJ8 E;  5I5I A;  1K32 A;  3EI4 A;  3MUN A;  2HXC A;  4EWR A;  3ZE1 A;  1H2X A;  4AEZ A;  3EI4 B;  4J78 A;  5FKT A;  4PNK B;  3VI3 A;  1PI6 A;  5B4W A;  4BCD A;  3EQ8 A;  4J73 A;  4JHN A;  5K19 A;  1L5G A;  3F3P A;  5TEF A;  4OWR A;  2UZX B;  5EAM A;  1GG2 B;  1YFQ A;  2IUQ A;  5FA5 B;  2IUP A;  2EID A;  2Q7Q A;  5THA A;  4RE6 A;  2CN2 A;  2B5L A;  4FWW A;  4K3J B;  2BKL A;  3UVN A;  3EI3 A;  4K3I D;  4CY1 A;  3IUJ A;  4FAV D;  3I7P A;  5SXM A;  4D0K A;  4A09 B;  3GFC A;  3I7O A;  3F3G A;  4ES0 A;  4I79 A;  1OMW B;  3ZDX A;  4J8B A;  4L1M A;  3I7N A;  4CY5 A;  1N6E A;  4RE5 A;  4A2L A;  1C9I A;  2AH0 A;  2AH1 A;  4TZ4 A;  1TBG A;  3I7K A;  5C86 A;  4AOW A;  3CFV A;  2CN3 A;  5IGO A;  1JMX B;  1N6F A;  2J57 G;  1P22 A;  4JT5 C;  2VDR A;  2BCJ B;  4NSX A;  4O45 A;  4UM8 A;  3NVN A;  1JJU B;  1VE7 A;  5HQG A;  3QI0 A;  3AL8 A;  3UVK A;  3IUR A;  3O4G A;  3PXW D;  2J55 H;  3UVO A;  1B9X A;  3B7F A;  4WK0 A;  4PSX B;  1YR2 A;  1TYE A;  5CYK A;  5M61 A;  3IJE A;  4J81 A;  4BL0 A;  4GQB B;  4A0A A;  5GSA A;  3VI4 A;  4UM9 A;  3ODT A;  2AGX A;  3L4M D;  3K27 A;  4BP9 A;  2AGL A;  5FFG A;  2AQ5 A;  2PBI B;  2TRC B;  3ZE2 A;  3C5M A;  4X3E A;  2HU7 A;  3IUL A;  4ZOV A;  3OKW A;  1GOF A;  4D6V A;  2P9I C;  3GC3 B;  3K26 A;  2CE9 A;  2IWF A;  4AMZ A;  5FXY A;  3NVX A;  5CXB B;  3MVD K;  3IKO A;  3NIF A;  5M5S A;  4E5Z A;  3MZL A;  3V4P A;  1S4U X;  4ERQ A;  1JTD B;  2EIB A;  4CI1 A;  4A09 A;  1SQJ A;  4NC4 A;  4XYI A;  2H14 A;  4G1M A;  4X61 B;  4O2W A;  5EMK B;  1I2M B;  2XDW A;  3N0D A;  3DM0 A;  4O3T B;  1MDA H;  2IAA A;  3I2N A;  4YVD A;  5E6S A;  2WQ8 A;  1A0R B;  5CXB A;  2OJY A;  2BBK H;  4PC0 A; 
#chains in the Genus database with same CATH homology
 3UKR C;  4A2M A;  2P9K C;  5FKR A;  2HJB A;  4LG9 A;  2HYE A;  2Z2N A;  3PXS D;  1OLZ A;  3UVM A;  1SHY B;  5HE3 B;  2B5M A;  3I8C A;  2P9S C;  4A08 B;  1NEX B;  3MZK A;  5FKS A;  4OZU A;  4MK0 B;  5EMJ B;  5GXI A;  1B9Y A;  3A0F A;  5CXC A;  3SCY A;  2H9M A;  2OIZ A;  1SQ9 A;  3SHF A;  2Z2P A;  3IIW A;  3GRE A;  3VGZ A;  3IJC A;  4J86 A;  3N0E A;  2MTA H;  3EI1 B;  5C2W B;  3P4F A;  4E5Z B;  2H9P A;  4FA4 D;  2G99 A;  5H17 A;  2PM7 B;  3NVQ A;  1JMZ B;  2B5N A;  4PBZ A;  3EG6 A;  4IA9 A;  3RN0 D;  1GOT B;  4JSV C;  4CI8 A;  5AJA A;  1NR0 A;  3PE7 A;  1PEV A;  3SLE D;  1GXR A;  4BH6 A;  2XL3 A;  3AFC A;  4J87 A;  2CO0 A;  2H68 A;  2OK6 A;  3UVL A;  4J79 A;  3VA6 A;  3W15 A;  2AGZ A;  1XKS A;  2XU7 A;  5KDO B;  3FM0 A;  3RRM C;  4FB1 D;  5H1M A;  4X60 B;  4L1Q D;  5FKQ A;  3JZG A;  3EWE A;  2XL2 A;  3MXX A;  5CYK B;  4N14 A;  5C2V B;  3CIK B;  4CC9 A;  3IJ0 A;  4CZY A;  2OVP B;  4A0B B;  3DWL C;  5EAL A;  5IT9 g;  3EI1 A;  2J56 H;  4ZOX A;  4ERY A;  2GC7 A;  3KRW B;  5CXC B;  3RFH A;  3E0C A;  3OW8 A;  4JSP C;  3SBQ A;  3UKU C;  4JSX C;  2H6Q A;  3MMY A;  4CI2 A;  4GZ8 A;  3JRO A;  4HDJ A;  3EI3 B;  1ERJ A;  4O1Q D;  2IWK A;  4A7J A;  4A08 A;  5TF2 A;  4QRJ A;  3C9C A;  2CO0 C;  2PM6 B;  3I7H A;  5TEE A;  4ZN4 A;  2QC5 A;  3FGB A;  4GGD A;  3RN1 D;  4KFM B;  3AH8 B;  3RSE C;  4H5J A;  4Y5R D;  4ZOZ A;  4ERZ A;  4ESG A;  4JT6 C;  3PSC B;  3SBR A;  3V7D B;  3VH0 A;  4A0A B;  2HKR A;  4XYH A;  2YNO A;  3SN6 B;  3ORV D;  5FQD A;  4L3G D;  3HFQ A;  5TDH B;  2P9N C;  1JOF A;  3DXM C;  2YNP A;  2IUR A;  3SMR A;  3EMH A;  3V5W B;  3JPX A;  3JRP A;  2H6K A;  2H6N A;  4X63 B;  2PM9 A;  4FAN D;  4QL1 A;  4JSN C;  2HJ4 A;  4PSW B;  3ZWL B;  4PBY A;  2CNX A;  2P9L C;  3MKS B;  5HYN B;  1TYQ C;  4J0X A;  4E54 A;  3BWS A;  2P9P C;  4O9D A;  4UI9 R;  4FHL A;  3C99 A;  3DSM A;  3MKQ A;  3OKY A;  4LGN A;  2I0T A;  4JD2 C;  5K1C C;  2OK4 A;  3BG0 A;  4GQ2 P;  5GMK n;  4H5I A;  1XIP A;  3I7L A;  3JZH A;  3L4O D;  5I5M A;  4Y7R A;  4U1E I;  4GGA A;  3C75 H;  4CY2 A;  4CY3 A;  5A2Q g;  3PXT D;  4CZX A;  2UZY B;  3SXT D;  2OVR B;  1FWX A;  3FRX A;  4LG8 A;  3I8E A;  3UR4 A;  2GC4 A;  4XEI C;  4GQ1 A;  1GP2 B;  5H14 A;  3J80 g;  2W18 A;  5EM2 B;  5IC7 A;  3PVU B;  3F3F A;  4G56 B;  4O3U B;  4GM3 A;  2H3X A;  4L3H D;  3JAM g;  4FA1 D;  2QXV A;  3RMZ D;  3PVW B;  2I3T A;  3RLM D;  5C9Z B;  1U2V C;  3OL2 B;  4FA5 D;  3JB9 L;  2H47 A;  3OL2 A;  4ZOY A;  5GXH A;  2OVQ B;  3I89 A;  4FA9 D;  2PM9 B;  5AFU 3;  1VYH C;  5AMS A;  4J0W A;  5HE1 B;  5IJ7 E;  1Q47 A;  4U7A A;  3SJL D;  2XYI A;  3OKT A;  4IMM A;  3CFS B;  2YNN A;  1R5M A;  3DXK C;  3U4Y A;  4PXW A;  2H13 A;  3JZN A;  2Z2O A;  3KRX B;  5EM2 A;  5EAP A;  2H9N A;  3SVW D;  3ULE C;  2I0S A;  1RI6 A;  5HE2 B;  3PSL A;  1QNI A;  3J81 g;  2B4E A;  3SFZ A;  4CI3 A;  4JXM A;  5I5J A;  4CZV A;  5FLX g;  5EMM B;  2HKM A;  4J8G A;  4J82 A;  3OTT A;  2G9A A;  2H9L A;  4J77 A;  3AL8 B;  5EAR A;  2P9U C;  1PBY B;  4GMB A;  1L0Q A;  1MG3 A;  3OKY B;  4QQE A;  2EBS A;  2YBA A;  3RFG A;  2CE8 A;  4GM9 A;  1MG2 A;  3IIY A;  4GGC A;  3EI2 A;  5EML B;  2GNQ A;  3AL9 A;  3IJ1 A;  4QT8 A;  4L9O A;  4A11 B;  4J84 A;  4A11 A;  4GM8 A;  2YMU A;  2IUV A;  1U4C A;  5HE0 B;  2O9K A;  3SWS D;  4A0B A;  1PGU A;  3EI2 B;  3SBP A;  1XHM A;  1N6D A;  3EU7 A;  4R7A B;  5JWZ A;  2AGW A;  2YB8 B;  4Z8L A;  2HES X;  2I0R A;  2I3S A;  4BUJ C;  4E54 B;  1K8K C;  2AGY A;  5IGQ A;  3BG1 A;  3V9F A;  5IJ8 E;  5I5I A;  1K32 A;  3EI4 A;  2HXC A;  4EWR A;  4AEZ A;  3EI4 B;  4J78 A;  5FKT A;  4PNK B;  1PI6 A;  5B4W A;  4J73 A;  5K19 A;  3F3P A;  5TEF A;  4OWR A;  2UZX B;  5EAM A;  1GG2 B;  1YFQ A;  2IUQ A;  5FA5 B;  2IUP A;  2Q7Q A;  5THA A;  2CN2 A;  2B5L A;  4FWW A;  4K3J B;  3UVN A;  3EI3 A;  4K3I D;  4CY1 A;  4FAV D;  3I7P A;  5SXM A;  4D0K A;  4A09 B;  3GFC A;  3I7O A;  3F3G A;  4ES0 A;  4I79 A;  1OMW B;  4J8B A;  4CY5 A;  3I7N A;  1N6E A;  4A2L A;  2AH0 A;  2AH1 A;  4TZ4 A;  1TBG A;  3I7K A;  4AOW A;  3CFV A;  2CN3 A;  5IGO A;  1JMX B;  1N6F A;  2J57 G;  1P22 A;  4JT5 C;  2BCJ B;  4NSX A;  4O45 A;  3NVN A;  1JJU B;  5HQG A;  3AL8 A;  3UVK A;  3UVO A;  2J55 H;  3PXW D;  1B9X A;  3B7F A;  4PSX B;  5CYK A;  4J81 A;  4BL0 A;  4GQB B;  4A0A A;  5GSA A;  3ODT A;  2AGX A;  3L4M D;  3K27 A;  2AGL A;  2AQ5 A;  2PBI B;  2TRC B;  3C5M A;  4X3E A;  4ZOV A;  4D6V A;  3OKW A;  2P9I C;  3K26 A;  2CE9 A;  2IWF A;  5FXY A;  3NVX A;  5CXB B;  3IKO A;  4E5Z A;  3MZL A;  1S4U X;  4ERQ A;  4A09 A;  4CI1 A;  1SQJ A;  4XYI A;  2H14 A;  4X61 B;  5EMK B;  3N0D A;  3DM0 A;  4O3T B;  1MDA H;  2IAA A;  3I2N A;  4YVD A;  5CXB A;  1A0R B;  2OJY A;  2BBK H;  4PC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...