4X60B

Crystal structure of prmt5:mep50 with epz015666 and sinefungin
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
310
Chain Sequence
LPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 5
publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4x60B00
3DM0A 1VYHC 3DXMC 1S4UX 3PXTD 4J0WA 4X60B 3SHFA 2HXCA 4AEZA 3OW8A 3A0FA 3VGZA 2P9IC 2Z2PA 4H5IA 4IMMA 3JPXA 5I5MA 3RFHA 3EG6A 4A0AA 4JSXC 4GGCA 5HE1B 5TDHB 4CY3A 4J8BA 3SN6B 4BUJC 4ERZA 2H3XA 2B4EA 3N0DA 4L3HD 3SJLD 3SCYA 4JT5C 2EBSA 3JRPA 3IJCA 3I7LA 4J86A 4ZOXA 3OKYB 2I3TA 5IC7A 4CC9A 3SBPA 5HYNB 3EI3B 2P9KC 4ES0A 5EMJB 4A7JA 4ZOYA 4LGNA 1YFQA 4GM8A 4A08A 3FGBA 4LG9A 2AGXA 2H6QA 4BH6A 1GP2B 4ZOVA 3I7OA 4GM9A 2PM9B 4QQEA 4Y7RA 4PBZA 3MMYA 3RMZD 2H9LA 1N6FA 1U2VC 5FXYA 3SBQA 2IUQA 1MG3A 5CXCA 2H6NA 4ERYA 2P9NC 3V5WB 3IKOA 2B5MA 2OVRB 3JB9L 4PSWB 2QXVA 2MTAH 4N14A 3DWLC 3UKRC 1JOFA 2YNPA 2GC4A 3F3PA 2G9AA 2HKMA 4U1EI 2OIZA 4GQ2P 4U7AA 3EMHA 4Y5RD 4CZXA 4A0AB 2I0TA 3OL2A 3E0CA 4PXWA 1PGUA 5C2VB 4BL0A 4D6VA 4FAVD 3UKUC 3IIYA 4YVDA 2J55H 2GNQA 1SQ9A 3AH8B 5H17A 4IA9A 3JZHA 5GMKn 5FKTA 1NEXB 4A0BB 2I3SA 3PE7A 2YNOA 5EMMB 4JSNC 2HESX 4JSVC 4A08B 2P9UC 3RN0D 2QC5A 2W18A 4JXMA 3B7FA 3UVMA 3MZLA 2XU7A 4FHLA 2PM6B 3MZKA 4KFMB 2XYIA 4L1QD 3C75H 3I8EA 5IT9g 4GGDA 1GXRA 1QNIA 5CXCB 4K3JB 4J77A 4O3UB 4AOWA 2HYEA 4QL1A 4CY5A 4MK0B 2P9LC 4XEIC 1P22A 2J57G 5H1MA 2B5LA 4PC0A 5IGQA 1FWXA 2J56H 2H68A 4FB1D 3NVXA 4J79A 3EWEA 4A2MA 4I79A 5GSAA 2XL3A 3RN1D 2CO0A 5I5JA 4J0XA 3ORVD 3OL2B 3V9FA 3J81g 2I0RA 2PBIB 2H9PA 5FKSA 4GM3A 1K8KC 2OVPB 3KRXB 3JROA 3NVNA 4JD2C 4CY1A 5A2Qg 5GXIA 4HDJA 3AL9A 4PBYA 4PNKB 4E54A 4ZN4A 2IWKA 4J82A 4FA9D 2G99A 4GMBA 4J8GA 3AFCA 4GZ8A 1XKSA 3KRWB 5EMLB 5KDOB 2OK4A 5B4WA 3CFVA 4LG8A 3ODTA 2OJYA 3RLMD 5EARA 2IAAA 2UZXB 5H14A 4ESGA 5AFU3 3UR4A 2CE9A 1SHYB 3SXTD 4O45A 5TF2A 2AGZA 5HQGA 3IJ1A 4J81A 2P9PC 3U4YA 5CYKA 3AL8A 1JMXB 2AH0A 3I8CA 4CI3A 3OKTA 5K19A 2BBKH 3MXXA 5CXBA 4A09A 3EI2A 3I7PA 2HKRA 3RSEC 4G56B 4JSPC 5FKRA 3SVWD 3GFCA 2XL2A 3RFGA 3W15A 3K27A 3EI1A 3JZNA 5TEFA 2AQ5A 3EI4A 4OZUA 1RI6A 2YMUA 3K26A 3DSMA 4XYHA 3UVLA 2YNNA 5SXMA 4FA1D 3NVQA 2UZYB 5IGOA 4R7AB 2CNXA 5EAMA 3PVWB 1XIPA 2O9KA 2H47A 2BCJB 1OMWB 3SBRA 2IWFA 4H5JA 4O9DA 4CI2A 4J87A 5FA5B 1TBGA 3HFQA 3P4FA 3I7KA 1JJUB 1PBYB 4UI9R 5C2WB 2HJ4A 3C9CA 4L9OA 2H9NA 2I0SA 4GQ1A 2H14A 3AL8B 4PSXB 3FM0A 3I89A 5GXHA 4QT8A 4X63B 5CXBB 4A09B 3EI2B 1SQJA 4NSXA 3SWSD 5HE0B 4FAND 3GREA 5IJ7E 3EI1B 1N6EA 4QRJA 3UVKA 4TZ4A 1NR0A 3EI4B 2CE8A 3ULEC 4O1QD 4L3GD 5AJAA 3EU7A 2CO0C 1A0RB 4OWRA 3L4OD 1PI6A 1MG2A 5K1CC 1JMZB 3DXKC 2H13A 3VH0A 1ERJA 4FA4D 2IUVA 4X3EA 1MDAH 3C5MA 5THAA 2OK6A 2H9MA 5EM2A 4A0BA 4J84A 3UVNA 2P9SC 2YB8B 3SMRA 4E5ZA 1U4CA 3ZWLB 5HE2B 5FLXg 2HJBA 2AH1A 2B5NA 2YBAA 3I7NA 1R5MA 4K3ID 2Z2NA 3VA6A 4FA5D 4D0KA 3F3FA 4A11A 3UVOA 3I7HA 3CFSB 5JWZA 4CZVA 3PSCB 5EALA 2AGLA 2H6KA 3MKSB 3PXWD 2IURA 5TEEA 2AGWA 4GQBB 3BG0A 1XHMA 5FKQA 3PVUB 4ERQA 3BG1A 4XYIA 2Q7QA 5EAPA 5EMKB 3MKQA 2GC7A 1B9YA 2AGYA 1PEVA 2PM7B 3IIWA 2TRCB 1N6DA 5HE3B 5I5IA 5C9ZB 3JZGA 4CY2A 2Z2OA 3L4MD 4E54B 2IUPA 1GG2B 3OKYA 4A2LA 3N0EA 3EI3A 4CI1A 3JAMg 1K32A 1L0QA 1Q47A 5IJ8E 3C99A 5EM2B 1OLZA 2CN3A 4E5ZB 3OKWA 2OVQB 3F3GA 4JT6C 1GOTB 3SLED 2PM9A 3I2NA 3PXSD 4X61B 4ZOZA 5CYKB 3PSLA 3RRMC 3V7DB 3SFZA 2CN2A 3OTTA 3J80g 3BWSA 3CIKB 4A11B 3IJ0A 5AMSA 1B9XA 4CZYA 4CI8A 5FQDA 4J73A 4Z8LA 4FWWA 4EWRA 4J78A 4O3TB 1TYQC 4GGAA 3FRXA
chains in the Genus database with same CATH superfamily
3DM0A 4AMYA 1VYHC 3DXMC 1S4UX 3PXTD 4J0WA 4X60B 3SHFA 2HXCA 4AEZA 3OW8A 3A0FA 3VGZA 2P9IC 2Z2PA 4BP8A 4H5IA 4IMMA 1H2YA 3JPXA 5I5MA 2EICA 3RFHA 3EG6A 4A0AA 5M5TA 4JSXC 4GGCA 5HE1B 5TDHB 4CY3A 4J8BA 3SN6B 4BUJC 4ERZA 2H3XA 1UOOA 2B4EA 1JV2A 3N0DA 4L3HD 3SJLD 3SCYA 4JT5C 4Z7OA 2EBSA 1O6FA 3JRPA 3IJCA 3I7LA 4J86A 4ZOXA 2VDRA 3IJEA 3OKYB 3T3PA 4Z7QA 2I3TA 5IC7A 4CC9A 3SBPA 5HYNB 3EI3B 2P9KC 4ES0A 5EMJB 2XE4A 4A7JA 4RE5A 4ZOYA 4LGNA 3DDUA 1YFQA 4GM8A 2EIDA 4UM8A 4A08A 3FGBA 4LG9A 2AGXA 2H6QA 4BH6A 1GP2B 1UTCA 4ZOVA 3I7OA 4GM9A 2PM9B 4QQEA 4Y7RA 3IVMA 4PBZA 3MMYA 3RMZD 2H9LA 3MUNA 3NIGA 1N6FA 1U2VC 5FXYA 2VC2A 5HDBA 3SBQA 2IUQA 1MG3A 5CXCA 2H6NA 4WJKA 4ERYA 3IURA 2P9NC 3V5WB 3IKOA 2B5MA 2OVRB 1E8MA 4MMZA 3JB9L 1QFSA 4PSWB 2QXVA 2MTAH 4N14A 4NAAA 3DWLC 3O4JA 3IUJA 2VDOA 3UKRC 1JOFA 2YNPA 2GC4A 3F3PA 2G9AA 2HKMA 4U1EI 1YR2A 2OIZA 4GQ2P 4U7AA 3EMHA 4Y5RD 5FFGA 4CZXA 4A0AB 3GD1I 2I0TA 3VI4A 3OL2A 3E0CA 4PXWA 1PGUA 3NIFA 5C2VB 4BL0A 4D6VA 4FAVD 2HU5A 3UKUC 3IIYA 2JKXA 4YVDA 2J55H 3QI0A 5M61A 4O02A 2GNQA 1SQ9A 3AH8B 5H17A 3ZDYA 4IA9A 3JZHA 5GMKn 5FKTA 1NEXB 4A0BB 3EQ7A 4BP9A 2I3SA 3PE7A 2YNOA 5EMMB 4JSNC 2HESX 4JSVC 4A08B 2P9UC 3RN0D 2QC5A 2W18A 4JXMA 3B7FA 3UVMA 3MZLA 2XU7A 4FHLA 2PM6B 3MZKA 4KFMB 2XYIA 4L1QD 3C75H 3I8EA 5IT9g 4GGDA 1GXRA 1QNIA 2VDPA 5CXCB 4K3JB 4J77A 4O3UB 4AOWA 2HYEA 4QL1A 4CY5A 4MK0B 2P9LC 4XEIC 1P22A 2J57G 5H1MA 2B5LA 4PC0A 5IGQA 1FWXA 1L5GA 2J56H 4Z7NA 2H68A 4FB1D 5M5RA 3NVXA 3IUNA 4G1EA 1H2WA 4J79A 4BCBA 3EWEA 4A2MA 4I79A 5GSAA 4G55A 1M1XA 2XL3A 3RN1D 2CO0A 5I5JA 4J0XA 3KCIA 3ORVD 3OL2B 3V9FA 2BKLA 3J81g 2I0RA 2PBIB 2H9PA 5FKSA 4GM3A 1K8KC 3EQ9A 2VDNA 2OVPB 3KRXB 2WQ8A 3JROA 5E6UA 3NVNA 4JD2C 4CY1A 5A2Qg 5GXIA 3OF7A 4HDJA 3AL9A 4PBYA 4PNKB 4E54A 4ZN4A 2IWKA 4J82A 4FA9D 2G99A 4GMBA 4J8GA 4JHNA 4JHPC 3AFCA 4GZ8A 4BCDA 3KRWB 1XKSA 5EMLB 3K72A 2OK4A 5KDOB 1UOPA 5B4WA 1O6GA 3CFVA 4IRZA 4LG8A 3ODTA 2OJYA 3RLMD 5EARA 2IAAA 2UZXB 5H14A 1C9LA 4ESGA 5AFU3 3UR4A 3O4IA 1GOHA 1SHYB 2CE9A 3SXTD 4AN1A 4O45A 5TF2A 2AGZA 5HQGA 3IJ1A 3FCUA 4J81A 2P9PC 1H2XA 3U4YA 3K71A 5CYKA 3AL8A 3MUOA 1JMXB 2AH0A 3I8CA 4CI3A 2VZ3A 3OKTA 5K19A 2BBKH 4RE6A 3MXXA 5CXBA 4AMZA 4A09A 3V4VA 3EI2A 3I7PA 2HKRA 3RSEC 4G56B 3K6SA 4JSPC 5FKRA 3SVWD 3GFCA 2XL2A 3ZE0A 3RFGA 3W15A 3K27A 3EI1A 3JZNA 4O2WA 4WK2A 5TEFA 2AQ5A 3GC3B 3EI4A 1TYEA 4OZUA 1RI6A 2YMUA 3K26A 3DSMA 1T2XA 4XYHA 4UM9A 3UVLA 2YNNA 5SXMA 4FA1D 3NVQA 2UZYB 5E6RA 2XDWA 4R7AB 2CNXA 5IGOA 5EAMA 3PVWB 1XIPA 3O4GA 2O9KA 2H47A 2BCJB 1OMWB 3SBRA 3MVDK 3ZE1A 2IWFA 4H5JA 4O9DA 2EIBA 4CI2A 4J87A 5FA5B 1TBGA 3IUMA 3O4HA 3HFQA 3P4FA 5M5SA 3I7KA 2QR5A 1JJUB 1BPOA 1PBYB 4UI9R 2VDQA 5C2WB 2HJ4A 3C9CA 4L9OA 2H9NA 2I0SA 4GQ1A 2H14A 3AL8B 4WK0A 5C92A 1E8NA 4PSXB 4NENA 3FM0A 3I89A 5GXHA 4QT8A 4X63B 5CXBB 4A09B 3EI2B 4DNWA 1SQJA 5FFOA 4NSXA 3SWSD 5HE0B 1VZ3A 4FAND 3ZE2A 4D9SA 3GREA 5IJ7E 3EI1B 2HU7A 1N6EA 1VZ2A 2QZPA 4QRJA 4WK4A 3UVKA 4TZ4A 1NR0A 4NBMA 3EI4B 2CE8A 3ULEC 4O1QD 4L3GD 5AJAA 3EU7A 4DNUA 2CO0C 1A0RB 4OWRA 3L4OD 1PI6A 1MG2A 5K1CC 1E5TA 1JMZB 3DXKC 2EIEA 2H13A 3VH0A 1ERJA 4FA4D 4G1MA 2IUVA 4X3EA 1MDAH 3C5MA 1TYQC 5THAA 2OK6A 2H9MA 5EM2A 4A0BA 4J84A 2HU8A 3UVNA 2P9SC 2YB8B 3IUQA 3SMRA 4E5ZA 1U4CA 3ZWLB 5HE2B 5FLXg 2HJBA 2AH1A 2B5NA 3IULA 2YBAA 3I7NA 1R5MA 1VE6A 4K3ID 3ZDXA 2Z2NA 3VA6A 4FA5D 1GOFA 4D0KA 3F3FA 3ZDZA 4A11A 3UVOA 3I7HA 3CFSB 5JWZA 4CZVA 1GOGA 5E6SA 3PSCB 1JTDB 5EALA 2AGLA 2VDLA 2H6KA 3V4PA 3MKSB 5M5VA 3PXWD 2IURA 5TEEA 2AGWA 4GQBB 5C86A 3BG0A 4MMXA 1XHMA 5FKQA 1UOQA 2VDMA 3PVUB 4ERQA 3BG1A 2VDKA 4XYIA 2Q7QA 1K3IA 5EAPA 5EMKB 3MKQA 1B9YA 3EQ8A 4AN0A 4NC4A 2AGYA 1PEVA 2PM7B 3IIWA 2VZ1A 2TRCB 1N6DA 5HE3B 5I5IA 5C9ZB 3JZGA 4CY2A 2Z2OA 3L4MD 4E54B 2IUPA 4BCCA 1GG2B 3OKYA 4A2LA 5M5UA 4L1MA 3N0EA 1I2MB 3EI3A 3FCSA 4CI1A 3JAMg 1K32A 1L0QA 1Q47A 5IJ8E 3C99A 3QHYB 4QAMA 3VI3A 3NIDA 1C9IA 5EM2B 1OLZA 4MMYA 1H2ZA 1U8CA 1QFMA 2CN3A 1A12A 4E5ZB 3OKWA 2OVQB 3F3GA 4DNVA 4JT6C 1GOTB 3SLED 2XZGA 2PM9A 3I2NA 1VE7A 3PXSD 4X61B 4ZOZA 5CYKB 3PSLA 3RRMC 3V7DB 3SFZA 2CN2A 3OTTA 3J80g 3BWSA 3CIKB 4A11B 3IJ0A 5AMSA 1B9XA 4CZYA 4CI8A 4AX4A 3T3MA 5FQDA 4J73A 4Z8LA 4FWWA 4EWRA 4J78A 4O3TB 2GC7A 4GGAA 3FRXA
chains in the Genus database with same CATH topology
3DM0A 1VYHC 3DXMC 1S4UX 3PXTD 4J0WA 4X60B 3SHFA 2HXCA 4AEZA 3OW8A 3A0FA 3VGZA 2P9IC 2Z2PA 4H5IA 4IMMA 3JPXA 5I5MA 3RFHA 3EG6A 4A0AA 4JSXC 4GGCA 5HE1B 5TDHB 4CY3A 4J8BA 3SN6B 4BUJC 4ERZA 2H3XA 2B4EA 3N0DA 4L3HD 3SJLD 3SCYA 4JT5C 2EBSA 3JRPA 3IJCA 3I7LA 4J86A 4ZOXA 3OKYB 2I3TA 5IC7A 4CC9A 3SBPA 5HYNB 3EI3B 2P9KC 4ES0A 5EMJB 4A7JA 4ZOYA 4LGNA 1YFQA 4GM8A 4A08A 3FGBA 4LG9A 2AGXA 2H6QA 4BH6A 1GP2B 4ZOVA 3I7OA 4GM9A 2PM9B 4QQEA 4Y7RA 4PBZA 3MMYA 3RMZD 2H9LA 1N6FA 1U2VC 5FXYA 3SBQA 2IUQA 1MG3A 5CXCA 2H6NA 4ERYA 2P9NC 3V5WB 3IKOA 2B5MA 2OVRB 3JB9L 4PSWB 2QXVA 2MTAH 4N14A 3DWLC 3UKRC 1JOFA 2YNPA 2GC4A 3F3PA 2G9AA 2HKMA 4U1EI 2OIZA 4GQ2P 4U7AA 3EMHA 4Y5RD 4CZXA 4A0AB 2I0TA 3OL2A 3E0CA 4PXWA 1PGUA 5C2VB 4BL0A 4D6VA 4FAVD 3UKUC 3IIYA 4YVDA 2J55H 2GNQA 1SQ9A 3AH8B 5H17A 4IA9A 3JZHA 5GMKn 5FKTA 1NEXB 4A0BB 2I3SA 3PE7A 2YNOA 5EMMB 4JSNC 2HESX 4JSVC 4A08B 2P9UC 3RN0D 2QC5A 2W18A 4JXMA 3B7FA 3UVMA 3MZLA 2XU7A 4FHLA 2PM6B 3MZKA 4KFMB 2XYIA 4L1QD 3C75H 3I8EA 5IT9g 4GGDA 1GXRA 1QNIA 5CXCB 4K3JB 4J77A 4O3UB 4AOWA 2HYEA 4QL1A 4CY5A 4MK0B 2P9LC 4XEIC 1P22A 2J57G 5H1MA 2B5LA 4PC0A 5IGQA 1FWXA 2J56H 2H68A 4FB1D 3NVXA 4J79A 3EWEA 4A2MA 4I79A 5GSAA 2XL3A 3RN1D 2CO0A 5I5JA 4J0XA 3ORVD 3OL2B 3V9FA 3J81g 2I0RA 2PBIB 2H9PA 5FKSA 4GM3A 1K8KC 2OVPB 3KRXB 3JROA 3NVNA 4JD2C 4CY1A 5A2Qg 5GXIA 4HDJA 3AL9A 4PBYA 4PNKB 4E54A 4ZN4A 2IWKA 4J82A 4FA9D 2G99A 4GMBA 4J8GA 3AFCA 4GZ8A 1XKSA 3KRWB 5EMLB 5KDOB 2OK4A 5B4WA 3CFVA 4LG8A 3ODTA 2OJYA 3RLMD 5EARA 2IAAA 2UZXB 5H14A 4ESGA 5AFU3 3UR4A 2CE9A 1SHYB 3SXTD 4O45A 5TF2A 2AGZA 5HQGA 3IJ1A 4J81A 2P9PC 3U4YA 5CYKA 3AL8A 1JMXB 2AH0A 3I8CA 4CI3A 3OKTA 5K19A 2BBKH 3MXXA 5CXBA 4A09A 3EI2A 3I7PA 2HKRA 3RSEC 4G56B 4JSPC 5FKRA 3SVWD 3GFCA 2XL2A 3RFGA 3W15A 3K27A 3EI1A 3JZNA 5TEFA 2AQ5A 3EI4A 4OZUA 1RI6A 2YMUA 3K26A 3DSMA 4XYHA 3UVLA 2YNNA 5SXMA 4FA1D 3NVQA 2UZYB 5IGOA 4R7AB 2CNXA 5EAMA 3PVWB 1XIPA 2O9KA 2H47A 2BCJB 1OMWB 3SBRA 2IWFA 4H5JA 4O9DA 4CI2A 4J87A 5FA5B 1TBGA 3HFQA 3P4FA 3I7KA 1JJUB 1PBYB 4UI9R 5C2WB 2HJ4A 3C9CA 4L9OA 2H9NA 2I0SA 4GQ1A 2H14A 3AL8B 4PSXB 3FM0A 3I89A 5GXHA 4QT8A 4X63B 5CXBB 4A09B 3EI2B 1SQJA 4NSXA 3SWSD 5HE0B 4FAND 3GREA 5IJ7E 3EI1B 1N6EA 4QRJA 3UVKA 4TZ4A 1NR0A 3EI4B 2CE8A 3ULEC 4O1QD 4L3GD 5AJAA 3EU7A 2CO0C 1A0RB 4OWRA 3L4OD 1PI6A 1MG2A 5K1CC 1JMZB 3DXKC 2H13A 3VH0A 1ERJA 4FA4D 2IUVA 4X3EA 1MDAH 3C5MA 5THAA 2OK6A 2H9MA 5EM2A 4A0BA 4J84A 3UVNA 2P9SC 2YB8B 3SMRA 4E5ZA 1U4CA 3ZWLB 5HE2B 5FLXg 2HJBA 2AH1A 2B5NA 2YBAA 3I7NA 1R5MA 4K3ID 2Z2NA 3VA6A 4FA5D 4D0KA 3F3FA 4A11A 3UVOA 3I7HA 3CFSB 5JWZA 4CZVA 3PSCB 5EALA 2AGLA 2H6KA 3MKSB 3PXWD 2IURA 5TEEA 2AGWA 4GQBB 3BG0A 1XHMA 5FKQA 3PVUB 4ERQA 3BG1A 4XYIA 2Q7QA 5EAPA 5EMKB 3MKQA 2GC7A 1B9YA 2AGYA 1PEVA 2PM7B 3IIWA 2TRCB 1N6DA 5HE3B 5I5IA 5C9ZB 3JZGA 4CY2A 2Z2OA 3L4MD 4E54B 2IUPA 1GG2B 3OKYA 4A2LA 3N0EA 3EI3A 4CI1A 3JAMg 1K32A 1L0QA 1Q47A 5IJ8E 3C99A 5EM2B 1OLZA 2CN3A 4E5ZB 3OKWA 2OVQB 3F3GA 4JT6C 1GOTB 3SLED 2PM9A 3I2NA 3PXSD 4X61B 4ZOZA 5CYKB 3PSLA 3RRMC 3V7DB 3SFZA 2CN2A 3OTTA 3J80g 3BWSA 3CIKB 4A11B 3IJ0A 5AMSA 1B9XA 4CZYA 4CI8A 5FQDA 4J73A 4Z8LA 4FWWA 4EWRA 4J78A 4O3TB 1TYQC 4GGAA 3FRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DM0 A;  1VYH C;  3DXM C;  1S4U X;  3PXT D;  4J0W A;  4X60 B;  3SHF A;  2HXC A;  4AEZ A;  3OW8 A;  3A0F A;  3VGZ A;  2P9I C;  2Z2P A;  4H5I A;  4IMM A;  3JPX A;  5I5M A;  3RFH A;  3EG6 A;  4A0A A;  4JSX C;  4GGC A;  5HE1 B;  5TDH B;  4CY3 A;  4J8B A;  3SN6 B;  4BUJ C;  4ERZ A;  2H3X A;  2B4E A;  3N0D A;  4L3H D;  3SJL D;  3SCY A;  4JT5 C;  2EBS A;  3JRP A;  3IJC A;  3I7L A;  4J86 A;  4ZOX A;  3OKY B;  2I3T A;  5IC7 A;  4CC9 A;  3SBP A;  5HYN B;  3EI3 B;  2P9K C;  4ES0 A;  5EMJ B;  4A7J A;  4ZOY A;  4LGN A;  1YFQ A;  4GM8 A;  4A08 A;  3FGB A;  4LG9 A;  2AGX A;  2H6Q A;  4BH6 A;  1GP2 B;  4ZOV A;  3I7O A;  4GM9 A;  2PM9 B;  4QQE A;  4Y7R A;  4PBZ A;  3MMY A;  3RMZ D;  2H9L A;  1N6F A;  1U2V C;  5FXY A;  3SBQ A;  2IUQ A;  1MG3 A;  5CXC A;  2H6N A;  4ERY A;  2P9N C;  3V5W B;  3IKO A;  2B5M A;  2OVR B;  3JB9 L;  4PSW B;  2QXV A;  2MTA H;  4N14 A;  3DWL C;  3UKR C;  1JOF A;  2YNP A;  2GC4 A;  3F3P A;  2G9A A;  2HKM A;  4U1E I;  2OIZ A;  4GQ2 P;  4U7A A;  3EMH A;  4Y5R D;  4CZX A;  4A0A B;  2I0T A;  3OL2 A;  3E0C A;  4PXW A;  1PGU A;  5C2V B;  4BL0 A;  4D6V A;  4FAV D;  3UKU C;  3IIY A;  4YVD A;  2J55 H;  2GNQ A;  1SQ9 A;  3AH8 B;  5H17 A;  4IA9 A;  3JZH A;  5GMK n;  5FKT A;  1NEX B;  4A0B B;  2I3S A;  3PE7 A;  2YNO A;  5EMM B;  4JSN C;  2HES X;  4JSV C;  4A08 B;  2P9U C;  3RN0 D;  2QC5 A;  2W18 A;  4JXM A;  3B7F A;  3UVM A;  3MZL A;  2XU7 A;  4FHL A;  2PM6 B;  3MZK A;  4KFM B;  2XYI A;  4L1Q D;  3C75 H;  3I8E A;  5IT9 g;  4GGD A;  1GXR A;  1QNI A;  5CXC B;  4K3J B;  4J77 A;  4O3U B;  4AOW A;  2HYE A;  4QL1 A;  4CY5 A;  4MK0 B;  2P9L C;  4XEI C;  1P22 A;  2J57 G;  5H1M A;  2B5L A;  4PC0 A;  5IGQ A;  1FWX A;  2J56 H;  2H68 A;  4FB1 D;  3NVX A;  4J79 A;  3EWE A;  4A2M A;  4I79 A;  5GSA A;  2XL3 A;  3RN1 D;  2CO0 A;  5I5J A;  4J0X A;  3ORV D;  3OL2 B;  3V9F A;  3J81 g;  2I0R A;  2PBI B;  2H9P A;  5FKS A;  4GM3 A;  1K8K C;  2OVP B;  3KRX B;  3JRO A;  3NVN A;  4JD2 C;  4CY1 A;  5A2Q g;  5GXI A;  4HDJ A;  3AL9 A;  4PBY A;  4PNK B;  4E54 A;  4ZN4 A;  2IWK A;  4J82 A;  4FA9 D;  2G99 A;  4GMB A;  4J8G A;  3AFC A;  4GZ8 A;  1XKS A;  3KRW B;  5EML B;  5KDO B;  2OK4 A;  5B4W A;  3CFV A;  4LG8 A;  3ODT A;  2OJY A;  3RLM D;  5EAR A;  2IAA A;  2UZX B;  5H14 A;  4ESG A;  5AFU 3;  3UR4 A;  2CE9 A;  1SHY B;  3SXT D;  4O45 A;  5TF2 A;  2AGZ A;  5HQG A;  3IJ1 A;  4J81 A;  2P9P C;  3U4Y A;  5CYK A;  3AL8 A;  1JMX B;  2AH0 A;  3I8C A;  4CI3 A;  3OKT A;  5K19 A;  2BBK H;  3MXX A;  5CXB A;  4A09 A;  3EI2 A;  3I7P A;  2HKR A;  3RSE C;  4G56 B;  4JSP C;  5FKR A;  3SVW D;  3GFC A;  2XL2 A;  3RFG A;  3W15 A;  3K27 A;  3EI1 A;  3JZN A;  5TEF A;  2AQ5 A;  3EI4 A;  4OZU A;  1RI6 A;  2YMU A;  3K26 A;  3DSM A;  4XYH A;  3UVL A;  2YNN A;  5SXM A;  4FA1 D;  3NVQ A;  2UZY B;  5IGO A;  4R7A B;  2CNX A;  5EAM A;  3PVW B;  1XIP A;  2O9K A;  2H47 A;  2BCJ B;  1OMW B;  3SBR A;  2IWF A;  4H5J A;  4O9D A;  4CI2 A;  4J87 A;  5FA5 B;  1TBG A;  3HFQ A;  3P4F A;  3I7K A;  1JJU B;  1PBY B;  4UI9 R;  5C2W B;  2HJ4 A;  3C9C A;  4L9O A;  2H9N A;  2I0S A;  4GQ1 A;  2H14 A;  3AL8 B;  4PSX B;  3FM0 A;  3I89 A;  5GXH A;  4QT8 A;  4X63 B;  5CXB B;  4A09 B;  3EI2 B;  1SQJ A;  4NSX A;  3SWS D;  5HE0 B;  4FAN D;  3GRE A;  5IJ7 E;  3EI1 B;  1N6E A;  4QRJ A;  3UVK A;  4TZ4 A;  1NR0 A;  3EI4 B;  2CE8 A;  3ULE C;  4O1Q D;  4L3G D;  5AJA A;  3EU7 A;  2CO0 C;  1A0R B;  4OWR A;  3L4O D;  1PI6 A;  1MG2 A;  5K1C C;  1JMZ B;  3DXK C;  2H13 A;  3VH0 A;  1ERJ A;  4FA4 D;  2IUV A;  4X3E A;  1MDA H;  3C5M A;  5THA A;  2OK6 A;  2H9M A;  5EM2 A;  4A0B A;  4J84 A;  3UVN A;  2P9S C;  2YB8 B;  3SMR A;  4E5Z A;  1U4C A;  3ZWL B;  5HE2 B;  5FLX g;  2HJB A;  2AH1 A;  2B5N A;  2YBA A;  3I7N A;  1R5M A;  4K3I D;  2Z2N A;  3VA6 A;  4FA5 D;  4D0K A;  3F3F A;  4A11 A;  3UVO A;  3I7H A;  3CFS B;  5JWZ A;  4CZV A;  3PSC B;  5EAL A;  2AGL A;  2H6K A;  3MKS B;  3PXW D;  2IUR A;  5TEE A;  2AGW A;  4GQB B;  3BG0 A;  1XHM A;  5FKQ A;  3PVU B;  4ERQ A;  3BG1 A;  4XYI A;  2Q7Q A;  5EAP A;  5EMK B;  3MKQ A;  2GC7 A;  1B9Y A;  2AGY A;  1PEV A;  2PM7 B;  3IIW A;  2TRC B;  1N6D A;  5HE3 B;  5I5I A;  5C9Z B;  3JZG A;  4CY2 A;  2Z2O A;  3L4M D;  4E54 B;  2IUP A;  1GG2 B;  3OKY A;  4A2L A;  3N0E A;  3EI3 A;  4CI1 A;  3JAM g;  1K32 A;  1L0Q A;  1Q47 A;  5IJ8 E;  3C99 A;  5EM2 B;  1OLZ A;  2CN3 A;  4E5Z B;  3OKW A;  2OVQ B;  3F3G A;  4JT6 C;  1GOT B;  3SLE D;  2PM9 A;  3I2N A;  3PXS D;  4X61 B;  4ZOZ A;  5CYK B;  3PSL A;  3RRM C;  3V7D B;  3SFZ A;  2CN2 A;  3OTT A;  3J80 g;  3BWS A;  3CIK B;  4A11 B;  3IJ0 A;  5AMS A;  1B9X A;  4CZY A;  4CI8 A;  5FQD A;  4J73 A;  4Z8L A;  4FWW A;  4EWR A;  4J78 A;  4O3T B;  1TYQ C;  4GGA A;  3FRX A; 
#chains in the Genus database with same CATH topology
 3DM0 A;  4AMY A;  1VYH C;  3DXM C;  1S4U X;  3PXT D;  4J0W A;  4X60 B;  3SHF A;  2HXC A;  4AEZ A;  3OW8 A;  3A0F A;  3VGZ A;  2P9I C;  2Z2P A;  4BP8 A;  4H5I A;  4IMM A;  1H2Y A;  3JPX A;  5I5M A;  2EIC A;  3RFH A;  3EG6 A;  4A0A A;  5M5T A;  4JSX C;  4GGC A;  5HE1 B;  5TDH B;  4CY3 A;  4J8B A;  3SN6 B;  4BUJ C;  4ERZ A;  2H3X A;  1UOO A;  2B4E A;  1JV2 A;  3N0D A;  4L3H D;  3SJL D;  3SCY A;  4JT5 C;  4Z7O A;  2EBS A;  1O6F A;  3JRP A;  3IJC A;  3I7L A;  4J86 A;  4ZOX A;  2VDR A;  3IJE A;  3OKY B;  3T3P A;  4Z7Q A;  2I3T A;  5IC7 A;  4CC9 A;  3SBP A;  5HYN B;  3EI3 B;  2P9K C;  4ES0 A;  5EMJ B;  2XE4 A;  4A7J A;  4RE5 A;  4ZOY A;  4LGN A;  3DDU A;  1YFQ A;  4GM8 A;  2EID A;  4UM8 A;  4A08 A;  3FGB A;  4LG9 A;  2AGX A;  2H6Q A;  4BH6 A;  1GP2 B;  1UTC A;  4ZOV A;  3I7O A;  4GM9 A;  2PM9 B;  4QQE A;  4Y7R A;  3IVM A;  4PBZ A;  3MMY A;  3RMZ D;  2H9L A;  3MUN A;  3NIG A;  1N6F A;  1U2V C;  5FXY A;  2VC2 A;  5HDB A;  3SBQ A;  2IUQ A;  1MG3 A;  5CXC A;  2H6N A;  4WJK A;  4ERY A;  3IUR A;  2P9N C;  3V5W B;  3IKO A;  2B5M A;  2OVR B;  1E8M A;  4MMZ A;  3JB9 L;  1QFS A;  4PSW B;  2QXV A;  2MTA H;  4N14 A;  4NAA A;  3DWL C;  3O4J A;  3IUJ A;  2VDO A;  3UKR C;  1JOF A;  2YNP A;  2GC4 A;  3F3P A;  2G9A A;  2HKM A;  4U1E I;  1YR2 A;  2OIZ A;  4GQ2 P;  4U7A A;  3EMH A;  4Y5R D;  5FFG A;  4CZX A;  4A0A B;  3GD1 I;  2I0T A;  3VI4 A;  3OL2 A;  3E0C A;  4PXW A;  1PGU A;  3NIF A;  5C2V B;  4BL0 A;  4D6V A;  4FAV D;  2HU5 A;  3UKU C;  3IIY A;  2JKX A;  4YVD A;  2J55 H;  3QI0 A;  5M61 A;  4O02 A;  2GNQ A;  1SQ9 A;  3AH8 B;  5H17 A;  3ZDY A;  4IA9 A;  3JZH A;  5GMK n;  5FKT A;  1NEX B;  4A0B B;  3EQ7 A;  4BP9 A;  2I3S A;  3PE7 A;  2YNO A;  5EMM B;  4JSN C;  2HES X;  4JSV C;  4A08 B;  2P9U C;  3RN0 D;  2QC5 A;  2W18 A;  4JXM A;  3B7F A;  3UVM A;  3MZL A;  2XU7 A;  4FHL A;  2PM6 B;  3MZK A;  4KFM B;  2XYI A;  4L1Q D;  3C75 H;  3I8E A;  5IT9 g;  4GGD A;  1GXR A;  1QNI A;  2VDP A;  5CXC B;  4K3J B;  4J77 A;  4O3U B;  4AOW A;  2HYE A;  4QL1 A;  4CY5 A;  4MK0 B;  2P9L C;  4XEI C;  1P22 A;  2J57 G;  5H1M A;  2B5L A;  4PC0 A;  5IGQ A;  1FWX A;  1L5G A;  2J56 H;  4Z7N A;  2H68 A;  4FB1 D;  5M5R A;  3NVX A;  3IUN A;  4G1E A;  1H2W A;  4J79 A;  4BCB A;  3EWE A;  4A2M A;  4I79 A;  5GSA A;  4G55 A;  1M1X A;  2XL3 A;  3RN1 D;  2CO0 A;  5I5J A;  4J0X A;  3KCI A;  3ORV D;  3OL2 B;  3V9F A;  2BKL A;  3J81 g;  2I0R A;  2PBI B;  2H9P A;  5FKS A;  4GM3 A;  1K8K C;  3EQ9 A;  2VDN A;  2OVP B;  3KRX B;  2WQ8 A;  3JRO A;  5E6U A;  3NVN A;  4JD2 C;  4CY1 A;  5A2Q g;  5GXI A;  3OF7 A;  4HDJ A;  3AL9 A;  4PBY A;  4PNK B;  4E54 A;  4ZN4 A;  2IWK A;  4J82 A;  4FA9 D;  2G99 A;  4GMB A;  4J8G A;  4JHN A;  4JHP C;  3AFC A;  4GZ8 A;  4BCD A;  3KRW B;  1XKS A;  5EML B;  3K72 A;  2OK4 A;  5KDO B;  1UOP A;  5B4W A;  1O6G A;  3CFV A;  4IRZ A;  4LG8 A;  3ODT A;  2OJY A;  3RLM D;  5EAR A;  2IAA A;  2UZX B;  5H14 A;  1C9L A;  4ESG A;  5AFU 3;  3UR4 A;  3O4I A;  1GOH A;  1SHY B;  2CE9 A;  3SXT D;  4AN1 A;  4O45 A;  5TF2 A;  2AGZ A;  5HQG A;  3IJ1 A;  3FCU A;  4J81 A;  2P9P C;  1H2X A;  3U4Y A;  3K71 A;  5CYK A;  3AL8 A;  3MUO A;  1JMX B;  2AH0 A;  3I8C A;  4CI3 A;  2VZ3 A;  3OKT A;  5K19 A;  2BBK H;  4RE6 A;  3MXX A;  5CXB A;  4AMZ A;  4A09 A;  3V4V A;  3EI2 A;  3I7P A;  2HKR A;  3RSE C;  4G56 B;  3K6S A;  4JSP C;  5FKR A;  3SVW D;  3GFC A;  2XL2 A;  3ZE0 A;  3RFG A;  3W15 A;  3K27 A;  3EI1 A;  3JZN A;  4O2W A;  4WK2 A;  5TEF A;  2AQ5 A;  3GC3 B;  3EI4 A;  1TYE A;  4OZU A;  1RI6 A;  2YMU A;  3K26 A;  3DSM A;  1T2X A;  4XYH A;  4UM9 A;  3UVL A;  2YNN A;  5SXM A;  4FA1 D;  3NVQ A;  2UZY B;  5E6R A;  2XDW A;  4R7A B;  2CNX A;  5IGO A;  5EAM A;  3PVW B;  1XIP A;  3O4G A;  2O9K A;  2H47 A;  2BCJ B;  1OMW B;  3SBR A;  3MVD K;  3ZE1 A;  2IWF A;  4H5J A;  4O9D A;  2EIB A;  4CI2 A;  4J87 A;  5FA5 B;  1TBG A;  3IUM A;  3O4H A;  3HFQ A;  3P4F A;  5M5S A;  3I7K A;  2QR5 A;  1JJU B;  1BPO A;  1PBY B;  4UI9 R;  2VDQ A;  5C2W B;  2HJ4 A;  3C9C A;  4L9O A;  2H9N A;  2I0S A;  4GQ1 A;  2H14 A;  3AL8 B;  4WK0 A;  5C92 A;  1E8N A;  4PSX B;  4NEN A;  3FM0 A;  3I89 A;  5GXH A;  4QT8 A;  4X63 B;  5CXB B;  4A09 B;  3EI2 B;  4DNW A;  1SQJ A;  5FFO A;  4NSX A;  3SWS D;  5HE0 B;  1VZ3 A;  4FAN D;  3ZE2 A;  4D9S A;  3GRE A;  5IJ7 E;  3EI1 B;  2HU7 A;  1N6E A;  1VZ2 A;  2QZP A;  4QRJ A;  4WK4 A;  3UVK A;  4TZ4 A;  1NR0 A;  4NBM A;  3EI4 B;  2CE8 A;  3ULE C;  4O1Q D;  4L3G D;  5AJA A;  3EU7 A;  4DNU A;  2CO0 C;  1A0R B;  4OWR A;  3L4O D;  1PI6 A;  1MG2 A;  5K1C C;  1E5T A;  1JMZ B;  3DXK C;  2EIE A;  2H13 A;  3VH0 A;  1ERJ A;  4FA4 D;  4G1M A;  2IUV A;  4X3E A;  1MDA H;  3C5M A;  1TYQ C;  5THA A;  2OK6 A;  2H9M A;  5EM2 A;  4A0B A;  4J84 A;  2HU8 A;  3UVN A;  2P9S C;  2YB8 B;  3IUQ A;  3SMR A;  4E5Z A;  1U4C A;  3ZWL B;  5HE2 B;  5FLX g;  2HJB A;  2AH1 A;  2B5N A;  3IUL A;  2YBA A;  3I7N A;  1R5M A;  1VE6 A;  4K3I D;  3ZDX A;  2Z2N A;  3VA6 A;  4FA5 D;  1GOF A;  4D0K A;  3F3F A;  3ZDZ A;  4A11 A;  3UVO A;  3I7H A;  3CFS B;  5JWZ A;  4CZV A;  1GOG A;  5E6S A;  3PSC B;  1JTD B;  5EAL A;  2AGL A;  2VDL A;  2H6K A;  3V4P A;  3MKS B;  5M5V A;  3PXW D;  2IUR A;  5TEE A;  2AGW A;  4GQB B;  5C86 A;  3BG0 A;  4MMX A;  1XHM A;  5FKQ A;  1UOQ A;  2VDM A;  3PVU B;  4ERQ A;  3BG1 A;  2VDK A;  4XYI A;  2Q7Q A;  1K3I A;  5EAP A;  5EMK B;  3MKQ A;  1B9Y A;  3EQ8 A;  4AN0 A;  4NC4 A;  2AGY A;  1PEV A;  2PM7 B;  3IIW A;  2VZ1 A;  2TRC B;  1N6D A;  5HE3 B;  5I5I A;  5C9Z B;  3JZG A;  4CY2 A;  2Z2O A;  3L4M D;  4E54 B;  2IUP A;  4BCC A;  1GG2 B;  3OKY A;  4A2L A;  5M5U A;  4L1M A;  3N0E A;  1I2M B;  3EI3 A;  3FCS A;  4CI1 A;  3JAM g;  1K32 A;  1L0Q A;  1Q47 A;  5IJ8 E;  3C99 A;  3QHY B;  4QAM A;  3VI3 A;  3NID A;  1C9I A;  5EM2 B;  1OLZ A;  4MMY A;  1H2Z A;  1U8C A;  1QFM A;  2CN3 A;  1A12 A;  4E5Z B;  3OKW A;  2OVQ B;  3F3G A;  4DNV A;  4JT6 C;  1GOT B;  3SLE D;  2XZG A;  2PM9 A;  3I2N A;  1VE7 A;  3PXS D;  4X61 B;  4ZOZ A;  5CYK B;  3PSL A;  3RRM C;  3V7D B;  3SFZ A;  2CN2 A;  3OTT A;  3J80 g;  3BWS A;  3CIK B;  4A11 B;  3IJ0 A;  5AMS A;  1B9X A;  4CZY A;  4CI8 A;  4AX4 A;  3T3M A;  5FQD A;  4J73 A;  4Z8L A;  4FWW A;  4EWR A;  4J78 A;  4O3T B;  2GC7 A;  4GGA A;  3FRX A; 
#chains in the Genus database with same CATH homology
 3DM0 A;  1VYH C;  3DXM C;  1S4U X;  3PXT D;  4J0W A;  4X60 B;  3SHF A;  2HXC A;  4AEZ A;  3OW8 A;  3A0F A;  3VGZ A;  2P9I C;  2Z2P A;  4H5I A;  4IMM A;  3JPX A;  5I5M A;  3RFH A;  3EG6 A;  4A0A A;  4JSX C;  4GGC A;  5HE1 B;  5TDH B;  4CY3 A;  4J8B A;  3SN6 B;  4BUJ C;  4ERZ A;  2H3X A;  2B4E A;  3N0D A;  4L3H D;  3SJL D;  3SCY A;  4JT5 C;  2EBS A;  3JRP A;  3IJC A;  3I7L A;  4J86 A;  4ZOX A;  3OKY B;  2I3T A;  5IC7 A;  4CC9 A;  3SBP A;  5HYN B;  3EI3 B;  2P9K C;  4ES0 A;  5EMJ B;  4A7J A;  4ZOY A;  4LGN A;  1YFQ A;  4GM8 A;  4A08 A;  3FGB A;  4LG9 A;  2AGX A;  2H6Q A;  4BH6 A;  1GP2 B;  4ZOV A;  3I7O A;  4GM9 A;  2PM9 B;  4QQE A;  4Y7R A;  4PBZ A;  3MMY A;  3RMZ D;  2H9L A;  1N6F A;  1U2V C;  5FXY A;  3SBQ A;  2IUQ A;  1MG3 A;  5CXC A;  2H6N A;  4ERY A;  2P9N C;  3V5W B;  3IKO A;  2B5M A;  2OVR B;  3JB9 L;  4PSW B;  2QXV A;  2MTA H;  4N14 A;  3DWL C;  3UKR C;  1JOF A;  2YNP A;  2GC4 A;  3F3P A;  2G9A A;  2HKM A;  4U1E I;  2OIZ A;  4GQ2 P;  4U7A A;  3EMH A;  4Y5R D;  4CZX A;  4A0A B;  2I0T A;  3OL2 A;  3E0C A;  4PXW A;  1PGU A;  5C2V B;  4BL0 A;  4D6V A;  4FAV D;  3UKU C;  3IIY A;  4YVD A;  2J55 H;  2GNQ A;  1SQ9 A;  3AH8 B;  5H17 A;  4IA9 A;  3JZH A;  5GMK n;  5FKT A;  1NEX B;  4A0B B;  2I3S A;  3PE7 A;  2YNO A;  5EMM B;  4JSN C;  2HES X;  4JSV C;  4A08 B;  2P9U C;  3RN0 D;  2QC5 A;  2W18 A;  4JXM A;  3B7F A;  3UVM A;  3MZL A;  2XU7 A;  4FHL A;  2PM6 B;  3MZK A;  4KFM B;  2XYI A;  4L1Q D;  3C75 H;  3I8E A;  5IT9 g;  4GGD A;  1GXR A;  1QNI A;  5CXC B;  4K3J B;  4J77 A;  4O3U B;  4AOW A;  2HYE A;  4QL1 A;  4CY5 A;  4MK0 B;  2P9L C;  4XEI C;  1P22 A;  2J57 G;  5H1M A;  2B5L A;  4PC0 A;  5IGQ A;  1FWX A;  2J56 H;  2H68 A;  4FB1 D;  3NVX A;  4J79 A;  3EWE A;  4A2M A;  4I79 A;  5GSA A;  2XL3 A;  3RN1 D;  2CO0 A;  5I5J A;  4J0X A;  3ORV D;  3OL2 B;  3V9F A;  3J81 g;  2I0R A;  2PBI B;  2H9P A;  5FKS A;  4GM3 A;  1K8K C;  2OVP B;  3KRX B;  3JRO A;  3NVN A;  4JD2 C;  4CY1 A;  5A2Q g;  5GXI A;  4HDJ A;  3AL9 A;  4PBY A;  4PNK B;  4E54 A;  4ZN4 A;  2IWK A;  4J82 A;  4FA9 D;  2G99 A;  4GMB A;  4J8G A;  3AFC A;  4GZ8 A;  1XKS A;  3KRW B;  5EML B;  5KDO B;  2OK4 A;  5B4W A;  3CFV A;  4LG8 A;  3ODT A;  2OJY A;  3RLM D;  5EAR A;  2IAA A;  2UZX B;  5H14 A;  4ESG A;  5AFU 3;  3UR4 A;  2CE9 A;  1SHY B;  3SXT D;  4O45 A;  5TF2 A;  2AGZ A;  5HQG A;  3IJ1 A;  4J81 A;  2P9P C;  3U4Y A;  5CYK A;  3AL8 A;  1JMX B;  2AH0 A;  3I8C A;  4CI3 A;  3OKT A;  5K19 A;  2BBK H;  3MXX A;  5CXB A;  4A09 A;  3EI2 A;  3I7P A;  2HKR A;  3RSE C;  4G56 B;  4JSP C;  5FKR A;  3SVW D;  3GFC A;  2XL2 A;  3RFG A;  3W15 A;  3K27 A;  3EI1 A;  3JZN A;  5TEF A;  2AQ5 A;  3EI4 A;  4OZU A;  1RI6 A;  2YMU A;  3K26 A;  3DSM A;  4XYH A;  3UVL A;  2YNN A;  5SXM A;  4FA1 D;  3NVQ A;  2UZY B;  5IGO A;  4R7A B;  2CNX A;  5EAM A;  3PVW B;  1XIP A;  2O9K A;  2H47 A;  2BCJ B;  1OMW B;  3SBR A;  2IWF A;  4H5J A;  4O9D A;  4CI2 A;  4J87 A;  5FA5 B;  1TBG A;  3HFQ A;  3P4F A;  3I7K A;  1JJU B;  1PBY B;  4UI9 R;  5C2W B;  2HJ4 A;  3C9C A;  4L9O A;  2H9N A;  2I0S A;  4GQ1 A;  2H14 A;  3AL8 B;  4PSX B;  3FM0 A;  3I89 A;  5GXH A;  4QT8 A;  4X63 B;  5CXB B;  4A09 B;  3EI2 B;  1SQJ A;  4NSX A;  3SWS D;  5HE0 B;  4FAN D;  3GRE A;  5IJ7 E;  3EI1 B;  1N6E A;  4QRJ A;  3UVK A;  4TZ4 A;  1NR0 A;  3EI4 B;  2CE8 A;  3ULE C;  4O1Q D;  4L3G D;  5AJA A;  3EU7 A;  2CO0 C;  1A0R B;  4OWR A;  3L4O D;  1PI6 A;  1MG2 A;  5K1C C;  1JMZ B;  3DXK C;  2H13 A;  3VH0 A;  1ERJ A;  4FA4 D;  2IUV A;  4X3E A;  1MDA H;  3C5M A;  5THA A;  2OK6 A;  2H9M A;  5EM2 A;  4A0B A;  4J84 A;  3UVN A;  2P9S C;  2YB8 B;  3SMR A;  4E5Z A;  1U4C A;  3ZWL B;  5HE2 B;  5FLX g;  2HJB A;  2AH1 A;  2B5N A;  2YBA A;  3I7N A;  1R5M A;  4K3I D;  2Z2N A;  3VA6 A;  4FA5 D;  4D0K A;  3F3F A;  4A11 A;  3UVO A;  3I7H A;  3CFS B;  5JWZ A;  4CZV A;  3PSC B;  5EAL A;  2AGL A;  2H6K A;  3MKS B;  3PXW D;  2IUR A;  5TEE A;  2AGW A;  4GQB B;  3BG0 A;  1XHM A;  5FKQ A;  3PVU B;  4ERQ A;  3BG1 A;  4XYI A;  2Q7Q A;  5EAP A;  5EMK B;  3MKQ A;  2GC7 A;  1B9Y A;  2AGY A;  1PEV A;  2PM7 B;  3IIW A;  2TRC B;  1N6D A;  5HE3 B;  5I5I A;  5C9Z B;  3JZG A;  4CY2 A;  2Z2O A;  3L4M D;  4E54 B;  2IUP A;  1GG2 B;  3OKY A;  4A2L A;  3N0E A;  3EI3 A;  4CI1 A;  3JAM g;  1K32 A;  1L0Q A;  1Q47 A;  5IJ8 E;  3C99 A;  5EM2 B;  1OLZ A;  2CN3 A;  4E5Z B;  3OKW A;  2OVQ B;  3F3G A;  4JT6 C;  1GOT B;  3SLE D;  2PM9 A;  3I2N A;  3PXS D;  4X61 B;  4ZOZ A;  5CYK B;  3PSL A;  3RRM C;  3V7D B;  3SFZ A;  2CN2 A;  3OTT A;  3J80 g;  3BWS A;  3CIK B;  4A11 B;  3IJ0 A;  5AMS A;  1B9X A;  4CZY A;  4CI8 A;  5FQD A;  4J73 A;  4Z8L A;  4FWW A;  4EWR A;  4J78 A;  4O3T B;  1TYQ C;  4GGA A;  3FRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...