4X60B

Crystal structure of prmt5:mep50 with epz015666 and sinefungin
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
310
structure length
310
Chain Sequence
LPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 5
publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 86
structure length 310
sequence length 310
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4x60B00
2H9NA 4D6VA 1K32A 3OL2A 5CYKA 2P9LC 2H9PA 4L1QD 3SHFA 4JSPC 3K27A 4GQ1A 2P9KC 4A11A 5AMSA 4GGAA 4IMMA 4J0XA 4Z8LA 5FKQA 4PSXB 5AJAA 4U7AA 3VH0A 3UVNA 2OVPB 3SBQA 2CNXA 4CY5A 2G9AA 1GG2B 4ZOZA 3NVQA 2I0SA 4J73A 3NVXA 5EM2A 3CIKB 1XIPA 3B7FA 4ZOYA 3AL8B 2P9IC 5TEEA 3OKYB 4XYHA 1K8KC 3OKTA 4ZOVA 4A0BA 3F3FA 3N0DA 5GSAA 4YVDA 4FAND 1JOFA 3ODTA 4J81A 3IJ1A 1JMXB 1GXRA 2PM9A 3VGZA 3FGBA 4A2MA 3L4OD 5EARA 4PC0A 3EI2A 4O3UB 2J55H 1B9XA 2CE8A 4EWRA 3P4FA 1GP2B 4FA1D 3FRXA 2OK4A 3MZLA 3UKUC 4Y5RD 1SHYB 3MZKA 4CZYA 1N6FA 3EU7A 4X61B 3UVMA 4IA9A 2HXCA 4J82A 3RRMC 3DM0A 2PM6B 4CI2A 3I8EA 5FKTA 3K26A 3W15A 2Q7QA 3V9FA 4A0AB 4TZ4A 3EMHA 1PBYB 3UKRC 4BH6A 3I7HA 2BBKH 1U4CA 3OKYA 5AFU3 3JB9L 3MKQA 5CXCB 3RFHA 4O1QD 1RI6A 2W18A 2B5MA 5IC7A 1SQ9A 2OVRB 4L9OA 4E54B 4GGDA 5EAPA 2XL3A 3JZHA 3IIWA 2H13A 3I7KA 3UVKA 3J81g 5GXIA 4QRJA 2HKRA 2XL2A 2HKMA 3GREA 1SQJA 4LG9A 3RSEC 3SWSD 4OZUA 4GQBB 3PVUB 1R5MA 2GC7A 1U2VC 2OK6A 3L4MD 1FWXA 2TRCB 3IJ0A 4JSXC 5EMMB 2OJYA 3EG6A 4A0AA 2AQ5A 2IAAA 4CZVA 3MMYA 5H1MA 1QNIA 2IUQA 5IJ8E 4N14A 3DXMC 3I8CA 2H68A 4GM8A 2HESX 3AH8B 3PE7A 4J0WA 2J57G 5C2VB 3UVLA 2B5LA 3OTTA 4PBYA 5TDHB 5EAMA 5EALA 1PI6A 4A09B 3EI3B 5HE0B 5SXMA 2H3XA 4O45A 2XU7A 2OIZA 4ERYA 3JPXA 4AOWA 4QL1A 2IURA 4JSVC 4CI3A 5IGOA 2PM7B 3DWLC 5FKRA 4D0KA 2UZYB 4OWRA 1Q47A 4PSWB 3KRWB 3JZGA 4CY1A 2H6QA 2PBIB 4GGCA 4H5JA 2BCJB 2H6NA 3PXSD 5HE3B 5EMLB 4J77A 3FM0A 2YBAA 4QT8A 1NR0A 2B4EA 4GQ2P 3C5MA 4BL0A 3EWEA 4PBZA 5H17A 4FHLA 1OMWB 1VYHC 1P22A 4O9DA 5FQDA 2H6KA 4CC9A 5GXHA 4UI9R 4PXWA 4O3TB 4PNKB 4J8BA 1S4UX 4E5ZB 2H9MA 3CFVA 1PGUA 1GOTB 3AL8A 5C9ZB 3I2NA 5KDOB 3F3GA 5TEFA 2O9KA 2Z2OA 3OKWA 3SVWD 4J84A 2IWKA 4JSNC 4KFMB 4A11B 1B9YA 2GC4A 2CN2A 2CO0A 3C9CA 4A7JA 3J80g 2AH0A 3I7OA 3PSCB 3SMRA 1MDAH 2H9LA 4ES0A 4ERQA 2Z2NA 4GM9A 2G99A 2AGXA 3JAMg 2AGLA 1OLZA 4BUJC 1NEXB 3ULEC 1PEVA 5HQGA 4A08B 2YNPA 1L0QA 2P9PC 2HJ4A 4X3EA 5HYNB 3DXKC 4A2LA 4ZN4A 4A0BB 5FKSA 2P9UC 5I5MA 2I3SA 2YMUA 2PM9B 5JWZA 2QXVA 4H5IA 2XYIA 4GZ8A 4FA4D 4JD2C 4HDJA 4J87A 5CXCA 4I79A 3NVNA 4ESGA 2IUVA 2HJBA 3I7PA 3V5WB 4LG8A 5H14A 1A0RB 5I5IA 2I0TA 4J79A 4FA9D 5IGQA 4E54A 5GMKn 5EMKB 2CE9A 3AL9A 3MKSB 4GMBA 2QC5A 3CFSB 2I0RA 4GM3A 3IKOA 4CY2A 2GNQA 2AH1A 4JT5C 1MG3A 3IJCA 5I5JA 4ERZA 5FLXg 4FB1D 3C99A 3N0EA 3E0CA 4A08A 3F3PA 2P9NC 4NSXA 5EMJB 5THAA 5IJ7E 2HYEA 2H47A 1JMZB 4JT6C 2UZXB 2B5NA 4AEZA 2P9SC 3RLMD 1YFQA 3RFGA 4L3GD 3SBRA 3EI4B 3SBPA 3IIYA 4CY3A 3PXWD 4J8GA 3C75H 3PXTD 2AGWA 3AFCA 5CXBB 3BWSA 3EI1B 5A2Qg 1TYQC 4Y7RA 3GFCA 3I89A 4FA5D 1N6EA 4XEIC 2EBSA 3JZNA 3SFZA 3SCYA 3JROA 4A09A 4FAVD 4J78A 4K3ID 3UR4A 2H14A 2YNNA 3EI3A 4R7AB 3PSLA 4FWWA 3JRPA 2CN3A 4ZOXA 4X63B 2OVQB 2IUPA 3DSMA 4XYIA 3A0FA 3UVOA 2CO0C 3OL2B 5CYKB 3BG1A 2YNOA 2AGYA 1MG2A 5HE2B 3KRXB 1XKSA 3ZWLB 3RMZD 3RN1D 1XHMA 3SLED 5K1CC 5FA5B 3I7NA 3V7DB 5C2WB 4U1EI 3BG0A 3SN6B 3U4YA 4QQEA 4K3JB 3PVWB 2Z2PA 3ORVD 1TBGA 3EI4A 4CI8A 5IT9g 5EM2B 4LGNA 3VA6A 4X60B 2MTAH 3OW8A 3MXXA 4J86A 4CI1A 5CXBA 3I7LA 3EI1A 5B4WA 2I3TA 1ERJA 5FXYA 2IWFA 5K19A 3HFQA 3SXTD 3RN0D 5HE1B 5TF2A 4E5ZA 4G56B 4CZXA 3SJLD 4L3HD 2AGZA 2J56H 4JXMA 4MK0B 1N6DA 2YB8B 3EI2B 1JJUB
chains in the Genus database with same CATH superfamily
2H9NA 2VZ3A 1K32A 3OL2A 5CYKA 2P9LC 2H9PA 4L1QD 4D6VA 3SHFA 4O02A 1JTDB 2XZGA 4JSPC 5M5SA 3K27A 4GQ1A 2P9KC 3V4VA 4A11A 5AMSA 4GGAA 4IMMA 4J0XA 4Z8LA 5FKQA 4PSXB 5AJAA 4Z7NA 1UTCA 4U7AA 3VH0A 4D9SA 1M1XA 3UVNA 2OVPB 3SBQA 2CNXA 4CY5A 2G9AA 4BP8A 1GG2B 4ZOZA 3NVQA 4NAAA 2I0SA 4J73A 3NVXA 4O2WA 5EM2A 3CIKB 1XIPA 1E8MA 1E5TA 3B7FA 3IUQA 4AMZA 4ZOYA 1L5GA 3AL8B 4NENA 2P9IC 5TEEA 3OKYB 2VDPA 4XYHA 1K8KC 3OKTA 4ZOVA 4A0BA 3F3FA 3N0DA 3ZDZA 5GSAA 3O4GA 4YVDA 4FAND 1JOFA 3ODTA 4J81A 3IJ1A 3IURA 1JMXB 1GXRA 2PM9A 3VGZA 3FGBA 4A2MA 3L4OD 5EARA 4PC0A 3EI2A 4O3UB 2J55H 3EQ9A 1B9XA 2CE8A 4EWRA 3P4FA 1GP2B 3IUMA 4FA1D 3FRXA 2OK4A 3MZLA 3UKUC 4MMXA 1SHYB 3MZKA 4Y5RD 1N6FA 4CZYA 3EU7A 4X61B 3UVMA 4IA9A 2HXCA 4J82A 3RRMC 1GOHA 3DM0A 3VI4A 2PM6B 4CI2A 3I8EA 2QZPA 2HU8A 5FKTA 3MVDK 4BCBA 3K26A 3W15A 2Q7QA 3DDUA 3V9FA 4A0AB 3O4JA 1K3IA 2XE4A 4TZ4A 3EMHA 1PBYB 3EQ8A 3UKRC 4BH6A 3I7HA 2BBKH 1U4CA 4JHPC 4UM8A 4BP9A 3OKYA 1UOQA 4WK0A 5AFU3 3JB9L 2VZ1A 3MKQA 5CXCB 3RFHA 4O1QD 1RI6A 4RE6A 2W18A 2B5MA 1VE6A 1QFMA 5IC7A 4MMZA 1SQ9A 2OVRB 4L9OA 5M5TA 4E54B 4GGDA 1H2YA 5EAPA 4JHNA 3O4IA 2XL3A 3JZHA 2VDMA 2H13A 3IIWA 3I7KA 3UVKA 3J81g 2EICA 5GXIA 2EIBA 4QRJA 2HKRA 2XL2A 2HKMA 5E6UA 3GREA 1SQJA 4LG9A 3RSEC 3SWSD 4OZUA 4GQBB 3PVUB 1R5MA 2GC7A 5M5VA 1U2VC 3KCIA 5M5UA 3NIDA 2OK6A 3L4MD 1FWXA 2TRCB 1YR2A 3IJ0A 4JSXC 3IVMA 5EMMB 5FFGA 2OJYA 3EG6A 3VI3A 4A0AA 2AQ5A 2IAAA 4CZVA 3MMYA 4G55A 5H1MA 1QNIA 2IUQA 5IJ8E 4N14A 3DXMC 3I8CA 2H68A 4GM8A 2HESX 4MMYA 3AH8B 3NIGA 3PE7A 4J0WA 2J57G 5C2VB 3UVLA 2B5LA 3OTTA 4PBYA 3MUOA 5TDHB 5EAMA 5EALA 1PI6A 3K71A 3FCUA 4A09B 3EI3B 5HE0B 5SXMA 2H3XA 4O45A 2XU7A 2OIZA 4DNUA 4ERYA 3JPXA 4AOWA 4QL1A 2IURA 4JSVC 3OF7A 4CI3A 5IGOA 5E6SA 2VC2A 2PM7B 3DWLC 5FKRA 3ZE2A 3NIFA 4D0KA 2UZYB 4OWRA 2VDKA 1GOFA 1Q47A 4PSWB 3KRWB 3JZGA 4CY1A 2H6QA 2PBIB 4GGCA 4H5JA 2BCJB 2H6NA 3PXSD 5HE3B 5EMLB 4J77A 3FM0A 3IULA 2YBAA 4QT8A 4NC4A 1NR0A 1T2XA 2B4EA 4GQ2P 1VZ2A 3C5MA 4BL0A 3EWEA 4PBZA 5H17A 1QFSA 5E6RA 4FHLA 1OMWB 4AN1A 1GOGA 1VYHC 1P22A 4O9DA 5FQDA 3GD1I 2H6KA 4CC9A 5GXHA 2QR5A 4UI9R 1E8NA 4PXWA 1H2XA 4AX4A 4O3TB 4PNKB 5C86A 1H2ZA 4J8BA 1S4UX 4E5ZB 2JKXA 2H9MA 3CFVA 1PGUA 1GOTB 3AL8A 4Z7OA 4IRZA 5C9ZB 3I2NA 5KDOB 3F3GA 5TEFA 2O9KA 2Z2OA 3OKWA 3SVWD 4J84A 2IWKA 3ZDYA 4JSNC 3MUNA 4KFMB 1O6GA 2VDOA 2XDWA 3QI0A 4A11B 1B9YA 4QAMA 2GC4A 2CN2A 2CO0A 3C9CA 4A7JA 3J80g 2AH0A 3I7OA 3PSCB 3SMRA 4DNVA 1MDAH 2H9LA 5C92A 3IUNA 4ES0A 3FCSA 4ERQA 2Z2NA 4GM9A 2G99A 2AGXA 3JAMg 1C9IA 1OLZA 2AGLA 4BUJC 1NEXB 3ULEC 1PEVA 1UOOA 5HQGA 4A08B 2YNPA 1L0QA 2P9PC 2HJ4A 4X3EA 5HYNB 3DXKC 3K6SA 4A2LA 3ZE0A 1VE7A 4ZN4A 4A0BB 3ZE1A 5FKSA 2P9UC 1A12A 5I5MA 2I3SA 2YMUA 2PM9B 5JWZA 2QXVA 4H5IA 2XYIA 2HU7A 4GZ8A 4FA4D 4JD2C 4HDJA 4J87A 5CXCA 4I79A 3NVNA 4ESGA 2IUVA 4WJKA 2HJBA 3I7PA 3V5WB 4LG8A 3IUJA 5H14A 3K72A 3T3PA 1A0RB 5FFOA 5I5IA 2I0TA 3EQ7A 4J79A 4FA9D 5IGQA 4E54A 4G1MA 5GMKn 2VDQA 5EMKB 2CE9A 3AL9A 3MKSB 1VZ3A 4GMBA 2QC5A 5HDBA 3CFSB 2I0RA 4GM3A 3IKOA 4CY2A 2GNQA 2AH1A 4JT5C 1MG3A 3IJCA 5I5JA 4ERZA 4WK4A 3T3MA 4FB1D 3C99A 5FLXg 3N0EA 3E0CA 4A08A 3F3PA 2P9NC 4NSXA 5EMJB 5THAA 5IJ7E 2HYEA 2H47A 1JMZB 4JT6C 1H2WA 2UZXB 4BCCA 2B5NA 4AEZA 2P9SC 3RLMD 1YFQA 4G1EA 3RFGA 4L3GD 3SBRA 3EI4B 1JV2A 3SBPA 3IIYA 4RE5A 4CY3A 4UM9A 3PXWD 4J8GA 3C75H 4DNWA 2VDRA 3PXTD 4Z7QA 1I2MB 2AGWA 3AFCA 5CXBB 3BWSA 3EI1B 5A2Qg 2WQ8A 4BCDA 1TYQC 1U8CA 4Y7RA 3I89A 3GFCA 4FA5D 1N6EA 4XEIC 2EBSA 3JZNA 3SFZA 3SCYA 3JROA 4A09A 4FAVD 4J78A 4K3ID 3UR4A 2H14A 2YNNA 3EI3A 4R7AB 3PSLA 4FWWA 3JRPA 2CN3A 4ZOXA 4X63B 2VDNA 5M61A 2OVQB 2IUPA 3DSMA 4XYIA 1C9LA 3A0FA 2CO0C 3OL2B 5CYKB 3UVOA 3BG1A 2YNOA 2AGYA 3O4HA 1MG2A 5HE2B 3KRXB 1XKSA 4WK2A 3ZDXA 3ZWLB 1BPOA 3RMZD 1TYEA 3RN1D 1XHMA 1UOPA 4NBMA 3SLED 5K1CC 5FA5B 3I7NA 3V7DB 5C2WB 4U1EI 3BG0A 3SN6B 3U4YA 3V4PA 4QQEA 4K3JB 3PVWB 3GC3B 2Z2PA 3ORVD 1TBGA 3EI4A 4L1MA 2EIEA 4CI8A 5IT9g 5EM2B 4LGNA 3VA6A 4X60B 2MTAH 4AMYA 3OW8A 3MXXA 4J86A 1O6FA 4CI1A 5CXBA 3I7LA 4AN0A 5B4WA 3EI1A 2I3TA 1ERJA 5FXYA 2IWFA 5K19A 3HFQA 5M5RA 3SXTD 3RN0D 2VDLA 5HE1B 2BKLA 2HU5A 5TF2A 4E5ZA 4G56B 4CZXA 2EIDA 3SJLD 4L3HD 2AGZA 2J56H 4JXMA 4MK0B 3IJEA 1N6DA 2YB8B 3QHYB 3EI2B 1JJUB
chains in the Genus database with same CATH topology
2H9NA 4D6VA 1K32A 3OL2A 5CYKA 2P9LC 2H9PA 4L1QD 3SHFA 4JSPC 3K27A 4GQ1A 2P9KC 4A11A 5AMSA 4GGAA 4IMMA 4J0XA 4Z8LA 5FKQA 4PSXB 5AJAA 4U7AA 3VH0A 3UVNA 2OVPB 3SBQA 2CNXA 4CY5A 2G9AA 1GG2B 4ZOZA 3NVQA 2I0SA 4J73A 3NVXA 5EM2A 3CIKB 1XIPA 3B7FA 4ZOYA 3AL8B 2P9IC 5TEEA 3OKYB 4XYHA 1K8KC 3OKTA 4ZOVA 4A0BA 3F3FA 3N0DA 5GSAA 4YVDA 4FAND 1JOFA 3ODTA 4J81A 3IJ1A 1JMXB 1GXRA 2PM9A 3VGZA 3FGBA 4A2MA 3L4OD 5EARA 4PC0A 3EI2A 4O3UB 2J55H 1B9XA 2CE8A 4EWRA 3P4FA 1GP2B 4FA1D 3FRXA 2OK4A 3MZLA 3UKUC 4Y5RD 1SHYB 3MZKA 4CZYA 1N6FA 3EU7A 4X61B 3UVMA 4IA9A 2HXCA 4J82A 3RRMC 3DM0A 2PM6B 4CI2A 3I8EA 5FKTA 3K26A 3W15A 2Q7QA 3V9FA 4A0AB 4TZ4A 3EMHA 1PBYB 3UKRC 4BH6A 3I7HA 2BBKH 1U4CA 3OKYA 5AFU3 3JB9L 3MKQA 5CXCB 3RFHA 4O1QD 1RI6A 2W18A 2B5MA 5IC7A 1SQ9A 2OVRB 4L9OA 4E54B 4GGDA 5EAPA 2XL3A 3JZHA 3IIWA 2H13A 3I7KA 3UVKA 3J81g 5GXIA 4QRJA 2HKRA 2XL2A 2HKMA 3GREA 1SQJA 4LG9A 3RSEC 3SWSD 4OZUA 4GQBB 3PVUB 1R5MA 2GC7A 1U2VC 2OK6A 3L4MD 1FWXA 2TRCB 3IJ0A 4JSXC 5EMMB 2OJYA 3EG6A 4A0AA 2AQ5A 2IAAA 4CZVA 3MMYA 5H1MA 1QNIA 2IUQA 5IJ8E 4N14A 3DXMC 3I8CA 2H68A 4GM8A 2HESX 3AH8B 3PE7A 4J0WA 2J57G 5C2VB 3UVLA 2B5LA 3OTTA 4PBYA 5TDHB 5EAMA 5EALA 1PI6A 4A09B 3EI3B 5HE0B 5SXMA 2H3XA 4O45A 2XU7A 2OIZA 4ERYA 3JPXA 4AOWA 4QL1A 2IURA 4JSVC 4CI3A 5IGOA 2PM7B 3DWLC 5FKRA 4D0KA 2UZYB 4OWRA 1Q47A 4PSWB 3KRWB 3JZGA 4CY1A 2H6QA 2PBIB 4GGCA 4H5JA 2BCJB 2H6NA 3PXSD 5HE3B 5EMLB 4J77A 3FM0A 2YBAA 4QT8A 1NR0A 2B4EA 4GQ2P 3C5MA 4BL0A 3EWEA 4PBZA 5H17A 4FHLA 1OMWB 1VYHC 1P22A 4O9DA 5FQDA 2H6KA 4CC9A 5GXHA 4UI9R 4PXWA 4O3TB 4PNKB 4J8BA 1S4UX 4E5ZB 2H9MA 3CFVA 1PGUA 1GOTB 3AL8A 5C9ZB 3I2NA 5KDOB 3F3GA 5TEFA 2O9KA 2Z2OA 3OKWA 3SVWD 4J84A 2IWKA 4JSNC 4KFMB 4A11B 1B9YA 2GC4A 2CN2A 2CO0A 3C9CA 4A7JA 3J80g 2AH0A 3I7OA 3PSCB 3SMRA 1MDAH 2H9LA 4ES0A 4ERQA 2Z2NA 4GM9A 2G99A 2AGXA 3JAMg 2AGLA 1OLZA 4BUJC 1NEXB 3ULEC 1PEVA 5HQGA 4A08B 2YNPA 1L0QA 2P9PC 2HJ4A 4X3EA 5HYNB 3DXKC 4A2LA 4ZN4A 4A0BB 5FKSA 2P9UC 5I5MA 2I3SA 2YMUA 2PM9B 5JWZA 2QXVA 4H5IA 2XYIA 4GZ8A 4FA4D 4JD2C 4HDJA 4J87A 5CXCA 4I79A 3NVNA 4ESGA 2IUVA 2HJBA 3I7PA 3V5WB 4LG8A 5H14A 1A0RB 5I5IA 2I0TA 4J79A 4FA9D 5IGQA 4E54A 5GMKn 5EMKB 2CE9A 3AL9A 3MKSB 4GMBA 2QC5A 3CFSB 2I0RA 4GM3A 3IKOA 4CY2A 2GNQA 2AH1A 4JT5C 1MG3A 3IJCA 5I5JA 4ERZA 5FLXg 4FB1D 3C99A 3N0EA 3E0CA 4A08A 3F3PA 2P9NC 4NSXA 5EMJB 5THAA 5IJ7E 2HYEA 2H47A 1JMZB 4JT6C 2UZXB 2B5NA 4AEZA 2P9SC 3RLMD 1YFQA 3RFGA 4L3GD 3SBRA 3EI4B 3SBPA 3IIYA 4CY3A 3PXWD 4J8GA 3C75H 3PXTD 2AGWA 3AFCA 5CXBB 3BWSA 3EI1B 5A2Qg 1TYQC 4Y7RA 3GFCA 3I89A 4FA5D 1N6EA 4XEIC 2EBSA 3JZNA 3SFZA 3SCYA 3JROA 4A09A 4FAVD 4J78A 4K3ID 3UR4A 2H14A 2YNNA 3EI3A 4R7AB 3PSLA 4FWWA 3JRPA 2CN3A 4ZOXA 4X63B 2OVQB 2IUPA 3DSMA 4XYIA 3A0FA 3UVOA 2CO0C 3OL2B 5CYKB 3BG1A 2YNOA 2AGYA 1MG2A 5HE2B 3KRXB 1XKSA 3ZWLB 3RMZD 3RN1D 1XHMA 3SLED 5K1CC 5FA5B 3I7NA 3V7DB 5C2WB 4U1EI 3BG0A 3SN6B 3U4YA 4QQEA 4K3JB 3PVWB 2Z2PA 3ORVD 1TBGA 3EI4A 4CI8A 5IT9g 5EM2B 4LGNA 3VA6A 4X60B 2MTAH 3OW8A 3MXXA 4J86A 4CI1A 5CXBA 3I7LA 3EI1A 5B4WA 2I3TA 1ERJA 5FXYA 2IWFA 5K19A 3HFQA 3SXTD 3RN0D 5HE1B 5TF2A 4E5ZA 4G56B 4CZXA 3SJLD 4L3HD 2AGZA 2J56H 4JXMA 4MK0B 1N6DA 2YB8B 3EI2B 1JJUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H9N A;  4D6V A;  1K32 A;  3OL2 A;  5CYK A;  2P9L C;  2H9P A;  4L1Q D;  3SHF A;  4JSP C;  3K27 A;  4GQ1 A;  2P9K C;  4A11 A;  5AMS A;  4GGA A;  4IMM A;  4J0X A;  4Z8L A;  5FKQ A;  4PSX B;  5AJA A;  4U7A A;  3VH0 A;  3UVN A;  2OVP B;  3SBQ A;  2CNX A;  4CY5 A;  2G9A A;  1GG2 B;  4ZOZ A;  3NVQ A;  2I0S A;  4J73 A;  3NVX A;  5EM2 A;  3CIK B;  1XIP A;  3B7F A;  4ZOY A;  3AL8 B;  2P9I C;  5TEE A;  3OKY B;  4XYH A;  1K8K C;  3OKT A;  4ZOV A;  4A0B A;  3F3F A;  3N0D A;  5GSA A;  4YVD A;  4FAN D;  1JOF A;  3ODT A;  4J81 A;  3IJ1 A;  1JMX B;  1GXR A;  2PM9 A;  3VGZ A;  3FGB A;  4A2M A;  3L4O D;  5EAR A;  4PC0 A;  3EI2 A;  4O3U B;  2J55 H;  1B9X A;  2CE8 A;  4EWR A;  3P4F A;  1GP2 B;  4FA1 D;  3FRX A;  2OK4 A;  3MZL A;  3UKU C;  4Y5R D;  1SHY B;  3MZK A;  4CZY A;  1N6F A;  3EU7 A;  4X61 B;  3UVM A;  4IA9 A;  2HXC A;  4J82 A;  3RRM C;  3DM0 A;  2PM6 B;  4CI2 A;  3I8E A;  5FKT A;  3K26 A;  3W15 A;  2Q7Q A;  3V9F A;  4A0A B;  4TZ4 A;  3EMH A;  1PBY B;  3UKR C;  4BH6 A;  3I7H A;  2BBK H;  1U4C A;  3OKY A;  5AFU 3;  3JB9 L;  3MKQ A;  5CXC B;  3RFH A;  4O1Q D;  1RI6 A;  2W18 A;  2B5M A;  5IC7 A;  1SQ9 A;  2OVR B;  4L9O A;  4E54 B;  4GGD A;  5EAP A;  2XL3 A;  3JZH A;  3IIW A;  2H13 A;  3I7K A;  3UVK A;  3J81 g;  5GXI A;  4QRJ A;  2HKR A;  2XL2 A;  2HKM A;  3GRE A;  1SQJ A;  4LG9 A;  3RSE C;  3SWS D;  4OZU A;  4GQB B;  3PVU B;  1R5M A;  2GC7 A;  1U2V C;  2OK6 A;  3L4M D;  1FWX A;  2TRC B;  3IJ0 A;  4JSX C;  5EMM B;  2OJY A;  3EG6 A;  4A0A A;  2AQ5 A;  2IAA A;  4CZV A;  3MMY A;  5H1M A;  1QNI A;  2IUQ A;  5IJ8 E;  4N14 A;  3DXM C;  3I8C A;  2H68 A;  4GM8 A;  2HES X;  3AH8 B;  3PE7 A;  4J0W A;  2J57 G;  5C2V B;  3UVL A;  2B5L A;  3OTT A;  4PBY A;  5TDH B;  5EAM A;  5EAL A;  1PI6 A;  4A09 B;  3EI3 B;  5HE0 B;  5SXM A;  2H3X A;  4O45 A;  2XU7 A;  2OIZ A;  4ERY A;  3JPX A;  4AOW A;  4QL1 A;  2IUR A;  4JSV C;  4CI3 A;  5IGO A;  2PM7 B;  3DWL C;  5FKR A;  4D0K A;  2UZY B;  4OWR A;  1Q47 A;  4PSW B;  3KRW B;  3JZG A;  4CY1 A;  2H6Q A;  2PBI B;  4GGC A;  4H5J A;  2BCJ B;  2H6N A;  3PXS D;  5HE3 B;  5EML B;  4J77 A;  3FM0 A;  2YBA A;  4QT8 A;  1NR0 A;  2B4E A;  4GQ2 P;  3C5M A;  4BL0 A;  3EWE A;  4PBZ A;  5H17 A;  4FHL A;  1OMW B;  1VYH C;  1P22 A;  4O9D A;  5FQD A;  2H6K A;  4CC9 A;  5GXH A;  4UI9 R;  4PXW A;  4O3T B;  4PNK B;  4J8B A;  1S4U X;  4E5Z B;  2H9M A;  3CFV A;  1PGU A;  1GOT B;  3AL8 A;  5C9Z B;  3I2N A;  5KDO B;  3F3G A;  5TEF A;  2O9K A;  2Z2O A;  3OKW A;  3SVW D;  4J84 A;  2IWK A;  4JSN C;  4KFM B;  4A11 B;  1B9Y A;  2GC4 A;  2CN2 A;  2CO0 A;  3C9C A;  4A7J A;  3J80 g;  2AH0 A;  3I7O A;  3PSC B;  3SMR A;  1MDA H;  2H9L A;  4ES0 A;  4ERQ A;  2Z2N A;  4GM9 A;  2G99 A;  2AGX A;  3JAM g;  2AGL A;  1OLZ A;  4BUJ C;  1NEX B;  3ULE C;  1PEV A;  5HQG A;  4A08 B;  2YNP A;  1L0Q A;  2P9P C;  2HJ4 A;  4X3E A;  5HYN B;  3DXK C;  4A2L A;  4ZN4 A;  4A0B B;  5FKS A;  2P9U C;  5I5M A;  2I3S A;  2YMU A;  2PM9 B;  5JWZ A;  2QXV A;  4H5I A;  2XYI A;  4GZ8 A;  4FA4 D;  4JD2 C;  4HDJ A;  4J87 A;  5CXC A;  4I79 A;  3NVN A;  4ESG A;  2IUV A;  2HJB A;  3I7P A;  3V5W B;  4LG8 A;  5H14 A;  1A0R B;  5I5I A;  2I0T A;  4J79 A;  4FA9 D;  5IGQ A;  4E54 A;  5GMK n;  5EMK B;  2CE9 A;  3AL9 A;  3MKS B;  4GMB A;  2QC5 A;  3CFS B;  2I0R A;  4GM3 A;  3IKO A;  4CY2 A;  2GNQ A;  2AH1 A;  4JT5 C;  1MG3 A;  3IJC A;  5I5J A;  4ERZ A;  5FLX g;  4FB1 D;  3C99 A;  3N0E A;  3E0C A;  4A08 A;  3F3P A;  2P9N C;  4NSX A;  5EMJ B;  5THA A;  5IJ7 E;  2HYE A;  2H47 A;  1JMZ B;  4JT6 C;  2UZX B;  2B5N A;  4AEZ A;  2P9S C;  3RLM D;  1YFQ A;  3RFG A;  4L3G D;  3SBR A;  3EI4 B;  3SBP A;  3IIY A;  4CY3 A;  3PXW D;  4J8G A;  3C75 H;  3PXT D;  2AGW A;  3AFC A;  5CXB B;  3BWS A;  3EI1 B;  5A2Q g;  1TYQ C;  4Y7R A;  3GFC A;  3I89 A;  4FA5 D;  1N6E A;  4XEI C;  2EBS A;  3JZN A;  3SFZ A;  3SCY A;  3JRO A;  4A09 A;  4FAV D;  4J78 A;  4K3I D;  3UR4 A;  2H14 A;  2YNN A;  3EI3 A;  4R7A B;  3PSL A;  4FWW A;  3JRP A;  2CN3 A;  4ZOX A;  4X63 B;  2OVQ B;  2IUP A;  3DSM A;  4XYI A;  3A0F A;  3UVO A;  2CO0 C;  3OL2 B;  5CYK B;  3BG1 A;  2YNO A;  2AGY A;  1MG2 A;  5HE2 B;  3KRX B;  1XKS A;  3ZWL B;  3RMZ D;  3RN1 D;  1XHM A;  3SLE D;  5K1C C;  5FA5 B;  3I7N A;  3V7D B;  5C2W B;  4U1E I;  3BG0 A;  3SN6 B;  3U4Y A;  4QQE A;  4K3J B;  3PVW B;  2Z2P A;  3ORV D;  1TBG A;  3EI4 A;  4CI8 A;  5IT9 g;  5EM2 B;  4LGN A;  3VA6 A;  4X60 B;  2MTA H;  3OW8 A;  3MXX A;  4J86 A;  4CI1 A;  5CXB A;  3I7L A;  3EI1 A;  5B4W A;  2I3T A;  1ERJ A;  5FXY A;  2IWF A;  5K19 A;  3HFQ A;  3SXT D;  3RN0 D;  5HE1 B;  5TF2 A;  4E5Z A;  4G56 B;  4CZX A;  3SJL D;  4L3H D;  2AGZ A;  2J56 H;  4JXM A;  4MK0 B;  1N6D A;  2YB8 B;  3EI2 B;  1JJU B; 
#chains in the Genus database with same CATH topology
 2H9N A;  2VZ3 A;  1K32 A;  3OL2 A;  5CYK A;  2P9L C;  2H9P A;  4L1Q D;  4D6V A;  3SHF A;  4O02 A;  1JTD B;  2XZG A;  4JSP C;  5M5S A;  3K27 A;  4GQ1 A;  2P9K C;  3V4V A;  4A11 A;  5AMS A;  4GGA A;  4IMM A;  4J0X A;  4Z8L A;  5FKQ A;  4PSX B;  5AJA A;  4Z7N A;  1UTC A;  4U7A A;  3VH0 A;  4D9S A;  1M1X A;  3UVN A;  2OVP B;  3SBQ A;  2CNX A;  4CY5 A;  2G9A A;  4BP8 A;  1GG2 B;  4ZOZ A;  3NVQ A;  4NAA A;  2I0S A;  4J73 A;  3NVX A;  4O2W A;  5EM2 A;  3CIK B;  1XIP A;  1E8M A;  1E5T A;  3B7F A;  3IUQ A;  4AMZ A;  4ZOY A;  1L5G A;  3AL8 B;  4NEN A;  2P9I C;  5TEE A;  3OKY B;  2VDP A;  4XYH A;  1K8K C;  3OKT A;  4ZOV A;  4A0B A;  3F3F A;  3N0D A;  3ZDZ A;  5GSA A;  3O4G A;  4YVD A;  4FAN D;  1JOF A;  3ODT A;  4J81 A;  3IJ1 A;  3IUR A;  1JMX B;  1GXR A;  2PM9 A;  3VGZ A;  3FGB A;  4A2M A;  3L4O D;  5EAR A;  4PC0 A;  3EI2 A;  4O3U B;  2J55 H;  3EQ9 A;  1B9X A;  2CE8 A;  4EWR A;  3P4F A;  1GP2 B;  3IUM A;  4FA1 D;  3FRX A;  2OK4 A;  3MZL A;  3UKU C;  4MMX A;  1SHY B;  3MZK A;  4Y5R D;  1N6F A;  4CZY A;  3EU7 A;  4X61 B;  3UVM A;  4IA9 A;  2HXC A;  4J82 A;  3RRM C;  1GOH A;  3DM0 A;  3VI4 A;  2PM6 B;  4CI2 A;  3I8E A;  2QZP A;  2HU8 A;  5FKT A;  3MVD K;  4BCB A;  3K26 A;  3W15 A;  2Q7Q A;  3DDU A;  3V9F A;  4A0A B;  3O4J A;  1K3I A;  2XE4 A;  4TZ4 A;  3EMH A;  1PBY B;  3EQ8 A;  3UKR C;  4BH6 A;  3I7H A;  2BBK H;  1U4C A;  4JHP C;  4UM8 A;  4BP9 A;  3OKY A;  1UOQ A;  4WK0 A;  5AFU 3;  3JB9 L;  2VZ1 A;  3MKQ A;  5CXC B;  3RFH A;  4O1Q D;  1RI6 A;  4RE6 A;  2W18 A;  2B5M A;  1VE6 A;  1QFM A;  5IC7 A;  4MMZ A;  1SQ9 A;  2OVR B;  4L9O A;  5M5T A;  4E54 B;  4GGD A;  1H2Y A;  5EAP A;  4JHN A;  3O4I A;  2XL3 A;  3JZH A;  2VDM A;  2H13 A;  3IIW A;  3I7K A;  3UVK A;  3J81 g;  2EIC A;  5GXI A;  2EIB A;  4QRJ A;  2HKR A;  2XL2 A;  2HKM A;  5E6U A;  3GRE A;  1SQJ A;  4LG9 A;  3RSE C;  3SWS D;  4OZU A;  4GQB B;  3PVU B;  1R5M A;  2GC7 A;  5M5V A;  1U2V C;  3KCI A;  5M5U A;  3NID A;  2OK6 A;  3L4M D;  1FWX A;  2TRC B;  1YR2 A;  3IJ0 A;  4JSX C;  3IVM A;  5EMM B;  5FFG A;  2OJY A;  3EG6 A;  3VI3 A;  4A0A A;  2AQ5 A;  2IAA A;  4CZV A;  3MMY A;  4G55 A;  5H1M A;  1QNI A;  2IUQ A;  5IJ8 E;  4N14 A;  3DXM C;  3I8C A;  2H68 A;  4GM8 A;  2HES X;  4MMY A;  3AH8 B;  3NIG A;  3PE7 A;  4J0W A;  2J57 G;  5C2V B;  3UVL A;  2B5L A;  3OTT A;  4PBY A;  3MUO A;  5TDH B;  5EAM A;  5EAL A;  1PI6 A;  3K71 A;  3FCU A;  4A09 B;  3EI3 B;  5HE0 B;  5SXM A;  2H3X A;  4O45 A;  2XU7 A;  2OIZ A;  4DNU A;  4ERY A;  3JPX A;  4AOW A;  4QL1 A;  2IUR A;  4JSV C;  3OF7 A;  4CI3 A;  5IGO A;  5E6S A;  2VC2 A;  2PM7 B;  3DWL C;  5FKR A;  3ZE2 A;  3NIF A;  4D0K A;  2UZY B;  4OWR A;  2VDK A;  1GOF A;  1Q47 A;  4PSW B;  3KRW B;  3JZG A;  4CY1 A;  2H6Q A;  2PBI B;  4GGC A;  4H5J A;  2BCJ B;  2H6N A;  3PXS D;  5HE3 B;  5EML B;  4J77 A;  3FM0 A;  3IUL A;  2YBA A;  4QT8 A;  4NC4 A;  1NR0 A;  1T2X A;  2B4E A;  4GQ2 P;  1VZ2 A;  3C5M A;  4BL0 A;  3EWE A;  4PBZ A;  5H17 A;  1QFS A;  5E6R A;  4FHL A;  1OMW B;  4AN1 A;  1GOG A;  1VYH C;  1P22 A;  4O9D A;  5FQD A;  3GD1 I;  2H6K A;  4CC9 A;  5GXH A;  2QR5 A;  4UI9 R;  1E8N A;  4PXW A;  1H2X A;  4AX4 A;  4O3T B;  4PNK B;  5C86 A;  1H2Z A;  4J8B A;  1S4U X;  4E5Z B;  2JKX A;  2H9M A;  3CFV A;  1PGU A;  1GOT B;  3AL8 A;  4Z7O A;  4IRZ A;  5C9Z B;  3I2N A;  5KDO B;  3F3G A;  5TEF A;  2O9K A;  2Z2O A;  3OKW A;  3SVW D;  4J84 A;  2IWK A;  3ZDY A;  4JSN C;  3MUN A;  4KFM B;  1O6G A;  2VDO A;  2XDW A;  3QI0 A;  4A11 B;  1B9Y A;  4QAM A;  2GC4 A;  2CN2 A;  2CO0 A;  3C9C A;  4A7J A;  3J80 g;  2AH0 A;  3I7O A;  3PSC B;  3SMR A;  4DNV A;  1MDA H;  2H9L A;  5C92 A;  3IUN A;  4ES0 A;  3FCS A;  4ERQ A;  2Z2N A;  4GM9 A;  2G99 A;  2AGX A;  3JAM g;  1C9I A;  1OLZ A;  2AGL A;  4BUJ C;  1NEX B;  3ULE C;  1PEV A;  1UOO A;  5HQG A;  4A08 B;  2YNP A;  1L0Q A;  2P9P C;  2HJ4 A;  4X3E A;  5HYN B;  3DXK C;  3K6S A;  4A2L A;  3ZE0 A;  1VE7 A;  4ZN4 A;  4A0B B;  3ZE1 A;  5FKS A;  2P9U C;  1A12 A;  5I5M A;  2I3S A;  2YMU A;  2PM9 B;  5JWZ A;  2QXV A;  4H5I A;  2XYI A;  2HU7 A;  4GZ8 A;  4FA4 D;  4JD2 C;  4HDJ A;  4J87 A;  5CXC A;  4I79 A;  3NVN A;  4ESG A;  2IUV A;  4WJK A;  2HJB A;  3I7P A;  3V5W B;  4LG8 A;  3IUJ A;  5H14 A;  3K72 A;  3T3P A;  1A0R B;  5FFO A;  5I5I A;  2I0T A;  3EQ7 A;  4J79 A;  4FA9 D;  5IGQ A;  4E54 A;  4G1M A;  5GMK n;  2VDQ A;  5EMK B;  2CE9 A;  3AL9 A;  3MKS B;  1VZ3 A;  4GMB A;  2QC5 A;  5HDB A;  3CFS B;  2I0R A;  4GM3 A;  3IKO A;  4CY2 A;  2GNQ A;  2AH1 A;  4JT5 C;  1MG3 A;  3IJC A;  5I5J A;  4ERZ A;  4WK4 A;  3T3M A;  4FB1 D;  3C99 A;  5FLX g;  3N0E A;  3E0C A;  4A08 A;  3F3P A;  2P9N C;  4NSX A;  5EMJ B;  5THA A;  5IJ7 E;  2HYE A;  2H47 A;  1JMZ B;  4JT6 C;  1H2W A;  2UZX B;  4BCC A;  2B5N A;  4AEZ A;  2P9S C;  3RLM D;  1YFQ A;  4G1E A;  3RFG A;  4L3G D;  3SBR A;  3EI4 B;  1JV2 A;  3SBP A;  3IIY A;  4RE5 A;  4CY3 A;  4UM9 A;  3PXW D;  4J8G A;  3C75 H;  4DNW A;  2VDR A;  3PXT D;  4Z7Q A;  1I2M B;  2AGW A;  3AFC A;  5CXB B;  3BWS A;  3EI1 B;  5A2Q g;  2WQ8 A;  4BCD A;  1TYQ C;  1U8C A;  4Y7R A;  3I89 A;  3GFC A;  4FA5 D;  1N6E A;  4XEI C;  2EBS A;  3JZN A;  3SFZ A;  3SCY A;  3JRO A;  4A09 A;  4FAV D;  4J78 A;  4K3I D;  3UR4 A;  2H14 A;  2YNN A;  3EI3 A;  4R7A B;  3PSL A;  4FWW A;  3JRP A;  2CN3 A;  4ZOX A;  4X63 B;  2VDN A;  5M61 A;  2OVQ B;  2IUP A;  3DSM A;  4XYI A;  1C9L A;  3A0F A;  2CO0 C;  3OL2 B;  5CYK B;  3UVO A;  3BG1 A;  2YNO A;  2AGY A;  3O4H A;  1MG2 A;  5HE2 B;  3KRX B;  1XKS A;  4WK2 A;  3ZDX A;  3ZWL B;  1BPO A;  3RMZ D;  1TYE A;  3RN1 D;  1XHM A;  1UOP A;  4NBM A;  3SLE D;  5K1C C;  5FA5 B;  3I7N A;  3V7D B;  5C2W B;  4U1E I;  3BG0 A;  3SN6 B;  3U4Y A;  3V4P A;  4QQE A;  4K3J B;  3PVW B;  3GC3 B;  2Z2P A;  3ORV D;  1TBG A;  3EI4 A;  4L1M A;  2EIE A;  4CI8 A;  5IT9 g;  5EM2 B;  4LGN A;  3VA6 A;  4X60 B;  2MTA H;  4AMY A;  3OW8 A;  3MXX A;  4J86 A;  1O6F A;  4CI1 A;  5CXB A;  3I7L A;  4AN0 A;  5B4W A;  3EI1 A;  2I3T A;  1ERJ A;  5FXY A;  2IWF A;  5K19 A;  3HFQ A;  5M5R A;  3SXT D;  3RN0 D;  2VDL A;  5HE1 B;  2BKL A;  2HU5 A;  5TF2 A;  4E5Z A;  4G56 B;  4CZX A;  2EID A;  3SJL D;  4L3H D;  2AGZ A;  2J56 H;  4JXM A;  4MK0 B;  3IJE A;  1N6D A;  2YB8 B;  3QHY B;  3EI2 B;  1JJU B; 
#chains in the Genus database with same CATH homology
 2H9N A;  4D6V A;  1K32 A;  3OL2 A;  5CYK A;  2P9L C;  2H9P A;  4L1Q D;  3SHF A;  4JSP C;  3K27 A;  4GQ1 A;  2P9K C;  4A11 A;  5AMS A;  4GGA A;  4IMM A;  4J0X A;  4Z8L A;  5FKQ A;  4PSX B;  5AJA A;  4U7A A;  3VH0 A;  3UVN A;  2OVP B;  3SBQ A;  2CNX A;  4CY5 A;  2G9A A;  1GG2 B;  4ZOZ A;  3NVQ A;  2I0S A;  4J73 A;  3NVX A;  5EM2 A;  3CIK B;  1XIP A;  3B7F A;  4ZOY A;  3AL8 B;  2P9I C;  5TEE A;  3OKY B;  4XYH A;  1K8K C;  3OKT A;  4ZOV A;  4A0B A;  3F3F A;  3N0D A;  5GSA A;  4YVD A;  4FAN D;  1JOF A;  3ODT A;  4J81 A;  3IJ1 A;  1JMX B;  1GXR A;  2PM9 A;  3VGZ A;  3FGB A;  4A2M A;  3L4O D;  5EAR A;  4PC0 A;  3EI2 A;  4O3U B;  2J55 H;  1B9X A;  2CE8 A;  4EWR A;  3P4F A;  1GP2 B;  4FA1 D;  3FRX A;  2OK4 A;  3MZL A;  3UKU C;  4Y5R D;  1SHY B;  3MZK A;  4CZY A;  1N6F A;  3EU7 A;  4X61 B;  3UVM A;  4IA9 A;  2HXC A;  4J82 A;  3RRM C;  3DM0 A;  2PM6 B;  4CI2 A;  3I8E A;  5FKT A;  3K26 A;  3W15 A;  2Q7Q A;  3V9F A;  4A0A B;  4TZ4 A;  3EMH A;  1PBY B;  3UKR C;  4BH6 A;  3I7H A;  2BBK H;  1U4C A;  3OKY A;  5AFU 3;  3JB9 L;  3MKQ A;  5CXC B;  3RFH A;  4O1Q D;  1RI6 A;  2W18 A;  2B5M A;  5IC7 A;  1SQ9 A;  2OVR B;  4L9O A;  4E54 B;  4GGD A;  5EAP A;  2XL3 A;  3JZH A;  3IIW A;  2H13 A;  3I7K A;  3UVK A;  3J81 g;  5GXI A;  4QRJ A;  2HKR A;  2XL2 A;  2HKM A;  3GRE A;  1SQJ A;  4LG9 A;  3RSE C;  3SWS D;  4OZU A;  4GQB B;  3PVU B;  1R5M A;  2GC7 A;  1U2V C;  2OK6 A;  3L4M D;  1FWX A;  2TRC B;  3IJ0 A;  4JSX C;  5EMM B;  2OJY A;  3EG6 A;  4A0A A;  2AQ5 A;  2IAA A;  4CZV A;  3MMY A;  5H1M A;  1QNI A;  2IUQ A;  5IJ8 E;  4N14 A;  3DXM C;  3I8C A;  2H68 A;  4GM8 A;  2HES X;  3AH8 B;  3PE7 A;  4J0W A;  2J57 G;  5C2V B;  3UVL A;  2B5L A;  3OTT A;  4PBY A;  5TDH B;  5EAM A;  5EAL A;  1PI6 A;  4A09 B;  3EI3 B;  5HE0 B;  5SXM A;  2H3X A;  4O45 A;  2XU7 A;  2OIZ A;  4ERY A;  3JPX A;  4AOW A;  4QL1 A;  2IUR A;  4JSV C;  4CI3 A;  5IGO A;  2PM7 B;  3DWL C;  5FKR A;  4D0K A;  2UZY B;  4OWR A;  1Q47 A;  4PSW B;  3KRW B;  3JZG A;  4CY1 A;  2H6Q A;  2PBI B;  4GGC A;  4H5J A;  2BCJ B;  2H6N A;  3PXS D;  5HE3 B;  5EML B;  4J77 A;  3FM0 A;  2YBA A;  4QT8 A;  1NR0 A;  2B4E A;  4GQ2 P;  3C5M A;  4BL0 A;  3EWE A;  4PBZ A;  5H17 A;  4FHL A;  1OMW B;  1VYH C;  1P22 A;  4O9D A;  5FQD A;  2H6K A;  4CC9 A;  5GXH A;  4UI9 R;  4PXW A;  4O3T B;  4PNK B;  4J8B A;  1S4U X;  4E5Z B;  2H9M A;  3CFV A;  1PGU A;  1GOT B;  3AL8 A;  5C9Z B;  3I2N A;  5KDO B;  3F3G A;  5TEF A;  2O9K A;  2Z2O A;  3OKW A;  3SVW D;  4J84 A;  2IWK A;  4JSN C;  4KFM B;  4A11 B;  1B9Y A;  2GC4 A;  2CN2 A;  2CO0 A;  3C9C A;  4A7J A;  3J80 g;  2AH0 A;  3I7O A;  3PSC B;  3SMR A;  1MDA H;  2H9L A;  4ES0 A;  4ERQ A;  2Z2N A;  4GM9 A;  2G99 A;  2AGX A;  3JAM g;  2AGL A;  1OLZ A;  4BUJ C;  1NEX B;  3ULE C;  1PEV A;  5HQG A;  4A08 B;  2YNP A;  1L0Q A;  2P9P C;  2HJ4 A;  4X3E A;  5HYN B;  3DXK C;  4A2L A;  4ZN4 A;  4A0B B;  5FKS A;  2P9U C;  5I5M A;  2I3S A;  2YMU A;  2PM9 B;  5JWZ A;  2QXV A;  4H5I A;  2XYI A;  4GZ8 A;  4FA4 D;  4JD2 C;  4HDJ A;  4J87 A;  5CXC A;  4I79 A;  3NVN A;  4ESG A;  2IUV A;  2HJB A;  3I7P A;  3V5W B;  4LG8 A;  5H14 A;  1A0R B;  5I5I A;  2I0T A;  4J79 A;  4FA9 D;  5IGQ A;  4E54 A;  5GMK n;  5EMK B;  2CE9 A;  3AL9 A;  3MKS B;  4GMB A;  2QC5 A;  3CFS B;  2I0R A;  4GM3 A;  3IKO A;  4CY2 A;  2GNQ A;  2AH1 A;  4JT5 C;  1MG3 A;  3IJC A;  5I5J A;  4ERZ A;  5FLX g;  4FB1 D;  3C99 A;  3N0E A;  3E0C A;  4A08 A;  3F3P A;  2P9N C;  4NSX A;  5EMJ B;  5THA A;  5IJ7 E;  2HYE A;  2H47 A;  1JMZ B;  4JT6 C;  2UZX B;  2B5N A;  4AEZ A;  2P9S C;  3RLM D;  1YFQ A;  3RFG A;  4L3G D;  3SBR A;  3EI4 B;  3SBP A;  3IIY A;  4CY3 A;  3PXW D;  4J8G A;  3C75 H;  3PXT D;  2AGW A;  3AFC A;  5CXB B;  3BWS A;  3EI1 B;  5A2Q g;  1TYQ C;  4Y7R A;  3GFC A;  3I89 A;  4FA5 D;  1N6E A;  4XEI C;  2EBS A;  3JZN A;  3SFZ A;  3SCY A;  3JRO A;  4A09 A;  4FAV D;  4J78 A;  4K3I D;  3UR4 A;  2H14 A;  2YNN A;  3EI3 A;  4R7A B;  3PSL A;  4FWW A;  3JRP A;  2CN3 A;  4ZOX A;  4X63 B;  2OVQ B;  2IUP A;  3DSM A;  4XYI A;  3A0F A;  3UVO A;  2CO0 C;  3OL2 B;  5CYK B;  3BG1 A;  2YNO A;  2AGY A;  1MG2 A;  5HE2 B;  3KRX B;  1XKS A;  3ZWL B;  3RMZ D;  3RN1 D;  1XHM A;  3SLE D;  5K1C C;  5FA5 B;  3I7N A;  3V7D B;  5C2W B;  4U1E I;  3BG0 A;  3SN6 B;  3U4Y A;  4QQE A;  4K3J B;  3PVW B;  2Z2P A;  3ORV D;  1TBG A;  3EI4 A;  4CI8 A;  5IT9 g;  5EM2 B;  4LGN A;  3VA6 A;  4X60 B;  2MTA H;  3OW8 A;  3MXX A;  4J86 A;  4CI1 A;  5CXB A;  3I7L A;  3EI1 A;  5B4W A;  2I3T A;  1ERJ A;  5FXY A;  2IWF A;  5K19 A;  3HFQ A;  3SXT D;  3RN0 D;  5HE1 B;  5TF2 A;  4E5Z A;  4G56 B;  4CZX A;  3SJL D;  4L3H D;  2AGZ A;  2J56 H;  4JXM A;  4MK0 B;  1N6D A;  2YB8 B;  3EI2 B;  1JJU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...