4X61A

Crystal structure of prmt5:mep50 with epz015666 and sam
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
625
structure length
625
Chain Sequence
RVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
total genus 207
structure length 625
sequence length 625
ec nomenclature ec 2.1.1.320: Type II protein arginine methyltransferase.
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05185 PRMT5 PRMT5 arginine-N-methyltransferase
A PF17285 PRMT5_TIM PRMT5 TIM barrel domain
A PF17286 PRMT5_C PRMT5 oligomerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.160.11 Mainly Beta Distorted Sandwich Hnrnp arginine n-methyltransferase1 Hnrnp arginine n-methyltransferase1 4x61A03
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 4x61A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4x61A02
3KHKA 3M6UA 3RW9A 1XIIA 5CD1A 3BGIA 4IV8A 2BM9A 2FK7A 3NGFA 2G4JA 2AN4A 3LDFA 4MTLA 1I4WA 3XIMA 3VNJA 3B7PA 4HSGA 3L23A 2HK1A 4KW7A 2P7IA 1VBFA 2ZSUA 3CJTA 2PSSA 2AN3A 3JWIA 3QOWA 4GOND 3MQ2A 1XLLA 2JH8A 5XIMA 2ZDSA 4C4AA 2ORED 3D2LA 3BGVA 3GDHA 4EACA 5B80A 3LBFA 1D2CA 3HP7A 3KU1A 1XJ5A 4QTTB 4HHLA 5E9JA 3REOA 3ELUA 1MUWA 4EKIA 2GPYA 3T7SA 3C0SA 5GOZA 1XIGA 3JU2A 3EEOA 3I64A 4YV0A 5GM1A 3UWPA 3UBTA 1SQGA 2YUIA 5DRTA 2PX4A 2IDJA 2JH9A 5EOVA 1MNZA 4RTSA 1YFJA 5EHIA 4PFHA 5GM2A 1VL5A 5B7YA 3KKZA 4MIKA 4GOMD 4CTKA 2VDUE 3U81A 4PCAA 3VYLA 3GRZA 5E8JA 4YUYA 1XYBA 3LX6A 4A8LA 2BR5A 2JHCA 3EMDA 3P97A 1F3LA 2AOVA 3M70A 1TW3A 5E1OA 4E32A 1RI4A 3I5UA 4PYQA 3TVAA 2OB2A 2GLKA 5E9WA 4PNEA 2Y1WA 3GNXA 1G60A 4BP3A 3C0LA 2PV0A 5T6BA 2ERCA 2ZIGA 5DX8A 3G8BA 1XIBA 2EJUA 3TR6A 4E30A 2PWYA 4RTKA 1KIAA 3ITTA 3BWWA 1NW5A 5CVVA 4F84A 5FCDA 3DTNA 1XYLA 1XLDA 4K1GA 2YVLA 5G02A 5DTMA 3P6LA 4EVIA 4YTUA 1M0EA 1IY9A 2IFTA 3FZGA 4XUCA 3FUTA 4FT4A 5HIMA 5U4XA 2Y1XA 2OPBA 5HOQA 2P3OA 1NKVA 3PB3A 4HC4A 1DE5A 5EZQA 3SXJA 1WXXA 2IIPA 3HTXA 3UZUA 2X7WA 1L3BA 3EVEA 5DRYA 5HIIA 1XDZA 3GWZA 2QRVB 3PT9A 5E8RA 4E31A 5DTQA 1XIFA 1P1CA 1UFKA 2HMYB 3SMQA 5K03A 1R00A 2XBMA 3KCLA 3NDJA 3EGVA 3PTAA 1NBHA 1PJZA 1RI3A 4AZWA 5CCXA 1YX1A 2AZTA 1XISA 1JTFA 1NBIA 3K6RA 1JG3A 1XLFA 5FQOA 1G8SA 2AN5A 2PLWA 3HCAA 3OCJA 4HGZA 4E2YA 1MJFA 2JG3A 3C6KA 1YZHA 3VSEA 4BLUA 3BUSA 1ORHA 3FYDA 3R0QA 2B9EA 5EIWA 3EVGA 2YR0A 3JWJA 2I62A 2IBSA 2VS1A 4P7GA 3DMFA 3TQSA 2GLUA 3UJ9A 8XIMA 3M0HA 1BHJA 1XINA 1BKYA 1WZNA 2A14A 2YXEA 3KBVA 3KQPA 2NXJA 5DM1A 5LSAA 2AOXA 3A26A 1BXCA 4H0NA 2AOTA 1XLCA 4CWAA 3LECA 3EGEA 3OZRA 4ER6A 1R18A 1KXZA 4P7JA 1EJ0A 3PX2A 4FSXA 3SR4A 2PT6A 1XP3A 2OBFA 3EVDA 3UJBA 2ONYA 3DR5A 3ITVA 4DA4A 3AXTA 2AVDA 4EAYA 1XIMA 2H00A 4K3ZA 3UJ6A 1XCJA 2XIMA 3KBMA 1RI2A 3VNMA 4K6MA 1X19A 3ORHA 2HR1A 1D2HA 5KQRA 3HVIA 5C9ZA 3OZSA 1SUIA 5H02A 1UIRA 2OZVA 1WXWA 2ZIFA 9XIAA 3HEMA 2HK0A 3NTVA 3ANXA 3P9CA 5DM2A 2FCAA 3FRHA 4XIMA 2NNWB 3DXYA 3HA5A 1TPYA 4NECA 3KBWA 4U7TB 4CKCA 5K0JA 5LQAA 5CUQA 4LWPA 3UA3A 3M6XA 4X60A 2F8LA 4RYLA 1I60A 3LDUA 4R6XA 5DTRA 1H1DA 4RTLA 1P91A 3JWGA 2NP7A 3QOXA 1KYWA 3TKYA 5EMLA 5E9QA 4RTOA 2C7RA 1VLMA 1RJGA 1SG9A 5LQKA 3HNRA 4HGYA 3P9NA 2GA9A 1R74A 3NMUF 5E1DA 1KR5A 3O7WA 4WVLA 5FWAA 1AQJA 1TZ9A 4MHTA 3TMAA 4FSDA 5GINE 4RTNA 4DMGA 1KYZA 4PIMA 4DQ0A 2I7CA 3GNLA 3GRVA 4GLEA 3B3FA 5HZMA 3SSMA 1TW2A 5M5BA 2ZULA 4HNOA 2EFJA 2P41A 3FTDA 1FBNA 3A25A 3CQHA 4CXMA 2GYIA 2NQHA 2P35A 5E2AA 5MHTA 1XLHA 5DT2A 3GGDA 3V97A 1SUSA 2PGXA 3QZAA 3ELWA 3HVJA 1XICA 3IUDA 3BDKA 5B7ZA 3QV2A 2CKDA 3UXIA 1XLKA 4A8NA 3AXSA 3CQKA 3ITLA 1KHHA 2QRVA 3E23A 6XIMA 1FP1D 2PVCA 1NW3A 2VP3A 3G88A 5KS2A 4R05A 2PXCA 3HCDA 3P8ZA 3LPMA 3QC0A 5EKUA 3UA4A 3KR1A 4CKBA 3R3HA 3KBSA 3H2BA 3HCCA 1CLKA 3IYLW 5CM2Z 2WK1A 2YX1A 3BZJA 3IUIA 2KW5A 3FRIA 1XLEA 3CCFA 2YTZA 3X0DA 3OE5A 1D8WA 4Q7IA 1IM8A 1M6EX 3I9FA 4E2WA 4YUZA 4YTSA 1QUMA 2QE6A 4XUEA 3KQVA 3BGDA 2QUMA 4XIAA 4XKMA 5LQUA 5LQJA 3LCCA 4RVHA 5HFJA 4RTJA 3CVOA 2JJQA 3MGGA 5XIAA 1XDUA 2ESRA 3E7PA 3E8SA 5DXAA 1AV6A 1EIZA 4YTTA 4AZVA 2J6VA 3B3JA 2IP2A 3SSOA 4GBED 3GJYA 3KQQA 5ERGB 3KPVA 5HIJA 2PXAA 3AYTA 2DPMA 1XIHA 1KPIA 1FJXA 3MB5A 1JG2A 1FP2A 3TRKA 3G2QA 3N4AA 4LG1A 2BM8A 3NDIA 5FHQA 3R9XB 1DE6A 1HMYA 4DKJA 2O0LA 4PIPA 4YTQA 3EPPA 4CKEA 2ZFUA 2IH2A 2OXTA 2GUBA 4Z2YA 2C7QA 5BW5A 2Q41A 4LECA 3TLJA 4O29A 5F2KA 3FVMA 1AQIA 2BR4A 5LQNA 5E1BA 4P58A 1OR8A 3HA7A 2CMHA 3LCUA 5CVJA 1A0DA 3KR9A 3S68A 4EMSA 5EGSA 2PY6A 2IH4A 4QEEA 1WG8A 3FUVA 3NVMB 4HTFA 1EG2A 3LCVB 3FUXA 3OZTA 3NWBA 2OB1A 1U2ZA 3LKDA 3R24A 4PCLA 1WY7A 3SVZA 4PYNA 2UYHA 3QXBA 3LDGA 2ZLBA 2XVMA 4R6WA 2VDWA 5EQJB 2XVAA 1VE3A 2QY6A 2PX2A 4E2ZA 5K0BA 9XIMA 1XCLA 2BZGA 5EG5A 4DM3A 4QE5A 2GAFA 3KQTA 3Q7EA 4FT2A 3THRA 5FULA 3M0MA 2XYRA 5HILA 3DMHA 1SVUA 3IEIA 5C1IA 3FPGA 4PGLA 4FS8A 2N47A 4P7KA 4OA5A 2ZVJA 2O06A 5FWDA 4DVOA 5ICGA 4E2XA 3GU3A 1X1BA 4XSLA 2CL5A 5DXJA 4GC5A 1I1NA 3BZBA 3ID6C 3NVKI 4GC9A 3T0IA 2NQ9A 3U3HA 5IKMA 5E1MA 3KPUA 4EK9A 4E33A 2PJDA 1VP3A 4KRGA 1YUBA 3BXOA 2R6ZA 4WXHA 5H6HA 5CCBA 10MHA 3A7DA 4XSMA 3XISA 8XIAA 2NYUA 4FZVA 5B1SA 4BLVA 2ZTHA 4E70A 4YV2A 4HGXA 3OU2A 3WSTA 3KPYA 4OBWA 3BT7A 3G8AA 3CC8A 2WA1A 3LHDA 3LBYA 4HTFB 5EKXA 3CJQA 5EMKA 3HCEA 5DPMA 9MHTA 2NQJA 3VNKA 1G55A 3O31A 3DLCA 5HIKA 3XINA 2LD4A 4OA8A 3B5IA 4X61A 4QQKA 1JG1A 5KVAA 5F2NA 1JQEA 5K8VA 3G89A 2PT9A 3CWHA 4QPNA 2NXEA 4ZTBA 3BWBA 3OPNA 4QVGA 2AOWA 2CMGA 3FPJA 1SKMA 3DUWA 3PVCA 1INLA 1QYRA 3G2PA 3NWEA 4QDJA 3HCFA 4HH4A 3TM5A 4GJJA 3KTCA 2BR3A 4C06A 3EVFA 3I58A 3HA3A 4L7VA 4ER3A 3FYCA 5K09A 3P14A 1L3CA 3ITYA 3UJAA 5AVNA 3KCOA 5DX0A 3GRUA 3I53A 2H1RA 2P3QA 1O9GA 1EJ6A 2ZWAA 5LR6A 1RJEA 2YXDA 3GCZA 5IH3A 3CQIA 3CJRA 3HM2A 5AVHA 4C07A 3M4XA 4GUAA 4ISCA 5KQSA 5ICCA 1N2XA 1I6NA 3MAGA 4GEKA 3M6VA 3NJRA 2JHPA 4A8RA 4HRAA 1F38A 4POOA 2V74B 1PRYA 3UVAA 4KVZA 4A6DA 1X1DA 4BY9E 3B3GA 3AWIA 3KQSA 3P9IA 5HEKA 2AOTB 5KYGA 1UWVA 5K05A 4RX1A 1DUSA 4QDKA 3M0LA 3AY0A 4F85A 4C04A 3DLIA 4MQ4A 3AJDA 3DXZA 2NXNA 3E05A 3WQOA 4DUOA 1XYCA 1VIDA 3TPZA 2B78A 4F86A 3RODA 4M37A 4XISA 5D1NA 7XIMA 3G5LA 5EC8A 2I6GA 1XLBA 2QYOA 2HCVA 4ZB5A 2OKCA 3G2MA 3KQMA 4PYMA 2HTEA 1VP9A 4FP9A 4DCGA 4RVFA 1L3IA 4PYLA 2I9KA 1P1BA 3M0YA 4FGZA 2XYVA 4LNCA 3FUUA 3DMGA 5DLYA 3SM3A 2IPXA 3ERCA 3GRYA 3MERA 3M6WA 1K77A 2CWWA 5H1WA 1P39A 3G2OA 1V39A 3PS9A 3UFBA 1XLJA 4US6A 2G71A 3BZGA 2X7VA 3A4TA 5ICFA 2UYCA 2P3LA 3BANA 1T43A 4LWOA 3ER8A 3KQWA 4HG2A 2ZZMA 5DM0A 1A0EA 1RI5A 1XLGA 4J4KA 4PYJA 1A0CA 2P8JA 5JR3A 2ZZKA 3LSTA 4M38A 5DM4A 2B2CA 1L1EA 4AZSA 3MTIA 5T67A 4QQNA 3KWSA 3ELYA 1XLIA 2FYTA 1SQFA 5LQCA 4RTQA 3BWYA 2BH2A 4GF5A 3UJ7A 5JUWA 3O4FA 1X1AA 3QYSA 7MHTA 3TOSA 5K0NA 5T64A 1QANA 2QUNA 4R8SA 3CBGA 4XUDA 1M6YA 2AOUB 1O54A 2PXXA 3FPEA 3KR0A 2OU4A 4OBXA 1EAMA 4ATNA 3UJ8A 2JHAA 1S5NA 3MCZA 3UJDA 5EHGA 4A6EA 1XYMA 5EEHA 4KIFA 1Q0TA 1KP9A 4BP1A 5DWQA 2VZ9A 5EMMA 3DULA 1XYAA 2O05A 5I7GA 1X1CA 3HVHA 4C08A 5DSTA 1G8AA 1R8YA 4DF3A 3B89A 3PX3A 5DSXA 4QDWA 5K0CA 1QAQA 2DULA 1XTPA 3MCTA 1DIEA 4W4QA 3VNLA 2FPOA 2G70A 1G38A 5FQNA 5E2BA 2ZBRA 1NW6A 4QDPA 3C3YA 4PYKA 4EQZA 5CVDA 4X41A 1XIEA 3ITOA 3IHTA 2EX4A 2NXCA 5FA5A 1Q0SA 1ZG3A 3IV6A 4V0QA 4YMGA 5K0FA 3TC3A 5EVJA 3KCJA 1NV8A 1Y8CA 2C7PA 2ZCJA 3CKKA 3IUHA 1JSXA 2ZBQA 4M7RA 1ORIA 3LMZA 2P7HA 2PBFA 1N7JA 2EJTA 1XIDA 2QULA 3ELDA 5GP1A 3GRRA 4EKGA 2ZWVA 4YUXA 4JXJA 3ER9A 3DX5A 2Z6UA 3OFJA 1JSZA 5K0EA 4OQDA 1NW7A 4ZB0A 1GW9A 4A8IA 2QW5A 3P9KA 3U0HA 3C0QA 1HNNA 4IV0A 4KWCA 3OFKA 4BLWA 2OO3A 5K0LA 4QPPA 4KW2A 1QZZA 1ZHFA 5EZSA 3T7TA 3AYVA 2G1PA 3FTFA 4GJIA 4YUVA 3TFWA 2FRXA 5EMJA 3M33A 3V8VA 5FHRA 2YQZA 4G56A 1O1HA 1S5MA 3M0VA 1QAOA 1JQ3A 1VPTA 2B3TA 2P40A 3EVAA 3PFHA 3OU6A 1YF3A 3C6MA 1DL5A 3SX0A 5LQRA 1KPGA 2GB4A 3KPWA 3EVBA 3JWHA 4GOOD 5EIFA 3EVZA 4XCXA 1YZ3A 3KR2A 5FADA 1EQAA 4RWZA 4AX8A 4DZRA 5BP7A 3CQJA 1NT2A 4QE4A 5C0OE 3KQOA 1DCTA 5D1HA 3EEYA 2GS9A 5EPEA 3FPHA 2UYOA 4QTUB 1VQ1A 2H11A 1MHTA 2G72A 2G8NA 4PONA 3KPJA 1NW8A 4YMHA 4YUWA 2IGTA 5F2OA 1JQDA 3A7EA 5CIYA 3LKZA 1R8XA 3EGIA 3R6TA 3THSA 5XINA 5P8WA 2V7EA 4AUKA 4OX9Y 3FTEA 3OBEA 2PX8A 2NP6A 4ER0A 1ZGJA 4HHMA 2ADMA 2ZIEA 4X1OA 3NW9A 3RIEA 3TM4A 4P7FA 1XLMA 1RJFA 3T7RA 2AOUA 3GIWA 3P71T 1NE2A 4YV1A 4U7PB 3EMBA 5FUBA 1IXKA 3UU0A 4DCMA 1BXBA 1DXIA 4OQEA 3ITXA 4Y30A 4ER7A 3GXOA 3VNIA 4KIGA 2AS0A 3UJCA 1XIJA 2XINA 4QVKA 2E5WA 2QM3A 2YXLA 4RTMA 4RV9A 3ME5A 3SSNA 1N7IA 4KDRA 5BW4A 1XDSA 2Q02A 5GIOE 4PGHA 5K01A 1FPQA 3BWMA 2OY0A 1ZKDA 3Q87B 1ZGAA 4GQBA 1R6AA 3LGAA 1L9KA 2OYRA 5ICEA 2O07A 2PWPA 4RSRA 4UOEA 4IKPA 1BOOA 2G0WA 2AVNA 3SGLA 2Z6AA 3VC1A 2P1DA 3DH0A 4AZTA 6XIAA 2ZW9A 1NV9A 1O9HA 3KQYA 3BKXA 3A27A 3CGGA 3C3PA 2GH1A 3DXXA 2WA2A 4PINA 3P2KA 5GWXA 2AR0A 2HV9A 3G5TA 4CTJA 3AAMA 1I9GA 2FK8A 3KBJA 4M36A 1BC5A 4X63A 3G7UA 5GIPE 2C7OA 3M0XA 1RI1A 3P2EA 4ZBCA 1XXLA 4OVXA 4YTRA 1AF7A 2IDKA 5J8LA 2FHPA 3AALA 1JG4A 2K4MA 2PX5A 5DX1A 3FUWA 4MWZA 2IH5A 2UZ4A 8MHTA 1B42A 3MHTA 1QT1A 2ZVRA 2ZZNA 3FPFA 4QEHA 1JTEA 4PWYA 2UYQA 5FA8A 4FR0A 3PLAE 4RTPA 4B17A 5CVEA 2I56A 2R3SA 2GVEA 4C05A 2PKWA 3GO4A 5EEGA 2IBTA 3VYWA 4PYIA 2XYQA 3HVKA 1YFLA 1XLAA 1D2GA 3LL7A 3KBNA 2VDVE 3C0KA 5BXYA 4RTRA 4RVDA 2ONZA 3OE4A 4ZB2A 3CNYA 1RJDA 3DOUA 2HWKA 4V0RA 1WS6A 3MTEA 4GOLD 5CVUA 1DIDA 1OADA 4Y2HA 4E3VA 1XVAA 4QE1A 3DP7A 2XISA 1QAMA 3EVCA 3HCBA 1ZQ9A 1KPHA 3OU7A 3PFGA 5K0GA 1QTWA 4ER5A 3DBNA 2I57A 2HNKA 3TKAA 2B25A 3L8DA 1Z3CA 4KDCA 2EG5A 2O57A 4C03A 2ZBPA 4PGGA 3FTCA 3VC2A 3F4KA 3K0BA 3BKWA 4RVGA 4R8RA 3P2IA 4IWNA 1YB2A 5FTWA 2Z6QA 1G6Q1 4PYOA 3BWCA 1JR4A 5TNVA
chains in the Genus database with same CATH superfamily
1TCDA 1TK9A 2EKLA 2MSKA 4C0KA 5I5GA 2DFAA 4G1MB 1VDZA 4DWSB 1Y5VA 3E2MA 1KRHA 4JYZA 3GGCA 4TMZA 3MA0A 1FC0A 2HEIA 5EXEA 4QDUA 2PX4A 3FGOA 3C70A 4A03A 3JAMA 3M5DA 3FIGA 1XI3A 1JAXA 3UK2A 1YVEI 4WPGA 3NEVA 1KCKA 3O7UA 1JVSA 4PSCA 3WL6A 2PRLA 2ZWOA 1ZC3A 2J25A 2VYOA 1NP3A 4KHZA 5FBRB 1SUBA 1EZ1A 1XZAA 5A2CA 4WFJA 4R7OA 4JHZA 3BSHA 3WK0A 3W3OA 5ELLA 3TAUA 5FR1A 3LTYA 4JBHA 3QF0A 2ASVA 3CONA 3HSSA 3G9XA 3ECQA 4NJGA 1FDJA 4GJ1A 3QEZA 2HA6A 5JYEA 2PLFA 5CIWA 1E0KA 4P7GA 1JX6A 1YMYA 4PBSA 2ACVA 4KDRA 3B97A 3RWMB 4O15A 4XWTA 4AXXA 2JL1A 2PWDA 1E72M 4ND8A 2TPSA 4OQYA 2F84A 2BEVA 5IJWA 5FOOA 3IEXA 2CKSA 5BSUA 4NZPA 5J23A 3ON5A 2NNWB 2Q6TA 1OK6A 4H7KA 2F8LA 1ONNA 1A2KC 5ESWA 1ZSNA 4R0MA 4PMDA 2X16A 4G63A 5K9XA 3SYMA 3RSGA 4IFEA 4ZC8A 3OMWA 3IQIX 3HDTA 3VSAA 2XHZA 3WY9A 3A9WA 4NYIR 3B8DA 3R12A 2VAXA 4MJ2A 4QSMA 2ZIVB 5AQEA 3JY6A 1KZ7B 3FJ6A 2H2IA 3PPWA 3PZRA 4E21A 2JGRA 3NGXA 3LVQE 2D23A 4S1FA 4ARVA 1HSOA 4AURA 4DZ5A 5TVGA 2BKXA 4IILA 4ZVNA 4LH8A 2EZTA 4NE9A 3LO5A 3HKBB 1I0IA 5JVDA 4ARUA 4PIPA 3DAHA 3X1ZA 1NI4B 4R69A 3HVUA 3SC2A 3UG3A 3LRXA 3HZRA 3WDQA 3TDKA 4BBPA 1U1EA 2XWEA 3DFNA 3GO2A 1QHEA 4YDHB 3NEHA 3VDMA 3STCA 5CPQA 2XVMA 5EQJB 4IFOA 4BQ5A 1JAHA 1JKIA 4YL2A 3U0BA 2O54A 3UJFA 1M1XB 3KZ1E 1CVLA 4LFCB 2YMLA 3KXQA 2BJVA 3KPUA 4O2LA 2DX7A 1XAJA 5IDWA 3DF7A 2WB2A 2FX3A 3E18A 2J3HA 1U8CB 3K09A 4QRIA 4LS2A 5K8VA 4B6QA 2BGQA 4BKQA 3H3JA 3W2TA 1QCWA 3P4YA 3QKEA 3ND5A 4GE3A 1FTQA 4GLOA 2OBNA 3QH2A 5AVHA 1ZS9A 5F7OA 4GEKA 1BWVA 2XADA 4WJKB 2ODBA 3QQ0A 2O1SA 4KAXA 4N47A 4KLZA 4M8IA 1IQ0A 2CLMA 4NNPA 3CE9A 5EJEA 5IK2A 2OLKA 4DIFA 1DTWB 2OILA 4K81B 2CWWA 1NRIA 1E0TA 1W4RA 3BARA 5CA1B 1RKXA 1T6NA 1OWLA 3GLHE 2DBQA 3NM3A 1W29A 4MYSA 5I7SA 1XZQA 1RHKA 1KFBA 1G5TA 1UR4A 2IS7A 3QKIA 4DYVA 1M6YA 2RDUA 4U02A 4ACZA 5LA6B 1FHDA 4RFSB 1HJUA 3OLGA 4E6PA 3U4QB 4Y0AA 4DCTA 1OYAA 4IQ0A 2DZPA 4LHVA 2NXCA 1ZG3A 3DHYA 3LUDA 1R7AA 4R68A 4XTRA 4ETIA 3GRRA 5E09A 2QIIA 3DL0A 4ERXA 5CSUA 3RRNA 4MEAA 3ABIA 2XUJA 4GGHA 1GFIA 4K1XA 3G23A 3QFHA 4RFLA 3I5YA 2O7QA 3GROA 3MYPA 1J6OA 2DTDA 1C3EA 1T10A 4R0NA 4CRWB 1DQSA 3OO1A 3KEFA 3N34A 3RLUA 2XCSB 4HNUA 1P6XA 5A8GA 5K6AC 1XIVA 2C7VA 1SZNA 4LKOA 2JGMA 4MLRA 5F21A 1HTWA 1UDXA 3OP4A 3T5PA 3PE4A 4MRSA 3ME5A 1PWLA 3RM9A 4FGKA 1CEOA 2G3YA 3T61A 5F1UA 2RJGA 3QU4A 1SO3A 5E6YA 4YALA 1PF7E 5JISA 1R5BA 3W1VA 4D8TA 5TF4A 4DLWA 4RV4A 5CAHA 1BC5A 1GTG1 1ODKA 1MB2A 1W52X 4CUJA 1BD3A 3FPFA 4DCVA 3AUUA 4QU9A 4RE4A 3RJXA 3P0WA 1ME7A 3GNPA 1G18A 1MGOA 4XQEA 1QAMA 1VFPA 5FI1B 2V45A 3D54D 3IAM1 1EHYA 1KBIA 1XRMA 5A9SB 1X1OA 4GVLA 2DFKB 2DLNA 1TZJA 2QENA 4AY2A 1Y8RB 2ETXA 3OFVA 5ELXA 4HP8A 3OQHA 4DXHA 3GXPA 4CN4A 3C4QA 1G7UA 2G5WA 1QBGA 2CL7X 4FFNA 1DCMA 1GUBA 2XJ9A 1VPXA 3A1EA 1KE1A 3PSWA 2XDFA 3AJ8A 3UR2A 4D1JA 4J0HA 3TH6A 5JS2A 4P4SB 4MUJA 3TSOA 5DHAA 2ACQA 4POCA 4YRAA 2GBFA 3GJ5A 2PRZA 1K7YA 2Q5JA 4WSOA 4OFXA 4MJ3A 3AW9A 2HWYA 3EZNA 4OM8A 1RPTA 2Z29A 4GLFA 1JRCA 1HURA 4RJJA 4EF8A 4EEXA 3PVZA 3IMFA 3A6DA 1L4KA 4AQLA 4Q4CA 1M6NA 1RIFA 1EM8A 1AS0A 3INTA 2ZAGA 1TJ5A 3CZRA 5TJHA 4JGBA 2HGSA 2Z27A 1FP9A 3DESA 2RHHA 1V79A 3PEWA 5IVHA 4ECAA 1RCUA 2QDEA 4B5XA 2BXZA 4Q8NA 2MMGA 1KWGA 4LAUA 4CWAA 1O96A 1YZTA 3AIBA 3L7RA 4RLSA 1D6JA 2JDID 3U3XA 3F3MA 5HUPA 5JWHA 1TCAA 4DJDC 1MA3A 2DFTA 5IAOA 4O19A 4UTPA 1O4UA 3H5TA 5PTDA 3R8RA 4HB0A 4YHHB 5K3EA 4FBMA 2J4FA 4RMGA 3C3WA 1Y5LA 3BD6A 4J4TA 1DRKA 4PRZA 2R11A 4BN5A 4MHTA 2RB5A 3DB2A 1RD4A 2EFJA 3QUCA 4AWTA 2XZOA 1H5UA 3SDBA 2J46A 3HQOA 5U7SA 4H9YA 4OG2A 1A5CA 5FIUA 3G6KA 5HNKA 4X66B 2DR2A 3B1XA 4RHTA 2DPHA 3DYBA 4Z7QB 4WAUA 5J4VA 1XA4A 3T41A 3PNSA 3EAGA 1MVYA 2QR5A 3ETEA 1QR2A 3FRJA 2ZVDA 3OZXA 3MM4A 2QX6A 3EWCA 4DCNA 4RCYA 1EIZA 4FFBA 4AZVA 2PDHA 3HU7A 4YIKA 1ZYUA 2B0MA 4MH0R 1O95A 2AZDA 3N2ZB 2H90A 4OGKA 1IWOA 3EFOB 4GWLA 1GOWA 3U7EB 5LYJA 1RE1A 2QPXA 1ONPA 5DEOA 2E9SA 4DNMA 4PXAA 1E4EA 1PK8A 1UOEA 2OVLA 2J67A 3ZVHA 2CXSA 4Q02A 4DVOA 3GZ3A 4OQMA 3I1YA 3NQ2A 5DT9A 4KNYA 4GC9A 4ZDJA 3PDIA 2R14A 1MIOA 5A69A 1B6TA 3RO6A 4IQDA 2NQJA 4CEHB 3NTYA 1YAHA 2IU3A 2VFEA 2ZP1A 3QVTA 3GR8A 3D2CA 5CC5A 1GNTA 1SKYE 4P6VF 1Y9DA 1ZY2A 2W11A 5IZCA 3CIXA 1XPRA 2VCBA 4A0FA 2P3QA 1E9LA 4GYPA 7ENLA 2JJ1A 3D9QX 5I4KA 1SNYA 2HSGA 5LZ4A 4C4ZA 2PTYA 4UTTC 2C2OA 3SYNA 1KJ9A 2K7ZA 3AQ4A 4K0RA 3WB9A 3FG9A 5EU9A 4JDYA 5HSGA 3TOCA 3SF8B 3W25A 3PEFA 3WBJA 3H24A 4D97A 1LWIA 1QWOA 3WRWA 1WXHA 3PPIA 5BWBA 3RS0A 1G19A 4QFBA 3FDJA 4Z3OA 3FK4A 1F3EA 2WZBA 3N28A 3M49A 4OLFA 1XM3A 5HJYA 2VIIA 2ORIA 4NSBA 4JODA 1UPXA 5HBGA 1BVUA 2WHQA 1ODTC 3PANA 1OIWA 1VHJA 3DULA 2HLDD 4X7RA 1C8XA 4B3BA 4QDPA 1PT7A 3MYRA 3DUGA 1J0IA 3GMSA 4PZYA 1VQTA 4UD2A 2AXQA 1QF7A 5AI8A 2QR3A 4V3CA 1LI4A 4F4FA 3CO8A 4I99A 1QNRA 4LC8A 3KXIA 1PTKA 1CJSA 3ES8A 1RA5A 2A9KA 3ABRA 1E9ZB 5AVJA 5EUCA 4Q7NA 4GZ6A 1DC7A 2Y2UA 1MHTA 4KNWA 1C0EA 4A0GA 2NZYA 3NPVA 2OD7A 5CIYA 2VQEB 2CV0A 1E8NA 4RY2A 1EWEA 4B2LA 1PGJA 2NUWA 2FP4A 5CW2A 3LX9A 4KEVA 1E5NA 4QOIA 5LLTA 3FB1A 3ZQJA 5GJVC 3PDHA 2ZB2A 3QA3E 3WYFA 3U3OA 3AR2A 1PR0A 3PG8A 1TK2A 3DXXA 4QA9A 1OCEA 1DG3A 2BKAA 2AGKA 5DE3A 2E37A 1AK5A 3WGOA 2BHNA 3VVLA 4EHNA 4UUAA 4B7XA 1FP8A 2V97A 1SVMA 2QUJA 3GO4A 5EJ7A 2Y85A 3JZIA 4NQ1A 1EM6A 1ZXLA 1FFCA 3R6GA 1I4NA 3PTMA 3JS3A 5KOIA 4WDUA 3QQ1A 4UR7A 3K0BA 3BKWA 2DW6A 4LHYA 2PIDA 5J04A 3ZDDA 1SXIA 4C90A 4UHBA 1Y4UA 2ENUA 2Z3WA 4FIRA 4RHXA 3UY4A 2W6PA 3RR2A 2AN3A 4BNMA 2Z5LA 3FJNA 3T7SA 5HK4A 3I64A 1CECA 1J0HA 1A9QA 2WZHA 4GZ5A 4D0GA 1QHGA 2XMSA 2GM3A 4BU1A 3RQIA 1AGXA 3FCSB 3NTUA 4YUYA 3LXAA 1YZNA 2IH2A 1VB9A 4LWWA 2NVOA 2DUJA 2C1IA 4BO8A 2O59A 1ZXXA 4AX7A 4AIEA 4JJGA 3I2JA 1ISSA 2F62A 1BGWA 2C88A 4OQFA 3EVEA 3RJ5A 3I6QA 1TMQA 1R6DA 4KBFA 1XEXA 3JARA 1YULA 2QMKA 3DHPA 1TPEA 4G7EB 3VA8A 5IHRA 5DRIA 3PHIA 2P2DA 3UG6A 3E74A 2RAUA 1JG3A 3OCJA 2WJ3A 4E2YA 5EIOA 2Q8NA 1IHYA 2FQXA 1E5DA 1DARA 5IJ9B 1A5OC 4YJ3F 4XOIA 2WHYA 1KAEA 4ALJA 1MJGM 1M1NA 2WVHA 2BX7A 3W7IA 4KFSA 4O1BA 3FAZA 3H2GA 3GLIA 4CLRB 2Z6VA 5LNK6 4X00A 5HK9A 5L6UA 2C9YA 4FNPA 1QH1B 1YQXA 4BWFB 1DVRA 2DKFA 3NHJA 3OG9A 3KBWA 1R37A 1J8QA 2VJQA 4D6CA 1FFWA 4HGYA 1U2SA 4IJWA 5KKAA 1OLUB 4BNZA 4B4VA 2I6QA 2O5EA 2C1EA 4HLUC 1RCFA 1XSIA 1BCSB 1H41A 3EN0A 1WV1A 4REMA 1OBCA 4ZQPA 1WM1A 4WCFB 4N0RA 2KE5A 5AN7A 2ZJAA 3HFSA 1CT5A 4Y6GB 4F2WA 2HPVA 2PR2A 1ZUNB 3VKDA 3PCRB 2LDXA 4Y67A 2EKGA 4AW7A 3LHIA 3VR0A 1I0BA 1TX4B 1SJDA 2BY2A 4XZBA 2R1VA 3KVRA 4HYTA 1WUTA 3GLFB 4IIYA 3CM0A 3C5EA 1U33A 5CLGA 3HJGA 1U2ZA 5J2TA 4JQZA 1OD6A 4QPZA 2WVGA 4REQA 2VHLA 1DMRA 5EESA 4AZGA 3LPNA 4OK5A 4GZEA 3N2GB 2LCFA 2WBKA 4M24A 1W2PA 4L8WB 4E2FA 2ZIXB 3M1AA 4FZVA 3FKQA 5IDZA 1RCTE 4W7UA 1P7PA 5DPMA 5EZYB 4PMQA 1T5IA 1UBUS 3P94A 4NZJA 2DQWA 3A4NA 3LPPA 2WICA 2ZOSA 4EHJA 1FWDC 2SKCA 1ZW1A 3M4NA 5JSUA 1CRZA 2Y8EA 2VBCA 1FA2A 3GCZA 1WAWA 1IT8A 4B8YA 2IY9A 1JCMP 4IJMA 4BZQA 2OZ8A 3GT0A 1HI9A 4HMPA 3PBYA 4GK8A 3DLIA 3OURA 4CGYA 5FOVA 3NM6B 2JCSA 1AGYA 2QJHA 4KGXA 1V6UA 2J0EA 5JJCA 4KXXA 1S2LA 3M6WA 3HL4A 1HZYA 3TRDA 3CEUA 3KQWA 1G59A 4HG2A 2CHQA 3VNBA 1DWGM 2H17A 1LLWA 3ME3A 1XWIA 2LKCA 2Z95A 5BVHA 1ZD4A 1F6DA 1ZBKA 3PUDA 2QLBA 5IG2A 2AOUB 3QV9A 3CCCA 2WAYA 5DO8A 2VD9A 1WP6A 3UCCA 3V1YA 1U3UA 1UD3A 2CIPA 4LV9A 4DR3B 4F0RA 4X5OA 5A6MA 1EFUA 4U1RA 3V2UA 3OJCA 2JLYA 1QC5A 4Z51A 1NV8A 1VLLA 5JJIA 5BVGB 4HHHA 2IC5A 1U7UA 5E0OA 1RXUA 3PDUA 3KALA 3TIMA 1OC4A 5FKJA 3ZLTA 4ZHQA 4GY7A 5CPLA 1BTCA 4FX5A 4JL5A 1IY0A 4TQUS 5G41A 2J4CA 3AR6A 2NU9B 4C0XA 1PJ3A 1POWA 4HGRA 1DQXA 4GT1A 3HPRA 1YHNA 4X1OA 1W3IA 4R9VA 4IOTA 2AZXA 1LSJA 5AW8A 4CGZA 5IPFA 1YUMA 4FOPA 4U7HA 2HDHA 2FOLA 2PL5A 2XTJA 5FH9A 4PVCA 1AUVA 3EXHA 3EVNA 4AF8A 2F67A 2ZW9A 4IOJA 2X09A 4L5YA 4ETWA 3CV7A 4NDNE 1SJAA 3ADCA 2BV9A 3CAQA 2D69A 1JSRA 2IYAA 3MI2A 2HWKA 4YAEA 2PCLA 4BA0A 1QGUA 3O4JA 1W1ZA 4JTDA 1EFRA 5G0SA 4O4LB 4KDCA 4DJDA 4Q3KA 1RXOB 3FCAA 5LKAA 4FX8A 5JSQA 3BGIA 2ZIUB 2FTYA 4MW5A 4NMMA 1V6CA 4L9XA 2G4JA 4B8WA 1ULAA 3UICA 1JIUA 3EC2A 4MQMA 1IV8A 4TUYF 4IHAA 5A06A 2P6MA 3U7QB 4N0EA 5MGBA 3EUAA 5ISMA 5CPMA 5ALIA 1QZUA 4YLEA 1X77A 1TYEB 3FR8A 1A5MC 3COJA 3OPSA 4LW8A 3MGBA 4TN1A 1Y7IA 3NV9A 2QCFA 1TAGA 4MDEA 4MWAB 2NXHA 3Q3VA 5FXMA 1CE8B 3MMNA 4LRYA 3V4SA 4FD3A 4BRUA 1HL2A 1MENA 1G98A 4CMBA 1LNZA 3T0FA 3WK2A 4HMCA 3W9SA 2V63A 3WLHA 1QPOA 2E7ZA 4F21A 2HN9A 4HT3A 2IPNA 2PS2A 4Y6GA 4AJEA 4JKMA 4PLVA 2PD9A 4ZAGA 4Y2VA 1J2UA 4MV9A 1BXCA 1PCKA 1FX1A 1D0VA 4DWWA 3NJ8A 6TAAA 1UZAA 4ZYUA 2W2LA 2X2YA 1XCMA 3IC5A 3VYRB 3V2GA 1QIHA 4OMUA 4HXEB 4W5QA 4MRVA 1QOZA 4LUTA 5BY2A 4RTOA 5L9AA 2BYTA 4D25A 1TX0A 2GJNA 3B2NA 3AMCA 1B4KA 4M9UA 1R2TA 2XH2A 1OIFA 4K9OA 3G9TA 5B7ZA 2WIAA 1L8XA 1LL4A 3ZLBA 3LQQA 3RHFA 1TMYA 2Q9AA 2HWXA 5FNVA 1QPQA 3C8NA 3ZT5A 4CCWA 3IK2A 4RVNA 3IUIA 2WPBA 3AR9A 1BU5A 5KNCD 4N0DA 2NX9A 5KTSA 1T8PA 2QRKA 3VD9A 3UNXA 3A0UA 3STEA 2V8BA 2RJHA 4BLTA 3N4AA 1MO4A 3ZUGA 4CEJA 1AMKA 3NQCA 2VDNB 4U5IA 1CZ1A 1VXRA 1XJWA 3T9BA 1YNPA 5LQMA 1B4DA 2Z0IA 1RHUA 4HDSA 2D2JA 2NO9A 3P81A 5ITVA 5EE1A 4XJVA 4RULA 5G40A 1XCBA 1DHRA 2WT9A 3L1IA 2JFNA 3WNZA 3WLSA 2JI6A 1HG0A 3NIBA 1AH4A 3LSYA 2ES4A 5JT1A 1PAUA 2LD4A 4FEYA 3N2KB 4EEZA 3AIEA 4HQLA 3NUZA 1DJQA 2CNKA 2QVHA 3WNKA 3TW7A 1DGQA 4Q4HB 2V3DA 2FN3A 2HH9A 4JFWA 3AXXA 2XVXA 3QXXA 2PMEA 2E4TA 3U2OA 4LZOA 1LDBA 1ZJ5A 4MW6A 3PQ4A 4PHHA 2O7NA 1KVTA 1OBVA 3C2QA 1YXYA 1RU3A 3RS7A 2PX6A 2ESCA 3NU1A 3MUOA 3S2JA 3QLTA 2PBZA 1M33A 1G9XA 4TKUB 3M6YA 2VYNA 2JRLA 3R7SA 4JT8A 1HQKA 3PS9A 1XUZA 1R6BX 1V39A 4YIHA 3SOPA 1CTQA 2XJ7A 1UAYA 4U6NA 1FU4A 4J4KA 1UXHA 1FSSA 1KFWA 2ANUA 3MKKA 4L4LA 4AJ1A 3KZNA 4EAQA 4EH1A 3JRKA 1GEGA 1KEZA 3MIZA 4YRBA 1TYBE 1KLYA 2J87A 3IP9A 1Y0EA 4O4IB 3IJEB 1H7NA 3ZWXA 1VJZA 3VDBA 2P2ZA 4HDRB 2PNFA 1RVKA 1SUFA 7TIMA 5JMOA 3EYPA 2DUWA 4C1KA 1OFUX 3GXDA 1KYTA 3HFYA 3NL6A 3UYCA 1KJZA 3D6UA 1KEPA 4EMUA 1EUCA 4CM9D 3O3RA 5GADl 5A4KA 2YV4A 5JMPA 4BNJA 1W3NA 1QGUB 3NWPA 1VG8A 1AN0A 4C3ZA 3WF4A 3OJGA 1EG7A 5T3UA 1AG1O 1NQKA 3TW8B 1I0LA 2VTBA 1GA4A 4OQEA 1Y6RA 1M6VB 3W0LB 1Z12A 2QM3A 4LE1A 3AP3A 2XUQA 3LGGA 1W32A 5KVQA 3G1FA 4I1SA 4LVDA 4QUKA 4F6RA 2ZRJA 4NJMA 5B2EA 4RMNA 3TSMA 3HI4A 5I7WA 4XZMX 3O75A 3H17A 3GUVA 3JSXA 5H81A 3LS2A 3D0RA 4JFAA 3WGLA 4XEUA 3OIGA 4UHJA 3U2QA 3H42B 4BQ4A 5FEMA 4HYVA 2W2QA 3DP7A 3ZU6A 5K0GA 4S2UA 2KM1A 3GLSA 3DBNA 4GX8A 3ZHBA 4JYPA 4PG7A 1XF0A 1IZ9A 3VK5A 4CETA 3JPYA 3KT6A 4QHRA 5UKDA 3I5AA 5DYYA 1USGA 5BQPA 3HSKA 1QI2A 3GD6A 4HNHA 4JBXA 4D5GA 2GBPA 4EPXA 1NF3A 5DBGA 3DBRA 1QIFA 1V3IA 1FLVA 4GOMD 2JNWA 2OGZA 4IIJA 1FP4B 2JFXA 3I6EA 1PT8A 5F1KA 1I10A 3LBOA 4LS0A 3WADA 1O03A 2WOQA 3ZJ4A 1SFLA 4QAWA 5BXQC 3ZDRA 2XUOA 3KL5A 3SMQA 3LDAA 4FB4A 3IQHX 4U2KA 4KAAA 3EC1A 3RI3A 1RK6A 4F40A 4S2CA 3VOBA 2E3JA 1NF2A 3MJ4A 5I9BA 2Z2ZA 2Q2OA 1XINA 2A3RA 3KQPA 4JR0A 3RFXA 1GYMA 2H31A 2NM0A 3VPGA 3ADOA 2Q3DA 4ENPA 3SLKA 1ZR2A 3OZSA 3FGCB 2AMLA 4MI3A 3RV3A 1M8KA 2G9ZA 2VAMA 5DTRA 1GCUA 4IOMA 3DL2A 1ULSA 3G9ZA 1K7SN 3QKWA 1GUYA 4BV3A 3D8TA 1YRQA 5I9MA 4OFWA 4TM7A 4HZGA 2WSYB 3V35A 5MHTA 5CC6A 2GZMA 1JRBA 2EEZA 4WCDA 4DUXA 2VK2A 4K6HA 3SUWA 221PA 5DY2A 3RTEA 3PX7A 1E3DA 1P4SA 1A53A 3L6EA 3W8RA 1ONBA 5LHFA 3MLBA 3GHUA 3G6MA 3DB1A 3MSGA 2BG5A 3AHVA 4HV4A 1X7HA 4OQZA 1P72A 3L4TA 4PMJA 5K20A 3FDKA 2VJLA 4E38A 4L2IB 4RIIA 5DXFA 2KAUC 4XZ9A 1RPZA 1KPIA 2FMKA 3BTSA 4IGMA 2FTPA 4I4NA 1P5JA 2GNPA 3SQDA 4X2RA 3P5BA 1XRNA 1C29A 3HKCA 1QPZA 1D4FA 2E87A 1P74A 2GBCA 1WXQA 4DUPA 4KGVA 2ODEA 3PTZA 2G41A 2BVDA 2BZGA 4LALA 3TZLA 3D3AA 3DMTA 3L68A 4OZOA 2FQYA 4P5DA 4GW3A 3RSSA 3MDUA 5FWDA 1QK2A 2O06A 3VCRA 3MW8A 3G2JA 4GXQA 2RBEA 4PZAA 5I8ZA 4PX9A 2WWCA 1RV8A 1H6AA 3WRXA 4XBKA 4YONB 1IH8A 4O1MA 2J9ZB 1ELSA 2NUTA 5ILOA 2RGLA 3WB0A 3T1GA 4LC0A 4AN1A 2KBFA 1AQMA 5MHBA 1EP1B 3GUYA 4GJJA 4LE0A 5MN4A 1TR1A 3PITA 5KAPA 4ZGYA 1WABA 2UAGA 1LBQA 3FW6A 4PUNA 1YE3A 4LRSA 5DCYA 5ICCA 5T8KC 2DIJA 3L46A 4B3CA 1TEXA 2XFRA 3BPSA 2HBYA 2WJFA 3G0DA 4O4JB 4PTMA 5KYGA 4WBNB 4D72A 1N8FA 1FWRA 1LF1A 4Q4RA 3DC7A 4RESA 4D2JA 1P4HA 2BFFB 2VX4A 2Z1NA 3ZW9A 1M5TA 3S2SA 3BQMB 3O6YX 2C6QA 1A0CA 1R1DA 4EXAA 2PSEA 1JR3D 4G1BA 2F6RA 2ZYUX 4WFQA 2J3MA 1WCIA 2YWXA 1W0JA 2I9UA 3VM5A 3LT4A 1UIPA 1FL9A 3IHWA 2BMFA 2QI9C 3EDFA 1NW6A 2RDXA 1EUNA 4TZ0A 2WZCA 3QMTA 3FYTA 3SR0A 4FW9A 5IDXA 3LA6A 4YQEA 2O8BA 3D1VA 4D44A 3HEBA 4JXJA 1PQWA 4DG5A 4IZHA 2RH9A 3LOQA 2G9QA 3OQNA 1B0UA 1P0PA 1JEDA 3CASA 2AQHA 4M88A 2WW8A 2RG1A 3OM8A 3L9WA 2B3TA 3RAOA 2WMNB 4BATA 2GNAA 4PIVA 1ZIOA 1LS1A 2WCAA 3L8MA 2NSDA 3K13A 3RCNA 5DN9A 5ESRA 4GD0A 3T0DA 3ICOA 1F0KA 4MYDA 3LKZA 3HURA 2X9VA 4PBGA 2XPKA 1QRTA 1MDRA 2YZ2A 1JUDA 1O5OA 2GVGA 2VDHA 3F4WA 4DPQA 3EHEA 4JJ6A 1H61A 1W5NA 1RP8A 1BOOA 4P4TA 4AJHA 4L6OA 1Q3HA 2WANA 1U04A 4CQAA 1U28A 3TO5A 3DEKA 5FI0B 2YJ4A 1DKUA 1GQQA 1B42A 3HM7A 4R8KA 4MI1A 2JALA 1XLAA 2CV2A 2ONZA 8MHTA 3GQYA 2AFRA 1NE7A 2WUWE 1UKVY 4CMKA 2GD2A 3DAFA 3PWZA 3DI0A 2V5CA 1KZHA 4Q8MA 4F60A 3DHUA 4TPKA 1KOFA 4MUHA 4M3NA 4GOND 3VDHA 4C7GA 4HPHA 5B80A 3REOA 1KTIA 3ZHYA 4O3MA 4WZAB 1W1TA 4JR2A 4NZ5A 4PTYA 4OGGA 4L74A 2G0AA 2B92A 3ZPXA 4PGMA 3TNLA 4NAEB 3IJLA 4YVVA 1W5SA 2IITA 2W27A 4C4XA 1ML4A 2DT2A 2WSYA 4YA6A 5J58A 1A5TA 3DA8A 4GX9A 1L6WA 1BX0A 3RGWS 4Y1RB 4AIRA 2GJKA 5F5LA 3IT2A 4GXMA 2DZXA 3LUJA 5AK4A 1Y82A 3JQPA 4HGZA 2QVCA 16PKA 5JALA 3SU8A 2OXIA 3HGTA 1R6UA 4RZBA 3RABA 1YVDA 1VBHA 5B37A 3H4XA 2UU9B 2OR3A 1XLCA 4Y8FA 4DLKA 3K53A 3N70A 4FOKA 1CR4A 4WLUA 2J30A 3PK0A 5I4CA 1AA6A 1JGIA 2HQSA 2YJ3A 1MJGA 4P8VA 2ZWIA 4PTLA 2W98A 3DPUA 3B9QA 2VPWA 4BQIA 2P9ZA 1RY8A 4C14A 3FN9A 4CNUA 4JKKA 2DSWA 3LX8A 3H6KA 1HE3A 2HNHA 2CYGA 2CF6A 3W2LA 3WJAA 3R7LA 1OIVA 4LZPA 3LRKA 2IKGA 1L6RA 3B8VA 4CKBA 5JTUA 2FR8A 3MOIA 4CQ8A 1YQ9A 3H7RA 3T0CA 3EXTA 3AZTA 1G291 2ESRA 3PIIA 4CLMA 4NV3A 1Y6JA 3HEAA 2V58A 1DWIM 2PU5A 4Q21A 1A8QA 1E3WB 1IBKB 2OLJA 3BQNB 4S3CA 1F5SA 4CI0B 2FKNA 3LCHA 1Y1QA 4X44A 1YTKA 3OZTA 5EZYF 2WYUA 3S0CA 3H11A 3B20A 4JVNA 5K0BA 2YBVA 3V80A 3NC0C 1CQPA 1ZRQA 2QUHA 4BKOA 4B43A 4QT4A 2GT1A 4TWAA 4QP0A 4W8OA 3ISVA 2LWIA 2FCRA 5AHXA 1TPH1 2VR4A 3WSTA 3BT7A 1TKBA 5BWMA 1KI1A 1JAEA 1T2CA 3TFXA 1R3VA 3HCEA 1C3OA 3MPUA 1UMLA 2YL6A 4N6OA 1BX3A 1WXDA 1TVPA 3WY1A 1HKKA 2XT9A 4AULA 5E4YA 4F5EA 1NY6A 2XVYA 1GR1A 1UQTA 2E25A 5FJIA 2VQSA 3DJYA 4L0CA 3NH6A 2WWRA 3P45A 4MVJG 2ZRUA 2VDIA 5G2IA 8CGTA 4OGZA 3BF8A 4OEHA 2Q5IA 4PFQA 3T44A 1WMEA 1N2XA 1JHQA 1MC8A 3M6VA 3UKDA 1IPFA 3AO0A 2FPGB 4A6DA 1F4HA 1KGWA 1H66A 4J7XA 1XYCA 3VDCA 2QYOA 4C6SA 5B3JC 4E4TA 5FWYB 4N42A 3T54A 2IPXA 4I5UA 3A6GA 4LOKA 2H2WA 2HLHA 4Q4LA 1M6WA 4BF5A 1NJ8A 4MO9A 4CM6A 3FMGA 4AWEA 4Y2TA 2EZUA 1CLUA 4I4IA 2YZGA 1JQJC 4EB8A 4C7MA 3RK4A 4UM8B 3CUXA 5CC3A 2PH1A 7MHTA 2QAJA 2GD6A 1LRTA 4LK3A 4WN3A 2Q2NA 4L50A 4RKAA 4TWZA 2B8WA 4KHPB 2XWBF 5FTLA 3H1PA 4ML9A 3ESRA 2GFIA 4M2LA 1M01A 1UK8A 1XU9A 3KCNA 1YBMA 2GCOB 2V98A 3PWTA 4KPFC 3IAAA 8GPBA 3HMJG 2XUIA 5EE9A 1E92A 3C3DA 1J2EA 1LL6A 3PPGA 3FWNA 1VHQA 2HWWA 3HBMA 2XTZA 2G1UA 4H00A 3ZXUB 3A22A 1MRSA 3PEEA 1QH9A 2JIZD 1WMBA 2X4LA 2QJOA 1BE0A 4DV7B 1EQAA 4V38A 3TI7A 2SNIE 4N40A 5EWMB 2ZSBA 1VQ1A 4PC3A 4Q7JB 5LNWA 2ZX7A 3ITNA 4IGSA 1I7NA 5CLWA 3T7RA 1Y3HA 4HKTA 3NOVA 1VPLA 2Z8ZA 4YVPA 4MMWA 4HDNB 4N03A 2X2OA 3BQ9A 2V5VA 1USKA 2R6GA 3GIDA 4KXVA 2YDRA 5T26A 5EJFA 5IJAA 3CKLA 3CN7A 2NT3A 1ZJBA 3C7KA 1XHLA 3WDPP 3MTAA 3FYUA 1G94A 2J09A 4B3DA 5G0UA 3WKEA 1PLLA 4Y2SA 4H7PA 1P3DA 1JTEA 3QE3A 1GTEA 2CFFA 5C5IA 3HVKA 4KGLA 2N1MA 3CUVA 2VDLB 1T8QA 1VBKA 2OOKA 2JAHA 3QFCA 3O07A 4J1QA 5EPOA 3H4VA 3CUKA 2BF4A 2PL9A 3O21A 1TR9A 13PKA 3GDHA 4QG6A 2ZB4A 1T4BA 3HYLA 4L95C 2IHNA 1JEEA 3D6FA 2GZSA 4RTSA 2QU7A 3ISIX 3ZDEA 2GPBA 3IVXA 4I5DA 1ZPTA 3TVAA 3TZBA 2VWGA 1NJ6A 4L1KA 2CCRA 1DOZA 2EQAA 1PJ8A 3ZJTA 1JH8A 1W85A 3QVLA 2NO5A 3PJGA 3CVUA 5CB6A 2QDDA 1ISZA 3E7DA 1FDYA 2H7YA 1FDOA 2C1ZA 1XTRA 3RVRA 1II8B 5EKSA 2XQVA 2P11A 3B6JA 1IXSB 1I3OA 2AN5A 4YP0A 2DHEA 4OOEA 1ZLPA 3VSEA 2TRSA 1ZZEA 1ORHA 3W38A 1U94A 1XMSA 3SY8A 1J0KA 1PSWA 4RK1A 4KJXA 1LB1B 4JP8A 1U7OA 1GPMA 2LVBA 3CF0A 2GFHA 5E3JA 3AY3A 4EB0A 4HEA1 3FNFA 4AZ6A 4NMLA 4JCMA 4ZOQI 1K27A 2ZIFA 1RWKA 1NDWA 1DKLA 1AZWA 2O23A 2PU7A 2EFYA 2NP7A 3H9JA 3IUSA 1E51A 1GYNA 1YPIA 3K1ZA 2XCQA 2RHBA 4DLSA 1OA0A 1M2OA 2VOJA 1TM5E 4QJ3B 1WB5A 2P9CA 1KEKA 3BSFA 1H1TA 2VRCD 3LHKA 4HNOA 3LTNC 4I9HA 3GGDA 4C5CA 2VMFA 2P9QA 2VO1A 4C2AA 1QDSA 1P9LA 4HDKB 3E15A 5CX1B 2I76A 2GBLC 4MA4A 4DR4B 1N6HA 3N9IA 2IHVA 2QRZA 4ZTZB 3W4RA 1L7VC 3APGA 2VF8A 4TS4A 5HRUA 2HS8A 2PXAA 3GQBA 3AYTA 4MV0A 4OI1A 4YNBA 2GCPA 2W6CX 4UPVA 1G69A 3QVVA 3NSXA 4U2BA 1NJFA 4IRMA 4LXYA 4DREA 3K0FA 4C6CA 5F2KA 1C7TA 1LF5A 1M1YB 2REQA 3LCUA 3RM3A 5LXTB 3RHZA 1Y1TA 1QG6A 1XCLA 2DFPA 3FBTA 1FTWA 2F8TA 4KNVA 2FFHA 1U5BB 3IGHX 1Z8AA 2ZUTA 1RZMA 5C9WA 1WKFA 2P2SA 1GM5A 1XL9A 4BGDA 4P3XA 3DLCA 3KHTA 1H6DA 2EF0A 1G01A 4JP2A 2EAWA 1TVNA 1W56A 5KJ1A 1L3CA 1NR7A 3SGGA 1Z13A 1XJCA 1Q13A 4H0CA 5E7QA 4HUQB 2VJNA 1DKMA 4MG4A 2CNLA 5KNBA 5KITA 1TQ8A 1XUUA 1Q3TA 1DSSG 5C9RA 1FDTA 4E7OA 2FH8A 4BF7A 1A7UA 5KIAA 4G07A 2VDGA 3EXG2 3UAVA 1I2QA 4HZ7A 3UCEA 4C0QC 1WD7A 4FILA 1V16B 2CFRA 5DCWA 5EWMA 4EYGA 2AJLI 3EWYA 4INPA 2DBVO 1X1AA 2ZB3A 2R1LA 1IEQA 2OU4A 2VPZA 1A4LA 4C2TA 1MG5A 1EGHA 3F5FA 3QV8A 1RWWA 1OLSA 1HDOA 4E15A 1LJYA 2EX4A 1UBMS 2EXXA 1M65A 4Z8XA 3KFXA 1W8IA 3CTPA 1NLUA 2RH5A 1JSZA 4JQYA 3AIOA 4MADA 2FVYA 2A9PA 4ZVKA 2GRAA 4LV4A 2EZ4A 4LX0A 4RL6A 1US8A 1X7XB 4HQRA 1J9ZA 4AHQA 4CQNA 1F8MA 4MQ6A 1GTZA 4UZFA 4KIGA 4BIIA 3T9CA 2YZKA 3HO8A 3NV7A 1R6AA 4S2EA 1VKHA 3SQOA 4RSRA 4AFNA 5T8GA 4ZQCA 5C18A 1G2QA 2V9CA 5JRZA 3AEXA 2QL6A 5F2LA 3D3WA 2PLRA 5K4HA 2FHPA 2NXGA 4R1UA 2RGYA 3K8MA 4FZJA 1TADA 2QN2A 4GSYA 4Z0HO 2NVAA 3DOUA 2J78A 3V0UA 5ALPA 4O4HF 3VD3A 1GYPA 1ISVA 3OO2A 2H1CA 3QITA 5BR4A 1PYFA 2CCKA 3BIJA 3W27A 1JZ5A 3HJRA 4JB3A 3NA8A 1ISMA 2ZDHA 4KPUA 3A6PC 4N5MA 3M6UA 4YCMA 3ESBA 5C8VA 4HK5A 2O0KA 4LS3A 3T1VA 4IDBA 4RLIA 1E77A 4EYOA 2DSVA 1H2RS 2C1XA 4R9OA 3VGGA 3C85A 2NAPA 2PF8A 2YW9A 4KVGA 4M56A 2X3FA 3CUFA 4Y9DA 2FB9A 2FWMX 3RYTC 5DB4A 4WV3A 3W28A 1E7WA 1M2OB 1UADA 2WP8J 3JQ6A 2PDPA 3DLBA 3QJGA 4ZD6A 4A2SA 3IVAA 4MR7A 1YU9A 1P1KA 1IY9A 4JN7A 4FT4A 1LQAA 5E4FA 1SK8A 4MGYR 1JFVA 1RQLA 1BDJA 2AF4C 1YASA 4A26A 1E2FA 1Q95A 3IXMA 3MT9A 3GBVA 1OROA 5LIPA 4P36A 3DDMA 5KNLA 1R30A 4KXYA 3DQZA 4D1YA 4ZOCA 4B85A 3VMOA 4BUZA 5B36A 4KH2A 3KBVA 4F3KA 2UKDA 1CR6A 1ABFA 3WIVA 1UP7A 1XQXA 3ZYZA 1DBQA 1QFJA 4KU4A 2BJHA 4K3ZA 1E1LA 1QRRA 2C9CA 5FOTA 3Q2OA 3OZDA 1TI7A 2G5TA 4C5BA 3RS8A 2A57A 2CE2X 1HXJA 3N0WA 4L1XA 1N5DA 2QV5A 3LU2A 3I9LA 2ZTKA 4IXMA 4KV9A 3O4RA 4KMRA 3BJIC 3K20A 4TVUA 3B3FA 1VLWA 5DSZA 2ACEA 3B4UA 3QMPA 5HMEA 3U39A 2PGXA 4RXUA 3FSGD 1OGBA 2EOAA 4YCJA 2YC4C 4O2AA 3L1JA 3GDRA 4PFMA 1VCHA 2FGLA 1LBEA 4J0IA 4FE7A 3M7WA 4YAJA 4XKMA 2GEFA 4RDCA 4Q47A 3B9EA 1TYAE 3ET5A 5I7AA 4HPJB 1VLQA 3IAQA 1IFXA 3MWJA 4BO6A 3T0GA 1E1KA 2HRBA 4IIBA 1W0KA 2VAPA 1R16A 1T0HB 2M2IA 3R9XB 1EJ2A 4A4DA 4LECA 1OE0A 3TBHA 1UWAA 4HX2A 2VDOB 3PHJA 1QP8A 2E4WA 4YR9A 4UXJA 4HZ8A 4FW8A 4H6QA 4MPDA 4JTIA 3ES7A 4MAAA 2FEWB 5EJ5A 1QFMA 1IT0A 1MYRA 1ODZA 5I4BA 2W2OA 3AR7A 1WE2A 4ES6A 1T96A 4FU0A 3IDOA 1W5PA 4CU2A 3LS9A 2CC0A 2ZZ3A 4TRMA 1MQSA 4ZVUA 5KVSA 1N6LA 3R9WA 1CPYA 1N0VC 1UIOA 1C0PA 3CUYA 3R8GA 1RP9A 1Y33E 1JB1A 4MW0A 3TEMA 1N25A 1EYWA 1V08A 3MWEA 2RGNC 5HBFA 2HSWA 1BA3A 1C30A 2EGUA 4OPMA 2GD1O 2QD2A 2G3FA 4DMLA 2QTRA 1B30A 4DA9A 4JGIA 5TQVA 2JGFA 4HUJA 4DMKA 1GCAA 3P62A 5D1NA 2DBRA 3G2MA 2CZDA 4CMAA 3E2IA 5DI3B 3AYXB 5FF4A 5DLYA 2IYTA 4X20B 4DJED 5H1WA 1CXKA 5F78A 3RYCB 2X9QA 3ABSB 1E1RA 4HNCA 3WH5A 3R0KA 5D6NA 4OKDA 4GP6A 2GQ0A 4IVNA 4EQ6B 3CEAA 1WKYA 2I3GA 5GY7A 2BZSA 3G0SA 1WBHA 1GVRA 4LXTA 3QTBA 5FBKA 4RVOA 4GYKA 4OBXA 1E3QA 1B9ZA 1S5NA 4KIFA 1A5KC 2VSOA 1QF6A 4Z0JA 5I7GA 4FA3A 3KEOA 3ED5A 5DSXA 1V6AA 3EGOA 1UMCA 4E2DA 3I76A 5E2BA 3OIVA 4C7FA 1PX4A 2X5KO 2ZYFA 3KCJA 2O2DA 4B9ZA 1VLZA 3PRYA 2NX1A 4DPLA 1CUCA 4FGJA 3MMXA 2IEYA 1ZN2A 4XGRA 1A8IA 3C0QA 2AKAB 1YZVA 4QPPA 1VB3A 4O4IF 2OCDA 1RSCA 1JL3A 1R4NA 4NZYA 4QROA 2M1ZA 3TOZA 4IDFA 3CNOA 1ZOOA 2VRWA 3W53A 3LCWA 3UV6A 4KPUB 1BEEA 5XINA 1ZGGA 5B2ZA 4F5DA 3LUBA 1SGJA 1IXZA 4UUPA 3MSRA 5AXCA 2XUCA 4HAYA 3H2EA 1NIPA 2VEMA 2BGNE 1JYSA 4PGHA 1QH8B 1B3OA 4KQNA 2FFCA 2O07A 2Q6KA 2O8CA 4V0KA 2FHSA 1ZP6A 1IHPA 1SU5A 1NSYA 1SUXA 1UDAA 2C7OA 1XD0A 1H2YA 2QRUA 4QXRA 4MR7B 1XXLA 3UWMA 1QTNA 2ZDGA 1EPVA 5ADVA 2AQOA 3NDZA 2BKEA 4PWYA 1DHTA 3PZVA 2BTMA 1LPBB 2BFBA 2OQHA 5TMPA 5FO1A 2GEJA 4AKHA 2QMEA 2H1WA 1X94A 2GN0A 3W02A 4B7ZA 3CNLA 1NUHA 2IYZA 1EBFA 3DDNA 3EWAA 3QOXA 2H4ZA 4G81A 1LWHA 1YS1X 4JFUA 1FUIA 1X7ZB 4L7QA 1J11A 1Y42X 5GONA 1GN9A 4R5HA 2Q3RA 4LX8A 1NGSA 1J4AA 2HO4A 2JD1A 1CHNA 1JR1A 3M9YA 1VL5A 3UH1A 3TE7A 2C8JA 3EMDA 4ZGWA 4RD3A 3ESYA 4GXPA 3QZ6A 2E9LA 1ESMA 4OKSA 3S9IA 1XR2A 1RQHA 4RC9A 2OGTA 2QG6A 5INTA 1XBTA 2V9ZA 4NY2A 4Z1MA 1F6PA 1DKWA 4CNBA 3FFSA 2HTMA 4NZFA 1A5SA 2BMJA 5KAMA 3VI2A 3K6RA 1EFCA 4QISA 1M2FA 2YL8A 2DT1A 3EB3A 3S47A 3M6LA 4JFSA 3QV1A 3SIPA 2ZZ5A 4QU0A 1Z41A 3I04M 2R1UA 5SZKB 1UBCA 2W66A 2FA9A 1Z89A 1ZNXA 4HFJA 4O4LA 4OXIA 1RFGE 1ZVVA 2EP8A 9XIAA 4BCCA 5I3CA 2GN1A 4HHPA 2CUKA 2FN7A 5ALJA 4X60A 3VPBA 3FR7A 5K9ZA 3QE0A 3MZ2A 3C7AA 1NN5A 1CT9A 3R7NA 4XD6A 4PLZA 3E23A 5HKOA 3PHHA 5G5IA 3UAOA 1UG6A 1E4YA 1DQUA 4HZMA 4IH3A 4KAFA 1I2MA 1N2CA 1QGDA 1Y1PA 3AFBA 1A9YA 1JIQA 5JI3E 2D0HA 5G2HA 3AUJB 4PG5A 3WEOA 2BHYA 5IMSA 1AV6A 3DHFA 5C4IA 4JEUA 1CGVA 3R43A 4XAPA 4HUTA 5ERGB 4XRRA 3OWXA 1WZIA 2QRQA 5ABGA 3OCXA 1R5OA 1E6KA 1WEKA 1EDBA 4KFUA 5CEWA 2YMMA 2X2EA 2COUA 1KETA 2A7RA 2YW2A 5BUZA 1XRJA 3UMCA 1TF2A 2FLVA 1PSZA 3M8KA 4JQSA 4LYGA 3CW8X 3O4IA 2Q3OA 1N3YA 2ZYHA 5DISB 1WBJA 4DTIA 4D0LB 3QG1A 3FIJA 4II7A 4MUZA 4BX2A 3L4VA 4WUIA 1XMIA 3ICQB 1TQ6A 2YJTD 3F6YA 1XJQA 4M1OA 2XXJA 4B7AA 3T7JA 3C1UA 3PK7A 1IAQA 4ENVA 1XEFA 4M0PA 1A8SA 1JQEA 3B04A 3KWJA 1CJCA 3OUZA 3QW3A 1Z0AA 4BO3A 2REXB 3NFUA 2POZA 3WGZA 4I1IA 5DULA 2VA9A 3I2IA 4Y7DA 3UG4A 3IDAA 4GG1A 3FZEA 1RPJA 4MRRA 3I83A 4QM7A 1M5WA 4J3FA 4QELA 4UOQA 1SOAA 3HYCA 4KWSA 4TTAA 4GUDA 4EZBA 3UY8A 2I2WA 1QPRA 1Z9AA 1EFZA 9LDTA 3LNTA 2WIDA 4JIQA 2FV8A 5JJKA 4IL0A 4CNSA 4EJSB 3FCUB 1US3A 1RXIA 1IZ8A 4E08A 4EY5A 3Q10A 2DG2A 3N76A 4ID3A 1MQPA 1V3JA 2UYCA 2QU8A 3JYPA 3A6LA 5AW2A 1RALA 1Z4JA 3TRFA 2WIJA 1Z0KA 4TYNA 2ECKA 1JR6A 4TVOA 4RKEA 3QSRA 2OSWA 4WOPA 4EZEA 3GPBA 3ZSSA 3E84A 5JAOA 2FJUA 2QCEA 3GJ3A 2OCPA 3PNBA 3J7AC 4BS0A 1NAHA 4ZODA 1EVEA 1PKEA 2ACRA 2XRYA 3IOEA 4P98A 2C7PA 4QQFA 5K8LA 3KOWA 2FZ8A 4JTEA 1U8ZA 3PUVA 3AXHA 1UK9A 3QF4A 1HN1A 4UUMA 1F14A 1NW7A 1Y3BE 3HB4X 2Q4OA 1JEZA 1RM3A 1R6XA 1SC4A 1L0BA 2OODA 2GN2A 1FUYA 1XKTA 3H5LA 4TYPA 2WHPB 3LVBA 1KA9F 4RWZA 3RD5A 4ARSA 1DCTA 4OHRA 1P33A 1T0BA 4K6GA 1JQDA 4Y2GA 1NUTA 3RROA 3DOCA 2AK3A 3WD0A 1E6LA 3EMCA 4KE6A 3NHRA 2WTUA 1E3JA 1RRGA 1R0WA 4OAPA 4RV9A 3WNMA 3LK6A 3W1XA 4EPWA 1HKJA 4IUOA 3JR3A 5C7YA 3RUDA 3NCOA 1ZGAA 4GQBA 2FRDA 2OYRA 1YJ5A 1OI4A 4W86A 3ZI0A 1YQGA 2AVNA 4UMBA 1ZVJA 4KPEC 2Q1SA 4H27A 4CTJA 1I9GA 1X7WB 4LBWA 3OLXA 2BTQA 2VKZG 2YW4A 5JQGB 3W1WA 3BK0A 2B3DA 5BSMA 2CXPA 4D56A 3URAA 4FI3C 1Z6YA 1WEHA 2RSLA 3D46A 3FKSA 1M2WA 3HLTA 4ERGA 3MLEA 1USUA 1OLUA 3BMXA 4WJ8A 5FCZA 1DIHA 1UOQA 2QV4A 3TEJA 4I6JA 3F4KA 1KY4A 1WUIS 2ZUBA 4PUUA 821PA 2R24A 2HF9A 2MR6A 4MTLA 3WHKA 5C5YA 4KPLA 1OX5A 3I30X 3AL2A 4TUFA 4QGHA 1SIOA 4MX8A 4C1NA 5G1PA 1V7YA 3DYPA 3HF3A 3R3XA 4UTFA 2JCVA 4PB4A 5G1MA 3NVAA 3W07A 2VYVD 4BRWA 3R8XA 2KQUA 1Y63A 4JROA 5CA0B 3AISA 3BWWA 1CDEA 1ADJA 5K8JB 2CLIA 1YNYA 1O87A 3D6AA 1KEEB 4XUCA 3MAAC 6REQB 4PTNA 1XDZA 4H83A 4YYCA 1XNHA 1TTJA 1FRBA 4HIBA 4QLLA 4L1GA 2QGNA 3D5TA 3EYAA 4Y6SA 3SFZA 3R0VA 4IKEA 1Q0PA 2PUFA 5TLSA 3LHSA 4E1VA 1OFIA 1ZNQO 4LI0A 1S4MA 1T9BA 1UZHA 3FOCA 4YJGA 1C90A 1ZCOA 3A1VA 1R9GA 3V1LA 4BKPA 4RZ3A 1B0IA 1IG0A 3HDGA 2CVFA 1L5WA 3AR8A 2CGEA 2OK7A 1PV4A 2XB2A 1IN7A 1AA1B 5I07A 4DQWA 4QUDA 2YWFA 4JJFA 3DBRB 4OYHA 4B6GA 2AZ4A 3KTXA 5CPOA 2X0EA 4YJ3A 3PI7A 3VNAA 2YJ5A 2YW3A 4R3UA 2VHQA 3AFIA 5EZ6B 3CS3A 4NXKA 4S3GA 3HLKA 2BHRA 4RPPA 4LHSA 4H1HA 5LOVB 3KLBA 4HVLA 1XCWA 2ABWA 4J40A 4WDXA 2OO5C 2I22A 5AR1A 2IKIA 5A6VA 4A6GA 2POQX 4HAUA 1Z8HA 3DFKA 1K9EA 2VHYA 3LHVA 4IG2B 3C2YA 2QVGA 3VKBA 5CVJA 4N18A 4PRLA 3NWBA 3L7LA 3T07A 4BNDA 2NQZA 1JJIA 5FL3A 3L7IA 1GAEO 3RPTA 3OQIA 2D59A 3E9CA 3ND9A 2WZTA 3TN3A 5KZMA 1XEWX 2IXAA 3MYYA 2RAPA 3GDGA 1H63A 2XCLA 3LI0A 5DTJA 2R1NA 5AW7A 3KB6A 3W90A 3CAVA 1B3XA 3S6JA 1G8PA 5DASA 3A4LA 4GEGA 2DUAA 3DZJA 4PBRA 3MQTA 1BU8A 3WQ4A 4G4SO 3ET4A 1Z17A 3G2NA 4B32A 3TIFA 5JVLA 2HT6A 3WH6A 1GRNA 3TLGB 1P5HA 5D01A 3ISJA 3RUPA 4G97A 2IV2X 1CDGA 2HJPA 5AW3A 4ICMA 1I6NA 5C8ZA 1OYYA 1AW2A 1E71M 2GZAA 2WD7A 7CGTA 4MDHA 5CIQA 2NSJA 3IIEA 6ENLA 2ZRQA 1D0SA 1BJRE 3HQNA 1I5RA 2W2PA 4JTHA 4R2JA 2C7RA 5DMNA 2B78A 2PK3A 4UPEA 2IXGA 1AMNA 7XIMA 1FX0A 3O38A 5EC8A 3CH7A 1FWEC 1J97A 2J41A 4DJTA 3OQ6A 1N5KA 1VTKA 3GB9A 1VSVA 3PZGA 1ZITA 4MVAA 3LHTA 5FYQA 1P1XA 4O13A 3I2YX 3LOUA 3L5OA 1KK1A 5JR3A 3GEEA 3COZA 1VRXA 3OKAA 5DM4A 4QGAA 4IQ8A 4RTQA 2QJTA 4G4IA 4NFLA 4F3YA 2VSNA 3PC8C 3HN3A 1MV5A 1I45A 3K9QO 1ME9A 2J45A 4OUDA 5EP1A 1Z33A 1NG9A 2LCQA 2GRJA 1T4MA 4JS0A 2WJGA 3EPRA 1W4LA 4U3CA 5F76A 4BQQA 4EA9A 3WKDA 2EBFX 3RKUA 3BE4A 3JQBA 2VFFA 5F3DA 2EJTA 3Q7RA 2HRDA 1K66A 2DIKA 4S0XA 2XWQA 4ZB0A 3UK6A 4M6WA 1CB7B 3EY4A 4Q8TA 3R41A 2VSYA 4FYJA 4F7WA 2I55A 4OTZA 1CQIA 5I7EA 4MWAA 3JQFC 4M5PA 3KSAC 4IGFA 3CLUD 4QUHA 3WLKX 4D6PA 3D1JA 1YBQB 721PA 1ISJA 3H86A 3MMTA 3RIEA 3C5VA 2WT4A 1YVUA 3CGWA 1WXIA 3RDKA 3W00A 1AF4A 3F1QA 1QBKC 1FPQA 3VD4A 3R7FA 1JL8A 4OFZA 4QM1A 1V02A 3FI9A 7TAAA 3GHSA 4Q6BA 4CQLA 1XS2A 4S3FA 1JFLA 2XA9A 4ZEWA 3MW7A 4BOYA 5M17A 4Q9KA 2AD5A 1OXMA 4B3LA 1TGYA 3Q94A 4EW1A 1AE1A 1YB4A 2BFEA 3VYWA 3AEUB 2WQPA 1T2EA 4FLSA 5G53C 4Y9OA 1BW9A 4JHMA 3KBBA 5JO9A 3OI7A 4HYYA 4GACA 4GO9A 3M47A 1OFVA 2H2DA 1T0OA 2EFEB 4RVGA 4RR4A 4XYGA 3S7TA 4DJEA 1ZB5A 1X96A 1NVGA 1N5LA 3LBHA 3RIHA 2JGYA 1E5LA 3MSDA 4J7AA 2WAGA 5JH2A 3QY6A 3MVIA 1SO8A 2C7BA 1IATA 4UB9A 3D64A 2IXEA 3ZC3A 1GN8A 1K9TA 4Z0NA 3A21A 2VSXA 2WFLB 3QLJA 4DM2A 3WK4A 3COTA 4Z3DA 2F55A 1AGNA 2JAQA 3UGKA 3AVUA 1XD2B 4B31A 4TIMA 1RT9A 2J88A 3HG2A 3PZNA 1T1GA 2A1UB 2OFXA 1OD0A 1Q0ZA 2AJDA 3D3FA 2QTHA 1Z83A 1W30A 4JD4A 1QMPA 4R83A 1R86A 3JATB 1VLJA 2V2CA 2GAIA 2P9YA 3P0FA 5GTDA 3OLZA 4RJEA 2XXBA 2VQ6A 3RS9A 2VL4A 3IOYA 1GKYA 2C2WA 1ZU8A 3IKVA 2GZ3A 4CCEA 2CWXA 5E6ZA 4L9AA 4A8PA 1EE1A 3GDLA 2RHTA 2J7EA 4G3XA 3LVRE 4NAEA 2Q7DA 4IGIA 4PV7A 3CG0A 3F8TA 3VHLB 3I23A 4LYEA 5E2AA 1M8JA 2FMXA 4HCLA 1MVOA 3UXIA 3C1AA 1ZENA 4CQMA 4YQYA 1IY2A 1E4LA 5DT5A 2BFCB 4Q4SA 2I3BA 4H9UA 3Q6MA 2D06A 1E59A 1NONA 2OEKA 1SUWA 5BROA 1V35A 2YY5A 3WLTA 2X5XA 1QNOA 2ONJA 2WU1A 3B9OA 2X9GA 3HXKA 1GUAA 4JXKA 3VMFA 1EGMA 3C14C 1X74A 3TF5A 5HBRA 3O05A 5T9CE 1U2YA 1FX0B 2ZRGA 3GZAA 4LVOA 1MWOA 4URWR 4AWXA 4ZIRB 1JCYA 3TAKA 5TT1A 5DBHX 3RUHA 4BMOB 3EOOA 1QYVA 2WIKA 3DDWA 1UJCA 4PCUA 2UDPA 3VTFA 1N8WA 1KAGA 2ISSD 4MR8B 1AURA 5A2BA 5L8VA 4HOWA 3PA6A 4DBZA 5K3DA 4ZAWA 4AZ7A 4WXHA 3L8HA 4XSMA 1ZSXA 2PDAA 2ZYAA 1PZNA 2WA1A 3ZZUA 3G0IA 4D8WA 2QD1A 4LDNA 3NP7A 4HU3A 1KAHA 5E7IA 1PTAA 3AILA 2ZYGA 4GOAA 3AERB 5LL6P 4BN0A 1JPKA 4HBKA 1JPHA 1FNCA 1PZGA 3HCFA 3KLOA 2AW5A 2L0XA 3WUGA 1SUAA 4NENB 4CKBB 4XUYA 3S1AB 3NP9A 3TECE 1F5ZA 1G8KA 1GU7A 3CW9A 4AH7A 5KETA 3SJNA 4J94A 4ALDA 1W75A 2JHPA 3WA6A 5IT9A 3TXVA 5COBA 4AFYA 5HE9A 1LCIA 1SZDA 3WZ2A 4YRPA 1Z56C 3M0LA 2ZXFA 1HQYE 1T9DA 1E69A 2G9RA 1YCDA 2QCCA 3CL8A 3GRAA 1SVWA 3MV11 2XX3A 1P1BA 2JIMA 3IEPA 4AMGA 1FP6A 2PFGA 3OHPA 2BGLA 2RK3A 1YZQA 3IQFA 1ZK4A 3VHRA 4CUZA 2QHXA 3KJXA 5JCJD 5EA9A 1UBNA 1CUFA 4FFPA 3VZDA 2ZSJA 4P8RA 1KVRA 5F52A 1KK2A 3TLMA 3CU5A 1KSJA 4AECA 2QPAA 3CX6A 1TD9A 4BC1A 5CLLA 3R10A 4P0QB 3RVPA 5D00A 3U19A 3RG6A 3R4IA 2PRKA 3I7RA 5CJNA 1J5SA 5AI9A 3OESA 3I32A 3ST7A 2DZUA 2XVLA 4ZGGA 1JU4A 3DFUA 4DA0A 2VUHB 3ZEIA 3TZHA 3PWSA 1B8UA 2CW6A 1FQKA 3GMDA 2H2HA 3ZMRA 2GS9A 4YPVA 4NJIA 3VFCA 3OE7D 5CXQA 3HBNA 2V7EA 2RHLA 2KHZA 1ZESA 3QKRA 3WBWA 3HKDB 2C2HA 4RJ2A 1FCQA 2OV4A 5F51A 3LE8A 4JCLA 1E58A 3MU7A 4GMHA 3EZFA 3NJ3A 2IPOA 5LB4A 3DUFA 3HG7A 1Y1LA 3LW8A 4JGDA 1DEHA 2ZQYA 3ANMA 4US5A 4LVNA 5IM5A 3LLCA 1KH1A 3JW8A 1H5QA 2YDXA 5C31A 2OHHA 1VPDA 4E13A 3R40A 1HZJA 3WG9A 1V8BA 1B1CA 3CNYA 1FF9A 4MKZA 3DE1X 3RVQA 2VLBA 1YXMA 4PGGA 1A0OA 1UJMA 3VR4H 2D73A 2NV2A 1YB2A 5BSWA 1DZ3A 2RHDA 1UZUA 2PS0A 1LZKA 3VNJA 1OLXA 3I5XA 1HBJA 4JA0A 3L84A 1QTIA 3I62A 5B1SA 3RF7A 3Q0IA 4I9FA 2FPRA 3N25A 1CEEA 2WKJA 2QN1A 3V8NA 3QTTA 1A3WA 2HB6A 4I90A 3SK0A 3IV3A 1X8JA 1OINA 5E6UB 1P3JA 2R8XA 4OM7A 3EKLA 4YRNA 3TR6A 4RTKA 2Z24A 1UXJA 2V6GA 1U2PA 1NFBA 3LNMA 4UHCA 3ZWPA 5CB0A 1EZWA 2GWRA 3KVNA 1G20B 4FWBA 1ULHA 4X1YB 1CLEA 3QLLA 3LQ1A 4BQEA 3AI2A 1TAUA 1YHTA 3AETA 3TKFA 3SLGA 2Z43A 4MGHA 4R4JA 1AQFA 3LCGA 2BPOA 4D3FA 1Y80A 3H99A 4TTUA 3DKPA 3PUWA 5DM1A 2ZRZA 4WDQA 1NKSA 2IEDA 3EGEA 3CZ5A 4DDKA 1CNVA 3BVJA 2DQKA 3BGJA 1FKXA 4MF4A 2QWXA 4HNAB 3GG1A 2B69A 4BK9A 2C07A 2QTVA 2Y2WA 3H8AA 1DU4A 2QBYB 5LOVF 4JL2A 1YVPA 3HNRA 4Q3DA 1DYSA 1QUFA 4TYMA 2A0UA 3GNLA 2OPJA 3KYDB 1EPXA 4A8NA 3CQKA 1EQCA 2O1WA 3G1WA 1AY0A 4DYEA 1IOVA 1Y3FE 1R6TA 1EVIA 2X7JA 4Z2AA 2Y1FA 1F2UB 1EJXC 3U4FA 1ZGZA 4Y1GA 1P4JA 2PP0A 4XUEA 4OLJA 1JIIA 1IN4A 4BC0A 4DBSA 3I6IA 3X1YA 3CYJA 2V54A 4JYAB 4MJ4A 4L4YA 1DFGA 4E22A 3DFYA 2GQ3A 2YXGA 4DF0A 3ZWBA 4MYXA 1KJWA 3A3YA 1AUXA 4XBSA 4L15A 1G16A 5FF3A 2APJA 3TTSA 4AD4A 3B5EA 4IG9A 3U3ZA 1EK6A 1H65A 4DBUA 4OHOA 5BQ5A 3SUVA 3PUGA 4BS9A 2G63A 1X1BA 3U5ZB 1V6XA 4FK8A 1I1NA 4QOSA 2GGHA 1KAOA 4RSGA 3F03K 3WZLA 3TAOA 5SWUA 3CNNA 1EWYA 2JK0A 2HPMA 2NLYA 1RRVA 3EW9A 3QHQA 4H4CA 1XP8A 4YWSA 3Q11A 4WHMA 2PT9A 1V1JA 5HWSA 3JZMA 3G2PA 2OZEA 1WE5A 4YT2A 5B58C 1CEXA 2G4FA 2Q46A 4Y9MA 1U7PA 4JBYA 5HIMA 3TQ0A 2GHQA 3UOWA 4DWVA 3PQ6A 1GPFA 4DLMA 3EWWA 2Y05A 1ENPA 4WKHA 2GUWA 3PQDA 4M1SA 4C65A 4WKOA 4BQNA 3NANA 2QTGA 4F86A 2H7CA 4J0EA 2C29D 4NIMA 2FGZA 4H4IA 2I6GA 3JRNA 1Y1RA 1T15A 3GVWA 3L66A 3V3TA 2REQB 3GMTA 1JILA 3PSHA 2DQ4A 4US6A 4QYWA 3UF9A 1XQYA 3GC5A 1EK1A 2JBHA 2R6CA 2FZKA 4E5KA 2DERA 1WVIA 1Q7QA 5FPQA 1GAWA 3BWYA 3F1LA 4LOLA 3OT1B 2ZUSA 4QNWA 2MWMA 4CNNA 5EQFA 4CQDA 2QROA 1EQ2A 2Z2UA 3I1IA 4INOA 4INFA 4KLCA 3A9VA 3ARQA 1X6VA 5HOSA 4C6TA 3COYA 3UZXA 1LLDA 3RVNA 2ZRBA 5I24A 3FLAA 2GMWA 1I13A 5IZ4A 1KC7A 1Q1NA 4IZ6A 4W9NA 4FJ1A 5BN4A 2GSHA 4XWOA 5GP1A 3ER9A 1QWKA 1Q7CA 2PP1A 3W2EA 3OZOA 2GAOA 3EX1A 2I65A 1Q16A 2J9YA 1CUHA 4HDQB 3IGUA 1UJNA 3EDRA 1T7LA 3B60A 1GOXA 2HDWA 1W4AA 3ESZA 3ZNQA 3EDMA 1PFQA 3MWLA 5MDHA 3NM4A 1DTSA 3IDZA 2IQIA 1PGOA 5K3BA 4IIJF 1KVQA 1WTAA 3WA7A 1TPWA 4WEOA 3FE2A 3PFNA 5DHFA 1W44A 3QJYA 4XEHA 3UUEA 3W1PA 5F7JA 3U49A 4RKRA 2JQXA 4XSGA 2VF4X 2BGUA 1T3HA 2XUZA 3KVMA 5FPSA 4IKPA 1QO0A 4QWWA 2B0JA 4PO9A 3NAZA 2WVUA 1OJLA 5HIAA 2D1FA 1DS6A 1GPJA 3SWWA 2CFSA 1MIOB 4J6FA 1TWWA 1XAHA 3RARA 3P9YA 4MAVA 5CB4B 5CJ2A 3DMRA 3H1AA 5GVRA 4FE4A 2CK3A 1XK7A 5CVUA 5AVVA 1TTIA 3M0JA 1Z35A 2DBYA 4YMIA 2GDJA 1HJXA 1P1JA 1ZUHA 3RCYA 4ENQA 5JAMA 3EBVA 4LB3A 2ZUUA 3TKLA 2QLYA 4QNNA 1JDNA 2XE8A 2HQRA 4EF5A 1UT6A 1MUWA 4DTCA 1XIGA 2R9VA 2YUIA 3KDPA 2C4WA 3ZX4A 4R31A 3TOPA 3TGWA 3WL4A 6ADHA 1XHGA 1EIWA 4JLOA 1ZRMA 4EENA 2GVDC 4RIHA 1OXXK 3WLJA 3N2IA 2GYUA 3DD5A 2ZBGA 2EV9A 1KIAA 3C8FA 3GYBA 5FCDA 3DTNA 5FPHA 2FMFA 1T2FA 3BXPA 3TD2A 1JPIA 3GV0A 4YHEA 1NKVA 3GVPA 2XGJA 1IBSA 1W8GA 2ZSHA 1UBFA 4JB0A 4ZQCB 1Z4LA 4B48A 3DERA 3QTPA 4IHCA 2GKSA 3HY6A 3R5EA 1JD7A 4U3JA 2A5HA 5FAJA 2KSQA 4XDGA 4GIYA 2YR0A 3VM6A 5CGMA 3W7EA 3SJBA 1PDOA 1W25A 3O9VA 3AM5A 4LNYA 2AVDA 1XTJA 3HH8A 1EFKA 3HVIA 4LSWA 3V33A 4KYIB 4LVUA 3V7NA 5J4LA 5ITZA 2PMKA 4LNUB 4LWPA 3TJ4A 2BB0A 3WNNA 1UH3A 3UZWA 3DFFA 4BCEA 3OZGA 1TE6A 4IJ5A 1QOQB 1RE0A 3BLPX 5BPHA 3ZHVA 1BFDA 2DR3A 3QFEA 1V41E 1GL3A </