4X61B

Crystal structure of prmt5:mep50 with epz015666 and sam
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
305
structure length
302
Chain Sequence
PACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein arginine N-methyltransferase 5
publication title A selective inhibitor of PRMT5 with in vivo and in vitro potency in MCL models.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 79
structure length 302
sequence length 305
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4x61B00
3C99A 1JOFA 2PM9A 3RFGA 4JSVC 3IJ1A 4D6VA 2AH1A 3DXKC 5FLXg 4CY3A 3PVUB 5AFU3 4O3TB 2YNPA 4J86A 4Y5RD 1SQJA 4A11B 5B4WA 3IIWA 3I7KA 4J84A 4J78A 3EI1A 4A08B 3NVXA 5C2WB 2P9UC 5FKRA 2P9NC 4IMMA 3DM0A 3PSCB 2YNOA 2P9PC 4L9OA 3SJLD 2H3XA 3MKSB 4Y7RA 1VYHC 3OKYB 5CYKB 4JSXC 4CY2A 3PXWD 4E54B 4FB1D 5I5MA 2OK4A 2H6KA 3RRMC 4XYIA 3EG6A 4MK0B 5FA5B 3OKTA 1K8KC 3I7OA 3UVMA 2W18A 4QL1A 4BUJC 2GC4A 4ZOVA 5HE0B 5H1MA 3GREA 2H68A 3N0EA 4ZOZA 3EI3B 4GGCA 5IGQA 2AGZA 5TEFA 4TZ4A 2AH0A 3V5WB 4A09B 5IJ7E 3OL2A 5K19A 4A2LA 3A0FA 2XL2A 4CZVA 2XL3A 4FA1D 5EM2A 1MG2A 4K3JB 3P4FA 4JXMA 2GC7A 4PSWB 4J8GA 3NVNA 5IC7A 4KFMB 3L4MD 1U4CA 4EWRA 3C75H 3VA6A 4A08A 2YNNA 2HJBA 4CY1A 4GM8A 3EI2B 2P9IC 2TRCB 5KDOB 3CIKB 4QRJA 3GFCA 3JZNA 3RSEC 4GQ2P 3MZLA 3SWSD 2HKMA 5H17A 4ERZA 2PM7B 2H6QA 1N6EA 2QXVA 2B5NA 3C5MA 3OKYA 5CYKA 3IJCA 3MKQA 3J81g 4PBZA 3SBQA 3N0DA 4E54A 2H14A 3BG1A 4G56B 4GQBB 4X60B 1GXRA 4GMBA 4R7AB 2OJYA 1GP2B 1FWXA 2J57G 1N6FA 4ESGA 1GG2B 3BWSA 5CXCA 2AGLA 4CZXA 3KRWB 3RN1D 4GM3A 3RN0D 4JD2C 3EI3A 5IJ8E 4UI9R 4FA9D 4GM9A 1JMXB 1OMWB 4A09A 4QT8A 3UVNA 4FAND 2AGWA 4J87A 4E5ZB 3F3FA 4PXWA 5A2Qg 1SQ9A 2I3SA 4QQEA 2H9LA 4A0AB 3K26A 1RI6A 2P9LC 1GOTB 4AEZA 4FHLA 4Z8LA 3SLED 2GNQA 3K27A 3SCYA 4X3EA 3RMZD 4CY5A 4JT5C 3DSMA 3JB9L 3EI2A 5TDHB 2O9KA 2CN3A 3I7NA 2CN2A 2OVPB 4H5IA 4U1EI 3V9FA 3UVKA 2EBSA 3OKWA 5CXCB 2OVQB 3UKUC 2YMUA 2IUPA 5HYNB 4JSNC 3NVQA 3SVWD 5JWZA 5EMJB 4O45A 3IIYA 1U2VC 2CNXA 5H14A 1P22A 3UVOA 2H9PA 3SBRA 1L0QA 4X61B 1PBYB 5FQDA 4CI3A 3JPXA 3U4YA 5GMKn 5HE2B 5GXIA 2HYEA 2P9SC 4LG8A 2H9MA 3FGBA 4OWRA 2G99A 3F3GA 3B7FA 2I0TA 4JT6C 1XIPA 4PBYA 2UZXB 3EMHA 2I3TA 4H5JA 2B5MA 1JMZB 4LG9A 4E5ZA 2Z2NA 3C9CA 3EI4B 3I7LA 2IUQA 4J77A 2AGYA 1QNIA 4A0AA 2PBIB 4FA4D 4AOWA 3OW8A 2YB8B 4N14A 2I0RA 1A0RB 3AH8B 4PC0A 5CXBB 1K32A 4X63B 3AL9A 4CZYA 5FXYA 5FKTA 3AL8B 1SHYB 3FRXA 4BH6A 4O1QD 1PGUA 5FKSA 4FA5D 4CC9A 4ZN4A 2OIZA 3DWLC 4ZOYA 2MTAH 2AQ5A 5HQGA 2I0SA 2J55H 4HDJA 4L3GD 1B9XA 4A2MA 3JROA 2HKRA 4IA9A 5AJAA 4J0WA 4ERQA 3PVWB 3CFSB 2CO0C 2CE9A 5C2VB 3EU7A 1OLZA 3SHFA 2BBKH 2CE8A 5THAA 4JSPC 5TF2A 2P9KC 3SXTD 4K3ID 5EMKB 3KRXB 2G9AA 2OVRB 5GXHA 1TBGA 2IAAA 2J56H 4A7JA 1PI6A 3ODTA 1NEXB 4J8BA 4NSXA 4PNKB 3SN6B 2H9NA 2YBAA 3EWEA 4J81A 3EI4A 4GGAA 4J82A 3W15A 2XU7A 5FKQA 1JJUB 4FAVD 5C9ZB 2UZYB 5TEEA 3UR4A 4J73A 5EALA 4GZ8A 1YFQA 4A0BB 5CXBA 2HJ4A 4CI1A 2IWKA 3ULEC 5I5IA 3PXSD 3PSLA 3JRPA 2CO0A 3J80g 3AL8A 2H6NA 3SMRA 2IUVA 3ZWLB 3I89A 1MG3A 4XYHA 4ES0A 4OZUA 1XKSA 2PM6B 3F3PA 3DXMC 4FWWA 4LGNA 1Q47A 3OTTA 3PXTD 3VGZA 3JZGA 3CFVA 5EMLB 3V7DB 2PM9B 4PSXB 2HESX 1ERJA 3BG0A 3PE7A 4O3UB 3I7HA 2BCJB 4ZOXA 1R5MA 1B9YA 4YVDA 3MXXA 3SBPA 3JZHA 5HE3B 3I7PA 2IWFA 2B5LA 3EI1B 4BL0A 5EMMB 4L3HD 3JAMg 1S4UX 2Z2PA 3IJ0A 2Q7QA 2B4EA 3L4OD 3MMYA 2AGXA 5K1CC 3MZKA 4ERYA 4A11A 1MDAH 4CI8A 3HFQA 4L1QD 3FM0A 2IURA 3ORVD 2H47A 4J0XA 4U7AA 4GQ1A 5AMSA 2H13A 5EAMA 5GSAA 3IKOA 5EARA 1TYQC 4A0BA 3I2NA 3RFHA 3I8CA 3RLMD 1PEVA 2OK6A 2Z2OA 1N6DA 2HXCA 1NR0A 3AFCA 5SXMA 4GGDA 3I8EA 3UVLA 4J79A 4D0KA 1XHMA 5IGOA 4O9DA 5EAPA 4CI2A 5I5JA 5IT9g 4I79A 3VH0A 3E0CA 3OL2B 2XYIA 5HE1B 4XEIC 3UKRC 2QC5A 3SFZA 5EM2B
chains in the Genus database with same CATH superfamily
2VDLA 3C99A 1JOFA 1VZ2A 2PM9A 2XDWA 3RFGA 5M61A 1H2XA 4JSVC 3IJ1A 4MMXA 4D6VA 2AH1A 3DXKC 4G1EA 5FLXg 4CY3A 3PVUB 4DNUA 3GD1I 5AFU3 4O3TB 2YNPA 2JKXA 3O4GA 4J86A 4Y5RD 5M5SA 3NIFA 1SQJA 4A11B 5B4WA 3IIWA 3I7KA 4J84A 4J78A 4WK0A 3EI1A 3IJEA 3GC3B 4A08B 3NVXA 4AN0A 5C2WB 2P9UC 5FKRA 2P9NC 4IMMA 3DM0A 3PSCB 2YNOA 2P9PC 2VDPA 1O6FA 4L9OA 3SJLD 1O6GA 2H3XA 3MKSB 4Y7RA 1VYHC 3OKYB 5CYKB 4JSXC 4CY2A 1T2XA 3PXWD 4E54B 4FB1D 5I5MA 2OK4A 5M5TA 2H6KA 3RRMC 4XYIA 4NBMA 3EG6A 4MMYA 4MK0B 1UOPA 5FA5B 3OKTA 1L5GA 1JTDB 1K8KC 3I7OA 3UVMA 2W18A 4QL1A 3O4HA 4BUJC 2GC4A 4ZOVA 5HE0B 3ZE1A 1E5TA 3IULA 2VDMA 5H1MA 4WK4A 3GREA 2H68A 3K72A 3N0EA 3VI3A 4ZOZA 3EI3B 4L1MA 4GGCA 5IGQA 2AGZA 5TEFA 4AMZA 4TZ4A 2AH0A 3V5WB 4A09B 5IJ7E 3OL2A 5K19A 4A2LA 3K6SA 3A0FA 2XL2A 2XE4A 4CZVA 2XL3A 3T3MA 4FA1D 5EM2A 1MG2A 2QZPA 4O2WA 4K3JB 3P4FA 5M5UA 4JXMA 2GC7A 3OF7A 4PSWB 4J8GA 3NVNA 1JV2A 5IC7A 1GOHA 4KFMB 3L4MD 1U4CA 4EWRA 1VE6A 3C75H 3VA6A 4A08A 2YNNA 5E6RA 2HJBA 4CY1A 1YR2A 4GM8A 3EI2B 2P9IC 2TRCB 5KDOB 3CIKB 4QRJA 3GFCA 3JZNA 4JHPC 1UOOA 3RSEC 4GQ2P 3MZLA 3SWSD 2HKMA 5H17A 4ERZA 2VDNA 2PM7B 2EIEA 2H6QA 2EIDA 1N6EA 2QXVA 2B5NA 3C5MA 2HU5A 3OKYA 5CYKA 3IJCA 3MKQA 3J81g 4PBZA 3SBQA 3N0DA 4E54A 2H14A 3BG1A 4G56B 4GQBB 4X60B 3K71A 4BCBA 1GXRA 4GMBA 4R7AB 3QI0A 2OJYA 1GP2B 1FWXA 2J57G 1N6FA 3IUQA 1GG2B 3BWSA 4O02A 4ESGA 1U8CA 5CXCA 2AGLA 4CZXA 3NIDA 4RE6A 3KRWB 2VDKA 3RN1D 4GM3A 3RN0D 4JD2C 4QAMA 3EI3A 5IJ8E 4BCCA 4UI9R 4FA9D 4GM9A 1JMXB 1OMWB 3IUNA 4A09A 4QT8A 3UVNA 4FAND 2AGWA 2VC2A 1VZ3A 5E6UA 4J87A 4E5ZB 1QFMA 3F3FA 4BP9A 4PXWA 3V4VA 2VZ3A 5FFOA 5A2Qg 1SQ9A 2I3SA 3FCUA 4QQEA 2H9LA 1QFSA 4A0AB 3K26A 5M5RA 1RI6A 1GOFA 2P9LC 1GOTB 4AEZA 4FHLA 4Z8LA 3SLED 2GNQA 3K27A 3SCYA 1C9LA 4X3EA 3RMZD 4CY5A 4JT5C 3DSMA 3JB9L 3EI2A 5TDHB 3KCIA 4UM9A 3O4JA 2O9KA 2CN3A 3I7NA 1UTCA 2CN2A 2OVPB 4H5IA 4U1EI 4AMYA 2WQ8A 3V9FA 3UVKA 2EBSA 3FCSA 3OKWA 5CXCB 2OVQB 3UKUC 2YMUA 2IUPA 5HYNB 1A12A 4JSNC 3NVQA 3SVWD 5JWZA 5EMJB 4O45A 3IIYA 1U2VC 2CNXA 5H14A 1P22A 2HU7A 3UVOA 2H9PA 3SBRA 1L0QA 4X61B 1PBYB 5FQDA 4CI3A 3JPXA 3U4YA 5GMKn 5HE2B 1E8NA 3ZE2A 5GXIA 2HYEA 2P9SC 4G55A 4LG8A 2H9MA 3FGBA 4OWRA 2G99A 3F3GA 3B7FA 2I0TA 4JT6C 1XIPA 4PBYA 2UZXB 3EMHA 2I3TA 4MMZA 2VDQA 4H5JA 2B5MA 1JMZB 4LG9A 4E5ZA 2HU8A 2Z2NA 4WK2A 3C9CA 3EI4B 3I7LA 3QHYB 2IUQA 4J77A 2AGYA 1QNIA 1I2MB 4UM8A 3ZDYA 3IUMA 4A0AA 2PBIB 4FA4D 4AOWA 3OW8A 2YB8B 4N14A 2I0RA 1A0RB 3AH8B 4PC0A 5CXBB 1K32A 4X63B 3AL9A 4CZYA 5FXYA 5FKTA 3AL8B 1SHYB 3FRXA 3IVMA 4AX4A 3ZDZA 4BH6A 4O1QD 1PGUA 3NIGA 1BPOA 5FKSA 4FA5D 4CC9A 4ZN4A 2OIZA 3DWLC 4ZOYA 2MTAH 2AQ5A 5HQGA 2I0SA 2J55H 4HDJA 4L3GD 1B9XA 4A2MA 3JROA 2HKRA 4IA9A 5AJAA 4J0WA 4ERQA 3PVWB 3CFSB 2CO0C 4NC4A 2CE9A 5C2VB 3EU7A 3V4PA 1OLZA 3O4IA 3SHFA 2BBKH 2CE8A 5THAA 4JSPC 5TF2A 3EQ7A 2P9KC 3MVDK 3SXTD 5C86A 4K3ID 5EMKB 5E6SA 3KRXB 2G9AA 2OVRB 5GXHA 1TBGA 2IAAA 2VDOA 2J56H 1E8MA 4A7JA 1PI6A 3ODTA 1NEXB 4J8BA 4WJKA 4NSXA 4PNKB 4NENA 3SN6B 2H9NA 2YBAA 3EWEA 4J81A 3EI4A 4GGAA 4J82A 3W15A 2XU7A 5FKQA 1JJUB 4FAVD 5C9ZB 2UZYB 4NAAA 5TEEA 3UR4A 4J73A 5EALA 4GZ8A 1YFQA 4A0BB 5CXBA 2HJ4A 4CI1A 2IWKA 3ULEC 5I5IA 3PXSD 3PSLA 3JRPA 2CO0A 3J80g 3AL8A 2H6NA 3SMRA 4DNWA 2IUVA 2BKLA 3ZDXA 3I89A 3ZWLB 4IRZA 1MG3A 5M5VA 4AN1A 4XYHA 4JHNA 4ES0A 4OZUA 1XKSA 2PM6B 3F3PA 3DXMC 4FWWA 4LGNA 1Q47A 4G1MA 3OTTA 3PXTD 3VGZA 3JZGA 3CFVA 5EMLB 3ZE0A 3V7DB 2PM9B 4PSXB 1H2WA 2HESX 1ERJA 3BG0A 3PE7A 3IURA 4O3UB 3I7HA 2BCJB 4ZOXA 1R5MA 2VDRA 3MUOA 1B9YA 4YVDA 3MXXA 3SBPA 3JZHA 5HE3B 3I7PA 2IWFA 2B5LA 3EI1B 4BL0A 5EMMB 2QR5A 4L3HD 3JAMg 1C9IA 3T3PA 1S4UX 1VE7A 2Z2PA 1H2ZA 3IJ0A 2Q7QA 2B4EA 3L4OD 3MMYA 2AGXA 1H2YA 5K1CC 3VI4A 3MZKA 4ERYA 4A11A 4D9SA 4DNVA 1MDAH 3EQ9A 4BCDA 4CI8A 3HFQA 2XZGA 4L1QD 1K3IA 3FM0A 2IURA 5HDBA 3ORVD 2H47A 4J0XA 2EICA 4U7AA 4GQ1A 5AMSA 2H13A 5EAMA 4Z7NA 5GSAA 3IKOA 5EARA 1TYQC 4A0BA 3I2NA 3RFHA 3I8CA 3RLMD 1PEVA 3IUJA 2OK6A 2VZ1A 2Z2OA 1N6DA 2HXCA 5FFGA 3EQ8A 5C92A 1NR0A 1TYEA 3AFCA 5SXMA 1M1XA 4GGDA 3DDUA 3I8EA 3UVLA 4J79A 4D0KA 1XHMA 5IGOA 1UOQA 4O9DA 4Z7QA 5EAPA 4Z7OA 4CI2A 5I5JA 5IT9g 1GOGA 4I79A 4RE5A 3VH0A 3MUNA 3E0CA 3OL2B 2XYIA 5HE1B 4XEIC 3UKRC 2EIBA 2QC5A 3SFZA 5EM2B 4BP8A
chains in the Genus database with same CATH topology
3C99A 1JOFA 2PM9A 3RFGA 4JSVC 3IJ1A 4D6VA 2AH1A 3DXKC 5FLXg 4CY3A 3PVUB 5AFU3 4O3TB 2YNPA 4J86A 4Y5RD 1SQJA 4A11B 5B4WA 3IIWA 3I7KA 4J84A 4J78A 3EI1A 4A08B 3NVXA 5C2WB 2P9UC 5FKRA 2P9NC 4IMMA 3DM0A 3PSCB 2YNOA 2P9PC 4L9OA 3SJLD 2H3XA 3MKSB 4Y7RA 1VYHC 3OKYB 5CYKB 4JSXC 4CY2A 3PXWD 4E54B 4FB1D 5I5MA 2OK4A 2H6KA 3RRMC 4XYIA 3EG6A 4MK0B 5FA5B 3OKTA 1K8KC 3I7OA 3UVMA 2W18A 4QL1A 4BUJC 2GC4A 4ZOVA 5HE0B 5H1MA 3GREA 2H68A 3N0EA 4ZOZA 3EI3B 4GGCA 5IGQA 2AGZA 5TEFA 4TZ4A 2AH0A 3V5WB 4A09B 5IJ7E 3OL2A 5K19A 4A2LA 3A0FA 2XL2A 4CZVA 2XL3A 4FA1D 5EM2A 1MG2A 4K3JB 3P4FA 4JXMA 2GC7A 4PSWB 4J8GA 3NVNA 5IC7A 4KFMB 3L4MD 1U4CA 4EWRA 3C75H 3VA6A 4A08A 2YNNA 2HJBA 4CY1A 4GM8A 3EI2B 2P9IC 2TRCB 5KDOB 3CIKB 4QRJA 3GFCA 3JZNA 3RSEC 4GQ2P 3MZLA 3SWSD 2HKMA 5H17A 4ERZA 2PM7B 2H6QA 1N6EA 2QXVA 2B5NA 3C5MA 3OKYA 5CYKA 3IJCA 3MKQA 3J81g 4PBZA 3SBQA 3N0DA 4E54A 2H14A 3BG1A 4G56B 4GQBB 4X60B 1GXRA 4GMBA 4R7AB 2OJYA 1GP2B 1FWXA 2J57G 1N6FA 4ESGA 1GG2B 3BWSA 5CXCA 2AGLA 4CZXA 3KRWB 3RN1D 4GM3A 3RN0D 4JD2C 3EI3A 5IJ8E 4UI9R 4FA9D 4GM9A 1JMXB 1OMWB 4A09A 4QT8A 3UVNA 4FAND 2AGWA 4J87A 4E5ZB 3F3FA 4PXWA 5A2Qg 1SQ9A 2I3SA 4QQEA 2H9LA 4A0AB 3K26A 1RI6A 2P9LC 1GOTB 4AEZA 4FHLA 4Z8LA 3SLED 2GNQA 3K27A 3SCYA 4X3EA 3RMZD 4CY5A 4JT5C 3DSMA 3JB9L 3EI2A 5TDHB 2O9KA 2CN3A 3I7NA 2CN2A 2OVPB 4H5IA 4U1EI 3V9FA 3UVKA 2EBSA 3OKWA 5CXCB 2OVQB 3UKUC 2YMUA 2IUPA 5HYNB 4JSNC 3NVQA 3SVWD 5JWZA 5EMJB 4O45A 3IIYA 1U2VC 2CNXA 5H14A 1P22A 3UVOA 2H9PA 3SBRA 1L0QA 4X61B 1PBYB 5FQDA 4CI3A 3JPXA 3U4YA 5GMKn 5HE2B 5GXIA 2HYEA 2P9SC 4LG8A 2H9MA 3FGBA 4OWRA 2G99A 3F3GA 3B7FA 2I0TA 4JT6C 1XIPA 4PBYA 2UZXB 3EMHA 2I3TA 4H5JA 2B5MA 1JMZB 4LG9A 4E5ZA 2Z2NA 3C9CA 3EI4B 3I7LA 2IUQA 4J77A 2AGYA 1QNIA 4A0AA 2PBIB 4FA4D 4AOWA 3OW8A 2YB8B 4N14A 2I0RA 1A0RB 3AH8B 4PC0A 5CXBB 1K32A 4X63B 3AL9A 4CZYA 5FXYA 5FKTA 3AL8B 1SHYB 3FRXA 4BH6A 4O1QD 1PGUA 5FKSA 4FA5D 4CC9A 4ZN4A 2OIZA 3DWLC 4ZOYA 2MTAH 2AQ5A 5HQGA 2I0SA 2J55H 4HDJA 4L3GD 1B9XA 4A2MA 3JROA 2HKRA 4IA9A 5AJAA 4J0WA 4ERQA 3PVWB 3CFSB 2CO0C 2CE9A 5C2VB 3EU7A 1OLZA 3SHFA 2BBKH 2CE8A 5THAA 4JSPC 5TF2A 2P9KC 3SXTD 4K3ID 5EMKB 3KRXB 2G9AA 2OVRB 5GXHA 1TBGA 2IAAA 2J56H 4A7JA 1PI6A 3ODTA 1NEXB 4J8BA 4NSXA 4PNKB 3SN6B 2H9NA 2YBAA 3EWEA 4J81A 3EI4A 4GGAA 4J82A 3W15A 2XU7A 5FKQA 1JJUB 4FAVD 5C9ZB 2UZYB 5TEEA 3UR4A 4J73A 5EALA 4GZ8A 1YFQA 4A0BB 5CXBA 2HJ4A 4CI1A 2IWKA 3ULEC 5I5IA 3PXSD 3PSLA 3JRPA 2CO0A 3J80g 3AL8A 2H6NA 3SMRA 2IUVA 3ZWLB 3I89A 1MG3A 4XYHA 4ES0A 4OZUA 1XKSA 2PM6B 3F3PA 3DXMC 4FWWA 4LGNA 1Q47A 3OTTA 3PXTD 3VGZA 3JZGA 3CFVA 5EMLB 3V7DB 2PM9B 4PSXB 2HESX 1ERJA 3BG0A 3PE7A 4O3UB 3I7HA 2BCJB 4ZOXA 1R5MA 1B9YA 4YVDA 3MXXA 3SBPA 3JZHA 5HE3B 3I7PA 2IWFA 2B5LA 3EI1B 4BL0A 5EMMB 4L3HD 3JAMg 1S4UX 2Z2PA 3IJ0A 2Q7QA 2B4EA 3L4OD 3MMYA 2AGXA 5K1CC 3MZKA 4ERYA 4A11A 1MDAH 4CI8A 3HFQA 4L1QD 3FM0A 2IURA 3ORVD 2H47A 4J0XA 4U7AA 4GQ1A 5AMSA 2H13A 5EAMA 5GSAA 3IKOA 5EARA 1TYQC 4A0BA 3I2NA 3RFHA 3I8CA 3RLMD 1PEVA 2OK6A 2Z2OA 1N6DA 2HXCA 1NR0A 3AFCA 5SXMA 4GGDA 3I8EA 3UVLA 4J79A 4D0KA 1XHMA 5IGOA 4O9DA 5EAPA 4CI2A 5I5JA 5IT9g 4I79A 3VH0A 3E0CA 3OL2B 2XYIA 5HE1B 4XEIC 3UKRC 2QC5A 3SFZA 5EM2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C99 A;  1JOF A;  2PM9 A;  3RFG A;  4JSV C;  3IJ1 A;  4D6V A;  2AH1 A;  3DXK C;  5FLX g;  4CY3 A;  3PVU B;  5AFU 3;  4O3T B;  2YNP A;  4J86 A;  4Y5R D;  1SQJ A;  4A11 B;  5B4W A;  3IIW A;  3I7K A;  4J84 A;  4J78 A;  3EI1 A;  4A08 B;  3NVX A;  5C2W B;  2P9U C;  5FKR A;  2P9N C;  4IMM A;  3DM0 A;  3PSC B;  2YNO A;  2P9P C;  4L9O A;  3SJL D;  2H3X A;  3MKS B;  4Y7R A;  1VYH C;  3OKY B;  5CYK B;  4JSX C;  4CY2 A;  3PXW D;  4E54 B;  4FB1 D;  5I5M A;  2OK4 A;  2H6K A;  3RRM C;  4XYI A;  3EG6 A;  4MK0 B;  5FA5 B;  3OKT A;  1K8K C;  3I7O A;  3UVM A;  2W18 A;  4QL1 A;  4BUJ C;  2GC4 A;  4ZOV A;  5HE0 B;  5H1M A;  3GRE A;  2H68 A;  3N0E A;  4ZOZ A;  3EI3 B;  4GGC A;  5IGQ A;  2AGZ A;  5TEF A;  4TZ4 A;  2AH0 A;  3V5W B;  4A09 B;  5IJ7 E;  3OL2 A;  5K19 A;  4A2L A;  3A0F A;  2XL2 A;  4CZV A;  2XL3 A;  4FA1 D;  5EM2 A;  1MG2 A;  4K3J B;  3P4F A;  4JXM A;  2GC7 A;  4PSW B;  4J8G A;  3NVN A;  5IC7 A;  4KFM B;  3L4M D;  1U4C A;  4EWR A;  3C75 H;  3VA6 A;  4A08 A;  2YNN A;  2HJB A;  4CY1 A;  4GM8 A;  3EI2 B;  2P9I C;  2TRC B;  5KDO B;  3CIK B;  4QRJ A;  3GFC A;  3JZN A;  3RSE C;  4GQ2 P;  3MZL A;  3SWS D;  2HKM A;  5H17 A;  4ERZ A;  2PM7 B;  2H6Q A;  1N6E A;  2QXV A;  2B5N A;  3C5M A;  3OKY A;  5CYK A;  3IJC A;  3MKQ A;  3J81 g;  4PBZ A;  3SBQ A;  3N0D A;  4E54 A;  2H14 A;  3BG1 A;  4G56 B;  4GQB B;  4X60 B;  1GXR A;  4GMB A;  4R7A B;  2OJY A;  1GP2 B;  1FWX A;  2J57 G;  1N6F A;  4ESG A;  1GG2 B;  3BWS A;  5CXC A;  2AGL A;  4CZX A;  3KRW B;  3RN1 D;  4GM3 A;  3RN0 D;  4JD2 C;  3EI3 A;  5IJ8 E;  4UI9 R;  4FA9 D;  4GM9 A;  1JMX B;  1OMW B;  4A09 A;  4QT8 A;  3UVN A;  4FAN D;  2AGW A;  4J87 A;  4E5Z B;  3F3F A;  4PXW A;  5A2Q g;  1SQ9 A;  2I3S A;  4QQE A;  2H9L A;  4A0A B;  3K26 A;  1RI6 A;  2P9L C;  1GOT B;  4AEZ A;  4FHL A;  4Z8L A;  3SLE D;  2GNQ A;  3K27 A;  3SCY A;  4X3E A;  3RMZ D;  4CY5 A;  4JT5 C;  3DSM A;  3JB9 L;  3EI2 A;  5TDH B;  2O9K A;  2CN3 A;  3I7N A;  2CN2 A;  2OVP B;  4H5I A;  4U1E I;  3V9F A;  3UVK A;  2EBS A;  3OKW A;  5CXC B;  2OVQ B;  3UKU C;  2YMU A;  2IUP A;  5HYN B;  4JSN C;  3NVQ A;  3SVW D;  5JWZ A;  5EMJ B;  4O45 A;  3IIY A;  1U2V C;  2CNX A;  5H14 A;  1P22 A;  3UVO A;  2H9P A;  3SBR A;  1L0Q A;  4X61 B;  1PBY B;  5FQD A;  4CI3 A;  3JPX A;  3U4Y A;  5GMK n;  5HE2 B;  5GXI A;  2HYE A;  2P9S C;  4LG8 A;  2H9M A;  3FGB A;  4OWR A;  2G99 A;  3F3G A;  3B7F A;  2I0T A;  4JT6 C;  1XIP A;  4PBY A;  2UZX B;  3EMH A;  2I3T A;  4H5J A;  2B5M A;  1JMZ B;  4LG9 A;  4E5Z A;  2Z2N A;  3C9C A;  3EI4 B;  3I7L A;  2IUQ A;  4J77 A;  2AGY A;  1QNI A;  4A0A A;  2PBI B;  4FA4 D;  4AOW A;  3OW8 A;  2YB8 B;  4N14 A;  2I0R A;  1A0R B;  3AH8 B;  4PC0 A;  5CXB B;  1K32 A;  4X63 B;  3AL9 A;  4CZY A;  5FXY A;  5FKT A;  3AL8 B;  1SHY B;  3FRX A;  4BH6 A;  4O1Q D;  1PGU A;  5FKS A;  4FA5 D;  4CC9 A;  4ZN4 A;  2OIZ A;  3DWL C;  4ZOY A;  2MTA H;  2AQ5 A;  5HQG A;  2I0S A;  2J55 H;  4HDJ A;  4L3G D;  1B9X A;  4A2M A;  3JRO A;  2HKR A;  4IA9 A;  5AJA A;  4J0W A;  4ERQ A;  3PVW B;  3CFS B;  2CO0 C;  2CE9 A;  5C2V B;  3EU7 A;  1OLZ A;  3SHF A;  2BBK H;  2CE8 A;  5THA A;  4JSP C;  5TF2 A;  2P9K C;  3SXT D;  4K3I D;  5EMK B;  3KRX B;  2G9A A;  2OVR B;  5GXH A;  1TBG A;  2IAA A;  2J56 H;  4A7J A;  1PI6 A;  3ODT A;  1NEX B;  4J8B A;  4NSX A;  4PNK B;  3SN6 B;  2H9N A;  2YBA A;  3EWE A;  4J81 A;  3EI4 A;  4GGA A;  4J82 A;  3W15 A;  2XU7 A;  5FKQ A;  1JJU B;  4FAV D;  5C9Z B;  2UZY B;  5TEE A;  3UR4 A;  4J73 A;  5EAL A;  4GZ8 A;  1YFQ A;  4A0B B;  5CXB A;  2HJ4 A;  4CI1 A;  2IWK A;  3ULE C;  5I5I A;  3PXS D;  3PSL A;  3JRP A;  2CO0 A;  3J80 g;  3AL8 A;  2H6N A;  3SMR A;  2IUV A;  3ZWL B;  3I89 A;  1MG3 A;  4XYH A;  4ES0 A;  4OZU A;  1XKS A;  2PM6 B;  3F3P A;  3DXM C;  4FWW A;  4LGN A;  1Q47 A;  3OTT A;  3PXT D;  3VGZ A;  3JZG A;  3CFV A;  5EML B;  3V7D B;  2PM9 B;  4PSX B;  2HES X;  1ERJ A;  3BG0 A;  3PE7 A;  4O3U B;  3I7H A;  2BCJ B;  4ZOX A;  1R5M A;  1B9Y A;  4YVD A;  3MXX A;  3SBP A;  3JZH A;  5HE3 B;  3I7P A;  2IWF A;  2B5L A;  3EI1 B;  4BL0 A;  5EMM B;  4L3H D;  3JAM g;  1S4U X;  2Z2P A;  3IJ0 A;  2Q7Q A;  2B4E A;  3L4O D;  3MMY A;  2AGX A;  5K1C C;  3MZK A;  4ERY A;  4A11 A;  1MDA H;  4CI8 A;  3HFQ A;  4L1Q D;  3FM0 A;  2IUR A;  3ORV D;  2H47 A;  4J0X A;  4U7A A;  4GQ1 A;  5AMS A;  2H13 A;  5EAM A;  5GSA A;  3IKO A;  5EAR A;  1TYQ C;  4A0B A;  3I2N A;  3RFH A;  3I8C A;  3RLM D;  1PEV A;  2OK6 A;  2Z2O A;  1N6D A;  2HXC A;  1NR0 A;  3AFC A;  5SXM A;  4GGD A;  3I8E A;  3UVL A;  4J79 A;  4D0K A;  1XHM A;  5IGO A;  4O9D A;  5EAP A;  4CI2 A;  5I5J A;  5IT9 g;  4I79 A;  3VH0 A;  3E0C A;  3OL2 B;  2XYI A;  5HE1 B;  4XEI C;  3UKR C;  2QC5 A;  3SFZ A;  5EM2 B; 
#chains in the Genus database with same CATH topology
 2VDL A;  3C99 A;  1JOF A;  1VZ2 A;  2PM9 A;  2XDW A;  3RFG A;  5M61 A;  1H2X A;  4JSV C;  3IJ1 A;  4MMX A;  4D6V A;  2AH1 A;  3DXK C;  4G1E A;  5FLX g;  4CY3 A;  3PVU B;  4DNU A;  3GD1 I;  5AFU 3;  4O3T B;  2YNP A;  2JKX A;  3O4G A;  4J86 A;  4Y5R D;  5M5S A;  3NIF A;  1SQJ A;  4A11 B;  5B4W A;  3IIW A;  3I7K A;  4J84 A;  4J78 A;  4WK0 A;  3EI1 A;  3IJE A;  3GC3 B;  4A08 B;  3NVX A;  4AN0 A;  5C2W B;  2P9U C;  5FKR A;  2P9N C;  4IMM A;  3DM0 A;  3PSC B;  2YNO A;  2P9P C;  2VDP A;  1O6F A;  4L9O A;  3SJL D;  1O6G A;  2H3X A;  3MKS B;  4Y7R A;  1VYH C;  3OKY B;  5CYK B;  4JSX C;  4CY2 A;  1T2X A;  3PXW D;  4E54 B;  4FB1 D;  5I5M A;  2OK4 A;  5M5T A;  2H6K A;  3RRM C;  4XYI A;  4NBM A;  3EG6 A;  4MMY A;  4MK0 B;  1UOP A;  5FA5 B;  3OKT A;  1L5G A;  1JTD B;  1K8K C;  3I7O A;  3UVM A;  2W18 A;  4QL1 A;  3O4H A;  4BUJ C;  2GC4 A;  4ZOV A;  5HE0 B;  3ZE1 A;  1E5T A;  3IUL A;  2VDM A;  5H1M A;  4WK4 A;  3GRE A;  2H68 A;  3K72 A;  3N0E A;  3VI3 A;  4ZOZ A;  3EI3 B;  4L1M A;  4GGC A;  5IGQ A;  2AGZ A;  5TEF A;  4AMZ A;  4TZ4 A;  2AH0 A;  3V5W B;  4A09 B;  5IJ7 E;  3OL2 A;  5K19 A;  4A2L A;  3K6S A;  3A0F A;  2XL2 A;  2XE4 A;  4CZV A;  2XL3 A;  3T3M A;  4FA1 D;  5EM2 A;  1MG2 A;  2QZP A;  4O2W A;  4K3J B;  3P4F A;  5M5U A;  4JXM A;  2GC7 A;  3OF7 A;  4PSW B;  4J8G A;  3NVN A;  1JV2 A;  5IC7 A;  1GOH A;  4KFM B;  3L4M D;  1U4C A;  4EWR A;  1VE6 A;  3C75 H;  3VA6 A;  4A08 A;  2YNN A;  5E6R A;  2HJB A;  4CY1 A;  1YR2 A;  4GM8 A;  3EI2 B;  2P9I C;  2TRC B;  5KDO B;  3CIK B;  4QRJ A;  3GFC A;  3JZN A;  4JHP C;  1UOO A;  3RSE C;  4GQ2 P;  3MZL A;  3SWS D;  2HKM A;  5H17 A;  4ERZ A;  2VDN A;  2PM7 B;  2EIE A;  2H6Q A;  2EID A;  1N6E A;  2QXV A;  2B5N A;  3C5M A;  2HU5 A;  3OKY A;  5CYK A;  3IJC A;  3MKQ A;  3J81 g;  4PBZ A;  3SBQ A;  3N0D A;  4E54 A;  2H14 A;  3BG1 A;  4G56 B;  4GQB B;  4X60 B;  3K71 A;  4BCB A;  1GXR A;  4GMB A;  4R7A B;  3QI0 A;  2OJY A;  1GP2 B;  1FWX A;  2J57 G;  1N6F A;  3IUQ A;  1GG2 B;  3BWS A;  4O02 A;  4ESG A;  1U8C A;  5CXC A;  2AGL A;  4CZX A;  3NID A;  4RE6 A;  3KRW B;  2VDK A;  3RN1 D;  4GM3 A;  3RN0 D;  4JD2 C;  4QAM A;  3EI3 A;  5IJ8 E;  4BCC A;  4UI9 R;  4FA9 D;  4GM9 A;  1JMX B;  1OMW B;  3IUN A;  4A09 A;  4QT8 A;  3UVN A;  4FAN D;  2AGW A;  2VC2 A;  1VZ3 A;  5E6U A;  4J87 A;  4E5Z B;  1QFM A;  3F3F A;  4BP9 A;  4PXW A;  3V4V A;  2VZ3 A;  5FFO A;  5A2Q g;  1SQ9 A;  2I3S A;  3FCU A;  4QQE A;  2H9L A;  1QFS A;  4A0A B;  3K26 A;  5M5R A;  1RI6 A;  1GOF A;  2P9L C;  1GOT B;  4AEZ A;  4FHL A;  4Z8L A;  3SLE D;  2GNQ A;  3K27 A;  3SCY A;  1C9L A;  4X3E A;  3RMZ D;  4CY5 A;  4JT5 C;  3DSM A;  3JB9 L;  3EI2 A;  5TDH B;  3KCI A;  4UM9 A;  3O4J A;  2O9K A;  2CN3 A;  3I7N A;  1UTC A;  2CN2 A;  2OVP B;  4H5I A;  4U1E I;  4AMY A;  2WQ8 A;  3V9F A;  3UVK A;  2EBS A;  3FCS A;  3OKW A;  5CXC B;  2OVQ B;  3UKU C;  2YMU A;  2IUP A;  5HYN B;  1A12 A;  4JSN C;  3NVQ A;  3SVW D;  5JWZ A;  5EMJ B;  4O45 A;  3IIY A;  1U2V C;  2CNX A;  5H14 A;  1P22 A;  2HU7 A;  3UVO A;  2H9P A;  3SBR A;  1L0Q A;  4X61 B;  1PBY B;  5FQD A;  4CI3 A;  3JPX A;  3U4Y A;  5GMK n;  5HE2 B;  1E8N A;  3ZE2 A;  5GXI A;  2HYE A;  2P9S C;  4G55 A;  4LG8 A;  2H9M A;  3FGB A;  4OWR A;  2G99 A;  3F3G A;  3B7F A;  2I0T A;  4JT6 C;  1XIP A;  4PBY A;  2UZX B;  3EMH A;  2I3T A;  4MMZ A;  2VDQ A;  4H5J A;  2B5M A;  1JMZ B;  4LG9 A;  4E5Z A;  2HU8 A;  2Z2N A;  4WK2 A;  3C9C A;  3EI4 B;  3I7L A;  3QHY B;  2IUQ A;  4J77 A;  2AGY A;  1QNI A;  1I2M B;  4UM8 A;  3ZDY A;  3IUM A;  4A0A A;  2PBI B;  4FA4 D;  4AOW A;  3OW8 A;  2YB8 B;  4N14 A;  2I0R A;  1A0R B;  3AH8 B;  4PC0 A;  5CXB B;  1K32 A;  4X63 B;  3AL9 A;  4CZY A;  5FXY A;  5FKT A;  3AL8 B;  1SHY B;  3FRX A;  3IVM A;  4AX4 A;  3ZDZ A;  4BH6 A;  4O1Q D;  1PGU A;  3NIG A;  1BPO A;  5FKS A;  4FA5 D;  4CC9 A;  4ZN4 A;  2OIZ A;  3DWL C;  4ZOY A;  2MTA H;  2AQ5 A;  5HQG A;  2I0S A;  2J55 H;  4HDJ A;  4L3G D;  1B9X A;  4A2M A;  3JRO A;  2HKR A;  4IA9 A;  5AJA A;  4J0W A;  4ERQ A;  3PVW B;  3CFS B;  2CO0 C;  4NC4 A;  2CE9 A;  5C2V B;  3EU7 A;  3V4P A;  1OLZ A;  3O4I A;  3SHF A;  2BBK H;  2CE8 A;  5THA A;  4JSP C;  5TF2 A;  3EQ7 A;  2P9K C;  3MVD K;  3SXT D;  5C86 A;  4K3I D;  5EMK B;  5E6S A;  3KRX B;  2G9A A;  2OVR B;  5GXH A;  1TBG A;  2IAA A;  2VDO A;  2J56 H;  1E8M A;  4A7J A;  1PI6 A;  3ODT A;  1NEX B;  4J8B A;  4WJK A;  4NSX A;  4PNK B;  4NEN A;  3SN6 B;  2H9N A;  2YBA A;  3EWE A;  4J81 A;  3EI4 A;  4GGA A;  4J82 A;  3W15 A;  2XU7 A;  5FKQ A;  1JJU B;  4FAV D;  5C9Z B;  2UZY B;  4NAA A;  5TEE A;  3UR4 A;  4J73 A;  5EAL A;  4GZ8 A;  1YFQ A;  4A0B B;  5CXB A;  2HJ4 A;  4CI1 A;  2IWK A;  3ULE C;  5I5I A;  3PXS D;  3PSL A;  3JRP A;  2CO0 A;  3J80 g;  3AL8 A;  2H6N A;  3SMR A;  4DNW A;  2IUV A;  2BKL A;  3ZDX A;  3I89 A;  3ZWL B;  4IRZ A;  1MG3 A;  5M5V A;  4AN1 A;  4XYH A;  4JHN A;  4ES0 A;  4OZU A;  1XKS A;  2PM6 B;  3F3P A;  3DXM C;  4FWW A;  4LGN A;  1Q47 A;  4G1M A;  3OTT A;  3PXT D;  3VGZ A;  3JZG A;  3CFV A;  5EML B;  3ZE0 A;  3V7D B;  2PM9 B;  4PSX B;  1H2W A;  2HES X;  1ERJ A;  3BG0 A;  3PE7 A;  3IUR A;  4O3U B;  3I7H A;  2BCJ B;  4ZOX A;  1R5M A;  2VDR A;  3MUO A;  1B9Y A;  4YVD A;  3MXX A;  3SBP A;  3JZH A;  5HE3 B;  3I7P A;  2IWF A;  2B5L A;  3EI1 B;  4BL0 A;  5EMM B;  2QR5 A;  4L3H D;  3JAM g;  1C9I A;  3T3P A;  1S4U X;  1VE7 A;  2Z2P A;  1H2Z A;  3IJ0 A;  2Q7Q A;  2B4E A;  3L4O D;  3MMY A;  2AGX A;  1H2Y A;  5K1C C;  3VI4 A;  3MZK A;  4ERY A;  4A11 A;  4D9S A;  4DNV A;  1MDA H;  3EQ9 A;  4BCD A;  4CI8 A;  3HFQ A;  2XZG A;  4L1Q D;  1K3I A;  3FM0 A;  2IUR A;  5HDB A;  3ORV D;  2H47 A;  4J0X A;  2EIC A;  4U7A A;  4GQ1 A;  5AMS A;  2H13 A;  5EAM A;  4Z7N A;  5GSA A;  3IKO A;  5EAR A;  1TYQ C;  4A0B A;  3I2N A;  3RFH A;  3I8C A;  3RLM D;  1PEV A;  3IUJ A;  2OK6 A;  2VZ1 A;  2Z2O A;  1N6D A;  2HXC A;  5FFG A;  3EQ8 A;  5C92 A;  1NR0 A;  1TYE A;  3AFC A;  5SXM A;  1M1X A;  4GGD A;  3DDU A;  3I8E A;  3UVL A;  4J79 A;  4D0K A;  1XHM A;  5IGO A;  1UOQ A;  4O9D A;  4Z7Q A;  5EAP A;  4Z7O A;  4CI2 A;  5I5J A;  5IT9 g;  1GOG A;  4I79 A;  4RE5 A;  3VH0 A;  3MUN A;  3E0C A;  3OL2 B;  2XYI A;  5HE1 B;  4XEI C;  3UKR C;  2EIB A;  2QC5 A;  3SFZ A;  5EM2 B;  4BP8 A; 
#chains in the Genus database with same CATH homology
 3C99 A;  1JOF A;  2PM9 A;  3RFG A;  4JSV C;  3IJ1 A;  4D6V A;  2AH1 A;  3DXK C;  5FLX g;  4CY3 A;  3PVU B;  5AFU 3;  4O3T B;  2YNP A;  4J86 A;  4Y5R D;  1SQJ A;  4A11 B;  5B4W A;  3IIW A;  3I7K A;  4J84 A;  4J78 A;  3EI1 A;  4A08 B;  3NVX A;  5C2W B;  2P9U C;  5FKR A;  2P9N C;  4IMM A;  3DM0 A;  3PSC B;  2YNO A;  2P9P C;  4L9O A;  3SJL D;  2H3X A;  3MKS B;  4Y7R A;  1VYH C;  3OKY B;  5CYK B;  4JSX C;  4CY2 A;  3PXW D;  4E54 B;  4FB1 D;  5I5M A;  2OK4 A;  2H6K A;  3RRM C;  4XYI A;  3EG6 A;  4MK0 B;  5FA5 B;  3OKT A;  1K8K C;  3I7O A;  3UVM A;  2W18 A;  4QL1 A;  4BUJ C;  2GC4 A;  4ZOV A;  5HE0 B;  5H1M A;  3GRE A;  2H68 A;  3N0E A;  4ZOZ A;  3EI3 B;  4GGC A;  5IGQ A;  2AGZ A;  5TEF A;  4TZ4 A;  2AH0 A;  3V5W B;  4A09 B;  5IJ7 E;  3OL2 A;  5K19 A;  4A2L A;  3A0F A;  2XL2 A;  4CZV A;  2XL3 A;  4FA1 D;  5EM2 A;  1MG2 A;  4K3J B;  3P4F A;  4JXM A;  2GC7 A;  4PSW B;  4J8G A;  3NVN A;  5IC7 A;  4KFM B;  3L4M D;  1U4C A;  4EWR A;  3C75 H;  3VA6 A;  4A08 A;  2YNN A;  2HJB A;  4CY1 A;  4GM8 A;  3EI2 B;  2P9I C;  2TRC B;  5KDO B;  3CIK B;  4QRJ A;  3GFC A;  3JZN A;  3RSE C;  4GQ2 P;  3MZL A;  3SWS D;  2HKM A;  5H17 A;  4ERZ A;  2PM7 B;  2H6Q A;  1N6E A;  2QXV A;  2B5N A;  3C5M A;  3OKY A;  5CYK A;  3IJC A;  3MKQ A;  3J81 g;  4PBZ A;  3SBQ A;  3N0D A;  4E54 A;  2H14 A;  3BG1 A;  4G56 B;  4GQB B;  4X60 B;  1GXR A;  4GMB A;  4R7A B;  2OJY A;  1GP2 B;  1FWX A;  2J57 G;  1N6F A;  4ESG A;  1GG2 B;  3BWS A;  5CXC A;  2AGL A;  4CZX A;  3KRW B;  3RN1 D;  4GM3 A;  3RN0 D;  4JD2 C;  3EI3 A;  5IJ8 E;  4UI9 R;  4FA9 D;  4GM9 A;  1JMX B;  1OMW B;  4A09 A;  4QT8 A;  3UVN A;  4FAN D;  2AGW A;  4J87 A;  4E5Z B;  3F3F A;  4PXW A;  5A2Q g;  1SQ9 A;  2I3S A;  4QQE A;  2H9L A;  4A0A B;  3K26 A;  1RI6 A;  2P9L C;  1GOT B;  4AEZ A;  4FHL A;  4Z8L A;  3SLE D;  2GNQ A;  3K27 A;  3SCY A;  4X3E A;  3RMZ D;  4CY5 A;  4JT5 C;  3DSM A;  3JB9 L;  3EI2 A;  5TDH B;  2O9K A;  2CN3 A;  3I7N A;  2CN2 A;  2OVP B;  4H5I A;  4U1E I;  3V9F A;  3UVK A;  2EBS A;  3OKW A;  5CXC B;  2OVQ B;  3UKU C;  2YMU A;  2IUP A;  5HYN B;  4JSN C;  3NVQ A;  3SVW D;  5JWZ A;  5EMJ B;  4O45 A;  3IIY A;  1U2V C;  2CNX A;  5H14 A;  1P22 A;  3UVO A;  2H9P A;  3SBR A;  1L0Q A;  4X61 B;  1PBY B;  5FQD A;  4CI3 A;  3JPX A;  3U4Y A;  5GMK n;  5HE2 B;  5GXI A;  2HYE A;  2P9S C;  4LG8 A;  2H9M A;  3FGB A;  4OWR A;  2G99 A;  3F3G A;  3B7F A;  2I0T A;  4JT6 C;  1XIP A;  4PBY A;  2UZX B;  3EMH A;  2I3T A;  4H5J A;  2B5M A;  1JMZ B;  4LG9 A;  4E5Z A;  2Z2N A;  3C9C A;  3EI4 B;  3I7L A;  2IUQ A;  4J77 A;  2AGY A;  1QNI A;  4A0A A;  2PBI B;  4FA4 D;  4AOW A;  3OW8 A;  2YB8 B;  4N14 A;  2I0R A;  1A0R B;  3AH8 B;  4PC0 A;  5CXB B;  1K32 A;  4X63 B;  3AL9 A;  4CZY A;  5FXY A;  5FKT A;  3AL8 B;  1SHY B;  3FRX A;  4BH6 A;  4O1Q D;  1PGU A;  5FKS A;  4FA5 D;  4CC9 A;  4ZN4 A;  2OIZ A;  3DWL C;  4ZOY A;  2MTA H;  2AQ5 A;  5HQG A;  2I0S A;  2J55 H;  4HDJ A;  4L3G D;  1B9X A;  4A2M A;  3JRO A;  2HKR A;  4IA9 A;  5AJA A;  4J0W A;  4ERQ A;  3PVW B;  3CFS B;  2CO0 C;  2CE9 A;  5C2V B;  3EU7 A;  1OLZ A;  3SHF A;  2BBK H;  2CE8 A;  5THA A;  4JSP C;  5TF2 A;  2P9K C;  3SXT D;  4K3I D;  5EMK B;  3KRX B;  2G9A A;  2OVR B;  5GXH A;  1TBG A;  2IAA A;  2J56 H;  4A7J A;  1PI6 A;  3ODT A;  1NEX B;  4J8B A;  4NSX A;  4PNK B;  3SN6 B;  2H9N A;  2YBA A;  3EWE A;  4J81 A;  3EI4 A;  4GGA A;  4J82 A;  3W15 A;  2XU7 A;  5FKQ A;  1JJU B;  4FAV D;  5C9Z B;  2UZY B;  5TEE A;  3UR4 A;  4J73 A;  5EAL A;  4GZ8 A;  1YFQ A;  4A0B B;  5CXB A;  2HJ4 A;  4CI1 A;  2IWK A;  3ULE C;  5I5I A;  3PXS D;  3PSL A;  3JRP A;  2CO0 A;  3J80 g;  3AL8 A;  2H6N A;  3SMR A;  2IUV A;  3ZWL B;  3I89 A;  1MG3 A;  4XYH A;  4ES0 A;  4OZU A;  1XKS A;  2PM6 B;  3F3P A;  3DXM C;  4FWW A;  4LGN A;  1Q47 A;  3OTT A;  3PXT D;  3VGZ A;  3JZG A;  3CFV A;  5EML B;  3V7D B;  2PM9 B;  4PSX B;  2HES X;  1ERJ A;  3BG0 A;  3PE7 A;  4O3U B;  3I7H A;  2BCJ B;  4ZOX A;  1R5M A;  1B9Y A;  4YVD A;  3MXX A;  3SBP A;  3JZH A;  5HE3 B;  3I7P A;  2IWF A;  2B5L A;  3EI1 B;  4BL0 A;  5EMM B;  4L3H D;  3JAM g;  1S4U X;  2Z2P A;  3IJ0 A;  2Q7Q A;  2B4E A;  3L4O D;  3MMY A;  2AGX A;  5K1C C;  3MZK A;  4ERY A;  4A11 A;  1MDA H;  4CI8 A;  3HFQ A;  4L1Q D;  3FM0 A;  2IUR A;  3ORV D;  2H47 A;  4J0X A;  4U7A A;  4GQ1 A;  5AMS A;  2H13 A;  5EAM A;  5GSA A;  3IKO A;  5EAR A;  1TYQ C;  4A0B A;  3I2N A;  3RFH A;  3I8C A;  3RLM D;  1PEV A;  2OK6 A;  2Z2O A;  1N6D A;  2HXC A;  1NR0 A;  3AFC A;  5SXM A;  4GGD A;  3I8E A;  3UVL A;  4J79 A;  4D0K A;  1XHM A;  5IGO A;  4O9D A;  5EAP A;  4CI2 A;  5I5J A;  5IT9 g;  4I79 A;  3VH0 A;  3E0C A;  3OL2 B;  2XYI A;  5HE1 B;  4XEI C;  3UKR C;  2QC5 A;  3SFZ A;  5EM2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...