4X62E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x62E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x62E02
1N36E 1EI1A 1EKZA 4B3SI 1FKAE 1UHZA 4DR7E 4OX9E 1J5EI 4DV5E 3LNUA 3K1JA 4B3RI 4DV6I 1IBKI 2UUCI 4RPFA 1IBME 1HNWI 2VQFI 1NZ0A 4X66E 3OTOE 4LF8E 4YY3I 1NHIA 2Q2EB 4DV4E 4DV1I 3J81Q 4USKA 1Z0WA 4NXME 1XNQE 4B3MI 4YHHE 4LF5E 2UU9E 1T4LB 2V2ZA 1O0WA 4DR2E 1PVGA 4KQVA 1Z0TA 4DPTA 3PYFA 3WU5A 4JV5E 3B78A 3ZM7A 4JI5I 2RTXA 3ZKDA 3PYEA 2NUEA 1N32I 4DR5E 4DU8A 1MX0A 5L3JA 1YZ9A 5BR8E 2AJ4A 3T1HI 2LBSB 2ZM6I 2UUBI 3K17A 5GMDA 1Z5BA 4AQYE 4JYAE 2VQEI 1YYKA 2E1RA 1PKPA 4M2ZA 1XNRI 2LJHA 4M30A 4DV2I 1IBLI 2R42A 2NA2A 3B8HA 4UTGA 2HKJA 1J5EE 4P52A 5LMNE 5FLXC 3C4TA 4B3RE 4DV6E 1KVKA 1IBKE 2UUCE 4JI7I 2VQFE 4JI3I 1NHHA 4DUZI 1WHQA 4FW9A 1MU5A 2NUFA 4WYQB 4FWDA 4Z7YA 3JAMQ 5IWAI 3ADJA 2L2KB 1UILA 3C4BA 4JI2I 1NHJA 2MDRA 4B3ME 4B3TI 3QT8A 4LF4I 3J7AM 2EFGA 3ADGA 3T1YI 4JI5E 4DU7A 3J81C 4LF6I 2E5LI 1HNXI 3F0NA 1N32E 2CZ9A 4JI0I 2RS7A 3J7Yp 4DV3I 2X7IA 1S16A 1Z0VA 2IHR1 4X8WA 4DV7I 4DR3I 1XHKA 2ZM6E 2CPNA 1BKNA 4WFTA 4X62I 1H74A 5LMUI 2UUAI 1ZM2A 4DV0E 2JVAA 3QT5A 5IT9Q 1XNRE 2ZITA 4DPWA 1RC7A 4XTJA 2GS8A 2LTRA 2DMYA 1EA6A 1IBLE 1S4EA 2DB2A 2HHHI 2OI2A 2LJPA 4JI7E 1Z5AA 2DEIA 3PYDA 4DUZE 5IWAE 1Z0EA 2HK3A 2UXDE 2V2VA 2RSMA 4DR6I 4X65I 4B3TE 1Z0GA 1RQ0A 4JI8I 2VF3A 1KTVA 2N3GA 4LF4E 3JAMC 1N34I 4MYUA 4LFBI 4DR1E 4URLA 1ELOA 2ZBKB 4LF6E 1KIJA 2J7KA 4DUYI 4PU9A 2A2DA 4JI0E 4JI1E 3ZZTA 1RREA 4DV3E 2L33A 2HFSA 3P1XA 4DPYA 4DV7E 2YT4A 1QU6A 4DR3E 4USMA 2UXCI 4DXLA 1A6FA 4Z7CA 4B3SE 4LF9I 5A2QQ 4DR7I 3QT6A 5LMUE 2UUAE 1Z0BA 3V2UC 2NUGA 4I3HA 4P7AA 4JI6I 4JI4I 1HNWE 1IBMI 4X64I 1QZRA 4HACB 3OTOI 4YY3E 3D4JA 1VISA 4DR4I 4LFCI 1T4OA 2LUPB 2BM1A 4HXZA 4DV1E 4DV4I 2HHHE 4NXMI 1XNQI 2L3CA 1X48A 1Z5CA 4GKKI 1H7UA 4ZVIA 1YYOA 1I94I 1J26A 1DI2A 2F4VI 4JV5I 1DARA 1Z0CA 1D6TA 4HYMA 4DR6E 1PIEA 4R1FA 4X65E 4K0KI 5CFFE 3HTXA 5BR8I 3LPSA 1KKHA 3T1HE 4FN5A 1N34E 2UUBE 3WU3A 4LFBE 2EZ6A 4EMDA 2HK2A 1X49A 2KHXA 4KHPI 4LFAI 4MYTA 2VQEE 2HKEA 4DKKA 1OJ4A 3PYGA 4M1KA 3M6AA 4DV2E 1U2RA 3LTOA 1RR9A 2V8PA 1GQEA 2N3HA 4LF9E 1STUA 2R3VA 1UEKA 4LF7I 2WW4A 5LMNI 1X47A 3V5RA 4JI6E 4JI4E 4NXNI 4JI3E 3ZZ0A 4X64E 1B63A 3B82A 3J80Q 5A2QC 1HR0I 4DR4E 4LFCE 2L3JA 4JI2E 1H73A 5GMEA 3VYXA 1YYWA 2RS6A 3ZZUA 2JY9A 1K47A 1FJGI 4GKKE 1FI4A 2X36A 4HACA 4HY1A 1I94E 4UT4A 3T1YE 4GKJI 2F4VE 2E5LE 3QT7A 2L2MA 1HNXE 4DPUA 4WUDA 1HNZI 1N33I 4K0KE 1ZM4A 2UXBI 3ADLA 2B7TA 1XMQI 1XMOI 2B3TB 1B62A 4JG4A 4WUBA 1N36I 5LL6R 4X62E 4OX9I 2DEJA 1WUUA 4KHPE 4DV5I 4LFAE 1N0VC 3GONA 4DV0I 2LRSA 1N0UA 2DIXA 1ZM9A 4X66I 3ADIA 4LF8I 3WU4A 1H7SA 4LF7E 1Z59A 5IT9C 1MG7A 4YHHI 4ED4A 4LF5I 4DPXA 3Q1QA 2UU9I 4NXNE 4DR2I 2XEXA 2V2QA 4FWHA 1ZXMA 2BV3A 1HR0E 1H72C 3VYYA 4WUCA 3HULA 4DR5I 2UXDI 2NPFA 3CWVA 1FJGE 4JI8E 3LLHA 2HFUA 3J80C 3ZKBA 2L2NA 2LTSA 1T4NA 1FWKA 3WU6A 1ZM3A 4GKJE 4DR1I 4DUYE 4PRXA 1HNZE 2BM0A 4PRVA 2LUQA 4FWGA 1FNMA 1FWLA 1N33E 3H4LA 4JI1I 2V34A 4AQYI 4JYAI 5FLXQ 2UXBE 2B7VA 3J7AG 1XMQE 1WHNA 4OOGC 2A2CA 1XMOE 2UXCE 1ZXNA 1ZBTA
chains in the Genus database with same CATH superfamily
4BA2B 2LJUA 4R2PA 1N36E 1EKZA 1EI1A 2PNMA 1FKAE 1UHZA 4B3SI 2JOXA 2WBUA 2EPPA 2EN8A 4OX9E 4DR7E 1J5EI 4DV5E 3LNUA 3K1JA 5JEAF 2JR1A 4B3RI 1BB8A 5IXMB 5JEAA 2EM3A 4DV6I 1IBKI 2UUCI 4RPFA 1IBME 2ENCA 2CG9A 1HNWI 2VQFI 4O24A 1NZ0A 3U1KA 4X66E 4R2DA 2EOEA 4R03A 3OTOE 4LF8E 1MGTA 2EN6A 4F9CB 2C38A 5JEAC 4YY3I 4F6NA 1RMDA 1NHIA 2Q2EB 4DV4E 4R8OA 4DV1I 4M0VA 3J81Q 4USKA 5DRPA 1R6LA 1YUJA 2FV4B 2YTNA 4R2SA 4NXME 1Z0WA 1YFHA 1XNQE 4R2EA 4B3MI 2VE7C 4YHHE 1Y4SA 4LF5E 4Q35B 4BS9A 2EQ0A 2UU9E 1T4LB 1PJQA 2V2ZA 1O0WA 4DR2E 1PVGA 4KQVA 1Z0TA 3RMPA 4DPTA 3PYFA 2JEAA 3WU5A 3HKMA 2YTPA 1XXEA 2HJJA 2I9IA 4JV5E 1E3HA 3B78A 3GMEA 3ZM7A 4JI5I 2RTXA 2BB8A 3ZKDA 2YTJA 3MHHC 3PYEA 2NUEA 1N32I 4DR5E 3EPLA 1MX0A 4MU4A 4BC9A 4DU8A 2PNZA 5L3JA 2C39A 2DSYA 4OO1C 1YZ9A 4F9BB 2ADRA 2V89A 5K36B 5KL3A 2EP3A 3JTZA 5BR8E 3VK6A 2EN1A 1IMUA 3C6MA 5DRQA 1BBOA 1IQSA 4QNKA 2AJ4A 3T1HI 2BR2A 2NN6F 2LBSB 2ZM6I 5AC5A 2UUBI 3K17A 1A1LA 1T39A 4IS9A 2YRHA 2NN6A 5GMDA 2WNRA 1X3CA 2JPAA 1DQ3A 5EKWA 2LVHA 5FWKA 5K36D 2EMFA 1Z5BA 4MLQA 2GQ0A 4AQYE 4O5GA 4JYAE 2VQEI 2HGHA 2H36X 1YYKA 3M85G 2EPKX 4FW7A 5LLQA 3DJWA 2E1RA 1PKPA 4L8NA 3HPSA 4M2ZA 2LJHA 1XNRI 1WRJA 4M30A 3C6KA 2V83A 4DV2I 2G7HA 5JEAE 4J8ZA 1IBLI 2ODRC 2R42A 2NA2A 2Z5BA 4BBYA 2IOPA 3CDJA 3HJCA 2JP9A 3B8HA 4UTGA 2CT1A 2HKJA 4BCAA 1J5EE 4P52A 1X6FA 5FLXC 5LMNE 3DF6A 3C4TA 2JWOA 3F6GA 4B3RE 2ELZA 4DV6E 1KVKA 1IBKE 2UUCE 4JI7I 3BIDA 4F2JC 4WXCA 1F2IG 1IQOA 1ZBQA 2VQFE 4JI3I 1NHHA 4IZKB 4DUZI 1WHQA 2DLQA 1OYPA 4FW9A 2EM6A 4BA2A 1PDAA 1MU5A 2NUFA 4WYQB 4FWDA 4Z7YA 3JAMQ 5IWAI 4KWYA 1DGCA 3ADJA 5AE2A 2L2KB 1UILA 2V88A 3C4BA 4JI2I 1UBDC 2EOZA 1YSAC 1OYRA 1NHJA 2MDRA 4B3ME 2WP8B 4B3TI 2R76A 3PS3A 2RQLA 1X5WA 2EM5A 4BMJA 2PNLA 1UDNA 4QNJA 2V86A 2CSHA 3QT8A 4LF4I 3J7AM 5KL5A 2EFGA 2LO3A 3ADGA 2EMYA 3EPKA 4JI5E 3J81C 4N4RB 4DU7A 3T1YI 3U1YA 2E5LI 4LF6I 2D9HA 3TQMA 1HNXI 3UHMA 1GZ6A 3F0NA 1N32E 2CZ9A 1SR9A 4JI0I 5C0XB 2RS7A 1YUIA 3J7Yp 2NN6E 3OMLA 2X7IA 1S16A 4DV3I 1Z0VA 2GO4A 4U3BA 2IHR1 3HQ1A 4P7DA 4X8WA 2F1DA 1NEIA 4IZJB 4DV7I 4DR3I 1XHKA 2M7QA 2ZM6E 2A25A 3ZOQB 2CPNA 2EOHA 1BKNA 2YTEA 4WFTA 1B69A 4MU1A 2EMCA 4X62I 5K36F 1H74A 5LMUI 2UUAI 1A1IA 1A1FA 1ZM2A 4IZJD 5K36A 1G2FC 4DV0E 1ZAAC 2JVAA 2IESA 3QT5A 5IT9Q 1XNRE 4MDTA 4F6MA 2EPAA 2ZITA 2EPCA 1GTKA 4Q28A 4DPWA 3M85D 2YTGA 1RC7A 5K36C 4XTJA 2GS8A 2LTRA 2DMYA 1EA6A 1IBLE 1OYSA 1S4EA 3BF2A 5DNYA 2PO1B 5EL9A 4OKGA 1A1JA 3MHSC 3EPJA 2DB2A 2EM7A 2EL6A 2YSOA 1EH6A 2HHHI 2OI2A 3M7ND 2EM2A 2WBTA 1X6EA 2BA0G 5DROA 2EMZA 3IWBA 1AAYA 2LJPA 4R2RA 5TSEA 4JI7E 2CGEA 1Z5AA 2DEIA 4OO1B 3QG5C 3F6HA 3PYDA 4DUZE 1T38A 3P06A 2EOSA 2I13A 2GHFA 2NABA 1SFEA 5IWAE 2YRMA 1Z0EA 2LV2A 2HK3A 4FW5A 2UXDE 2V2VA 3P3EA 2GPIA 2RSMA 4DR6I 4X65I 4B3TE 1Z0GA 1RQ0A 3NZKA 4JI8I 5T6JA 5A6KA 2VF3A 2MKDA 2JT2A 1KTVA 2EN3A 4IZKA 2V8QB 1TN9A 2N3GA 4LF4E 3K85A 3M99B 3JAMC 4N3OA 1N34I 4MYUA 2EPXA 4LFBI 4DR1E 1Y6ZA 4URLA 2EOOA 1ELOA 2ZBKB 2V87A 4LF6E 1KIJA 2J7KA 2EOIA 4OZEA 4DUYI 4J3DA 4FK5C 4PU9A 2EMAA 2A2DA 3CDIA 2LMZA 2M4IA 4JI0E 2EJ4A 4LTYA 1YHCA 4JI1E 2WP8A 1JK2A 2O1UA 1RREA 4DV3E 2L33A 2NN6C 1RHYA 3ZZTA 2HFSA 2EMLA 3P1XA 4DPYA 2VESA 4DV7E 2YT4A 1QU6A 4GQUA 4DR3E 4DMIA 3GCMA 4BA1B 5K36E 4RH8A 4IFDB 4USMA 2C37A 4LOMA 4DXLA 2UXCI 4U3DA 1A6FA 2YTFA 5C0XF 4Z7CA 4B3SE 4LF9I 1A1KA 3KZYA 1MEYC 4AIMA 5A2QQ 5C0XA 2V85A 4DR7I 3QT6A 5A69A 3HPZA 5LMUE 2UUAE 1Z0BA 3V2UC 2NUGA 3GLLA 4I3HA 4P7AA 4MQYA 4JI6I 4JI4I 2CTDA 2JE6B 4IZJA 5DNLA 4IFDD 1HNWE 1IBMI 5A6JA 2EOJA 4ZYHA 3L7ZB 4X64I 1QZRA 1R6MA 5A6BD 4HACB 3OTOI 1KYQA 2EQ3A 4YY3E 2PO2B 3KRNA 4AIDA 4WXDA 3D4JA 1VISA 4DR4I 1EH7A 3P76A 1T4OA 2LUPB 2BM1A 4LFCI 4HXZA 4DV1E 4P78A 4DV4I 1ZU1A 2R1FA 2M1SA 2HHHE 2BA1G 2YU8A 2MDGA 1KJKA 4KZSA 4NXMI 4RHBB 2WCC3 1XNQI 2L3CA 4O43A 1X48A 1Z5CA 4GKKI 2VRDA 1H7UA 2BA0D 4LCFA 4ZVIA 1TF3A 2EPNA 2JOBA 1YYOA 2PO1A 2L8TA 3L00A 3H09A 1I94I 1J26A 3P3GA 1DI2A 2DRPA 2C37B 2F4VI 2YTIA 4JV5I 1DARA 1YPNA 1Z0CA 2EPOA 5KL2A 1D6TA 4HYMA 4DR6E 1PIEA 4R1FA 4ZYDA 4FW3A 4WSGA 4X65E 4K0KI 4NBQA 1ZR9A 5CFFE 5ADZA 5KL4A 3HTXA 5BR8I 3LPSA 1KKHA 3T1HE 4FN5A 1WXRA 4F54A 2EE8A 2EMWA 1N34E 2UUBE 2EL4A 4LFBE 4WSPA 4MU3A 3WU3A 5C0XD 2EZ6A 4EMDA 2HK2A 1X49A 2JYAA 1UDQA 2KHXA 1X6HA 1VI7A 4KHPI 2YSPA 2DLKA 2J65A 4LFAI 4MYTA 2Z5CB 2EOMA 3LMLA 2VQEE 4LU9A 3IWDA 4LCHA 2YTOA 2HKEA 2EOYA 4DKKA 5C0XE 1OJ4A 1Y5YA 3PYGA 4M1KA 3M6AA 3PS1A 4BHCA 4DV2E 1U2RA 3LTOA 1RR9A 5DNXA 2V8PA 4WPYA 4L5NC 1GQEA 4LPFA 2N3HA 2K4VA 3BGHA 2PRTA 2RPCA 1QNTA 4LF9E 2WBSA 1USVA 1STUA 2R3VA 2YTDA 1UDOA 1UEKA 4LF7I 4TUIA 2WW4A 5LMNI 2EPZA 4ZYGA 2EORA 1X47A 4R2AA 4FW4A 3V5RA 4JI6E 3JU0A 1YH8A 4JI4E 2EN7A 2MC6A 4IFDF 4NXNI 4BA1A 1TF6A 4JI3E 2GLIA 3ZZ0A 4IFDA 1Y4UA 1LLMC 4X64E 1B63A 4X9JA 2AE8A 3B82A 3J80Q 2LT7A 5A2QC 2O1VA 1HR0I 5AE1A 2ELYA 3IWCA 5A6BA 1A1HA 4DR4E 4LFCE 1UDSA 4MU0A 3THOB 2L3JA 1UN6B 4IFDC 4F9AB 2RSIA 4JI2E 1H73A 3FIGA 3VYXA 5GMEA 2PO0B 1YYWA 2RS6A 3ZZUA 2EPUA 2JY9A 1K47A 4GEQB 2JE6A 3PS2A 1FJGI 2YZTA 2EOXA 1N3GA 4GKKE 2BA1D 2EOQA 2DMIA 2EM4A 1FI4A 3L7ZA 2JEBB 2X36A 2Z5EA 4HACA 4HY1A 1I94E 4OO1F 2PO2A 4UT4A 3T1YE 4GKJI 4NHRA 2EMBA 2F4VE 4OO1A 2HC5A 4IJDA 2L2MA 2E5LE 3QT7A 1HNXE 2YRKA 4DPUA 4WUDA 2DGCA 1HNZI 3ECRA 4O4KA 4R2QA 4LCGA 2GO3A 2F8BA 1N33I 2EMKA 2EPMX 4K0KE 3K6QA 1ZM4A 2IOQA 2UXBI 3ADLA 2B7TA 5F3WA 2EMIA 5JEAB 1XMQI 2LE2A 4ISAA 3KZZA 1XMOI 3VHTB 1P47A 2B3TB 2YWQA 1B62A 1WJPA 2B9DA 3AV0A 5AASA 1Z1BA 2C38B 4R2CA 3PRYA 4JG4A 4WUBA 1N36I 5LL6R 2EM0A 4X62E 2DEJA 3Q6MA 2J7JA 1WUUA 4OX9I 4KHPE 4DV5I 4AM3A 4LFAE 2FGGA 3BBGA 5JEAD 1N0VC 3GONA 1G2DC 4M9VC 2K7IA 1L4SA 5KL7A 3B4TA 4DV0I 5C0XC 2YPNA 2EPRA 2LRSA 2DIXA 2EM8A 1N0UA 5AE3A 1ZM9A 1A1GA 4X66I 3THNA 2ENAA 2EMXA 4TUGA 3ADIA 4LF8I 2JEAB 3WU4A 2EM9A 1H7SA 4IFDE 3M7NG 1BBGA 2E1MA 2N8XA 4BC7A 3AUZA 2M9AA 2YTQA 4LF7E 2Z5CA 2KONA 1Z59A 5KL6A 5IT9C 2PNZB 2BBGA 1MG7A 1P42A 2C39B 4YHHI 4ED4A 4NZVA 4HTGA 1E3PA 2IERA 4DPXA 4LF5I 1PJTA 2UU9I 3Q1QA 2E72A 4NXNE 4DR2I 2L6MA 2XEXA 1Y60A 3KWRA 2V2QA 4FWHA 1ZXMA 4OO1D 1JK1A 2O1WA 2BV3A 4IS1C 2BR2B 1HR0E 1H72C 2O3ZA 4FW6A 5IV8B 1PJSA 3VYYA 2NN6B 2WNRB 4WUCA 3HULA 4DR5I 1AH5A 2UXDI 3EPHA 2VF1A 2LCEA 3HXLA 4OO1E 3MSWA 4I8OA 2NPFA 3CWVA 3P3CA 1FJGE 4JI8E 2MC5A 2ENHA 2YU5A 3LLHA 3J80C 2MKNA 2EMGA 2HFUA 5ELWA 3ZKBA 3H1CA 2L2NA 2LTSA 2WZOA 1T4NA 4WX9A 1EH8A 2EWLA 2EN4A 1FWKA 2NN6D 2KOUA 2O1TA 3WU6A 4HEIA 4GKJE 1USUA 1ZM3A 3Q6NA 4DR1I 4DUYE 2Z5BB 5DRRA 2EMHA 2EPLX 1HNZE 2BM0A 2PO0A 4PRXA 4PRVA 2LUQA 4FWGA 5A6AA 1FNMA 2ODRD 1FWLA 1N33E 3H4LA 4JI1I 2V34A 4AQYI 4JYAI 2EOFA 3EQ1A 5FLXQ 2EN2A 4ZYEA 2EQ1A 2L92A 2B7VA 2UXBE 2CVEA 5AC4A 3J7AG 2JEBA 1XMQE 1WHNA 1HK7A 4OOGC 1NCSA 4GZNC 2A2CA 4BHBA 4MLVA 1XMOE 2EL5A 3UK3C 2UXCE 1ZXNA 2JXPA 3DD6A 2Q8UA 1ZBTA 2FTXB
chains in the Genus database with same CATH topology
1N36E 1EI1A 1EKZA 2PNMA 4B3SI 1FKAE 1UHZA 2JOXA 4DR7E 4OX9E 1J5EI 4DV5E 3LNUA 3K1JA 2JR1A 4B3RI 4DV6I 1IBKI 2UUCI 4RPFA 1IBME 2CG9A 1HNWI 2VQFI 1NZ0A 4X66E 4R03A 3OTOE 4LF8E 4F9CB 4YY3I 1NHIA 2Q2EB 4DV4E 4R8OA 4DV1I 4M0VA 3J81Q 4USKA 2FV4B 1Z0WA 4NXME 1XNQE 4B3MI 2VE7C 4YHHE 1Y4SA 4LF5E 4BS9A 2UU9E 1T4LB 2V2ZA 1O0WA 4DR2E 1PVGA 4KQVA 1Z0TA 3RMPA 4DPTA 3PYFA 3WU5A 4JV5E 3B78A 3ZM7A 4JI5I 2RTXA 3ZKDA 3PYEA 2NUEA 1N32I 4DR5E 4DU8A 1MX0A 4BC9A 5L3JA 2DSYA 1YZ9A 4F9BB 2V89A 3JTZA 5BR8E 3VK6A 2AJ4A 3T1HI 2LBSB 2ZM6I 2UUBI 3K17A 5GMDA 1DQ3A 5FWKA 1Z5BA 2GQ0A 4AQYE 4JYAE 2VQEI 1YYKA 2H36X 3DJWA 2E1RA 1PKPA 4L8NA 3HPSA 4M2ZA 2LJHA 1XNRI 4M30A 2V83A 4DV2I 2G7HA 4J8ZA 1IBLI 2ODRC 2R42A 2NA2A 2Z5BA 4BBYA 2IOPA 3HJCA 3B8HA 4UTGA 2HKJA 4BCAA 1J5EE 4P52A 5FLXC 5LMNE 3DF6A 3C4TA 2JWOA 3F6GA 4B3RE 4DV6E 1KVKA 1IBKE 2UUCE 4JI7I 1ZBQA 2VQFE 4JI3I 1NHHA 4IZKB 4DUZI 1WHQA 4FW9A 1MU5A 2NUFA 4WYQB 4FWDA 4Z7YA 3JAMQ 5IWAI 3ADJA 5AE2A 2L2KB 1UILA 2V88A 3C4BA 4JI2I 1NHJA 2MDRA 4B3ME 4B3TI 4BMJA 2PNLA 2V86A 3QT8A 4LF4I 3J7AM 2EFGA 3ADGA 3T1YI 4JI5E 3J81C 4DU7A 4LF6I 2E5LI 1HNXI 1GZ6A 3F0NA 1N32E 2CZ9A 1SR9A 4JI0I 2RS7A 3J7Yp 3OMLA 2X7IA 1S16A 4DV3I 1Z0VA 2IHR1 3HQ1A 4P7DA 4X8WA 4IZJB 4DV7I 4DR3I 1XHKA 2M7QA 2ZM6E 3ZOQB 2CPNA 1BKNA 4WFTA 4X62I 1H74A 5LMUI 2UUAI 1ZM2A 4IZJD 4DV0E 2JVAA 3QT5A 5IT9Q 1XNRE 2ZITA 4Q28A 4DPWA 1RC7A 4XTJA 2GS8A 2LTRA 2DMYA 1EA6A 1IBLE 1S4EA 5DNYA 2DB2A 2HHHI 2OI2A 3IWBA 2LJPA 4JI7E 2CGEA 1Z5AA 2DEIA 3F6HA 3PYDA 4DUZE 3P06A 5IWAE 1Z0EA 2HK3A 2UXDE 2V2VA 2RSMA 4DR6I 4X65I 4B3TE 1Z0GA 1RQ0A 4JI8I 5T6JA 2VF3A 1KTVA 4IZKA 2V8QB 2N3GA 4LF4E 3K85A 4N3OA 3JAMC 1N34I 4MYUA 4LFBI 4DR1E 1Y6ZA 4URLA 1ELOA 2ZBKB 2V87A 4LF6E 1KIJA 2J7KA 4DUYI 4PU9A 2A2DA 2LMZA 2M4IA 4JI0E 4LTYA 4JI1E 3ZZTA 2O1UA 1RREA 4DV3E 2L33A 2HFSA 3P1XA 4DPYA 4DV7E 2YT4A 1QU6A 4DR3E 4DMIA 4USMA 2UXCI 4DXLA 1A6FA 4Z7CA 4B3SE 4LF9I 5A2QQ 2V85A 4DR7I 3QT6A 3HPZA 5LMUE 2UUAE 1Z0BA 3V2UC 2NUGA 4I3HA 4P7AA 4JI6I 4JI4I 4IZJA 1HNWE 1IBMI 4X64I 1QZRA 4HACB 3OTOI 4YY3E 3D4JA 1VISA 4DR4I 4LFCI 1T4OA 2LUPB 2BM1A 4HXZA 4DV1E 4P78A 4DV4I 2M1SA 2HHHE 4KZSA 4NXMI 1XNQI 2L3CA 1X48A 1Z5CA 4GKKI 1H7UA 4ZVIA 2JOBA 1YYOA 2L8TA 1I94I 3H09A 1J26A 1DI2A 2F4VI 4JV5I 1DARA 1Z0CA 1D6TA 4HYMA 4DR6E 1PIEA 4R1FA 4X65E 4K0KI 5CFFE 5ADZA 3HTXA 5BR8I 3LPSA 1KKHA 3T1HE 4FN5A 1WXRA 4F54A 1N34E 2UUBE 3WU3A 4LFBE 4WSPA 2EZ6A 4EMDA 2HK2A 1X49A 2KHXA 4KHPI 4LFAI 4MYTA 2Z5CB 3LMLA 2VQEE 4LU9A 3IWDA 2HKEA 4DKKA 1OJ4A 3PYGA 4M1KA 3M6AA 4DV2E 1U2RA 3LTOA 1RR9A 2V8PA 4WPYA 4L5NC 1GQEA 2N3HA 2K4VA 4LF9E 1USVA 1STUA 2R3VA 1UEKA 4LF7I 4TUIA 2WW4A 5LMNI 1X47A 3V5RA 4JI6E 3JU0A 4JI4E 2MC6A 4NXNI 4JI3E 3ZZ0A 1Y4UA 4X64E 1B63A 3B82A 3J80Q 2O1VA 5A2QC 1HR0I 5AE1A 3IWCA 4DR4E 4LFCE 2L3JA 4F9AB 4JI2E 1H73A 3FIGA 3VYXA 5GMEA 1YYWA 2RS6A 3ZZUA 2JY9A 1K47A 4GEQB 1FJGI 2YZTA 4GKKE 1FI4A 2X36A 2Z5EA 4HACA 4HY1A 1I94E 4UT4A 3T1YE 4GKJI 2F4VE 2E5LE 3QT7A 2L2MA 1HNXE 4DPUA 4WUDA 1HNZI 2F8BA 1N33I 4K0KE 3K6QA 1ZM4A 2IOQA 2UXBI 3ADLA 2B7TA 5F3WA 1XMQI 2LE2A 1XMOI 2B3TB 1B62A 2B9DA 5AASA 3AV0A 3PRYA 4JG4A 4WUBA 1N36I 5LL6R 4X62E 4OX9I 2DEJA 3Q6MA 1WUUA 4KHPE 4DV5I 4LFAE 2FGGA 1N0VC 3GONA 4DV0I 2LRSA 1N0UA 2DIXA 1ZM9A 5AE3A 4X66I 4TUGA 3ADIA 4LF8I 3WU4A 1H7SA 2E1MA 4BC7A 3AUZA 2Z5CA 4LF7E 2KONA 1Z59A 5IT9C 1MG7A 4YHHI 4ED4A 4LF5I 4DPXA 3Q1QA 2UU9I 4NXNE 4DR2I 2L6MA 2XEXA 3KWRA 2V2QA 4FWHA 1ZXMA 2O1WA 2BV3A 1HR0E 1H72C 3VYYA 4WUCA 3HULA 4DR5I 2UXDI 2VF1A 3HXLA 3MSWA 4I8OA 2NPFA 3CWVA 1FJGE 4JI8E 2MC5A 3LLHA 3J80C 2HFUA 3ZKBA 2L2NA 2LTSA 2WZOA 1T4NA 1FWKA 2O1TA 2EWLA 3WU6A 2KOUA 1ZM3A 4GKJE 1USUA 3Q6NA 4DR1I 4DUYE 2Z5BB 4PRXA 1HNZE 2BM0A 4PRVA 2LUQA 4FWGA 1FNMA 2ODRD 1FWLA 1N33E 3H4LA 4JI1I 2V34A 4AQYI 4JYAI 5FLXQ 2UXBE 2L92A 2B7VA 3J7AG 1XMQE 1WHNA 1HK7A 4OOGC 2A2CA 1XMOE 2UXCE 1ZXNA 1ZBTA 2FTXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 E;  1EI1 A;  1EKZ A;  4B3S I;  1FKA E;  1UHZ A;  4DR7 E;  4OX9 E;  1J5E I;  4DV5 E;  3LNU A;  3K1J A;  4B3R I;  4DV6 I;  1IBK I;  2UUC I;  4RPF A;  1IBM E;  1HNW I;  2VQF I;  1NZ0 A;  4X66 E;  3OTO E;  4LF8 E;  4YY3 I;  1NHI A;  2Q2E B;  4DV4 E;  4DV1 I;  3J81 Q;  4USK A;  1Z0W A;  4NXM E;  1XNQ E;  4B3M I;  4YHH E;  4LF5 E;  2UU9 E;  1T4L B;  2V2Z A;  1O0W A;  4DR2 E;  1PVG A;  4KQV A;  1Z0T A;  4DPT A;  3PYF A;  3WU5 A;  4JV5 E;  3B78 A;  3ZM7 A;  4JI5 I;  2RTX A;  3ZKD A;  3PYE A;  2NUE A;  1N32 I;  4DR5 E;  4DU8 A;  1MX0 A;  5L3J A;  1YZ9 A;  5BR8 E;  2AJ4 A;  3T1H I;  2LBS B;  2ZM6 I;  2UUB I;  3K17 A;  5GMD A;  1Z5B A;  4AQY E;  4JYA E;  2VQE I;  1YYK A;  2E1R A;  1PKP A;  4M2Z A;  1XNR I;  2LJH A;  4M30 A;  4DV2 I;  1IBL I;  2R42 A;  2NA2 A;  3B8H A;  4UTG A;  2HKJ A;  1J5E E;  4P52 A;  5LMN E;  5FLX C;  3C4T A;  4B3R E;  4DV6 E;  1KVK A;  1IBK E;  2UUC E;  4JI7 I;  2VQF E;  4JI3 I;  1NHH A;  4DUZ I;  1WHQ A;  4FW9 A;  1MU5 A;  2NUF A;  4WYQ B;  4FWD A;  4Z7Y A;  3JAM Q;  5IWA I;  3ADJ A;  2L2K B;  1UIL A;  3C4B A;  4JI2 I;  1NHJ A;  2MDR A;  4B3M E;  4B3T I;  3QT8 A;  4LF4 I;  3J7A M;  2EFG A;  3ADG A;  3T1Y I;  4JI5 E;  4DU7 A;  3J81 C;  4LF6 I;  2E5L I;  1HNX I;  3F0N A;  1N32 E;  2CZ9 A;  4JI0 I;  2RS7 A;  3J7Y p;  4DV3 I;  2X7I A;  1S16 A;  1Z0V A;  2IHR 1;  4X8W A;  4DV7 I;  4DR3 I;  1XHK A;  2ZM6 E;  2CPN A;  1BKN A;  4WFT A;  4X62 I;  1H74 A;  5LMU I;  2UUA I;  1ZM2 A;  4DV0 E;  2JVA A;  3QT5 A;  5IT9 Q;  1XNR E;  2ZIT A;  4DPW A;  1RC7 A;  4XTJ A;  2GS8 A;  2LTR A;  2DMY A;  1EA6 A;  1IBL E;  1S4E A;  2DB2 A;  2HHH I;  2OI2 A;  2LJP A;  4JI7 E;  1Z5A A;  2DEI A;  3PYD A;  4DUZ E;  5IWA E;  1Z0E A;  2HK3 A;  2UXD E;  2V2V A;  2RSM A;  4DR6 I;  4X65 I;  4B3T E;  1Z0G A;  1RQ0 A;  4JI8 I;  2VF3 A;  1KTV A;  2N3G A;  4LF4 E;  3JAM C;  1N34 I;  4MYU A;  4LFB I;  4DR1 E;  4URL A;  1ELO A;  2ZBK B;  4LF6 E;  1KIJ A;  2J7K A;  4DUY I;  4PU9 A;  2A2D A;  4JI0 E;  4JI1 E;  3ZZT A;  1RRE A;  4DV3 E;  2L33 A;  2HFS A;  3P1X A;  4DPY A;  4DV7 E;  2YT4 A;  1QU6 A;  4DR3 E;  4USM A;  2UXC I;  4DXL A;  1A6F A;  4Z7C A;  4B3S E;  4LF9 I;  5A2Q Q;  4DR7 I;  3QT6 A;  5LMU E;  2UUA E;  1Z0B A;  3V2U C;  2NUG A;  4I3H A;  4P7A A;  4JI6 I;  4JI4 I;  1HNW E;  1IBM I;  4X64 I;  1QZR A;  4HAC B;  3OTO I;  4YY3 E;  3D4J A;  1VIS A;  4DR4 I;  4LFC I;  1T4O A;  2LUP B;  2BM1 A;  4HXZ A;  4DV1 E;  4DV4 I;  2HHH E;  4NXM I;  1XNQ I;  2L3C A;  1X48 A;  1Z5C A;  4GKK I;  1H7U A;  4ZVI A;  1YYO A;  1I94 I;  1J26 A;  1DI2 A;  2F4V I;  4JV5 I;  1DAR A;  1Z0C A;  1D6T A;  4HYM A;  4DR6 E;  1PIE A;  4R1F A;  4X65 E;  4K0K I;  5CFF E;  3HTX A;  5BR8 I;  3LPS A;  1KKH A;  3T1H E;  4FN5 A;  1N34 E;  2UUB E;  3WU3 A;  4LFB E;  2EZ6 A;  4EMD A;  2HK2 A;  1X49 A;  2KHX A;  4KHP I;  4LFA I;  4MYT A;  2VQE E;  2HKE A;  4DKK A;  1OJ4 A;  3PYG A;  4M1K A;  3M6A A;  4DV2 E;  1U2R A;  3LTO A;  1RR9 A;  2V8P A;  1GQE A;  2N3H A;  4LF9 E;  1STU A;  2R3V A;  1UEK A;  4LF7 I;  2WW4 A;  5LMN I;  1X47 A;  3V5R A;  4JI6 E;  4JI4 E;  4NXN I;  4JI3 E;  3ZZ0 A;  4X64 E;  1B63 A;  3B82 A;  3J80 Q;  5A2Q C;  1HR0 I;  4DR4 E;  4LFC E;  2L3J A;  4JI2 E;  1H73 A;  5GME A;  3VYX A;  1YYW A;  2RS6 A;  3ZZU A;  2JY9 A;  1K47 A;  1FJG I;  4GKK E;  1FI4 A;  2X36 A;  4HAC A;  4HY1 A;  1I94 E;  4UT4 A;  3T1Y E;  4GKJ I;  2F4V E;  2E5L E;  3QT7 A;  2L2M A;  1HNX E;  4DPU A;  4WUD A;  1HNZ I;  1N33 I;  4K0K E;  1ZM4 A;  2UXB I;  3ADL A;  2B7T A;  1XMQ I;  1XMO I;  2B3T B;  1B62 A;  4JG4 A;  4WUB A;  1N36 I;  5LL6 R;  4X62 E;  4OX9 I;  2DEJ A;  1WUU A;  4KHP E;  4DV5 I;  4LFA E;  1N0V C;  3GON A;  4DV0 I;  2LRS A;  1N0U A;  2DIX A;  1ZM9 A;  4X66 I;  3ADI A;  4LF8 I;  3WU4 A;  1H7S A;  4LF7 E;  1Z59 A;  5IT9 C;  1MG7 A;  4YHH I;  4ED4 A;  4LF5 I;  4DPX A;  3Q1Q A;  2UU9 I;  4NXN E;  4DR2 I;  2XEX A;  2V2Q A;  4FWH A;  1ZXM A;  2BV3 A;  1HR0 E;  1H72 C;  3VYY A;  4WUC A;  3HUL A;  4DR5 I;  2UXD I;  2NPF A;  3CWV A;  1FJG E;  4JI8 E;  3LLH A;  2HFU A;  3J80 C;  3ZKB A;  2L2N A;  2LTS A;  1T4N A;  1FWK A;  3WU6 A;  1ZM3 A;  4GKJ E;  4DR1 I;  4DUY E;  4PRX A;  1HNZ E;  2BM0 A;  4PRV A;  2LUQ A;  4FWG A;  1FNM A;  1FWL A;  1N33 E;  3H4L A;  4JI1 I;  2V34 A;  4AQY I;  4JYA I;  5FLX Q;  2UXB E;  2B7V A;  3J7A G;  1XMQ E;  1WHN A;  4OOG C;  2A2C A;  1XMO E;  2UXC E;  1ZXN A;  1ZBT A; 
#chains in the Genus database with same CATH topology
 4BA2 B;  2LJU A;  4R2P A;  1N36 E;  1EKZ A;  1EI1 A;  2PNM A;  1FKA E;  1UHZ A;  4B3S I;  2JOX A;  2WBU A;  2EPP A;  2EN8 A;  4OX9 E;  4DR7 E;  1J5E I;  4DV5 E;  3LNU A;  3K1J A;  5JEA F;  2JR1 A;  4B3R I;  1BB8 A;  5IXM B;  5JEA A;  2EM3 A;  4DV6 I;  1IBK I;  2UUC I;  4RPF A;  1IBM E;  2ENC A;  2CG9 A;  1HNW I;  2VQF I;  4O24 A;  1NZ0 A;  3U1K A;  4X66 E;  4R2D A;  2EOE A;  4R03 A;  3OTO E;  4LF8 E;  1MGT A;  2EN6 A;  4F9C B;  2C38 A;  5JEA C;  4YY3 I;  4F6N A;  1RMD A;  1NHI A;  2Q2E B;  4DV4 E;  4R8O A;  4DV1 I;  4M0V A;  3J81 Q;  4USK A;  5DRP A;  1R6L A;  1YUJ A;  2FV4 B;  2YTN A;  4R2S A;  4NXM E;  1Z0W A;  1YFH A;  1XNQ E;  4R2E A;  4B3M I;  2VE7 C;  4YHH E;  1Y4S A;  4LF5 E;  4Q35 B;  4BS9 A;  2EQ0 A;  2UU9 E;  1T4L B;  1PJQ A;  2V2Z A;  1O0W A;  4DR2 E;  1PVG A;  4KQV A;  1Z0T A;  3RMP A;  4DPT A;  3PYF A;  2JEA A;  3WU5 A;  3HKM A;  2YTP A;  1XXE A;  2HJJ A;  2I9I A;  4JV5 E;  1E3H A;  3B78 A;  3GME A;  3ZM7 A;  4JI5 I;  2RTX A;  2BB8 A;  3ZKD A;  2YTJ A;  3MHH C;  3PYE A;  2NUE A;  1N32 I;  4DR5 E;  3EPL A;  1MX0 A;  4MU4 A;  4BC9 A;  4DU8 A;  2PNZ A;  5L3J A;  2C39 A;  2DSY A;  4OO1 C;  1YZ9 A;  4F9B B;  2ADR A;  2V89 A;  5K36 B;  5KL3 A;  2EP3 A;  3JTZ A;  5BR8 E;  3VK6 A;  2EN1 A;  1IMU A;  3C6M A;  5DRQ A;  1BBO A;  1IQS A;  4QNK A;  2AJ4 A;  3T1H I;  2BR2 A;  2NN6 F;  2LBS B;  2ZM6 I;  5AC5 A;  2UUB I;  3K17 A;  1A1L A;  1T39 A;  4IS9 A;  2YRH A;  2NN6 A;  5GMD A;  2WNR A;  1X3C A;  2JPA A;  1DQ3 A;  5EKW A;  2LVH A;  5FWK A;  5K36 D;  2EMF A;  1Z5B A;  4MLQ A;  2GQ0 A;  4AQY E;  4O5G A;  4JYA E;  2VQE I;  2HGH A;  2H36 X;  1YYK A;  3M85 G;  2EPK X;  4FW7 A;  5LLQ A;  3DJW A;  2E1R A;  1PKP A;  4L8N A;  3HPS A;  4M2Z A;  2LJH A;  1XNR I;  1WRJ A;  4M30 A;  3C6K A;  2V83 A;  4DV2 I;  2G7H A;  5JEA E;  4J8Z A;  1IBL I;  2ODR C;  2R42 A;  2NA2 A;  2Z5B A;  4BBY A;  2IOP A;  3CDJ A;  3HJC A;  2JP9 A;  3B8H A;  4UTG A;  2CT1 A;  2HKJ A;  4BCA A;  1J5E E;  4P52 A;  1X6F A;  5FLX C;  5LMN E;  3DF6 A;  3C4T A;  2JWO A;  3F6G A;  4B3R E;  2ELZ A;  4DV6 E;  1KVK A;  1IBK E;  2UUC E;  4JI7 I;  3BID A;  4F2J C;  4WXC A;  1F2I G;  1IQO A;  1ZBQ A;  2VQF E;  4JI3 I;  1NHH A;  4IZK B;  4DUZ I;  1WHQ A;  2DLQ A;  1OYP A;  4FW9 A;  2EM6 A;  4BA2 A;  1PDA A;  1MU5 A;  2NUF A;  4WYQ B;  4FWD A;  4Z7Y A;  3JAM Q;  5IWA I;  4KWY A;  1DGC A;  3ADJ A;  5AE2 A;  2L2K B;  1UIL A;  2V88 A;  3C4B A;  4JI2 I;  1UBD C;  2EOZ A;  1YSA C;  1OYR A;  1NHJ A;  2MDR A;  4B3M E;  2WP8 B;  4B3T I;  2R76 A;  3PS3 A;  2RQL A;  1X5W A;  2EM5 A;  4BMJ A;  2PNL A;  1UDN A;  4QNJ A;  2V86 A;  2CSH A;  3QT8 A;  4LF4 I;  3J7A M;  5KL5 A;  2EFG A;  2LO3 A;  3ADG A;  2EMY A;  3EPK A;  4JI5 E;  3J81 C;  4N4R B;  4DU7 A;  3T1Y I;  3U1Y A;  2E5L I;  4LF6 I;  2D9H A;  3TQM A;  1HNX I;  3UHM A;  1GZ6 A;  3F0N A;  1N32 E;  2CZ9 A;  1SR9 A;  4JI0 I;  5C0X B;  2RS7 A;  1YUI A;  3J7Y p;  2NN6 E;  3OML A;  2X7I A;  1S16 A;  4DV3 I;  1Z0V A;  2GO4 A;  4U3B A;  2IHR 1;  3HQ1 A;  4P7D A;  4X8W A;  2F1D A;  1NEI A;  4IZJ B;  4DV7 I;  4DR3 I;  1XHK A;  2M7Q A;  2ZM6 E;  2A25 A;  3ZOQ B;  2CPN A;  2EOH A;  1BKN A;  2YTE A;  4WFT A;  1B69 A;  4MU1 A;  2EMC A;  4X62 I;  5K36 F;  1H74 A;  5LMU I;  2UUA I;  1A1I A;  1A1F A;  1ZM2 A;  4IZJ D;  5K36 A;  1G2F C;  4DV0 E;  1ZAA C;  2JVA A;  2IES A;  3QT5 A;  5IT9 Q;  1XNR E;  4MDT A;  4F6M A;  2EPA A;  2ZIT A;  2EPC A;  1GTK A;  4Q28 A;  4DPW A;  3M85 D;  2YTG A;  1RC7 A;  5K36 C;  4XTJ A;  2GS8 A;  2LTR A;  2DMY A;  1EA6 A;  1IBL E;  1OYS A;  1S4E A;  3BF2 A;  5DNY A;  2PO1 B;  5EL9 A;  4OKG A;  1A1J A;  3MHS C;  3EPJ A;  2DB2 A;  2EM7 A;  2EL6 A;  2YSO A;  1EH6 A;  2HHH I;  2OI2 A;  3M7N D;  2EM2 A;  2WBT A;  1X6E A;  2BA0 G;  5DRO A;  2EMZ A;  3IWB A;  1AAY A;  2LJP A;  4R2R A;  5TSE A;  4JI7 E;  2CGE A;  1Z5A A;  2DEI A;  4OO1 B;  3QG5 C;  3F6H A;  3PYD A;  4DUZ E;  1T38 A;  3P06 A;  2EOS A;  2I13 A;  2GHF A;  2NAB A;  1SFE A;  5IWA E;  2YRM A;  1Z0E A;  2LV2 A;  2HK3 A;  4FW5 A;  2UXD E;  2V2V A;  3P3E A;  2GPI A;  2RSM A;  4DR6 I;  4X65 I;  4B3T E;  1Z0G A;  1RQ0 A;  3NZK A;  4JI8 I;  5T6J A;  5A6K A;  2VF3 A;  2MKD A;  2JT2 A;  1KTV A;  2EN3 A;  4IZK A;  2V8Q B;  1TN9 A;  2N3G A;  4LF4 E;  3K85 A;  3M99 B;  3JAM C;  4N3O A;  1N34 I;  4MYU A;  2EPX A;  4LFB I;  4DR1 E;  1Y6Z A;  4URL A;  2EOO A;  1ELO A;  2ZBK B;  2V87 A;  4LF6 E;  1KIJ A;  2J7K A;  2EOI A;  4OZE A;  4DUY I;  4J3D A;  4FK5 C;  4PU9 A;  2EMA A;  2A2D A;  3CDI A;  2LMZ A;  2M4I A;  4JI0 E;  2EJ4 A;  4LTY A;  1YHC A;  4JI1 E;  2WP8 A;  1JK2 A;  2O1U A;  1RRE A;  4DV3 E;  2L33 A;  2NN6 C;  1RHY A;  3ZZT A;  2HFS A;  2EML A;  3P1X A;  4DPY A;  2VES A;  4DV7 E;  2YT4 A;  1QU6 A;  4GQU A;  4DR3 E;  4DMI A;  3GCM A;  4BA1 B;  5K36 E;  4RH8 A;  4IFD B;  4USM A;  2C37 A;  4LOM A;  4DXL A;  2UXC I;  4U3D A;  1A6F A;  2YTF A;  5C0X F;  4Z7C A;  4B3S E;  4LF9 I;  1A1K A;  3KZY A;  1MEY C;  4AIM A;  5A2Q Q;  5C0X A;  2V85 A;  4DR7 I;  3QT6 A;  5A69 A;  3HPZ A;  5LMU E;  2UUA E;  1Z0B A;  3V2U C;  2NUG A;  3GLL A;  4I3H A;  4P7A A;  4MQY A;  4JI6 I;  4JI4 I;  2CTD A;  2JE6 B;  4IZJ A;  5DNL A;  4IFD D;  1HNW E;  1IBM I;  5A6J A;  2EOJ A;  4ZYH A;  3L7Z B;  4X64 I;  1QZR A;  1R6M A;  5A6B D;  4HAC B;  3OTO I;  1KYQ A;  2EQ3 A;  4YY3 E;  2PO2 B;  3KRN A;  4AID A;  4WXD A;  3D4J A;  1VIS A;  4DR4 I;  1EH7 A;  3P76 A;  1T4O A;  2LUP B;  2BM1 A;  4LFC I;  4HXZ A;  4DV1 E;  4P78 A;  4DV4 I;  1ZU1 A;  2R1F A;  2M1S A;  2HHH E;  2BA1 G;  2YU8 A;  2MDG A;  1KJK A;  4KZS A;  4NXM I;  4RHB B;  2WCC 3;  1XNQ I;  2L3C A;  4O43 A;  1X48 A;  1Z5C A;  4GKK I;  2VRD A;  1H7U A;  2BA0 D;  4LCF A;  4ZVI A;  1TF3 A;  2EPN A;  2JOB A;  1YYO A;  2PO1 A;  2L8T A;  3L00 A;  3H09 A;  1I94 I;  1J26 A;  3P3G A;  1DI2 A;  2DRP A;  2C37 B;  2F4V I;  2YTI A;  4JV5 I;  1DAR A;  1YPN A;  1Z0C A;  2EPO A;  5KL2 A;  1D6T A;  4HYM A;  4DR6 E;  1PIE A;  4R1F A;  4ZYD A;  4FW3 A;  4WSG A;  4X65 E;  4K0K I;  4NBQ A;  1ZR9 A;  5CFF E;  5ADZ A;  5KL4 A;  3HTX A;  5BR8 I;  3LPS A;  1KKH A;  3T1H E;  4FN5 A;  1WXR A;  4F54 A;  2EE8 A;  2EMW A;  1N34 E;  2UUB E;  2EL4 A;  4LFB E;  4WSP A;  4MU3 A;  3WU3 A;  5C0X D;  2EZ6 A;  4EMD A;  2HK2 A;  1X49 A;  2JYA A;  1UDQ A;  2KHX A;  1X6H A;  1VI7 A;  4KHP I;  2YSP A;  2DLK A;  2J65 A;  4LFA I;  4MYT A;  2Z5C B;  2EOM A;  3LML A;  2VQE E;  4LU9 A;  3IWD A;  4LCH A;  2YTO A;  2HKE A;  2EOY A;  4DKK A;  5C0X E;  1OJ4 A;  1Y5Y A;  3PYG A;  4M1K A;  3M6A A;  3PS1 A;  4BHC A;  4DV2 E;  1U2R A;  3LTO A;  1RR9 A;  5DNX A;  2V8P A;  4WPY A;  4L5N C;  1GQE A;  4LPF A;  2N3H A;  2K4V A;  3BGH A;  2PRT A;  2RPC A;  1QNT A;  4LF9 E;  2WBS A;  1USV A;  1STU A;  2R3V A;  2YTD A;  1UDO A;  1UEK A;  4LF7 I;  4TUI A;  2WW4 A;  5LMN I;  2EPZ A;  4ZYG A;  2EOR A;  1X47 A;  4R2A A;  4FW4 A;  3V5R A;  4JI6 E;  3JU0 A;  1YH8 A;  4JI4 E;  2EN7 A;  2MC6 A;  4IFD F;  4NXN I;  4BA1 A;  1TF6 A;  4JI3 E;  2GLI A;  3ZZ0 A;  4IFD A;  1Y4U A;  1LLM C;  4X64 E;  1B63 A;  4X9J A;  2AE8 A;  3B82 A;  3J80 Q;  2LT7 A;  5A2Q C;  2O1V A;  1HR0 I;  5AE1 A;  2ELY A;  3IWC A;  5A6B A;  1A1H A;  4DR4 E;  4LFC E;  1UDS A;  4MU0 A;  3THO B;  2L3J A;  1UN6 B;  4IFD C;  4F9A B;  2RSI A;  4JI2 E;  1H73 A;  3FIG A;  3VYX A;  5GME A;  2PO0 B;  1YYW A;  2RS6 A;  3ZZU A;  2EPU A;  2JY9 A;  1K47 A;  4GEQ B;  2JE6 A;  3PS2 A;  1FJG I;  2YZT A;  2EOX A;  1N3G A;  4GKK E;  2BA1 D;  2EOQ A;  2DMI A;  2EM4 A;  1FI4 A;  3L7Z A;  2JEB B;  2X36 A;  2Z5E A;  4HAC A;  4HY1 A;  1I94 E;  4OO1 F;  2PO2 A;  4UT4 A;  3T1Y E;  4GKJ I;  4NHR A;  2EMB A;  2F4V E;  4OO1 A;  2HC5 A;  4IJD A;  2L2M A;  2E5L E;  3QT7 A;  1HNX E;  2YRK A;  4DPU A;  4WUD A;  2DGC A;  1HNZ I;  3ECR A;  4O4K A;  4R2Q A;  4LCG A;  2GO3 A;  2F8B A;  1N33 I;  2EMK A;  2EPM X;  4K0K E;  3K6Q A;  1ZM4 A;  2IOQ A;  2UXB I;  3ADL A;  2B7T A;  5F3W A;  2EMI A;  5JEA B;  1XMQ I;  2LE2 A;  4ISA A;  3KZZ A;  1XMO I;  3VHT B;  1P47 A;  2B3T B;  2YWQ A;  1B62 A;  1WJP A;  2B9D A;  3AV0 A;  5AAS A;  1Z1B A;  2C38 B;  4R2C A;  3PRY A;  4JG4 A;  4WUB A;  1N36 I;  5LL6 R;  2EM0 A;  4X62 E;  2DEJ A;  3Q6M A;  2J7J A;  1WUU A;  4OX9 I;  4KHP E;  4DV5 I;  4AM3 A;  4LFA E;  2FGG A;  3BBG A;  5JEA D;  1N0V C;  3GON A;  1G2D C;  4M9V C;  2K7I A;  1L4S A;  5KL7 A;  3B4T A;  4DV0 I;  5C0X C;  2YPN A;  2EPR A;  2LRS A;  2DIX A;  2EM8 A;  1N0U A;  5AE3 A;  1ZM9 A;  1A1G A;  4X66 I;  3THN A;  2ENA A;  2EMX A;  4TUG A;  3ADI A;  4LF8 I;  2JEA B;  3WU4 A;  2EM9 A;  1H7S A;  4IFD E;  3M7N G;  1BBG A;  2E1M A;  2N8X A;  4BC7 A;  3AUZ A;  2M9A A;  2YTQ A;  4LF7 E;  2Z5C A;  2KON A;  1Z59 A;  5KL6 A;  5IT9 C;  2PNZ B;  2BBG A;  1MG7 A;  1P42 A;  2C39 B;  4YHH I;  4ED4 A;  4NZV A;  4HTG A;  1E3P A;  2IER A;  4DPX A;  4LF5 I;  1PJT A;  2UU9 I;  3Q1Q A;  2E72 A;  4NXN E;  4DR2 I;  2L6M A;  2XEX A;  1Y60 A;  3KWR A;  2V2Q A;  4FWH A;  1ZXM A;  4OO1 D;  1JK1 A;  2O1W A;  2BV3 A;  4IS1 C;  2BR2 B;  1HR0 E;  1H72 C;  2O3Z A;  4FW6 A;  5IV8 B;  1PJS A;  3VYY A;  2NN6 B;  2WNR B;  4WUC A;  3HUL A;  4DR5 I;  1AH5 A;  2UXD I;  3EPH A;  2VF1 A;  2LCE A;  3HXL A;  4OO1 E;  3MSW A;  4I8O A;  2NPF A;  3CWV A;  3P3C A;  1FJG E;  4JI8 E;  2MC5 A;  2ENH A;  2YU5 A;  3LLH A;  3J80 C;  2MKN A;  2EMG A;  2HFU A;  5ELW A;  3ZKB A;  3H1C A;  2L2N A;  2LTS A;  2WZO A;  1T4N A;  4WX9 A;  1EH8 A;  2EWL A;  2EN4 A;  1FWK A;  2NN6 D;  2KOU A;  2O1T A;  3WU6 A;  4HEI A;  4GKJ E;  1USU A;  1ZM3 A;  3Q6N A;  4DR1 I;  4DUY E;  2Z5B B;  5DRR A;  2EMH A;  2EPL X;  1HNZ E;  2BM0 A;  2PO0 A;  4PRX A;  4PRV A;  2LUQ A;  4FWG A;  5A6A A;  1FNM A;  2ODR D;  1FWL A;  1N33 E;  3H4L A;  4JI1 I;  2V34 A;  4AQY I;  4JYA I;  2EOF A;  3EQ1 A;  5FLX Q;  2EN2 A;  4ZYE A;  2EQ1 A;  2L92 A;  2B7V A;  2UXB E;  2CVE A;  5AC4 A;  3J7A G;  2JEB A;  1XMQ E;  1WHN A;  1HK7 A;  4OOG C;  1NCS A;  4GZN C;  2A2C A;  4BHB A;  4MLV A;  1XMO E;  2EL5 A;  3UK3 C;  2UXC E;  1ZXN A;  2JXP A;  3DD6 A;  2Q8U A;  1ZBT A;  2FTX B; 
#chains in the Genus database with same CATH homology
 1N36 E;  1EI1 A;  1EKZ A;  2PNM A;  4B3S I;  1FKA E;  1UHZ A;  2JOX A;  4DR7 E;  4OX9 E;  1J5E I;  4DV5 E;  3LNU A;  3K1J A;  2JR1 A;  4B3R I;  4DV6 I;  1IBK I;  2UUC I;  4RPF A;  1IBM E;  2CG9 A;  1HNW I;  2VQF I;  1NZ0 A;  4X66 E;  4R03 A;  3OTO E;  4LF8 E;  4F9C B;  4YY3 I;  1NHI A;  2Q2E B;  4DV4 E;  4R8O A;  4DV1 I;  4M0V A;  3J81 Q;  4USK A;  2FV4 B;  1Z0W A;  4NXM E;  1XNQ E;  4B3M I;  2VE7 C;  4YHH E;  1Y4S A;  4LF5 E;  4BS9 A;  2UU9 E;  1T4L B;  2V2Z A;  1O0W A;  4DR2 E;  1PVG A;  4KQV A;  1Z0T A;  3RMP A;  4DPT A;  3PYF A;  3WU5 A;  4JV5 E;  3B78 A;  3ZM7 A;  4JI5 I;  2RTX A;  3ZKD A;  3PYE A;  2NUE A;  1N32 I;  4DR5 E;  4DU8 A;  1MX0 A;  4BC9 A;  5L3J A;  2DSY A;  1YZ9 A;  4F9B B;  2V89 A;  3JTZ A;  5BR8 E;  3VK6 A;  2AJ4 A;  3T1H I;  2LBS B;  2ZM6 I;  2UUB I;  3K17 A;  5GMD A;  1DQ3 A;  5FWK A;  1Z5B A;  2GQ0 A;  4AQY E;  4JYA E;  2VQE I;  1YYK A;  2H36 X;  3DJW A;  2E1R A;  1PKP A;  4L8N A;  3HPS A;  4M2Z A;  2LJH A;  1XNR I;  4M30 A;  2V83 A;  4DV2 I;  2G7H A;  4J8Z A;  1IBL I;  2ODR C;  2R42 A;  2NA2 A;  2Z5B A;  4BBY A;  2IOP A;  3HJC A;  3B8H A;  4UTG A;  2HKJ A;  4BCA A;  1J5E E;  4P52 A;  5FLX C;  5LMN E;  3DF6 A;  3C4T A;  2JWO A;  3F6G A;  4B3R E;  4DV6 E;  1KVK A;  1IBK E;  2UUC E;  4JI7 I;  1ZBQ A;  2VQF E;  4JI3 I;  1NHH A;  4IZK B;  4DUZ I;  1WHQ A;  4FW9 A;  1MU5 A;  2NUF A;  4WYQ B;  4FWD A;  4Z7Y A;  3JAM Q;  5IWA I;  3ADJ A;  5AE2 A;  2L2K B;  1UIL A;  2V88 A;  3C4B A;  4JI2 I;  1NHJ A;  2MDR A;  4B3M E;  4B3T I;  4BMJ A;  2PNL A;  2V86 A;  3QT8 A;  4LF4 I;  3J7A M;  2EFG A;  3ADG A;  3T1Y I;  4JI5 E;  3J81 C;  4DU7 A;  4LF6 I;  2E5L I;  1HNX I;  1GZ6 A;  3F0N A;  1N32 E;  2CZ9 A;  1SR9 A;  4JI0 I;  2RS7 A;  3J7Y p;  3OML A;  2X7I A;  1S16 A;  4DV3 I;  1Z0V A;  2IHR 1;  3HQ1 A;  4P7D A;  4X8W A;  4IZJ B;  4DV7 I;  4DR3 I;  1XHK A;  2M7Q A;  2ZM6 E;  3ZOQ B;  2CPN A;  1BKN A;  4WFT A;  4X62 I;  1H74 A;  5LMU I;  2UUA I;  1ZM2 A;  4IZJ D;  4DV0 E;  2JVA A;  3QT5 A;  5IT9 Q;  1XNR E;  2ZIT A;  4Q28 A;  4DPW A;  1RC7 A;  4XTJ A;  2GS8 A;  2LTR A;  2DMY A;  1EA6 A;  1IBL E;  1S4E A;  5DNY A;  2DB2 A;  2HHH I;  2OI2 A;  3IWB A;  2LJP A;  4JI7 E;  2CGE A;  1Z5A A;  2DEI A;  3F6H A;  3PYD A;  4DUZ E;  3P06 A;  5IWA E;  1Z0E A;  2HK3 A;  2UXD E;  2V2V A;  2RSM A;  4DR6 I;  4X65 I;  4B3T E;  1Z0G A;  1RQ0 A;  4JI8 I;  5T6J A;  2VF3 A;  1KTV A;  4IZK A;  2V8Q B;  2N3G A;  4LF4 E;  3K85 A;  4N3O A;  3JAM C;  1N34 I;  4MYU A;  4LFB I;  4DR1 E;  1Y6Z A;  4URL A;  1ELO A;  2ZBK B;  2V87 A;  4LF6 E;  1KIJ A;  2J7K A;  4DUY I;  4PU9 A;  2A2D A;  2LMZ A;  2M4I A;  4JI0 E;  4LTY A;  4JI1 E;  3ZZT A;  2O1U A;  1RRE A;  4DV3 E;  2L33 A;  2HFS A;  3P1X A;  4DPY A;  4DV7 E;  2YT4 A;  1QU6 A;  4DR3 E;  4DMI A;  4USM A;  2UXC I;  4DXL A;  1A6F A;  4Z7C A;  4B3S E;  4LF9 I;  5A2Q Q;  2V85 A;  4DR7 I;  3QT6 A;  3HPZ A;  5LMU E;  2UUA E;  1Z0B A;  3V2U C;  2NUG A;  4I3H A;  4P7A A;  4JI6 I;  4JI4 I;  4IZJ A;  1HNW E;  1IBM I;  4X64 I;  1QZR A;  4HAC B;  3OTO I;  4YY3 E;  3D4J A;  1VIS A;  4DR4 I;  4LFC I;  1T4O A;  2LUP B;  2BM1 A;  4HXZ A;  4DV1 E;  4P78 A;  4DV4 I;  2M1S A;  2HHH E;  4KZS A;  4NXM I;  1XNQ I;  2L3C A;  1X48 A;  1Z5C A;  4GKK I;  1H7U A;  4ZVI A;  2JOB A;  1YYO A;  2L8T A;  1I94 I;  3H09 A;  1J26 A;  1DI2 A;  2F4V I;  4JV5 I;  1DAR A;  1Z0C A;  1D6T A;  4HYM A;  4DR6 E;  1PIE A;  4R1F A;  4X65 E;  4K0K I;  5CFF E;  5ADZ A;  3HTX A;  5BR8 I;  3LPS A;  1KKH A;  3T1H E;  4FN5 A;  1WXR A;  4F54 A;  1N34 E;  2UUB E;  3WU3 A;  4LFB E;  4WSP A;  2EZ6 A;  4EMD A;  2HK2 A;  1X49 A;  2KHX A;  4KHP I;  4LFA I;  4MYT A;  2Z5C B;  3LML A;  2VQE E;  4LU9 A;  3IWD A;  2HKE A;  4DKK A;  1OJ4 A;  3PYG A;  4M1K A;  3M6A A;  4DV2 E;  1U2R A;  3LTO A;  1RR9 A;  2V8P A;  4WPY A;  4L5N C;  1GQE A;  2N3H A;  2K4V A;  4LF9 E;  1USV A;  1STU A;  2R3V A;  1UEK A;  4LF7 I;  4TUI A;  2WW4 A;  5LMN I;  1X47 A;  3V5R A;  4JI6 E;  3JU0 A;  4JI4 E;  2MC6 A;  4NXN I;  4JI3 E;  3ZZ0 A;  1Y4U A;  4X64 E;  1B63 A;  3B82 A;  3J80 Q;  2O1V A;  5A2Q C;  1HR0 I;  5AE1 A;  3IWC A;  4DR4 E;  4LFC E;  2L3J A;  4F9A B;  4JI2 E;  1H73 A;  3FIG A;  3VYX A;  5GME A;  1YYW A;  2RS6 A;  3ZZU A;  2JY9 A;  1K47 A;  4GEQ B;  1FJG I;  2YZT A;  4GKK E;  1FI4 A;  2X36 A;  2Z5E A;  4HAC A;  4HY1 A;  1I94 E;  4UT4 A;  3T1Y E;  4GKJ I;  2F4V E;  2E5L E;  3QT7 A;  2L2M A;  1HNX E;  4DPU A;  4WUD A;  1HNZ I;  2F8B A;  1N33 I;  4K0K E;  3K6Q A;  1ZM4 A;  2IOQ A;  2UXB I;  3ADL A;  2B7T A;  5F3W A;  1XMQ I;  2LE2 A;  1XMO I;  2B3T B;  1B62 A;  2B9D A;  5AAS A;  3AV0 A;  3PRY A;  4JG4 A;  4WUB A;  1N36 I;  5LL6 R;  4X62 E;  4OX9 I;  2DEJ A;  3Q6M A;  1WUU A;  4KHP E;  4DV5 I;  4LFA E;  2FGG A;  1N0V C;  3GON A;  4DV0 I;  2LRS A;  1N0U A;  2DIX A;  1ZM9 A;  5AE3 A;  4X66 I;  4TUG A;  3ADI A;  4LF8 I;  3WU4 A;  1H7S A;  2E1M A;  4BC7 A;  3AUZ A;  2Z5C A;  4LF7 E;  2KON A;  1Z59 A;  5IT9 C;  1MG7 A;  4YHH I;  4ED4 A;  4LF5 I;  4DPX A;  3Q1Q A;  2UU9 I;  4NXN E;  4DR2 I;  2L6M A;  2XEX A;  3KWR A;  2V2Q A;  4FWH A;  1ZXM A;  2O1W A;  2BV3 A;  1HR0 E;  1H72 C;  3VYY A;  4WUC A;  3HUL A;  4DR5 I;  2UXD I;  2VF1 A;  3HXL A;  3MSW A;  4I8O A;  2NPF A;  3CWV A;  1FJG E;  4JI8 E;  2MC5 A;  3LLH A;  3J80 C;  2HFU A;  3ZKB A;  2L2N A;  2LTS A;  2WZO A;  1T4N A;  1FWK A;  2O1T A;  2EWL A;  3WU6 A;  2KOU A;  1ZM3 A;  4GKJ E;  1USU A;  3Q6N A;  4DR1 I;  4DUY E;  2Z5B B;  4PRX A;  1HNZ E;  2BM0 A;  4PRV A;  2LUQ A;  4FWG A;  1FNM A;  2ODR D;  1FWL A;  1N33 E;  3H4L A;  4JI1 I;  2V34 A;  4AQY I;  4JYA I;  5FLX Q;  2UXB E;  2L92 A;  2B7V A;  3J7A G;  1XMQ E;  1WHN A;  1HK7 A;  4OOG C;  2A2C A;  1XMO E;  2UXC E;  1ZXN A;  1ZBT A;  2FTX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...