4X62E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x62E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x62E02
1HR0E 4NXME 4MYTA 3Q1QA 2LRSA 4DPXA 1IBKI 2UUCE 2HK2A 4LFAI 5FLXQ 1HNXE 4DV1E 1PIEA 2RS6A 1Z0TA 1X48A 5L3JA 1XNQI 4P52A 2A2DA 5BR8E 4DPWA 3H4LA 4FW9A 4DR2I 1Z59A 2UUAE 4DR5E 1H7SA 4X62E 4NXNI 1XMOI 4KHPE 1KTVA 4JI6I 1UHZA 4WUCA 3LLHA 2B7VA 2RS7A 3WU4A 5IWAE 4LF7I 4HACB 1B62A 1NZ0A 4UT4A 1XNRI 3ADLA 4LFBE 4LF5E 1IBLI 3J81Q 2NUGA 1PKPA 1J5EE 2UUBI 1OJ4A 5IT9C 1FJGI 1ZBTA 4DV4E 4JI0I 4DR6E 1HNWE 1FKAE 4B3RI 1EI1A 4JI3I 1EKZA 2HHHE 3ZZTA 4Z7CA 2BM0A 4P7AA 1T4OA 4XTJA 3LTOA 4USKA 4OX9E 3ZM7A 4M2ZA 2L3CA 2E5LI 3J80Q 2RTXA 1K47A 4X65I 4K0KI 4MYUA 2BV3A 5LMNI 3ADJA 1HNZI 3J7AG 4YHHI 1XNQE 4USMA 2UXDI 2DIXA 4PRVA 1EA6A 1J26A 1N0VC 4LFCI 4WUDA 2UU9I 4FWDA 1XHKA 2DB2A 2JY9A 1Z0CA 1N32E 3ZZ0A 1XMOE 4JI1E 2Q2EB 4DV3E 4DR4E 4LF8I 5LMUE 4EMDA 4JI5I 2UXCE 2CZ9A 4X64I 1UILA 1I94I 1IBLE 4JI7I 1WUUA 4DV0E 3VYYA 3F0NA 2A2CA 1FI4A 3P1XA 4HACA 3OTOE 3K1JA 2WW4A 1Z5BA 2MDRA 2VQEE 3QT5A 2X36A 4DUYI 5A2QQ 5FLXC 1WHNA 1RQ0A 1FNMA 1WHQA 1KIJA 1O0WA 1ZM4A 4X65E 4K0KE 4DPTA 1QU6A 1ZM3A 4B3SI 4YY3E 5GMEA 4DR7E 2R42A 1XMQI 4DUZI 4LF6E 4B3MI 1N34E 1ZXNA 1MG7A 3V5RA 2VQFI 2B3TB 1KKHA 4JI2I 4RPFA 1YZ9A 2BM1A 3J7Yp 1X49A 3QT7A 1UEKA 3M6AA 2UU9E 2NA2A 2HKEA 4DV2E 4LF9E 1PVGA 2ZM6I 2UXBE 2NUEA 1QZRA 3WU3A 3WU6A 3D4JA 4DR3E 4X64E 5GMDA 3J81C 2V34A 4Z7YA 2DEIA 4GKJI 3ZZUA 2LTSA 3T1YI 2F4VI 4UTGA 2EFGA 3T1HI 4B3TE 1IBMI 4AQYI 4GKKE 3JAMQ 2JVAA 4X66E 1S16A 4JYAI 3ZKBA 3J80C 1GQEA 1N33E 1DARA 3ADGA 4DV6I 4LF4I 1N36I 4JI4I 1IBKE 2OI2A 4DU7A 1VISA 4LFAE 2DMYA 4DR1I 4JV5I 4M1KA 1H73A 1XMQE 2B7TA 1YYOA 1N0UA 2V2QA 2VQFE 2NPFA 4JI2E 4DU8A 1Z0BA 4DR2E 3B8HA 1T4NA 3QT8A 3PYGA 2L2NA 1S4EA 3B78A 4JI8I 3C4TA 1HR0I 4NXMI 2ZM6E 1B63A 4NXNE 1U2RA 2R3VA 4JI6E 2UUCI 3C4BA 2KHXA 4FN5A 2LJPA 4DV1I 1HNXI 1H74A 1H72C 1KVKA 4HYMA 4LF7E 1XNRE 2CPNA 5BR8I 2N3HA 3ADIA 3VYXA 4DR5I 1Z5CA 2UUBE 4X62I 1NHJA 4ZVIA 1FJGE 4KHPI 4JI0E 2L33A 5A2QC 2LUPB 4B3RE 4KQVA 4JI3E 2EZ6A 4DKKA 1FWKA 2ZITA 5IWAI 1Z5AA 2V2VA 1Z0EA 4X8WA 2E5LE 4LFBI 3PYEA 1Z0VA 4LF5I 4ED4A 3QT6A 5LMNE 4JG4A 4WYQB 1HNZE 4YHHE 1J5EI 4DPUA 2UXDE 3ZKDA 4DV4I 3HULA 4DR6I 1HNWI 1RREA 4LFCE 2HHHI 3CWVA 1BKNA 4OX9I 1RR9A 3LPSA 4OOGC 4LF8E 2N3GA 2E1RA 1Z0GA 2HK3A 4JI5E 4HY1A 1I94E 4DV7I 3JAMC 1MX0A 4JI7E 2GS8A 4DV5I 4R1FA 3V2UC 1N32I 4JI1I 1YYWA 4DV3I 2YT4A 2LUQA 1ZM2A 2V8PA 4DR4I 3K17A 5LMUI 1NHHA 4DUYE 2UXCI 1DI2A 2HFUA 2HKJA 4B3SE 4DV0I 1D6TA 1T4LB 4DUZE 4B3ME 3J7AM 2LBSB 1H7UA 4HXZA 4URLA 5LL6R 4I3HA 4WFTA 2L3JA 3OTOI 1YYKA 2DEJA 2X7IA 4M30A 5IT9Q 3HTXA 2VQEI 1RC7A 4DXLA 3WU5A 4FWGA 4YY3I 2HFSA 2IHR1 4DR7I 3PYFA 2L2MA 1FWLA 4LF6I 3GONA 2LTRA 4PU9A 1N34I 4DV7E 4GKJE 2F4VE 3T1YE 1X47A 3T1HE 2UUAI 1IBME 4FWHA 4DV5E 4AQYE 4DV2I 4WUBA 4LF9I 1A6FA 2L2KB 2UXBI 5CFFE 2AJ4A 2XEXA 1Z0WA 4JYAE 1MU5A 4DR3I 4DPYA 4DV6E 4LF4E 1N36E 4JI4E 4PRXA 1ZM9A 4DR1E 4JV5E 4B3TI 1ELOA 1ZXMA 2VF3A 1STUA 1NHIA 4GKKI 2RSMA 3PYDA 2ZBKB 2J7KA 2V2ZA 4X66I 3B82A 2NUFA 2LJHA 4JI8E 3LNUA 1N33I
chains in the Genus database with same CATH superfamily
2EMWA 4ZYHA 1HR0E 1ZAAC 4NXME 4MYTA 3Q1QA 2LRSA 4L8NA 4DPXA 1E3HA 1IBKI 2EPZA 2UUCE 2ENCA 2HK2A 4LFAI 5FLXQ 2EMLA 2GHFA 1HNXE 4DV1E 1UN6B 2YTDA 1PIEA 3Q6NA 2RS6A 1YUIA 1Z0TA 3UHMA 1X48A 5L3JA 1YFHA 4R8OA 1XNQI 2EN1A 4N4RB 4P52A 2EQ1A 2A2DA 5BR8E 2V83A 3H4LA 5DNXA 4FW9A 4DPWA 3M85G 4DR2I 3ECRA 2YTOA 1Z59A 2EMZA 2EN8A 2V8QB 2EM0A 2UUAE 1Y4SA 2BB8A 2M1SA 4L5NC 4DR5E 4NZVA 2GQ0A 5EKWA 2CSHA 3L7ZB 4FW5A 2V87A 1L4SA 1H7SA 4X62E 4NXNI 1XMOI 4BHCA 4F6MA 4KHPE 3M7ND 1KTVA 4JI6I 3EPJA 5A6BD 4IZKB 1UHZA 2EMHA 2EMYA 2GPIA 3QG5C 2O1VA 2DSYA 3EPHA 4WUCA 3LLHA 2K4VA 2B7VA 2V86A 2E72A 3HPSA 2RS7A 4WXCA 1X6HA 3WU4A 5IWAE 2O1WA 2JR1A 4LF7I 4HACB 5KL4A 1B62A 3K6QA 1NZ0A 2IESA 2O1UA 4UT4A 5EL9A 1XNRI 2YRMA 3ADLA 4LFBE 1OYSA 1A1LA 4LF5E 2EPXA 3DD6A 1IBLI 3J81Q 2EPNA 5A6JA 5C0XD 2EPLX 2NUGA 2EN7A 1PKPA 1NCSA 1J5EE 2UUBI 1OJ4A 1T38A 2YRKA 2C39A 2EP3A 2PO0A 4R2PA 5IT9C 2BA1D 3U1YA 3KWRA 1FJGI 1ZBTA 4DV4E 4JI0I 2L8TA 1VI7A 4DR6E 1HNWE 3NZKA 4P78A 1FKAE 2EOQA 2WZOA 1KYQA 4F2JC 2JE6B 1EI1A 4JI3I 4B3RI 1JK2A 3PS3A 1EKZA 1QNTA 2RQLA 2HHHE 2JEAB 3ZZTA 2H36X 3HXLA 4Z7CA 1A1FA 2BM0A 1T4OA 1RMDA 2ENHA 4P7AA 2V85A 4XTJA 4ZYGA 3LTOA 4USKA 4OX9E 3ZM7A 4M2ZA 2L3CA 2E5LI 3J80Q 2RTXA 1K47A 4X65I 4K0KI 4MYUA 3UK3C 2BV3A 2YTNA 4RH8A 5DNYA 2BA0G 5C0XE 5LMNI 3ADJA 2CVEA 1HNZI 5DRRA 4R2DA 3J7AG 4BA2B 4YHHI 4GQUA 1X5WA 2RSIA 1XNQE 3HJCA 4USMA 2UXDI 3GCMA 1GTKA 3PRYA 2DIXA 4PRVA 2WBTA 1EA6A 5LLQA 2EMGA 3GMEA 1J26A 2YTGA 1N0VC 4HEIA 4LFCI 2D9HA 4WUDA 2EMKA 1E3PA 2UU9I 1UDOA 4FWDA 1XHKA 2DB2A 2JY9A 1Z0CA 1N32E 2EM4A 3ZZ0A 1XMOE 4JI1E 2Q2EB 1JK1A 4DV3E 4IS9A 5C0XB 4DR4E 1YHCA 4LF8I 5TSEA 3DJWA 2YTPA 1X6FA 3MHHC 2WBUA 1AH5A 3FIGA 5LMUE 2C39B 2ELYA 2FTXB 3EPKA 2C37B 4EMDA 4JI5I 2VE7C 2UXCE 2CZ9A 4X64I 1WRJA 3L00A 4LTYA 1UILA 1TF6A 2EORA 4MQYA 5T6JA 2ODRD 4MLQA 1I94I 1IBLE 4JI7I 4WPYA 2EOMA 1UDSA 1XXEA 2O1TA 1WUUA 3Q6MA 4DV0E 3VYYA 3F0NA 2A2CA 2EPUA 1P42A 4IZKA 4FW3A 1UBDC 2YTIA 2HJJA 4WSPA 1FI4A 3P1XA 4HACA 3OTOE 3K1JA 4LPFA 2EOJA 2WW4A 3LMLA 3HKMA 1Z5BA 2MDRA 2WCC3 3JTZA 2VQEE 4LCHA 3QT5A 2X36A 4DUYI 2ODRC 5A2QQ 5FLXC 2Z5BA 1WHNA 1RQ0A 4O24A 1A1IA 1FNMA 1WHQA 1KIJA 1O0WA 2ENAA 1ZM4A 4X65E 4K0KE 4OZEA 2CGEA 4DPTA 1QU6A 2EMCA 3OMLA 4F9AB 1ZM3A 4B3SI 1Y4UA 2PRTA 3EPLA 4YY3E 5GMEA 1HK7A 2EPOA 4DR7E 2JE6A 2R42A 2GO3A 4DUZI 1XMQI 4IFDD 5C0XF 4LF6E 4B3MI 2CG9A 4BBYA 2IERA 2IOQA 2JEAA 4KZSA 1GZ6A 1ZR9A 2BA1G 1N34E 1ZXNA 1MG7A 2JT2A 3V5RA 2VQFI 2B3TB 1KKHA 4MU1A 4JI2I 1PDAA 5IXMB 4QNKA 2LMZA 4RPFA 4LU9A 1YZ9A 2EQ0A 2EOOA 3J7Yp 1X49A 3MHSC 1YUJA 2EN3A 2EOFA 1UEKA 2BM1A 3M6AA 2UU9E 3P3GA 2NA2A 4MU4A 2MDGA 2RPCA 1MGTA 2HKEA 4DV2E 4LF9E 4I8OA 1PVGA 2I9IA 4FK5C 4QNJA 2ZM6I 4BA2A 2NN6D 2UXBE 2EWLA 2NUEA 2EN2A 5A6BA 1R6LA 1QZRA 3WU3A 4IFDC 2VRDA 4ISAA 4IZJD 3WU6A 2EJ4A 3D4JA 2JEBB 4IFDE 2DGCA 1RHYA 4DR3E 1F2IG 4X64E 5JEAD 2EOIA 2EPMX 2WBSA 5GMDA 3J81C 2JOXA 2V34A 4Z7YA 2PNZA 2JXPA 1G2DC 2DEIA 4GKJI 3PS2A 3BBGA 2LTSA 3ZZUA 3T1YI 1Y6ZA 5C0XA 4UTGA 2EFGA 2F4VI 3T1HI 1USVA 2DLKA 2EOXA 4ZYEA 4B3TE 1KJKA 2NN6C 2Z5BB 4FW7A 1IBMI 4AQYI 2PO1A 1DQ3A 2ADRA 4GKKE 2NN6E 3JAMQ 5AE1A 2JVAA 4OO1D 2C37A 3P3EA 4IFDB 5JEAC 4X66E 1S16A 2M7QA 3EQ1A 4BC9A 4JYAI 1R6MA 4J8ZA 1TF3A 2EMBA 4X9JA 2LJUA 4R2AA 3ZKBA 1OYPA 2EN4A 2DMIA 1GQEA 2HC5A 3J80C 4IS1C 1N33E 3P76A 1DARA 3ADGA 4DV6I 4LF4I 2LVHA 1SR9A 1N36I 2EMAA 4JI4I 1IBKE 2OI2A 4DU7A 3P3CA 1VISA 3F6HA 2M9AA 4LFAE 2DMYA 2EM6A 4AIDA 4DR1I 4JV5I 2EPAA 2EMFA 2NN6B 1H73A 2WNRA 4M1KA 4OO1C 3AV0A 2EOHA 2B7TA 1YYOA 1XMQE 1ZBQA 1N0UA 4LCFA 4F6NA 2V2QA 3QT7A 2VQFE 3B4TA 2NPFA 4JI2E 4DU8A 5AC4A 1Z0BA 4DR2E 2EOYA 3B8HA 2L6MA 3CDJA 1T4NA 1BBGA 4WXDA 3PYGA 2L2NA 3QT8A 2JP9A 2EE8A 1S4EA 3B78A 4U3DA 4JI8I 4R2CA 3C4TA 2EM8A 1T39A 2GLIA 1HR0I 4NXMI 2PNZB 2ZM6E 2EQ3A 3KZYA 1B63A 4NXNE 1U2RA 2R3VA 4JI6E 2AE8A 3AUZA 2YTJA 2G7HA 4ZYDA 3P06A 5FWKA 2UUCI 3C4BA 2BBGA 2KHXA 4FN5A 2EM9A 2LJPA 2EN6A 4U3BA 4DV1I 2M4IA 4GZNC 1HNXI 2PO1B 2WP8A 2LT7A 4R03A 1H74A 1H72C 4R2QA 1KVKA 2VESA 4TUIA 2FV4B 4LF7E 4HYMA 4IFDF 1EH7A 1NEIA 1XNRE 3M99B 2YTEA 2CPNA 5BR8I 4O5GA 2F8BA 2JWOA 2N3HA 2ELZA 3ADIA 4R2EA 3VYXA 3ZOQB 4DMIA 2EPCA 1USUA 4DR5I 3IWBA 1BBOA 2LCEA 1EH8A 1Z5CA 5IV8B 2UUBE 2Z5CB 2JEBA 4X62I 1NHJA 4ZVIA 1FJGE 4FW4A 5K36D 3PS1A 3BF2A 4KHPI 4JI0E 2WNRB 4NHRA 3M7NG 2BR2B 2L33A 5A2QC 2N8XA 2YSPA 2LUPB 2DLQA 4B3RE 4KQVA 4JI3E 2EZ6A 3IWDA 4DKKA 1UDQA 2LV2A 3C6KA 5AC5A 1FWKA 1WXRA 2ZITA 1P47A 5DRQA 5IWAI 2Q8UA 1Z5AA 5DRPA 2EPRA 2V2VA 1Z0EA 2EL4A 4X8WA 3F6GA 2MC5A 1PJSA 5AE3A 2E5LE 3PYEA 1Z0VA 4LFBI 3IWCA 4LOMA 4LF5I 3JU0A 4ED4A 5KL6A 1A1KA 3QT6A 5LMNE 4JG4A 1X3CA 4WYQB 4IFDA 1HNZE 2YWQA 5K36C 4YHHE 2PNLA 1J5EI 1N3GA 5A6KA 1DGCA 4BHBA 4DPUA 2J65A 5K36E 5ADZA 2UXDE 3ZKDA 4DV4I 3HULA 3DF6A 4DR6I 1HNWI 1RREA 5F3WA 2WP8B 2J7JA 4LFCE 2HHHI 3U1KA 1Y60A 4OKGA 2C38B 3CWVA 3K85A 2NN6A 2MKDA 2PNMA 2IOPA 1BKNA 2A25A 2E1MA 4OX9I 4F9CB 4BCAA 1RR9A 3LPSA 4OOGC 2EMXA 2CT1A 4LF8E 4BS9A 5A6AA 4IZJA 1Y5YA 2N3GA 2E1RA 5K36B 5JEAA 1Z0GA 4Q35B 2HK3A 4JI5E 4AIMA 1PJTA 2EM2A 3H1CA 4HY1A 2Z5EA 1WJPA 5AASA 1Z1BA 2I13A 5KL7A 1IQOA 1IQSA 2GO4A 1I94E 4DV7I 3JAMC 1ZU1A 1MX0A 4JI7E 1UDNA 3GLLA 3VK6A 2PO2A 2GS8A 3HPZA 4OO1A 4DV5I 2R76A 4R1FA 3V2UC 1N32I 4O43A 1YYWA 4JI1I 4DV3I 2YT4A 2LUQA 2JPAA 1ZM2A 2V8PA 2KONA 4Q28A 1A1JA 1OYRA 4DR4I 3K17A 2EPPA 2EPKX 1AAYA 4M9VC 2LE2A 4P7DA 4HTGA 5LMUI 4URLA 4WSGA 5JEAE 1NHHA 4DUYE 2UXCI 2EMIA 2VF1A 1DI2A 2YU8A 2Z5CA 2HFUA 2HKJA 2L92A 4B3SE 5KL5A 4DV0I 1T4LB 1D6TA 2BR2A 4DUZE 2EM3A 2EL6A 2EOEA 4B3ME 3J7AM 4OO1E 2LBSB 1H7UA 4HXZA 2KOUA 2JYAA 5LL6R 4WFTA 4I3HA 4IZJB 1YPNA 4O4KA 2L3JA 3HQ1A 3VHTB 2B9DA 2EM7A 2LO3A 3M85D 3OTOI 1YYKA 3RMPA 5JEAB 5K36F 2DEJA 2X7IA 4M30A 5IT9Q 2MC6A 3HTXA 1G2FC 2VQEI 1A1GA 2O3ZA 4BA1A 1PJQA 4GEQB 1TN9A 5C0XC 5KL2A 1RC7A 3CDIA 2EL5A 2HGHA 2PO2B 3WU5A 2YZTA 4FWGA 4MU3A 4DXLA 3THNA 4YY3I 2HFSA 4OO1B 4R2SA 2CTDA 2IHR1 4BMJA 4DR7I 4LCGA 4BC7A 2K7IA 3PYFA 2FGGA 2L2MA 4R2RA 1FWLA 4LF6I 4IJDA 3GONA 2LTRA 4PU9A 3BGHA 2EM5A 4KWYA 2C38A 3KRNA 1N34I 4DV7E 4GKJE 2V88A 2DRPA 3T1YE 4M0VA 2F4VE 1X47A 3T1HE 1MEYC 2UUAI 1IBME 1B69A 4J3DA 4FWHA 4F9BB 4DV5E 4AQYE 5DROA 4DV2I 4WUBA 4LF9I 3H09A 1A6FA 4TUGA 2L2KB 5K36A 2UXBI 5CFFE 2AJ4A 4F54A 2XEXA 1IMUA 1Z0WA 4FW6A 3MSWA 4JYAE 2NN6F 2JOBA 1MU5A 2PO0B 2EOZA 4DR3I 4DPYA 4MDTA 4MLVA 4DV6E 4LF4E 5KL3A 3L7ZA 1A1HA 2MKNA 1N36E 5JEAF 4JI4E 4PRXA 4NBQA 2YRHA 2YPNA 3BIDA 4DR1E 4JV5E 3TQMA 1YSAC 1ZM9A 1BB8A 2BA0D 5ELWA 1LLMC 4B3TI 1YH8A 1ELOA 3KZZA 5AE2A 1SFEA 2F1DA 4BA1B 1ZXMA 2VF3A 1STUA 1NHIA 4GKKI 2V89A 2RSMA 2YU5A 4N3OA 2YTFA 2YTQA 5DNLA 2EOSA 3PYDA 5A69A 3THOB 2ZBKB 2J7KA 4WX9A 2V2ZA 4MU0A 4X66I 1EH6A 4RHBB 2NUFA 1X6EA 3B82A 4OO1F 4AM3A 2NABA 3C6MA 2LJHA 4JI8E 2R1FA 2YSOA 3LNUA 1N33I
chains in the Genus database with same CATH topology
1HR0E 4NXME 4MYTA 3Q1QA 2LJHA 2LRSA 4L8NA 4DPXA 1IBKI 2UUCE 2HK2A 4LFAI 5FLXQ 3Q6NA 1HNXE 4DV1E 1PIEA 2RS6A 1Z0TA 1X48A 5L3JA 4R8OA 1XNQI 4P52A 2A2DA 5BR8E 2V83A 3H4LA 4DPWA 4FW9A 4DR2I 1Z59A 2V8QB 2UUAE 1Y4SA 2GQ0A 2M1SA 4L5NC 4DR5E 2V87A 1H7SA 4X62E 4NXNI 1XMOI 4KHPE 1KTVA 4JI6I 4IZKB 1UHZA 4WUCA 2O1VA 2DSYA 2K4VA 2B7VA 2V86A 3HPSA 3LLHA 2RS7A 3WU4A 5IWAE 2O1WA 2JR1A 4LF7I 4HACB 1B62A 3K6QA 1NZ0A 2O1UA 4UT4A 1XNRI 3ADLA 4LFBE 4LF5E 1IBLI 3J81Q 2NUGA 1PKPA 1J5EE 2UUBI 1OJ4A 5IT9C 3KWRA 1FJGI 1ZBTA 4DV4E 4JI0I 2L8TA 4DR6E 1HNWE 4P78A 1FKAE 4B3RI 2WZOA 1EI1A 4JI3I 1EKZA 2HHHE 3ZZTA 2H36X 3HXLA 4Z7CA 2BM0A 4P7AA 1T4OA 4XTJA 2V85A 3LTOA 4USKA 4OX9E 3ZM7A 4M2ZA 2L3CA 2E5LI 3J80Q 2RTXA 1K47A 4X65I 4K0KI 4MYUA 2BV3A 5DNYA 5LMNI 3ADJA 1HNZI 3J7AG 4YHHI 1XNQE 3HJCA 4USMA 2UXDI 3PRYA 2DIXA 4PRVA 1EA6A 1J26A 1N0VC 4LFCI 4WUDA 2UU9I 4FWDA 1XHKA 2DB2A 2JY9A 1Z0CA 1N32E 3ZZ0A 1XMOE 4JI1E 2Q2EB 4DV3E 4DR4E 4LF8I 3DJWA 5LMUE 3FIGA 2FTXB 4EMDA 4JI5I 2VE7C 2UXCE 2CZ9A 4X64I 4LTYA 1UILA 5T6JA 2ODRD 1I94I 1IBLE 4JI7I 4WPYA 2O1TA 1WUUA 3Q6MA 4DV0E 3VYYA 3F0NA 2A2CA 4IZKA 4WSPA 1FI4A 3P1XA 4HACA 3OTOE 3K1JA 2WW4A 3LMLA 1Z5BA 2MDRA 2VQEE 3JTZA 3QT5A 2X36A 4DUYI 2ODRC 5A2QQ 5FLXC 2Z5BA 1WHNA 1RQ0A 1FNMA 1WHQA 1KIJA 1O0WA 1ZM4A 4X65E 4K0KE 2CGEA 4DPTA 1QU6A 3OMLA 4F9AB 1ZM3A 4B3SI 1Y4UA 4YY3E 5GMEA 1HK7A 4DR7E 2R42A 1XMQI 4DUZI 4LF6E 4B3MI 2CG9A 4BBYA 2IOQA 4KZSA 1GZ6A 1N34E 1ZXNA 1MG7A 3V5RA 2VQFI 2B3TB 1KKHA 4JI2I 4RPFA 2LMZA 4LU9A 1YZ9A 2BM1A 3J7Yp 1X49A 3QT7A 1UEKA 3M6AA 2UU9E 2NA2A 2HKEA 4DV2E 4LF9E 4I8OA 1PVGA 2ZM6I 2UXBE 2EWLA 2NUEA 1QZRA 3WU3A 4IZJD 3WU6A 3D4JA 4DR3E 4X64E 5GMDA 3J81C 2JOXA 2V34A 4Z7YA 2DEIA 4GKJI 3ZZUA 2LTSA 3T1YI 2F4VI 1Y6ZA 4UTGA 2EFGA 3T1HI 1USVA 4B3TE 1IBMI 2Z5BB 4AQYI 1DQ3A 4GKKE 3JAMQ 5AE1A 2JVAA 4X66E 1S16A 2M7QA 4BC9A 4JYAI 4J8ZA 3ZKBA 3J80C 1GQEA 1N33E 1DARA 3ADGA 4DV6I 4LF4I 1N36I 4JI4I 1IBKE 2OI2A 4DU7A 1VISA 3F6HA 4LFAE 2DMYA 4DR1I 4JV5I 4M1KA 1H73A 3AV0A 1XMQE 2B7TA 1YYOA 1ZBQA 1N0UA 2V2QA 2VQFE 2NPFA 4JI2E 4DU8A 1Z0BA 4DR2E 3B8HA 2L6MA 1T4NA 3QT8A 3PYGA 2L2NA 1S4EA 3B78A 4JI8I 3C4TA 1HR0I 4NXMI 2ZM6E 1B63A 4NXNE 1U2RA 2R3VA 4JI6E 3AUZA 3P06A 2G7HA 2UUCI 5FWKA 3C4BA 2KHXA 4FN5A 2LJPA 4DV1I 1HNXI 2M4IA 1H74A 4R03A 1H72C 1KVKA 4TUIA 2FV4B 4LF7E 4HYMA 1XNRE 2CPNA 5BR8I 2F8BA 2JWOA 2N3HA 3ADIA 3VYXA 3ZOQB 4DMIA 1USUA 4DR5I 3IWBA 1Z5CA 2UUBE 2Z5CB 4X62I 1NHJA 4ZVIA 1FJGE 4KHPI 4JI0E 2L33A 5A2QC 2LUPB 4B3RE 4KQVA 4JI3E 2EZ6A 3IWDA 4DKKA 1FWKA 1WXRA 2ZITA 5IWAI 1Z5AA 2V2VA 1Z0EA 4X8WA 3F6GA 2MC5A 5AE3A 2E5LE 3PYEA 4LFBI 1Z0VA 3IWCA 4LF5I 3JU0A 4ED4A 3QT6A 5LMNE 4JG4A 4WYQB 1HNZE 4YHHE 2PNLA 1J5EI 4DPUA 5ADZA 2UXDE 3ZKDA 4DV4I 3HULA 3DF6A 4DR6I 1HNWI 1RREA 5F3WA 4LFCE 2HHHI 3CWVA 3K85A 2PNMA 2IOPA 1BKNA 2E1MA 4OX9I 4F9CB 4BCAA 1RR9A 3LPSA 4OOGC 4LF8E 4BS9A 4IZJA 2N3GA 2E1RA 1Z0GA 2HK3A 4JI5E 4HY1A 2Z5EA 5AASA 1I94E 4DV7I 3JAMC 1MX0A 4JI7E 3VK6A 2GS8A 3HPZA 4DV5I 4R1FA 3V2UC 1N32I 4JI1I 1YYWA 4DV3I 2YT4A 2LUQA 1ZM2A 2V8PA 2KONA 4Q28A 4DR4I 3K17A 2LE2A 4P7DA 5LMUI 1NHHA 4DUYE 2UXCI 2VF1A 1DI2A 2Z5CA 2HFUA 2HKJA 2L92A 4B3SE 4DV0I 1D6TA 1T4LB 4DUZE 4B3ME 3J7AM 2LBSB 1H7UA 4HXZA 2KOUA 5LL6R 4I3HA 4WFTA 4URLA 4IZJB 2L3JA 3HQ1A 2B9DA 3OTOI 1YYKA 3RMPA 2DEJA 2X7IA 4M30A 5IT9Q 2MC6A 3HTXA 2VQEI 4GEQB 1RC7A 4DXLA 3WU5A 2YZTA 4FWGA 4YY3I 2HFSA 2IHR1 4BMJA 4DR7I 4BC7A 3PYFA 2FGGA 2L2MA 1FWLA 4LF6I 3GONA 2LTRA 4PU9A 1N34I 4DV7E 4GKJE 2V88A 2F4VE 3T1YE 4M0VA 1X47A 3T1HE 2UUAI 1IBME 4FWHA 4F9BB 4DV5E 4AQYE 4DV2I 4WUBA 4LF9I 3H09A 1A6FA 4TUGA 2L2KB 2UXBI 5CFFE 2AJ4A 4F54A 2XEXA 1Z0WA 3MSWA 4JYAE 2JOBA 1MU5A 4DR3I 4DPYA 4DV6E 4LF4E 1N36E 4JI4E 4PRXA 1ZM9A 4DR1E 4JV5E 4B3TI 1ELOA 5AE2A 1ZXMA 2VF3A 1STUA 1NHIA 4GKKI 2V89A 2RSMA 4N3OA 3PYDA 2ZBKB 2J7KA 2V2ZA 4X66I 3B82A 2NUFA 1SR9A 4JI8E 3LNUA 1N33I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 E;  4NXM E;  4MYT A;  3Q1Q A;  2LRS A;  4DPX A;  1IBK I;  2UUC E;  2HK2 A;  4LFA I;  5FLX Q;  1HNX E;  4DV1 E;  1PIE A;  2RS6 A;  1Z0T A;  1X48 A;  5L3J A;  1XNQ I;  4P52 A;  2A2D A;  5BR8 E;  4DPW A;  3H4L A;  4FW9 A;  4DR2 I;  1Z59 A;  2UUA E;  4DR5 E;  1H7S A;  4X62 E;  4NXN I;  1XMO I;  4KHP E;  1KTV A;  4JI6 I;  1UHZ A;  4WUC A;  3LLH A;  2B7V A;  2RS7 A;  3WU4 A;  5IWA E;  4LF7 I;  4HAC B;  1B62 A;  1NZ0 A;  4UT4 A;  1XNR I;  3ADL A;  4LFB E;  4LF5 E;  1IBL I;  3J81 Q;  2NUG A;  1PKP A;  1J5E E;  2UUB I;  1OJ4 A;  5IT9 C;  1FJG I;  1ZBT A;  4DV4 E;  4JI0 I;  4DR6 E;  1HNW E;  1FKA E;  4B3R I;  1EI1 A;  4JI3 I;  1EKZ A;  2HHH E;  3ZZT A;  4Z7C A;  2BM0 A;  4P7A A;  1T4O A;  4XTJ A;  3LTO A;  4USK A;  4OX9 E;  3ZM7 A;  4M2Z A;  2L3C A;  2E5L I;  3J80 Q;  2RTX A;  1K47 A;  4X65 I;  4K0K I;  4MYU A;  2BV3 A;  5LMN I;  3ADJ A;  1HNZ I;  3J7A G;  4YHH I;  1XNQ E;  4USM A;  2UXD I;  2DIX A;  4PRV A;  1EA6 A;  1J26 A;  1N0V C;  4LFC I;  4WUD A;  2UU9 I;  4FWD A;  1XHK A;  2DB2 A;  2JY9 A;  1Z0C A;  1N32 E;  3ZZ0 A;  1XMO E;  4JI1 E;  2Q2E B;  4DV3 E;  4DR4 E;  4LF8 I;  5LMU E;  4EMD A;  4JI5 I;  2UXC E;  2CZ9 A;  4X64 I;  1UIL A;  1I94 I;  1IBL E;  4JI7 I;  1WUU A;  4DV0 E;  3VYY A;  3F0N A;  2A2C A;  1FI4 A;  3P1X A;  4HAC A;  3OTO E;  3K1J A;  2WW4 A;  1Z5B A;  2MDR A;  2VQE E;  3QT5 A;  2X36 A;  4DUY I;  5A2Q Q;  5FLX C;  1WHN A;  1RQ0 A;  1FNM A;  1WHQ A;  1KIJ A;  1O0W A;  1ZM4 A;  4X65 E;  4K0K E;  4DPT A;  1QU6 A;  1ZM3 A;  4B3S I;  4YY3 E;  5GME A;  4DR7 E;  2R42 A;  1XMQ I;  4DUZ I;  4LF6 E;  4B3M I;  1N34 E;  1ZXN A;  1MG7 A;  3V5R A;  2VQF I;  2B3T B;  1KKH A;  4JI2 I;  4RPF A;  1YZ9 A;  2BM1 A;  3J7Y p;  1X49 A;  3QT7 A;  1UEK A;  3M6A A;  2UU9 E;  2NA2 A;  2HKE A;  4DV2 E;  4LF9 E;  1PVG A;  2ZM6 I;  2UXB E;  2NUE A;  1QZR A;  3WU3 A;  3WU6 A;  3D4J A;  4DR3 E;  4X64 E;  5GMD A;  3J81 C;  2V34 A;  4Z7Y A;  2DEI A;  4GKJ I;  3ZZU A;  2LTS A;  3T1Y I;  2F4V I;  4UTG A;  2EFG A;  3T1H I;  4B3T E;  1IBM I;  4AQY I;  4GKK E;  3JAM Q;  2JVA A;  4X66 E;  1S16 A;  4JYA I;  3ZKB A;  3J80 C;  1GQE A;  1N33 E;  1DAR A;  3ADG A;  4DV6 I;  4LF4 I;  1N36 I;  4JI4 I;  1IBK E;  2OI2 A;  4DU7 A;  1VIS A;  4LFA E;  2DMY A;  4DR1 I;  4JV5 I;  4M1K A;  1H73 A;  1XMQ E;  2B7T A;  1YYO A;  1N0U A;  2V2Q A;  2VQF E;  2NPF A;  4JI2 E;  4DU8 A;  1Z0B A;  4DR2 E;  3B8H A;  1T4N A;  3QT8 A;  3PYG A;  2L2N A;  1S4E A;  3B78 A;  4JI8 I;  3C4T A;  1HR0 I;  4NXM I;  2ZM6 E;  1B63 A;  4NXN E;  1U2R A;  2R3V A;  4JI6 E;  2UUC I;  3C4B A;  2KHX A;  4FN5 A;  2LJP A;  4DV1 I;  1HNX I;  1H74 A;  1H72 C;  1KVK A;  4HYM A;  4LF7 E;  1XNR E;  2CPN A;  5BR8 I;  2N3H A;  3ADI A;  3VYX A;  4DR5 I;  1Z5C A;  2UUB E;  4X62 I;  1NHJ A;  4ZVI A;  1FJG E;  4KHP I;  4JI0 E;  2L33 A;  5A2Q C;  2LUP B;  4B3R E;  4KQV A;  4JI3 E;  2EZ6 A;  4DKK A;  1FWK A;  2ZIT A;  5IWA I;  1Z5A A;  2V2V A;  1Z0E A;  4X8W A;  2E5L E;  4LFB I;  3PYE A;  1Z0V A;  4LF5 I;  4ED4 A;  3QT6 A;  5LMN E;  4JG4 A;  4WYQ B;  1HNZ E;  4YHH E;  1J5E I;  4DPU A;  2UXD E;  3ZKD A;  4DV4 I;  3HUL A;  4DR6 I;  1HNW I;  1RRE A;  4LFC E;  2HHH I;  3CWV A;  1BKN A;  4OX9 I;  1RR9 A;  3LPS A;  4OOG C;  4LF8 E;  2N3G A;  2E1R A;  1Z0G A;  2HK3 A;  4JI5 E;  4HY1 A;  1I94 E;  4DV7 I;  3JAM C;  1MX0 A;  4JI7 E;  2GS8 A;  4DV5 I;  4R1F A;  3V2U C;  1N32 I;  4JI1 I;  1YYW A;  4DV3 I;  2YT4 A;  2LUQ A;  1ZM2 A;  2V8P A;  4DR4 I;  3K17 A;  5LMU I;  1NHH A;  4DUY E;  2UXC I;  1DI2 A;  2HFU A;  2HKJ A;  4B3S E;  4DV0 I;  1D6T A;  1T4L B;  4DUZ E;  4B3M E;  3J7A M;  2LBS B;  1H7U A;  4HXZ A;  4URL A;  5LL6 R;  4I3H A;  4WFT A;  2L3J A;  3OTO I;  1YYK A;  2DEJ A;  2X7I A;  4M30 A;  5IT9 Q;  3HTX A;  2VQE I;  1RC7 A;  4DXL A;  3WU5 A;  4FWG A;  4YY3 I;  2HFS A;  2IHR 1;  4DR7 I;  3PYF A;  2L2M A;  1FWL A;  4LF6 I;  3GON A;  2LTR A;  4PU9 A;  1N34 I;  4DV7 E;  4GKJ E;  2F4V E;  3T1Y E;  1X47 A;  3T1H E;  2UUA I;  1IBM E;  4FWH A;  4DV5 E;  4AQY E;  4DV2 I;  4WUB A;  4LF9 I;  1A6F A;  2L2K B;  2UXB I;  5CFF E;  2AJ4 A;  2XEX A;  1Z0W A;  4JYA E;  1MU5 A;  4DR3 I;  4DPY A;  4DV6 E;  4LF4 E;  1N36 E;  4JI4 E;  4PRX A;  1ZM9 A;  4DR1 E;  4JV5 E;  4B3T I;  1ELO A;  1ZXM A;  2VF3 A;  1STU A;  1NHI A;  4GKK I;  2RSM A;  3PYD A;  2ZBK B;  2J7K A;  2V2Z A;  4X66 I;  3B82 A;  2NUF A;  2LJH A;  4JI8 E;  3LNU A;  1N33 I; 
#chains in the Genus database with same CATH topology
 2EMW A;  4ZYH A;  1HR0 E;  1ZAA C;  4NXM E;  4MYT A;  3Q1Q A;  2LRS A;  4L8N A;  4DPX A;  1E3H A;  1IBK I;  2EPZ A;  2UUC E;  2ENC A;  2HK2 A;  4LFA I;  5FLX Q;  2EML A;  2GHF A;  1HNX E;  4DV1 E;  1UN6 B;  2YTD A;  1PIE A;  3Q6N A;  2RS6 A;  1YUI A;  1Z0T A;  3UHM A;  1X48 A;  5L3J A;  1YFH A;  4R8O A;  1XNQ I;  2EN1 A;  4N4R B;  4P52 A;  2EQ1 A;  2A2D A;  5BR8 E;  2V83 A;  3H4L A;  5DNX A;  4FW9 A;  4DPW A;  3M85 G;  4DR2 I;  3ECR A;  2YTO A;  1Z59 A;  2EMZ A;  2EN8 A;  2V8Q B;  2EM0 A;  2UUA E;  1Y4S A;  2BB8 A;  2M1S A;  4L5N C;  4DR5 E;  4NZV A;  2GQ0 A;  5EKW A;  2CSH A;  3L7Z B;  4FW5 A;  2V87 A;  1L4S A;  1H7S A;  4X62 E;  4NXN I;  1XMO I;  4BHC A;  4F6M A;  4KHP E;  3M7N D;  1KTV A;  4JI6 I;  3EPJ A;  5A6B D;  4IZK B;  1UHZ A;  2EMH A;  2EMY A;  2GPI A;  3QG5 C;  2O1V A;  2DSY A;  3EPH A;  4WUC A;  3LLH A;  2K4V A;  2B7V A;  2V86 A;  2E72 A;  3HPS A;  2RS7 A;  4WXC A;  1X6H A;  3WU4 A;  5IWA E;  2O1W A;  2JR1 A;  4LF7 I;  4HAC B;  5KL4 A;  1B62 A;  3K6Q A;  1NZ0 A;  2IES A;  2O1U A;  4UT4 A;  5EL9 A;  1XNR I;  2YRM A;  3ADL A;  4LFB E;  1OYS A;  1A1L A;  4LF5 E;  2EPX A;  3DD6 A;  1IBL I;  3J81 Q;  2EPN A;  5A6J A;  5C0X D;  2EPL X;  2NUG A;  2EN7 A;  1PKP A;  1NCS A;  1J5E E;  2UUB I;  1OJ4 A;  1T38 A;  2YRK A;  2C39 A;  2EP3 A;  2PO0 A;  4R2P A;  5IT9 C;  2BA1 D;  3U1Y A;  3KWR A;  1FJG I;  1ZBT A;  4DV4 E;  4JI0 I;  2L8T A;  1VI7 A;  4DR6 E;  1HNW E;  3NZK A;  4P78 A;  1FKA E;  2EOQ A;  2WZO A;  1KYQ A;  4F2J C;  2JE6 B;  1EI1 A;  4JI3 I;  4B3R I;  1JK2 A;  3PS3 A;  1EKZ A;  1QNT A;  2RQL A;  2HHH E;  2JEA B;  3ZZT A;  2H36 X;  3HXL A;  4Z7C A;  1A1F A;  2BM0 A;  1T4O A;  1RMD A;  2ENH A;  4P7A A;  2V85 A;  4XTJ A;  4ZYG A;  3LTO A;  4USK A;  4OX9 E;  3ZM7 A;  4M2Z A;  2L3C A;  2E5L I;  3J80 Q;  2RTX A;  1K47 A;  4X65 I;  4K0K I;  4MYU A;  3UK3 C;  2BV3 A;  2YTN A;  4RH8 A;  5DNY A;  2BA0 G;  5C0X E;  5LMN I;  3ADJ A;  2CVE A;  1HNZ I;  5DRR A;  4R2D A;  3J7A G;  4BA2 B;  4YHH I;  4GQU A;  1X5W A;  2RSI A;  1XNQ E;  3HJC A;  4USM A;  2UXD I;  3GCM A;  1GTK A;  3PRY A;  2DIX A;  4PRV A;  2WBT A;  1EA6 A;  5LLQ A;  2EMG A;  3GME A;  1J26 A;  2YTG A;  1N0V C;  4HEI A;  4LFC I;  2D9H A;  4WUD A;  2EMK A;  1E3P A;  2UU9 I;  1UDO A;  4FWD A;  1XHK A;  2DB2 A;  2JY9 A;  1Z0C A;  1N32 E;  2EM4 A;  3ZZ0 A;  1XMO E;  4JI1 E;  2Q2E B;  1JK1 A;  4DV3 E;  4IS9 A;  5C0X B;  4DR4 E;  1YHC A;  4LF8 I;  5TSE A;  3DJW A;  2YTP A;  1X6F A;  3MHH C;  2WBU A;  1AH5 A;  3FIG A;  5LMU E;  2C39 B;  2ELY A;  2FTX B;  3EPK A;  2C37 B;  4EMD A;  4JI5 I;  2VE7 C;  2UXC E;  2CZ9 A;  4X64 I;  1WRJ A;  3L00 A;  4LTY A;  1UIL A;  1TF6 A;  2EOR A;  4MQY A;  5T6J A;  2ODR D;  4MLQ A;  1I94 I;  1IBL E;  4JI7 I;  4WPY A;  2EOM A;  1UDS A;  1XXE A;  2O1T A;  1WUU A;  3Q6M A;  4DV0 E;  3VYY A;  3F0N A;  2A2C A;  2EPU A;  1P42 A;  4IZK A;  4FW3 A;  1UBD C;  2YTI A;  2HJJ A;  4WSP A;  1FI4 A;  3P1X A;  4HAC A;  3OTO E;  3K1J A;  4LPF A;  2EOJ A;  2WW4 A;  3LML A;  3HKM A;  1Z5B A;  2MDR A;  2WCC 3;  3JTZ A;  2VQE E;  4LCH A;  3QT5 A;  2X36 A;  4DUY I;  2ODR C;  5A2Q Q;  5FLX C;  2Z5B A;  1WHN A;  1RQ0 A;  4O24 A;  1A1I A;  1FNM A;  1WHQ A;  1KIJ A;  1O0W A;  2ENA A;  1ZM4 A;  4X65 E;  4K0K E;  4OZE A;  2CGE A;  4DPT A;  1QU6 A;  2EMC A;  3OML A;  4F9A B;  1ZM3 A;  4B3S I;  1Y4U A;  2PRT A;  3EPL A;  4YY3 E;  5GME A;  1HK7 A;  2EPO A;  4DR7 E;  2JE6 A;  2R42 A;  2GO3 A;  4DUZ I;  1XMQ I;  4IFD D;  5C0X F;  4LF6 E;  4B3M I;  2CG9 A;  4BBY A;  2IER A;  2IOQ A;  2JEA A;  4KZS A;  1GZ6 A;  1ZR9 A;  2BA1 G;  1N34 E;  1ZXN A;  1MG7 A;  2JT2 A;  3V5R A;  2VQF I;  2B3T B;  1KKH A;  4MU1 A;  4JI2 I;  1PDA A;  5IXM B;  4QNK A;  2LMZ A;  4RPF A;  4LU9 A;  1YZ9 A;  2EQ0 A;  2EOO A;  3J7Y p;  1X49 A;  3MHS C;  1YUJ A;  2EN3 A;  2EOF A;  1UEK A;  2BM1 A;  3M6A A;  2UU9 E;  3P3G A;  2NA2 A;  4MU4 A;  2MDG A;  2RPC A;  1MGT A;  2HKE A;  4DV2 E;  4LF9 E;  4I8O A;  1PVG A;  2I9I A;  4FK5 C;  4QNJ A;  2ZM6 I;  4BA2 A;  2NN6 D;  2UXB E;  2EWL A;  2NUE A;  2EN2 A;  5A6B A;  1R6L A;  1QZR A;  3WU3 A;  4IFD C;  2VRD A;  4ISA A;  4IZJ D;  3WU6 A;  2EJ4 A;  3D4J A;  2JEB B;  4IFD E;  2DGC A;  1RHY A;  4DR3 E;  1F2I G;  4X64 E;  5JEA D;  2EOI A;  2EPM X;  2WBS A;  5GMD A;  3J81 C;  2JOX A;  2V34 A;  4Z7Y A;  2PNZ A;  2JXP A;  1G2D C;  2DEI A;  4GKJ I;  3PS2 A;  3BBG A;  2LTS A;  3ZZU A;  3T1Y I;  1Y6Z A;  5C0X A;  4UTG A;  2EFG A;  2F4V I;  3T1H I;  1USV A;  2DLK A;  2EOX A;  4ZYE A;  4B3T E;  1KJK A;  2NN6 C;  2Z5B B;  4FW7 A;  1IBM I;  4AQY I;  2PO1 A;  1DQ3 A;  2ADR A;  4GKK E;  2NN6 E;  3JAM Q;  5AE1 A;  2JVA A;  4OO1 D;  2C37 A;  3P3E A;  4IFD B;  5JEA C;  4X66 E;  1S16 A;  2M7Q A;  3EQ1 A;  4BC9 A;  4JYA I;  1R6M A;  4J8Z A;  1TF3 A;  2EMB A;  4X9J A;  2LJU A;  4R2A A;  3ZKB A;  1OYP A;  2EN4 A;  2DMI A;  1GQE A;  2HC5 A;  3J80 C;  4IS1 C;  1N33 E;  3P76 A;  1DAR A;  3ADG A;  4DV6 I;  4LF4 I;  2LVH A;  1SR9 A;  1N36 I;  2EMA A;  4JI4 I;  1IBK E;  2OI2 A;  4DU7 A;  3P3C A;  1VIS A;  3F6H A;  2M9A A;  4LFA E;  2DMY A;  2EM6 A;  4AID A;  4DR1 I;  4JV5 I;  2EPA A;  2EMF A;  2NN6 B;  1H73 A;  2WNR A;  4M1K A;  4OO1 C;  3AV0 A;  2EOH A;  2B7T A;  1YYO A;  1XMQ E;  1ZBQ A;  1N0U A;  4LCF A;  4F6N A;  2V2Q A;  3QT7 A;  2VQF E;  3B4T A;  2NPF A;  4JI2 E;  4DU8 A;  5AC4 A;  1Z0B A;  4DR2 E;  2EOY A;  3B8H A;  2L6M A;  3CDJ A;  1T4N A;  1BBG A;  4WXD A;  3PYG A;  2L2N A;  3QT8 A;  2JP9 A;  2EE8 A;  1S4E A;  3B78 A;  4U3D A;  4JI8 I;  4R2C A;  3C4T A;  2EM8 A;  1T39 A;  2GLI A;  1HR0 I;  4NXM I;  2PNZ B;  2ZM6 E;  2EQ3 A;  3KZY A;  1B63 A;  4NXN E;  1U2R A;  2R3V A;  4JI6 E;  2AE8 A;  3AUZ A;  2YTJ A;  2G7H A;  4ZYD A;  3P06 A;  5FWK A;  2UUC I;  3C4B A;  2BBG A;  2KHX A;  4FN5 A;  2EM9 A;  2LJP A;  2EN6 A;  4U3B A;  4DV1 I;  2M4I A;  4GZN C;  1HNX I;  2PO1 B;  2WP8 A;  2LT7 A;  4R03 A;  1H74 A;  1H72 C;  4R2Q A;  1KVK A;  2VES A;  4TUI A;  2FV4 B;  4LF7 E;  4HYM A;  4IFD F;  1EH7 A;  1NEI A;  1XNR E;  3M99 B;  2YTE A;  2CPN A;  5BR8 I;  4O5G A;  2F8B A;  2JWO A;  2N3H A;  2ELZ A;  3ADI A;  4R2E A;  3VYX A;  3ZOQ B;  4DMI A;  2EPC A;  1USU A;  4DR5 I;  3IWB A;  1BBO A;  2LCE A;  1EH8 A;  1Z5C A;  5IV8 B;  2UUB E;  2Z5C B;  2JEB A;  4X62 I;  1NHJ A;  4ZVI A;  1FJG E;  4FW4 A;  5K36 D;  3PS1 A;  3BF2 A;  4KHP I;  4JI0 E;  2WNR B;  4NHR A;  3M7N G;  2BR2 B;  2L33 A;  5A2Q C;  2N8X A;  2YSP A;  2LUP B;  2DLQ A;  4B3R E;  4KQV A;  4JI3 E;  2EZ6 A;  3IWD A;  4DKK A;  1UDQ A;  2LV2 A;  3C6K A;  5AC5 A;  1FWK A;  1WXR A;  2ZIT A;  1P47 A;  5DRQ A;  5IWA I;  2Q8U A;  1Z5A A;  5DRP A;  2EPR A;  2V2V A;  1Z0E A;  2EL4 A;  4X8W A;  3F6G A;  2MC5 A;  1PJS A;  5AE3 A;  2E5L E;  3PYE A;  1Z0V A;  4LFB I;  3IWC A;  4LOM A;  4LF5 I;  3JU0 A;  4ED4 A;  5KL6 A;  1A1K A;  3QT6 A;  5LMN E;  4JG4 A;  1X3C A;  4WYQ B;  4IFD A;  1HNZ E;  2YWQ A;  5K36 C;  4YHH E;  2PNL A;  1J5E I;  1N3G A;  5A6K A;  1DGC A;  4BHB A;  4DPU A;  2J65 A;  5K36 E;  5ADZ A;  2UXD E;  3ZKD A;  4DV4 I;  3HUL A;  3DF6 A;  4DR6 I;  1HNW I;  1RRE A;  5F3W A;  2WP8 B;  2J7J A;  4LFC E;  2HHH I;  3U1K A;  1Y60 A;  4OKG A;  2C38 B;  3CWV A;  3K85 A;  2NN6 A;  2MKD A;  2PNM A;  2IOP A;  1BKN A;  2A25 A;  2E1M A;  4OX9 I;  4F9C B;  4BCA A;  1RR9 A;  3LPS A;  4OOG C;  2EMX A;  2CT1 A;  4LF8 E;  4BS9 A;  5A6A A;  4IZJ A;  1Y5Y A;  2N3G A;  2E1R A;  5K36 B;  5JEA A;  1Z0G A;  4Q35 B;  2HK3 A;  4JI5 E;  4AIM A;  1PJT A;  2EM2 A;  3H1C A;  4HY1 A;  2Z5E A;  1WJP A;  5AAS A;  1Z1B A;  2I13 A;  5KL7 A;  1IQO A;  1IQS A;  2GO4 A;  1I94 E;  4DV7 I;  3JAM C;  1ZU1 A;  1MX0 A;  4JI7 E;  1UDN A;  3GLL A;  3VK6 A;  2PO2 A;  2GS8 A;  3HPZ A;  4OO1 A;  4DV5 I;  2R76 A;  4R1F A;  3V2U C;  1N32 I;  4O43 A;  1YYW A;  4JI1 I;  4DV3 I;  2YT4 A;  2LUQ A;  2JPA A;  1ZM2 A;  2V8P A;  2KON A;  4Q28 A;  1A1J A;  1OYR A;  4DR4 I;  3K17 A;  2EPP A;  2EPK X;  1AAY A;  4M9V C;  2LE2 A;  4P7D A;  4HTG A;  5LMU I;  4URL A;  4WSG A;  5JEA E;  1NHH A;  4DUY E;  2UXC I;  2EMI A;  2VF1 A;  1DI2 A;  2YU8 A;  2Z5C A;  2HFU A;  2HKJ A;  2L92 A;  4B3S E;  5KL5 A;  4DV0 I;  1T4L B;  1D6T A;  2BR2 A;  4DUZ E;  2EM3 A;  2EL6 A;  2EOE A;  4B3M E;  3J7A M;  4OO1 E;  2LBS B;  1H7U A;  4HXZ A;  2KOU A;  2JYA A;  5LL6 R;  4WFT A;  4I3H A;  4IZJ B;  1YPN A;  4O4K A;  2L3J A;  3HQ1 A;  3VHT B;  2B9D A;  2EM7 A;  2LO3 A;  3M85 D;  3OTO I;  1YYK A;  3RMP A;  5JEA B;  5K36 F;  2DEJ A;  2X7I A;  4M30 A;  5IT9 Q;  2MC6 A;  3HTX A;  1G2F C;  2VQE I;  1A1G A;  2O3Z A;  4BA1 A;  1PJQ A;  4GEQ B;  1TN9 A;  5C0X C;  5KL2 A;  1RC7 A;  3CDI A;  2EL5 A;  2HGH A;  2PO2 B;  3WU5 A;  2YZT A;  4FWG A;  4MU3 A;  4DXL A;  3THN A;  4YY3 I;  2HFS A;  4OO1 B;  4R2S A;  2CTD A;  2IHR 1;  4BMJ A;  4DR7 I;  4LCG A;  4BC7 A;  2K7I A;  3PYF A;  2FGG A;  2L2M A;  4R2R A;  1FWL A;  4LF6 I;  4IJD A;  3GON A;  2LTR A;  4PU9 A;  3BGH A;  2EM5 A;  4KWY A;  2C38 A;  3KRN A;  1N34 I;  4DV7 E;  4GKJ E;  2V88 A;  2DRP A;  3T1Y E;  4M0V A;  2F4V E;  1X47 A;  3T1H E;  1MEY C;  2UUA I;  1IBM E;  1B69 A;  4J3D A;  4FWH A;  4F9B B;  4DV5 E;  4AQY E;  5DRO A;  4DV2 I;  4WUB A;  4LF9 I;  3H09 A;  1A6F A;  4TUG A;  2L2K B;  5K36 A;  2UXB I;  5CFF E;  2AJ4 A;  4F54 A;  2XEX A;  1IMU A;  1Z0W A;  4FW6 A;  3MSW A;  4JYA E;  2NN6 F;  2JOB A;  1MU5 A;  2PO0 B;  2EOZ A;  4DR3 I;  4DPY A;  4MDT A;  4MLV A;  4DV6 E;  4LF4 E;  5KL3 A;  3L7Z A;  1A1H A;  2MKN A;  1N36 E;  5JEA F;  4JI4 E;  4PRX A;  4NBQ A;  2YRH A;  2YPN A;  3BID A;  4DR1 E;  4JV5 E;  3TQM A;  1YSA C;  1ZM9 A;  1BB8 A;  2BA0 D;  5ELW A;  1LLM C;  4B3T I;  1YH8 A;  1ELO A;  3KZZ A;  5AE2 A;  1SFE A;  2F1D A;  4BA1 B;  1ZXM A;  2VF3 A;  1STU A;  1NHI A;  4GKK I;  2V89 A;  2RSM A;  2YU5 A;  4N3O A;  2YTF A;  2YTQ A;  5DNL A;  2EOS A;  3PYD A;  5A69 A;  3THO B;  2ZBK B;  2J7K A;  4WX9 A;  2V2Z A;  4MU0 A;  4X66 I;  1EH6 A;  4RHB B;  2NUF A;  1X6E A;  3B82 A;  4OO1 F;  4AM3 A;  2NAB A;  3C6M A;  2LJH A;  4JI8 E;  2R1F A;  2YSO A;  3LNU A;  1N33 I; 
#chains in the Genus database with same CATH homology
 1HR0 E;  4NXM E;  4MYT A;  3Q1Q A;  2LJH A;  2LRS A;  4L8N A;  4DPX A;  1IBK I;  2UUC E;  2HK2 A;  4LFA I;  5FLX Q;  3Q6N A;  1HNX E;  4DV1 E;  1PIE A;  2RS6 A;  1Z0T A;  1X48 A;  5L3J A;  4R8O A;  1XNQ I;  4P52 A;  2A2D A;  5BR8 E;  2V83 A;  3H4L A;  4DPW A;  4FW9 A;  4DR2 I;  1Z59 A;  2V8Q B;  2UUA E;  1Y4S A;  2GQ0 A;  2M1S A;  4L5N C;  4DR5 E;  2V87 A;  1H7S A;  4X62 E;  4NXN I;  1XMO I;  4KHP E;  1KTV A;  4JI6 I;  4IZK B;  1UHZ A;  4WUC A;  2O1V A;  2DSY A;  2K4V A;  2B7V A;  2V86 A;  3HPS A;  3LLH A;  2RS7 A;  3WU4 A;  5IWA E;  2O1W A;  2JR1 A;  4LF7 I;  4HAC B;  1B62 A;  3K6Q A;  1NZ0 A;  2O1U A;  4UT4 A;  1XNR I;  3ADL A;  4LFB E;  4LF5 E;  1IBL I;  3J81 Q;  2NUG A;  1PKP A;  1J5E E;  2UUB I;  1OJ4 A;  5IT9 C;  3KWR A;  1FJG I;  1ZBT A;  4DV4 E;  4JI0 I;  2L8T A;  4DR6 E;  1HNW E;  4P78 A;  1FKA E;  4B3R I;  2WZO A;  1EI1 A;  4JI3 I;  1EKZ A;  2HHH E;  3ZZT A;  2H36 X;  3HXL A;  4Z7C A;  2BM0 A;  4P7A A;  1T4O A;  4XTJ A;  2V85 A;  3LTO A;  4USK A;  4OX9 E;  3ZM7 A;  4M2Z A;  2L3C A;  2E5L I;  3J80 Q;  2RTX A;  1K47 A;  4X65 I;  4K0K I;  4MYU A;  2BV3 A;  5DNY A;  5LMN I;  3ADJ A;  1HNZ I;  3J7A G;  4YHH I;  1XNQ E;  3HJC A;  4USM A;  2UXD I;  3PRY A;  2DIX A;  4PRV A;  1EA6 A;  1J26 A;  1N0V C;  4LFC I;  4WUD A;  2UU9 I;  4FWD A;  1XHK A;  2DB2 A;  2JY9 A;  1Z0C A;  1N32 E;  3ZZ0 A;  1XMO E;  4JI1 E;  2Q2E B;  4DV3 E;  4DR4 E;  4LF8 I;  3DJW A;  5LMU E;  3FIG A;  2FTX B;  4EMD A;  4JI5 I;  2VE7 C;  2UXC E;  2CZ9 A;  4X64 I;  4LTY A;  1UIL A;  5T6J A;  2ODR D;  1I94 I;  1IBL E;  4JI7 I;  4WPY A;  2O1T A;  1WUU A;  3Q6M A;  4DV0 E;  3VYY A;  3F0N A;  2A2C A;  4IZK A;  4WSP A;  1FI4 A;  3P1X A;  4HAC A;  3OTO E;  3K1J A;  2WW4 A;  3LML A;  1Z5B A;  2MDR A;  2VQE E;  3JTZ A;  3QT5 A;  2X36 A;  4DUY I;  2ODR C;  5A2Q Q;  5FLX C;  2Z5B A;  1WHN A;  1RQ0 A;  1FNM A;  1WHQ A;  1KIJ A;  1O0W A;  1ZM4 A;  4X65 E;  4K0K E;  2CGE A;  4DPT A;  1QU6 A;  3OML A;  4F9A B;  1ZM3 A;  4B3S I;  1Y4U A;  4YY3 E;  5GME A;  1HK7 A;  4DR7 E;  2R42 A;  1XMQ I;  4DUZ I;  4LF6 E;  4B3M I;  2CG9 A;  4BBY A;  2IOQ A;  4KZS A;  1GZ6 A;  1N34 E;  1ZXN A;  1MG7 A;  3V5R A;  2VQF I;  2B3T B;  1KKH A;  4JI2 I;  4RPF A;  2LMZ A;  4LU9 A;  1YZ9 A;  2BM1 A;  3J7Y p;  1X49 A;  3QT7 A;  1UEK A;  3M6A A;  2UU9 E;  2NA2 A;  2HKE A;  4DV2 E;  4LF9 E;  4I8O A;  1PVG A;  2ZM6 I;  2UXB E;  2EWL A;  2NUE A;  1QZR A;  3WU3 A;  4IZJ D;  3WU6 A;  3D4J A;  4DR3 E;  4X64 E;  5GMD A;  3J81 C;  2JOX A;  2V34 A;  4Z7Y A;  2DEI A;  4GKJ I;  3ZZU A;  2LTS A;  3T1Y I;  2F4V I;  1Y6Z A;  4UTG A;  2EFG A;  3T1H I;  1USV A;  4B3T E;  1IBM I;  2Z5B B;  4AQY I;  1DQ3 A;  4GKK E;  3JAM Q;  5AE1 A;  2JVA A;  4X66 E;  1S16 A;  2M7Q A;  4BC9 A;  4JYA I;  4J8Z A;  3ZKB A;  3J80 C;  1GQE A;  1N33 E;  1DAR A;  3ADG A;  4DV6 I;  4LF4 I;  1N36 I;  4JI4 I;  1IBK E;  2OI2 A;  4DU7 A;  1VIS A;  3F6H A;  4LFA E;  2DMY A;  4DR1 I;  4JV5 I;  4M1K A;  1H73 A;  3AV0 A;  1XMQ E;  2B7T A;  1YYO A;  1ZBQ A;  1N0U A;  2V2Q A;  2VQF E;  2NPF A;  4JI2 E;  4DU8 A;  1Z0B A;  4DR2 E;  3B8H A;  2L6M A;  1T4N A;  3QT8 A;  3PYG A;  2L2N A;  1S4E A;  3B78 A;  4JI8 I;  3C4T A;  1HR0 I;  4NXM I;  2ZM6 E;  1B63 A;  4NXN E;  1U2R A;  2R3V A;  4JI6 E;  3AUZ A;  3P06 A;  2G7H A;  2UUC I;  5FWK A;  3C4B A;  2KHX A;  4FN5 A;  2LJP A;  4DV1 I;  1HNX I;  2M4I A;  1H74 A;  4R03 A;  1H72 C;  1KVK A;  4TUI A;  2FV4 B;  4LF7 E;  4HYM A;  1XNR E;  2CPN A;  5BR8 I;  2F8B A;  2JWO A;  2N3H A;  3ADI A;  3VYX A;  3ZOQ B;  4DMI A;  1USU A;  4DR5 I;  3IWB A;  1Z5C A;  2UUB E;  2Z5C B;  4X62 I;  1NHJ A;  4ZVI A;  1FJG E;  4KHP I;  4JI0 E;  2L33 A;  5A2Q C;  2LUP B;  4B3R E;  4KQV A;  4JI3 E;  2EZ6 A;  3IWD A;  4DKK A;  1FWK A;  1WXR A;  2ZIT A;  5IWA I;  1Z5A A;  2V2V A;  1Z0E A;  4X8W A;  3F6G A;  2MC5 A;  5AE3 A;  2E5L E;  3PYE A;  4LFB I;  1Z0V A;  3IWC A;  4LF5 I;  3JU0 A;  4ED4 A;  3QT6 A;  5LMN E;  4JG4 A;  4WYQ B;  1HNZ E;  4YHH E;  2PNL A;  1J5E I;  4DPU A;  5ADZ A;  2UXD E;  3ZKD A;  4DV4 I;  3HUL A;  3DF6 A;  4DR6 I;  1HNW I;  1RRE A;  5F3W A;  4LFC E;  2HHH I;  3CWV A;  3K85 A;  2PNM A;  2IOP A;  1BKN A;  2E1M A;  4OX9 I;  4F9C B;  4BCA A;  1RR9 A;  3LPS A;  4OOG C;  4LF8 E;  4BS9 A;  4IZJ A;  2N3G A;  2E1R A;  1Z0G A;  2HK3 A;  4JI5 E;  4HY1 A;  2Z5E A;  5AAS A;  1I94 E;  4DV7 I;  3JAM C;  1MX0 A;  4JI7 E;  3VK6 A;  2GS8 A;  3HPZ A;  4DV5 I;  4R1F A;  3V2U C;  1N32 I;  4JI1 I;  1YYW A;  4DV3 I;  2YT4 A;  2LUQ A;  1ZM2 A;  2V8P A;  2KON A;  4Q28 A;  4DR4 I;  3K17 A;  2LE2 A;  4P7D A;  5LMU I;  1NHH A;  4DUY E;  2UXC I;  2VF1 A;  1DI2 A;  2Z5C A;  2HFU A;  2HKJ A;  2L92 A;  4B3S E;  4DV0 I;  1D6T A;  1T4L B;  4DUZ E;  4B3M E;  3J7A M;  2LBS B;  1H7U A;  4HXZ A;  2KOU A;  5LL6 R;  4I3H A;  4WFT A;  4URL A;  4IZJ B;  2L3J A;  3HQ1 A;  2B9D A;  3OTO I;  1YYK A;  3RMP A;  2DEJ A;  2X7I A;  4M30 A;  5IT9 Q;  2MC6 A;  3HTX A;  2VQE I;  4GEQ B;  1RC7 A;  4DXL A;  3WU5 A;  2YZT A;  4FWG A;  4YY3 I;  2HFS A;  2IHR 1;  4BMJ A;  4DR7 I;  4BC7 A;  3PYF A;  2FGG A;  2L2M A;  1FWL A;  4LF6 I;  3GON A;  2LTR A;  4PU9 A;  1N34 I;  4DV7 E;  4GKJ E;  2V88 A;  2F4V E;  3T1Y E;  4M0V A;  1X47 A;  3T1H E;  2UUA I;  1IBM E;  4FWH A;  4F9B B;  4DV5 E;  4AQY E;  4DV2 I;  4WUB A;  4LF9 I;  3H09 A;  1A6F A;  4TUG A;  2L2K B;  2UXB I;  5CFF E;  2AJ4 A;  4F54 A;  2XEX A;  1Z0W A;  3MSW A;  4JYA E;  2JOB A;  1MU5 A;  4DR3 I;  4DPY A;  4DV6 E;  4LF4 E;  1N36 E;  4JI4 E;  4PRX A;  1ZM9 A;  4DR1 E;  4JV5 E;  4B3T I;  1ELO A;  5AE2 A;  1ZXM A;  2VF3 A;  1STU A;  1NHI A;  4GKK I;  2V89 A;  2RSM A;  4N3O A;  3PYD A;  2ZBK B;  2J7K A;  2V2Z A;  4X66 I;  3B82 A;  2NUF A;  1SR9 A;  4JI8 E;  3LNU A;  1N33 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...