4X62E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x62E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x62E02
2EZ6A 2R42A 4MYTA 1FNMA 4DR3I 4X66E 2LTSA 1NHJA 4KQVA 1UILA 3LNUA 4FWGA 1H7UA 2VQFE 1XMOE 1Z0TA 1ZXNA 4RPFA 3VYXA 1NZ0A 2DEJA 4DR5I 3PYFA 4GKKE 1Z59A 1ZM3A 5LL6R 1RC7A 1HNXE 3QT8A 3QT5A 4DR5E 4DUZI 5FLXC 1UEKA 2UXCE 2KHXA 4DV3E 5LMUE 2WW4A 4DV1E 4DUZE 3B82A 4JYAI 1DARA 1HNWI 3K1JA 4KHPI 1OJ4A 2E5LE 5IT9C 1PKPA 1ZBTA 4DR2I 1HR0I 4KHPE 1RQ0A 2CPNA 2EFGA 4X62I 4HYMA 4B3ME 2V2ZA 3WU5A 1UHZA 3Q1QA 1XHKA 3LLHA 1ZM9A 2V8PA 4K0KI 4FN5A 1I94E 1PIEA 1Z0WA 4DV2I 2ZITA 1WHNA 1ELOA 4YHHI 3ADGA 3ZKDA 5IWAE 1Z5BA 4DPTA 4PRXA 1EI1A 2L2MA 1H73A 1B62A 4DPUA 2DEIA 1KKHA 5GMEA 4X62E 2J7KA 1HNZI 5LMNI 1ZM2A 2Q2EB 4GKKI 1X49A 2V34A 5CFFE 1O0WA 2RS7A 1T4LB 1QZRA 4USKA 2B7TA 4LFAE 3T1YE 4M2ZA 4DV2E 2LUPB 2HFSA 4JI5I 3J7Yp 2NA2A 4DV3I 1H7SA 5L3JA 3F0NA 2L33A 1XMQI 3WU3A 3ADJA 2NPFA 4HACA 1H74A 3P1XA 2V2VA 2JVAA 2HK2A 4OX9E 1B63A 2A2CA 4JG4A 4MYUA 4LF6E 1KIJA 1J5EI 4JI6E 3LTOA 2YT4A 2OI2A 4URLA 1RR9A 4UTGA 4B3RE 4AQYI 1IBME 2LTRA 4JI6I 4WYQB 1KVKA 4DV6E 4XTJA 2VQEE 2L3CA 1XNRI 4LF7E 1XNQI 4DR1I 1BKNA 4DV1I 4HY1A 2R3VA 3J7AM 1FWLA 3GONA 1WHQA 3C4TA 4DV0E 4LF4E 4X64E 4NXMI 1XNQE 4LF7I 2UUBI 4X66I 1YYOA 3B78A 1J26A 2VF3A 5BR8I 4DR6E 2F4VI 2UUBE 2NUEA 1N34E 2UXDE 1Z0GA 3ZZTA 3CWVA 4LF5E 4JI4E 3D4JA 2V2QA 4ED4A 4PRVA 4WFTA 1WUUA 4DPYA 3K17A 4LFBE 4DV5I 4DKKA 3T1HI 4M30A 2AJ4A 4LF5I 3JAMQ 2UXCI 3ZZUA 3LPSA 1MX0A 1DI2A 4DV4I 1A6FA 4JI1E 5LMUI 1FWKA 4JI8I 2IHR1 1FI4A 5A2QQ 4LFCE 4JI1I 4WUDA 4DR2E 4WUBA 3WU4A 1IBMI 4DU7A 4JI7I 1GQEA 2HKJA 4WUCA 4B3SE 4DU8A 3QT6A 4JV5E 1N33E 1S4EA 2HKEA 2BM0A 1N0VC 4EMDA 4GKJE 1IBKI 4LF9E 2X36A 3V5RA 1NHIA 1N33I 3QT7A 2A2DA 1Z0VA 2UXBI 1N36I 2UU9I 4R1FA 1MU5A 1RREA 2BV3A 5GMDA 1T4OA 4DR3E 1HNWE 1STUA 2DMYA 2UUAE 3V2UC 1IBLE 4ZVIA 4P52A 2JY9A 4YY3I 2VQEI 1VISA 3B8HA 2UUAI 2RS6A 4DV7E 4Z7YA 2MDRA 2LBSB 2UU9E 4DR1E 1HNXI 3HULA 3WU6A 4X65I 2ZM6E 2L2NA 4DV0I 4I3HA 2HHHE 4K0KE 4NXME 1EA6A 4YHHE 2HFUA 2LJPA 1X47A 4DR6I 2E1RA 2E5LI 4JI7E 2RTXA 1MG7A 3ADLA 2VQFI 4DXLA 3HTXA 1Z5AA 1ZXMA 4USMA 3ZZ0A 4DPXA 3M6AA 2X7IA 4B3TI 4B3MI 2RSMA 1YZ9A 2CZ9A 3C4BA 3ZM7A 5IT9Q 1FKAE 2LJHA 2UUCE 4B3TE 1EKZA 4JI2E 4X8WA 1S16A 3PYDA 2LUQA 4LF4I 5IWAI 4JI3I 5BR8E 4JI2I 1J5EE 4DR4I 3OTOI 2B7VA 5LMNE 4NXNE 4DPWA 1HNZE 4DV7I 4FW9A 1Z0BA 1HR0E 1FJGI 2ZM6I 4JI0I 1XNRE 4DV5E 1N36E 2HHHI 3T1HE 2XEXA 4DV4E 1T4NA 4DUYI 5A2QC 2LRSA 1N0UA 4LF8E 3J80Q 2HK3A 4DR4E 1QU6A 1K47A 4OX9I 3H4LA 4HXZA 4LF6I 4LF8I 1YYWA 1IBLI 3PYGA 4JYAE 2DIXA 2L2KB 1YYKA 1N34I 4B3SI 1FJGE 4YY3E 4AQYE 1ZM4A 1Z5CA 1U2RA 1Z0CA 4DR7E 1N32I 4GKJI 1XMOI 2DB2A 4LFBI 4FWDA 4DUYE 4X65E 1IBKE 2N3HA 2ZBKB 4LFAI 4JI5E 2GS8A 2NUGA 4P7AA 2UXBE 5FLXQ 1XMQE 4Z7CA 4X64I 4FWHA 3J81C 3J80C 3J7AG 4JI8E 3VYYA 3OTOE 4LFCI 4NXNI 4OOGC 2N3GA 4HACB 1N32E 4DR7I 2UXDI 4PU9A 4JV5I 4UT4A 2F4VE 4JI0E 2NUFA 3ZKBA 4B3RI 1D6TA 4DV6I 4JI4I 4M1KA 2L3JA 2BM1A 1Z0EA 1X48A 3J81Q 4LF9I 2UUCI 1KTVA 3T1YI 3ADIA 1PVGA 3PYEA 3JAMC 2B3TB 4JI3E 1NHHA 1H72C 1I94I
chains in the Genus database with same CATH superfamily
2VE7C 2EZ6A 3THNA 2R42A 4MYTA 1FNMA 4NBQA 4DR3I 2ENHA 3PS2A 4X66E 2LTSA 1NHJA 2EPMX 4KQVA 5JEAD 2MKNA 5JEAF 2EOIA 4BHCA 1TF6A 1UILA 3LNUA 4FWGA 2EPRA 4F6NA 4TUIA 2WBTA 1H7UA 1OYRA 5DNYA 2BA0D 4AIMA 1E3PA 2VQFE 2D9HA 2LO3A 1XMOE 1Z0TA 1ZXNA 4RPFA 2EPZA 2YTEA 3VYXA 2PRTA 1NZ0A 2R1FA 4ZYDA 2DEJA 4R03A 2PO2B 4DR5I 3PYFA 4GKKE 1BBOA 1Z59A 1ZM3A 2LE2A 1T38A 5LL6R 4U3DA 4IFDF 1RC7A 1HNXE 2EN8A 1NEIA 2WZOA 1YSAC 2ODRD 1ZAAC 2NN6A 2Z5EA 3Q6NA 3QT8A 3QT5A 1VI7A 5KL6A 4R2AA 4DR5E 4TUGA 3FIGA 4ZYEA 3HXLA 4DUZI 5FLXC 5K36A 4M9VC 1UEKA 2WNRA 2UXCE 2KHXA 1DGCA 4DV3E 5LMUE 2WW4A 4J3DA 3MHSC 4DV1E 4OO1F 2EMAA 4OO1D 4DUZE 5JEAA 3B82A 3Q6MA 4JYAI 1DARA 4FW6A 1HNWI 4MLQA 3K1JA 4O4KA 4KHPI 3L7ZA 1ZU1A 2YTGA 2MC5A 1OJ4A 1AH5A 2E5LE 2BR2B 4MU0A 5IT9C 2VF1A 2EOYA 1PKPA 1ZBTA 4DR2I 5K36B 2EN1A 3P3CA 4GEQB 2AE8A 2EOFA 3TQMA 1A1GA 1WRJA 2E72A 2EPUA 2YRMA 4KHPE 4GQUA 1HR0I 2JEAA 1RQ0A 2CPNA 2ELZA 4HTGA 2EFGA 4X62I 1OYSA 2YTNA 4HYMA 3ZOQB 2R76A 5A6KA 4B3ME 1IMUA 2V2ZA 5A6JA 2DRPA 1KJKA 4OKGA 4WXCA 3WU5A 3H09A 2BR2A 1UHZA 5C0XA 4OO1C 5EKWA 3Q1QA 4RH8A 2O1VA 2EMBA 1XHKA 4P78A 4MQYA 3LLHA 1ZM9A 2I9IA 2V8PA 4IS9A 4K0KI 4NZVA 4FN5A 1I94E 2JEAB 1PIEA 3VK6A 1Z0WA 4DV2I 2ZITA 1WHNA 1A1LA 3M85G 2EMHA 2FTXB 4LTYA 3HKMA 3M85D 2EM3A 3IWDA 2JP9A 1UN6B 1ELOA 4YHHI 3ADGA 3ZKDA 5IWAE 1Z5BA 4DPTA 4PRXA 2O3ZA 1EI1A 2YZTA 4KWYA 2L2MA 3U1YA 4M0VA 1H73A 2EMIA 1B62A 3KWRA 1Y60A 4IZKA 2DEIA 4DPUA 5K36C 1KKHA 3B4TA 4X62E 3JTZA 2IOQA 3RMPA 2J7KA 5GMEA 3C6KA 5LMNI 1HNZI 1ZM2A 2Q2EB 4GKKI 1X49A 3EPKA 2CG9A 2V34A 2JEBB 2JT2A 5CFFE 5IV8B 2Z5BA 1O0WA 2RS7A 1T4LB 1QZRA 4MLVA 5JEAC 4USKA 2B7TA 4IFDB 3MSWA 1X5WA 2V87A 4LFAE 3T1YE 4M2ZA 2HJJA 4DV2E 2LUPB 3PS1A 2YWQA 2HFSA 5C0XD 4JI5I 5ADZA 3J7Yp 2NA2A 4FW7A 4DV3I 3IWBA 1H7SA 5L3JA 4X9JA 3VHTB 3F0NA 2EPOA 2GQ0A 2L33A 2NN6C 1XMQI 2Z5BB 3KRNA 3DD6A 3WU3A 1JK1A 3PS3A 3ADJA 3JU0A 2NPFA 1G2FC 3K85A 4HACA 4LCFA 2ODRC 2CTDA 3EPJA 1H74A 1X6HA 3P1XA 3BIDA 2V2VA 2JVAA 3F6HA 4R2DA 2ENCA 4OX9E 1B63A 2A2CA 4J8ZA 2HK2A 4JG4A 4MYUA 4LF6E 2EM4A 2CVEA 1KIJA 1P47A 1J5EI 2PNMA 2YTDA 2ENAA 5AE3A 4JI6E 3LTOA 2EPNA 2WCC3 2YT4A 2OI2A 2J65A 3HPSA 1RR9A 4FW3A 4URLA 4UTGA 4IFDD 2EPAA 4B3RE 4AQYI 1IBME 4OO1E 1YHCA 1QNTA 2LTRA 1A1HA 1PJSA 4O24A 4JI6I 4WYQB 1KVKA 4F2JC 4QNKA 2NN6E 4FW4A 4DV6E 4XTJA 2VQEE 2L3CA 2EMXA 4KZSA 3BF2A 1XNRI 3U1KA 1GTKA 3MHHC 2JOBA 3EPLA 2PO1A 2LV2A 5C0XF 3HPZA 4BMJA 4BA1B 2GPIA 4LF7E 1XNQI 4DR1I 1BKNA 2VESA 4DV1I 5DRQA 2WBUA 4F9AB 4HY1A 2EOEA 2J7JA 2L92A 1PDAA 1FWLA 1X6EA 1UDSA 1WHQA 2R3VA 3GONA 3C4TA 4DV0E 4LF4E 4X64E 2EQ3A 2V83A 4NXMI 2EMLA 2LVHA 1XNQE 4LF7I 2CT1A 1X3CA 2UUBI 4N3OA 1PJTA 4X66I 3QG5C 2YPNA 2YRHA 1YYOA 4OZEA 4OO1A 2EN4A 3B78A 2EMFA 1J26A 2VF3A 2PO1B 5BR8I 2EPPA 4BA1A 4DR6E 2BA1G 2PO2A 3PRYA 2UUBE 2NUEA 2F4VI 2JYAA 3IWCA 1N34E 2GO4A 2UXDE 1Z0GA 5KL4A 2A25A 1PJQA 3CWVA 3ZZTA 2NN6B 4LF5E 4JI4E 3D4JA 2V2QA 4P7DA 4ED4A 4PRVA 4I8OA 4WFTA 2EM8A 1WUUA 5K36D 5K36F 4DPYA 5AC4A 3K17A 4OO1B 2YRKA 2YSOA 4LFBE 4DV5I 1BB8A 2WNRB 2EMGA 4DKKA 4LCGA 4M30A 3T1HI 2AJ4A 4MDTA 4BS9A 4IS1C 2VRDA 3JAMQ 4LF5I 2MC6A 4WXDA 1YUJA 1R6LA 3NZKA 2UXCI 2YTJA 1AAYA 3HJCA 2EE8A 2V89A 5KL2A 3ZZUA 1A1KA 1MX0A 1DI2A 3LPSA 1A6FA 4DV4I 2C37B 4JI1E 1XXEA 5LMUI 4Q35B 1FWKA 4L8NA 4JI8I 2IHR1 3M7NG 4O43A 4WSGA 4GZNC 1FI4A 4Q28A 5A2QQ 2EOMA 2EOXA 4LFCE 4JI1I 3CDIA 4DR2E 4WUDA 1Y4UA 5LLQA 4WUBA 3WU4A 2EP3A 1RMDA 1IBMI 2KONA 4BBYA 1NCSA 4DU7A 4JI7I 2L8TA 1GQEA 2HKJA 4WUCA 1F2IG 4B3SE 3QT6A 4JV5E 4DU8A 1N3GA 4BC9A 1N33E 1IQOA 1S4EA 5C0XB 1YPNA 5A6BA 4F6MA 4MU4A 4AIDA 2L6MA 2EMZA 2HKEA 2BM0A 1N0VC 1UDQA 4EMDA 3M7ND 4GKJE 5C0XE 1IBKI 4LF9E 2F1DA 2X36A 3V5RA 4BCAA 1NHIA 3P06A 1N33I 4R2PA 1E3HA 2A2DA 3GCMA 3QT7A 1Z0VA 5AE2A 2PO0A 2UXBI 1N36I 4NHRA 4FW5A 2C38B 2M9AA 2BB8A 2GLIA 4ISAA 2G7HA 2UU9I 3CDJA 2MDGA 4R1FA 2EPKX 4LU9A 5FWKA 2JOXA 2HGHA 3EPHA 1MU5A 2RQLA 1RREA 2BV3A 5GMDA 1T4OA 4DMIA 5AE1A 4DR3E 1HNWE 4ZYHA 4L5NC 4R2EA 2EPCA 1STUA 2JEBA 2C38A 2EPLX 2DMYA 2UUAE 3V2UC 2EJ4A 2IESA 1IBLE 1UBDC 4IFDA 2HC5A 4ZVIA 5C0XC 2Q8UA 4P52A 2JY9A 4BA2B 3LMLA 4R2QA 4YY3I 2VQEI 1DQ3A 1VISA 3B8HA 2UUAI 2N8XA 2RS6A 4DV7E 4Z7YA 5DNLA 2EN7A 5KL3A 5JEAE 1A1JA 2JE6B 2MDRA 2LBSB 2DSYA 2UU9E 4DR1E 1TN9A 5F3WA 2C39A 3HULA 3WU6A 4X65I 1HNXI 4R2CA 2ZM6E 2O1UA 2IERA 4MU3A 2L2NA 1P42A 3OMLA 4DV0I 4I3HA 2HHHE 1YUIA 4K0KE 3P3EA 4NXME 4BA2A 3M99B 2YTOA 2V86A 1EA6A 2YTFA 4YHHE 1GZ6A 1KYQA 2EMYA 2HFUA 2LT7A 3KZYA 1T39A 2M4IA 2LJPA 3H1CA 1X47A 3GMEA 4DR6I 2E1RA 2E5LI 2IOPA 4JI7E 1IQSA 2RTXA 1MG7A 5ELWA 3BGHA 2NN6D 2NN6F 2EOJA 2EM0A 3KZZA 3ADLA 1JK2A 2VQFI 2RPCA 4DXLA 3HTXA 1Z5AA 1ZXMA 3AUZA 1RHYA 4USMA 2M1SA 3P76A 3ZZ0A 4RHBB 5A69A 2GHFA 2EM5A 4DPXA 2YSPA 1Y4SA 4HEIA 3M6AA 4BHBA 1A1FA 2JPAA 2X7IA 2EPXA 4B3TI 4B3MI 2RSMA 1YZ9A 4R8OA 2CZ9A 3C4BA 1HK7A 3ZM7A 5IT9Q 2LMZA 1FKAE 2LJHA 1EH6A 2UUCE 2YU5A 4B3TE 2FV4B 1ZR9A 1EKZA 4X8WA 4JI2E 1R6MA 1S16A 3PYDA 2FGGA 5KL7A 4U3BA 2LUQA 2EQ1A 4LF4I 3K6QA 2EM9A 5IWAI 2JR1A 3BBGA 2BBGA 5DRPA 1MEYC 2NABA 4JI3I 2LJUA 2EN3A 5BR8E 4JI2I 2PNZA 1J5EE 1LLMC 4DR4I 2RSIA 2B7VA 5JEAB 3OTOI 5LMNE 4IFDC 4NXNE 4BC7A 5DROA 4DPWA 3L00A 1SFEA 2ADRA 4IZJD 4LCHA 3L7ZB 1HNZE 5EL9A 3C6MA 4DV7I 2EMKA 2EOSA 4FW9A 1Z0BA 1HR0E 2O1WA 1FJGI 1UDNA 2EOOA 2V85A 2ZM6I 2PNZB 2WBSA 4JI0I 1XNRE 2EOZA 4DV5E 1N36E 3UK3C 1SR9A 5DNXA 2HHHI 3T1HE 2XEXA 2C37A 1YFHA 4DV4E 1T4NA 4DUYI 5A2QC 2LRSA 4MU1A 1N0UA 1B69A 4LF8E 3J80Q 1EH8A 2Z5CA 2YTPA 1X6FA 5AASA 2HK3A 4DR4E 3EQ1A 2CGEA 1QU6A 2EM6A 2CSHA 1K47A 4OX9I 4R2RA 3H4LA 4HXZA 2B9DA 2EM2A 4LF6I 2EMWA 4LF8I 1YYWA 1IBLI 1G2DC 4JYAE 3PYGA 3AV0A 2DIXA 5A6AA 2L2KB 1YYKA 4F9BB 2EWLA 1N34I 4B3SI 1FJGE 4YY3E 1MGTA 2PNLA 5T6JA 4F54A 4AQYE 1ZM4A 1Z5CA 2Z5CB 4FK5C 2F8BA 2V88A 1U2RA 1Z0CA 4IZKB 4O5GA 4DR7E 1N32I 2EOQA 1USVA 4GKJI 3DF6A 1XMOI 2JWOA 2KOUA 4WPYA 1Y5YA 2DB2A 1Y6ZA 4LFBI 4AM3A 4FWDA 4DUYE 4X65E 5TSEA 2PO0B 2EN2A 1OYPA 1IBKE 3F6GA 2N3HA 4WX9A 5IXMB 3GLLA 2ZBKB 4LFAI 5AC5A 4JI5E 2BA1D 2GS8A 2BA0G 5K36E 2NUGA 4P7AA 2I13A 2UXBE 2WP8B 4IFDE 2K7IA 5FLXQ 5KL5A 4IJDA 2M7QA 1XMQE 2EMCA 2EOHA 4N4RB 4Z7CA 2DLQA 2EL4A 4X64I 2EORA 3J81C 3HQ1A 4FWHA 2YU8A 3J80C 3J7AG 4JI8E 3VYYA 3OTOE 4WSPA 4LFCI 4NXNI 4OOGC 2N3GA 1TF3A 1YH8A 1USUA 1WJPA 3J7AM 3THOB 4HACB 1N32E 4IZJB 2YTQA 4R2SA 2WP8A 2GO3A 4DR7I 2DGCA 1A1IA 4LPFA 3DJWA 2UXDI 4PU9A 4JV5I 2V8QB 2EL5A 1WXRA 5DRRA 1Z1BA 4UT4A 2F4VE 2JE6A 4JI0E 4QNJA 4ZYGA 2EN6A 2NUFA 3ZKBA 2DLKA 2C39B 3P3GA 4B3RI 1ZBQA 1D6TA 4F9CB 4DV6I 4JI4I 2DMIA 4M1KA 2L3JA 2BM1A 1Z0EA 1X48A 2K4VA 4IZJA 3J81Q 4LF9I 5A6BD 2UUCI 1KTVA 3T1YI 2EQ0A 3UHMA 1BBGA 2MKDA 2E1MA 2O1TA 2ELYA 3ADIA 2YTIA 1PVGA 3PYEA 1L4SA 3JAMC 2H36X 2JXPA 2EM7A 2B3TB 1UDOA 2EL6A 2LCEA 3ECRA 4JI3E 1NHHA 4LOMA 1EH7A 1H72C 1I94I
chains in the Genus database with same CATH topology
2VE7C 2EZ6A 2R42A 4MYTA 1FNMA 4DR3I 4X66E 2LTSA 1NHJA 4KQVA 1UILA 3LNUA 4FWGA 4TUIA 1H7UA 5DNYA 2VQFE 1XMOE 1Z0TA 1ZXNA 4RPFA 3VYXA 1NZ0A 2DEJA 4R03A 4DR5I 3PYFA 4GKKE 1Z59A 1ZM3A 2LE2A 5LL6R 1RC7A 1HNXE 2Z5EA 2WZOA 3Q6NA 2ODRD 3QT8A 3QT5A 4DR5E 4TUGA 3FIGA 3HXLA 4DUZI 5FLXC 1UEKA 2UXCE 2KHXA 4DV3E 5LMUE 2WW4A 4DV1E 4DUZE 3B82A 3Q6MA 4JYAI 1DARA 1HNWI 3K1JA 4KHPI 1OJ4A 2MC5A 2E5LE 5IT9C 2VF1A 1PKPA 1ZBTA 4DR2I 4GEQB 1HR0I 4KHPE 1RQ0A 2CPNA 2EFGA 4X62I 4HYMA 3ZOQB 4B3ME 2V2ZA 3WU5A 3H09A 1UHZA 3Q1QA 2O1VA 1XHKA 4P78A 3LLHA 1ZM9A 2V8PA 4K0KI 4FN5A 1I94E 1PIEA 3VK6A 1Z0WA 4DV2I 2ZITA 1WHNA 4LTYA 2FTXB 3IWDA 1ELOA 4YHHI 3ADGA 3ZKDA 5IWAE 1Z5BA 4DPTA 4PRXA 1EI1A 2YZTA 2L2MA 4M0VA 1H73A 1B62A 4IZKA 3KWRA 4DPUA 2DEIA 1KKHA 5GMEA 4X62E 3JTZA 2IOQA 3RMPA 2J7KA 1HNZI 5LMNI 1ZM2A 2Q2EB 4GKKI 1X49A 2CG9A 2V34A 5CFFE 2Z5BA 1O0WA 2RS7A 1T4LB 1QZRA 4USKA 2B7TA 3MSWA 2V87A 4LFAE 3T1YE 4M2ZA 4DV2E 2LUPB 2HFSA 4JI5I 5ADZA 3J7Yp 2NA2A 4DV3I 3IWBA 1H7SA 5L3JA 3F0NA 2GQ0A 2L33A 1XMQI 2Z5BB 3WU3A 3ADJA 3JU0A 2NPFA 3K85A 4HACA 2ODRC 1H74A 3P1XA 2V2VA 2JVAA 3F6HA 4OX9E 1B63A 2A2CA 2HK2A 4J8ZA 4JG4A 4MYUA 4LF6E 1KIJA 1J5EI 2PNMA 5AE3A 4JI6E 3LTOA 2YT4A 2OI2A 3HPSA 1RR9A 4URLA 4UTGA 4B3RE 4AQYI 1IBME 2LTRA 4JI6I 4WYQB 1KVKA 4DV6E 4XTJA 2VQEE 2L3CA 4KZSA 1XNRI 2JOBA 3HPZA 4BMJA 4LF7E 1XNQI 4DR1I 1BKNA 4DV1I 4F9AB 4HY1A 2R3VA 2L92A 1FWLA 3GONA 3J7AM 1WHQA 3C4TA 4DV0E 4LF4E 4X64E 2V83A 4NXMI 1XNQE 4LF7I 2UUBI 4N3OA 4X66I 1YYOA 3B78A 1J26A 2VF3A 5BR8I 4DR6E 3PRYA 2UUBE 2NUEA 2F4VI 3IWCA 1N34E 2UXDE 1Z0GA 3ZZTA 3CWVA 4LF5E 4JI4E 3D4JA 2V2QA 4P7DA 4ED4A 4PRVA 4I8OA 4WFTA 1WUUA 4DPYA 3K17A 4LFBE 4DV5I 4DKKA 3T1HI 4M30A 2AJ4A 4LF5I 4BS9A 3JAMQ 2MC6A 2UXCI 3HJCA 2V89A 3ZZUA 3LPSA 1MX0A 1DI2A 4DV4I 1A6FA 4JI1E 5LMUI 1FWKA 4L8NA 4JI8I 2IHR1 1FI4A 4Q28A 5A2QQ 4LFCE 4JI1I 4WUDA 4DR2E 1Y4UA 4WUBA 3WU4A 1IBMI 2KONA 4BBYA 4DU7A 4JI7I 2L8TA 1GQEA 2HKJA 4WUCA 4B3SE 4DU8A 3QT6A 4JV5E 4BC9A 1N33E 1S4EA 2L6MA 2HKEA 2BM0A 1N0VC 4EMDA 4GKJE 1IBKI 4LF9E 2X36A 3V5RA 4BCAA 1NHIA 3P06A 1N33I 3QT7A 2A2DA 1Z0VA 5AE2A 2UXBI 1N36I 2G7HA 2UU9I 4R1FA 4LU9A 5FWKA 2JOXA 1MU5A 1RREA 2BV3A 5GMDA 1T4OA 4DMIA 5AE1A 4DR3E 1HNWE 4L5NC 1STUA 2DMYA 2UUAE 3V2UC 1IBLE 4ZVIA 4P52A 2JY9A 3LMLA 4YY3I 2VQEI 1DQ3A 1VISA 3B8HA 2UUAI 2RS6A 4DV7E 4Z7YA 2MDRA 2LBSB 2DSYA 2UU9E 4DR1E 5F3WA 1HNXI 3HULA 3WU6A 4X65I 2ZM6E 2O1UA 2L2NA 3OMLA 4DV0I 4I3HA 2HHHE 4K0KE 4NXME 1EA6A 2V86A 4YHHE 1GZ6A 2HFUA 2M4IA 2LJPA 1X47A 4DR6I 2E1RA 2E5LI 2IOPA 4JI7E 2RTXA 1MG7A 3ADLA 2VQFI 4DXLA 3HTXA 1Z5AA 1ZXMA 3AUZA 4USMA 2M1SA 3ZZ0A 4DPXA 1Y4SA 3M6AA 2X7IA 4B3TI 4B3MI 2RSMA 1YZ9A 4R8OA 2CZ9A 3C4BA 1HK7A 3ZM7A 5IT9Q 2LMZA 1FKAE 2LJHA 2UUCE 4B3TE 2FV4B 1EKZA 4JI2E 4X8WA 1S16A 3PYDA 2FGGA 2LUQA 4LF4I 3K6QA 5IWAI 2JR1A 4JI3I 5BR8E 4JI2I 1J5EE 4DR4I 3OTOI 2B7VA 5LMNE 4NXNE 4BC7A 4DPWA 4IZJD 1HNZE 4DV7I 4FW9A 1Z0BA 1HR0E 2O1WA 1FJGI 2V85A 2ZM6I 4JI0I 1XNRE 4DV5E 1N36E 1SR9A 2HHHI 3T1HE 2XEXA 4DV4E 1T4NA 4DUYI 5A2QC 2LRSA 1N0UA 4LF8E 3J80Q 2Z5CA 5AASA 2HK3A 4DR4E 2CGEA 1QU6A 1K47A 4OX9I 3H4LA 4HXZA 2B9DA 4LF6I 4LF8I 1YYWA 1IBLI 3PYGA 4JYAE 3AV0A 2DIXA 2L2KB 1YYKA 4F9BB 2EWLA 1N34I 4B3SI 1FJGE 4YY3E 2PNLA 5T6JA 4F54A 4AQYE 1ZM4A 1Z5CA 2Z5CB 4IZKB 2F8BA 2V88A 1U2RA 1Z0CA 4DR7E 1N32I 1USVA 4GKJI 3DF6A 1XMOI 2JWOA 2KOUA 4WPYA 1Y6ZA 2DB2A 4LFBI 4FWDA 4DUYE 4X65E 1IBKE 3F6GA 2N3HA 2ZBKB 4LFAI 4JI5E 2GS8A 2NUGA 4P7AA 2UXBE 5FLXQ 2M7QA 1XMQE 4Z7CA 4X64I 3J81C 3HQ1A 4FWHA 3J80C 3J7AG 4JI8E 3VYYA 3OTOE 4WSPA 4LFCI 4NXNI 4OOGC 2N3GA 1USUA 4HACB 1N32E 4IZJB 4DR7I 3DJWA 2UXDI 4PU9A 4JV5I 2V8QB 1WXRA 4UT4A 2F4VE 4JI0E 2NUFA 3ZKBA 4B3RI 1D6TA 1ZBQA 4F9CB 4DV6I 4JI4I 4M1KA 2L3JA 2BM1A 1Z0EA 1X48A 2K4VA 4IZJA 3J81Q 4LF9I 2UUCI 1KTVA 3T1YI 2E1MA 2O1TA 3ADIA 1PVGA 3PYEA 3JAMC 2H36X 2B3TB 4JI3E 1NHHA 1H72C 1I94I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZ6 A;  2R42 A;  4MYT A;  1FNM A;  4DR3 I;  4X66 E;  2LTS A;  1NHJ A;  4KQV A;  1UIL A;  3LNU A;  4FWG A;  1H7U A;  2VQF E;  1XMO E;  1Z0T A;  1ZXN A;  4RPF A;  3VYX A;  1NZ0 A;  2DEJ A;  4DR5 I;  3PYF A;  4GKK E;  1Z59 A;  1ZM3 A;  5LL6 R;  1RC7 A;  1HNX E;  3QT8 A;  3QT5 A;  4DR5 E;  4DUZ I;  5FLX C;  1UEK A;  2UXC E;  2KHX A;  4DV3 E;  5LMU E;  2WW4 A;  4DV1 E;  4DUZ E;  3B82 A;  4JYA I;  1DAR A;  1HNW I;  3K1J A;  4KHP I;  1OJ4 A;  2E5L E;  5IT9 C;  1PKP A;  1ZBT A;  4DR2 I;  1HR0 I;  4KHP E;  1RQ0 A;  2CPN A;  2EFG A;  4X62 I;  4HYM A;  4B3M E;  2V2Z A;  3WU5 A;  1UHZ A;  3Q1Q A;  1XHK A;  3LLH A;  1ZM9 A;  2V8P A;  4K0K I;  4FN5 A;  1I94 E;  1PIE A;  1Z0W A;  4DV2 I;  2ZIT A;  1WHN A;  1ELO A;  4YHH I;  3ADG A;  3ZKD A;  5IWA E;  1Z5B A;  4DPT A;  4PRX A;  1EI1 A;  2L2M A;  1H73 A;  1B62 A;  4DPU A;  2DEI A;  1KKH A;  5GME A;  4X62 E;  2J7K A;  1HNZ I;  5LMN I;  1ZM2 A;  2Q2E B;  4GKK I;  1X49 A;  2V34 A;  5CFF E;  1O0W A;  2RS7 A;  1T4L B;  1QZR A;  4USK A;  2B7T A;  4LFA E;  3T1Y E;  4M2Z A;  4DV2 E;  2LUP B;  2HFS A;  4JI5 I;  3J7Y p;  2NA2 A;  4DV3 I;  1H7S A;  5L3J A;  3F0N A;  2L33 A;  1XMQ I;  3WU3 A;  3ADJ A;  2NPF A;  4HAC A;  1H74 A;  3P1X A;  2V2V A;  2JVA A;  2HK2 A;  4OX9 E;  1B63 A;  2A2C A;  4JG4 A;  4MYU A;  4LF6 E;  1KIJ A;  1J5E I;  4JI6 E;  3LTO A;  2YT4 A;  2OI2 A;  4URL A;  1RR9 A;  4UTG A;  4B3R E;  4AQY I;  1IBM E;  2LTR A;  4JI6 I;  4WYQ B;  1KVK A;  4DV6 E;  4XTJ A;  2VQE E;  2L3C A;  1XNR I;  4LF7 E;  1XNQ I;  4DR1 I;  1BKN A;  4DV1 I;  4HY1 A;  2R3V A;  3J7A M;  1FWL A;  3GON A;  1WHQ A;  3C4T A;  4DV0 E;  4LF4 E;  4X64 E;  4NXM I;  1XNQ E;  4LF7 I;  2UUB I;  4X66 I;  1YYO A;  3B78 A;  1J26 A;  2VF3 A;  5BR8 I;  4DR6 E;  2F4V I;  2UUB E;  2NUE A;  1N34 E;  2UXD E;  1Z0G A;  3ZZT A;  3CWV A;  4LF5 E;  4JI4 E;  3D4J A;  2V2Q A;  4ED4 A;  4PRV A;  4WFT A;  1WUU A;  4DPY A;  3K17 A;  4LFB E;  4DV5 I;  4DKK A;  3T1H I;  4M30 A;  2AJ4 A;  4LF5 I;  3JAM Q;  2UXC I;  3ZZU A;  3LPS A;  1MX0 A;  1DI2 A;  4DV4 I;  1A6F A;  4JI1 E;  5LMU I;  1FWK A;  4JI8 I;  2IHR 1;  1FI4 A;  5A2Q Q;  4LFC E;  4JI1 I;  4WUD A;  4DR2 E;  4WUB A;  3WU4 A;  1IBM I;  4DU7 A;  4JI7 I;  1GQE A;  2HKJ A;  4WUC A;  4B3S E;  4DU8 A;  3QT6 A;  4JV5 E;  1N33 E;  1S4E A;  2HKE A;  2BM0 A;  1N0V C;  4EMD A;  4GKJ E;  1IBK I;  4LF9 E;  2X36 A;  3V5R A;  1NHI A;  1N33 I;  3QT7 A;  2A2D A;  1Z0V A;  2UXB I;  1N36 I;  2UU9 I;  4R1F A;  1MU5 A;  1RRE A;  2BV3 A;  5GMD A;  1T4O A;  4DR3 E;  1HNW E;  1STU A;  2DMY A;  2UUA E;  3V2U C;  1IBL E;  4ZVI A;  4P52 A;  2JY9 A;  4YY3 I;  2VQE I;  1VIS A;  3B8H A;  2UUA I;  2RS6 A;  4DV7 E;  4Z7Y A;  2MDR A;  2LBS B;  2UU9 E;  4DR1 E;  1HNX I;  3HUL A;  3WU6 A;  4X65 I;  2ZM6 E;  2L2N A;  4DV0 I;  4I3H A;  2HHH E;  4K0K E;  4NXM E;  1EA6 A;  4YHH E;  2HFU A;  2LJP A;  1X47 A;  4DR6 I;  2E1R A;  2E5L I;  4JI7 E;  2RTX A;  1MG7 A;  3ADL A;  2VQF I;  4DXL A;  3HTX A;  1Z5A A;  1ZXM A;  4USM A;  3ZZ0 A;  4DPX A;  3M6A A;  2X7I A;  4B3T I;  4B3M I;  2RSM A;  1YZ9 A;  2CZ9 A;  3C4B A;  3ZM7 A;  5IT9 Q;  1FKA E;  2LJH A;  2UUC E;  4B3T E;  1EKZ A;  4JI2 E;  4X8W A;  1S16 A;  3PYD A;  2LUQ A;  4LF4 I;  5IWA I;  4JI3 I;  5BR8 E;  4JI2 I;  1J5E E;  4DR4 I;  3OTO I;  2B7V A;  5LMN E;  4NXN E;  4DPW A;  1HNZ E;  4DV7 I;  4FW9 A;  1Z0B A;  1HR0 E;  1FJG I;  2ZM6 I;  4JI0 I;  1XNR E;  4DV5 E;  1N36 E;  2HHH I;  3T1H E;  2XEX A;  4DV4 E;  1T4N A;  4DUY I;  5A2Q C;  2LRS A;  1N0U A;  4LF8 E;  3J80 Q;  2HK3 A;  4DR4 E;  1QU6 A;  1K47 A;  4OX9 I;  3H4L A;  4HXZ A;  4LF6 I;  4LF8 I;  1YYW A;  1IBL I;  3PYG A;  4JYA E;  2DIX A;  2L2K B;  1YYK A;  1N34 I;  4B3S I;  1FJG E;  4YY3 E;  4AQY E;  1ZM4 A;  1Z5C A;  1U2R A;  1Z0C A;  4DR7 E;  1N32 I;  4GKJ I;  1XMO I;  2DB2 A;  4LFB I;  4FWD A;  4DUY E;  4X65 E;  1IBK E;  2N3H A;  2ZBK B;  4LFA I;  4JI5 E;  2GS8 A;  2NUG A;  4P7A A;  2UXB E;  5FLX Q;  1XMQ E;  4Z7C A;  4X64 I;  4FWH A;  3J81 C;  3J80 C;  3J7A G;  4JI8 E;  3VYY A;  3OTO E;  4LFC I;  4NXN I;  4OOG C;  2N3G A;  4HAC B;  1N32 E;  4DR7 I;  2UXD I;  4PU9 A;  4JV5 I;  4UT4 A;  2F4V E;  4JI0 E;  2NUF A;  3ZKB A;  4B3R I;  1D6T A;  4DV6 I;  4JI4 I;  4M1K A;  2L3J A;  2BM1 A;  1Z0E A;  1X48 A;  3J81 Q;  4LF9 I;  2UUC I;  1KTV A;  3T1Y I;  3ADI A;  1PVG A;  3PYE A;  3JAM C;  2B3T B;  4JI3 E;  1NHH A;  1H72 C;  1I94 I; 
#chains in the Genus database with same CATH topology
 2VE7 C;  2EZ6 A;  3THN A;  2R42 A;  4MYT A;  1FNM A;  4NBQ A;  4DR3 I;  2ENH A;  3PS2 A;  4X66 E;  2LTS A;  1NHJ A;  2EPM X;  4KQV A;  5JEA D;  2MKN A;  5JEA F;  2EOI A;  4BHC A;  1TF6 A;  1UIL A;  3LNU A;  4FWG A;  2EPR A;  4F6N A;  4TUI A;  2WBT A;  1H7U A;  1OYR A;  5DNY A;  2BA0 D;  4AIM A;  1E3P A;  2VQF E;  2D9H A;  2LO3 A;  1XMO E;  1Z0T A;  1ZXN A;  4RPF A;  2EPZ A;  2YTE A;  3VYX A;  2PRT A;  1NZ0 A;  2R1F A;  4ZYD A;  2DEJ A;  4R03 A;  2PO2 B;  4DR5 I;  3PYF A;  4GKK E;  1BBO A;  1Z59 A;  1ZM3 A;  2LE2 A;  1T38 A;  5LL6 R;  4U3D A;  4IFD F;  1RC7 A;  1HNX E;  2EN8 A;  1NEI A;  2WZO A;  1YSA C;  2ODR D;  1ZAA C;  2NN6 A;  2Z5E A;  3Q6N A;  3QT8 A;  3QT5 A;  1VI7 A;  5KL6 A;  4R2A A;  4DR5 E;  4TUG A;  3FIG A;  4ZYE A;  3HXL A;  4DUZ I;  5FLX C;  5K36 A;  4M9V C;  1UEK A;  2WNR A;  2UXC E;  2KHX A;  1DGC A;  4DV3 E;  5LMU E;  2WW4 A;  4J3D A;  3MHS C;  4DV1 E;  4OO1 F;  2EMA A;  4OO1 D;  4DUZ E;  5JEA A;  3B82 A;  3Q6M A;  4JYA I;  1DAR A;  4FW6 A;  1HNW I;  4MLQ A;  3K1J A;  4O4K A;  4KHP I;  3L7Z A;  1ZU1 A;  2YTG A;  2MC5 A;  1OJ4 A;  1AH5 A;  2E5L E;  2BR2 B;  4MU0 A;  5IT9 C;  2VF1 A;  2EOY A;  1PKP A;  1ZBT A;  4DR2 I;  5K36 B;  2EN1 A;  3P3C A;  4GEQ B;  2AE8 A;  2EOF A;  3TQM A;  1A1G A;  1WRJ A;  2E72 A;  2EPU A;  2YRM A;  4KHP E;  4GQU A;  1HR0 I;  2JEA A;  1RQ0 A;  2CPN A;  2ELZ A;  4HTG A;  2EFG A;  4X62 I;  1OYS A;  2YTN A;  4HYM A;  3ZOQ B;  2R76 A;  5A6K A;  4B3M E;  1IMU A;  2V2Z A;  5A6J A;  2DRP A;  1KJK A;  4OKG A;  4WXC A;  3WU5 A;  3H09 A;  2BR2 A;  1UHZ A;  5C0X A;  4OO1 C;  5EKW A;  3Q1Q A;  4RH8 A;  2O1V A;  2EMB A;  1XHK A;  4P78 A;  4MQY A;  3LLH A;  1ZM9 A;  2I9I A;  2V8P A;  4IS9 A;  4K0K I;  4NZV A;  4FN5 A;  1I94 E;  2JEA B;  1PIE A;  3VK6 A;  1Z0W A;  4DV2 I;  2ZIT A;  1WHN A;  1A1L A;  3M85 G;  2EMH A;  2FTX B;  4LTY A;  3HKM A;  3M85 D;  2EM3 A;  3IWD A;  2JP9 A;  1UN6 B;  1ELO A;  4YHH I;  3ADG A;  3ZKD A;  5IWA E;  1Z5B A;  4DPT A;  4PRX A;  2O3Z A;  1EI1 A;  2YZT A;  4KWY A;  2L2M A;  3U1Y A;  4M0V A;  1H73 A;  2EMI A;  1B62 A;  3KWR A;  1Y60 A;  4IZK A;  2DEI A;  4DPU A;  5K36 C;  1KKH A;  3B4T A;  4X62 E;  3JTZ A;  2IOQ A;  3RMP A;  2J7K A;  5GME A;  3C6K A;  5LMN I;  1HNZ I;  1ZM2 A;  2Q2E B;  4GKK I;  1X49 A;  3EPK A;  2CG9 A;  2V34 A;  2JEB B;  2JT2 A;  5CFF E;  5IV8 B;  2Z5B A;  1O0W A;  2RS7 A;  1T4L B;  1QZR A;  4MLV A;  5JEA C;  4USK A;  2B7T A;  4IFD B;  3MSW A;  1X5W A;  2V87 A;  4LFA E;  3T1Y E;  4M2Z A;  2HJJ A;  4DV2 E;  2LUP B;  3PS1 A;  2YWQ A;  2HFS A;  5C0X D;  4JI5 I;  5ADZ A;  3J7Y p;  2NA2 A;  4FW7 A;  4DV3 I;  3IWB A;  1H7S A;  5L3J A;  4X9J A;  3VHT B;  3F0N A;  2EPO A;  2GQ0 A;  2L33 A;  2NN6 C;  1XMQ I;  2Z5B B;  3KRN A;  3DD6 A;  3WU3 A;  1JK1 A;  3PS3 A;  3ADJ A;  3JU0 A;  2NPF A;  1G2F C;  3K85 A;  4HAC A;  4LCF A;  2ODR C;  2CTD A;  3EPJ A;  1H74 A;  1X6H A;  3P1X A;  3BID A;  2V2V A;  2JVA A;  3F6H A;  4R2D A;  2ENC A;  4OX9 E;  1B63 A;  2A2C A;  4J8Z A;  2HK2 A;  4JG4 A;  4MYU A;  4LF6 E;  2EM4 A;  2CVE A;  1KIJ A;  1P47 A;  1J5E I;  2PNM A;  2YTD A;  2ENA A;  5AE3 A;  4JI6 E;  3LTO A;  2EPN A;  2WCC 3;  2YT4 A;  2OI2 A;  2J65 A;  3HPS A;  1RR9 A;  4FW3 A;  4URL A;  4UTG A;  4IFD D;  2EPA A;  4B3R E;  4AQY I;  1IBM E;  4OO1 E;  1YHC A;  1QNT A;  2LTR A;  1A1H A;  1PJS A;  4O24 A;  4JI6 I;  4WYQ B;  1KVK A;  4F2J C;  4QNK A;  2NN6 E;  4FW4 A;  4DV6 E;  4XTJ A;  2VQE E;  2L3C A;  2EMX A;  4KZS A;  3BF2 A;  1XNR I;  3U1K A;  1GTK A;  3MHH C;  2JOB A;  3EPL A;  2PO1 A;  2LV2 A;  5C0X F;  3HPZ A;  4BMJ A;  4BA1 B;  2GPI A;  4LF7 E;  1XNQ I;  4DR1 I;  1BKN A;  2VES A;  4DV1 I;  5DRQ A;  2WBU A;  4F9A B;  4HY1 A;  2EOE A;  2J7J A;  2L92 A;  1PDA A;  1FWL A;  1X6E A;  1UDS A;  1WHQ A;  2R3V A;  3GON A;  3C4T A;  4DV0 E;  4LF4 E;  4X64 E;  2EQ3 A;  2V83 A;  4NXM I;  2EML A;  2LVH A;  1XNQ E;  4LF7 I;  2CT1 A;  1X3C A;  2UUB I;  4N3O A;  1PJT A;  4X66 I;  3QG5 C;  2YPN A;  2YRH A;  1YYO A;  4OZE A;  4OO1 A;  2EN4 A;  3B78 A;  2EMF A;  1J26 A;  2VF3 A;  2PO1 B;  5BR8 I;  2EPP A;  4BA1 A;  4DR6 E;  2BA1 G;  2PO2 A;  3PRY A;  2UUB E;  2NUE A;  2F4V I;  2JYA A;  3IWC A;  1N34 E;  2GO4 A;  2UXD E;  1Z0G A;  5KL4 A;  2A25 A;  1PJQ A;  3CWV A;  3ZZT A;  2NN6 B;  4LF5 E;  4JI4 E;  3D4J A;  2V2Q A;  4P7D A;  4ED4 A;  4PRV A;  4I8O A;  4WFT A;  2EM8 A;  1WUU A;  5K36 D;  5K36 F;  4DPY A;  5AC4 A;  3K17 A;  4OO1 B;  2YRK A;  2YSO A;  4LFB E;  4DV5 I;  1BB8 A;  2WNR B;  2EMG A;  4DKK A;  4LCG A;  4M30 A;  3T1H I;  2AJ4 A;  4MDT A;  4BS9 A;  4IS1 C;  2VRD A;  3JAM Q;  4LF5 I;  2MC6 A;  4WXD A;  1YUJ A;  1R6L A;  3NZK A;  2UXC I;  2YTJ A;  1AAY A;  3HJC A;  2EE8 A;  2V89 A;  5KL2 A;  3ZZU A;  1A1K A;  1MX0 A;  1DI2 A;  3LPS A;  1A6F A;  4DV4 I;  2C37 B;  4JI1 E;  1XXE A;  5LMU I;  4Q35 B;  1FWK A;  4L8N A;  4JI8 I;  2IHR 1;  3M7N G;  4O43 A;  4WSG A;  4GZN C;  1FI4 A;  4Q28 A;  5A2Q Q;  2EOM A;  2EOX A;  4LFC E;  4JI1 I;  3CDI A;  4DR2 E;  4WUD A;  1Y4U A;  5LLQ A;  4WUB A;  3WU4 A;  2EP3 A;  1RMD A;  1IBM I;  2KON A;  4BBY A;  1NCS A;  4DU7 A;  4JI7 I;  2L8T A;  1GQE A;  2HKJ A;  4WUC A;  1F2I G;  4B3S E;  3QT6 A;  4JV5 E;  4DU8 A;  1N3G A;  4BC9 A;  1N33 E;  1IQO A;  1S4E A;  5C0X B;  1YPN A;  5A6B A;  4F6M A;  4MU4 A;  4AID A;  2L6M A;  2EMZ A;  2HKE A;  2BM0 A;  1N0V C;  1UDQ A;  4EMD A;  3M7N D;  4GKJ E;  5C0X E;  1IBK I;  4LF9 E;  2F1D A;  2X36 A;  3V5R A;  4BCA A;  1NHI A;  3P06 A;  1N33 I;  4R2P A;  1E3H A;  2A2D A;  3GCM A;  3QT7 A;  1Z0V A;  5AE2 A;  2PO0 A;  2UXB I;  1N36 I;  4NHR A;  4FW5 A;  2C38 B;  2M9A A;  2BB8 A;  2GLI A;  4ISA A;  2G7H A;  2UU9 I;  3CDJ A;  2MDG A;  4R1F A;  2EPK X;  4LU9 A;  5FWK A;  2JOX A;  2HGH A;  3EPH A;  1MU5 A;  2RQL A;  1RRE A;  2BV3 A;  5GMD A;  1T4O A;  4DMI A;  5AE1 A;  4DR3 E;  1HNW E;  4ZYH A;  4L5N C;  4R2E A;  2EPC A;  1STU A;  2JEB A;  2C38 A;  2EPL X;  2DMY A;  2UUA E;  3V2U C;  2EJ4 A;  2IES A;  1IBL E;  1UBD C;  4IFD A;  2HC5 A;  4ZVI A;  5C0X C;  2Q8U A;  4P52 A;  2JY9 A;  4BA2 B;  3LML A;  4R2Q A;  4YY3 I;  2VQE I;  1DQ3 A;  1VIS A;  3B8H A;  2UUA I;  2N8X A;  2RS6 A;  4DV7 E;  4Z7Y A;  5DNL A;  2EN7 A;  5KL3 A;  5JEA E;  1A1J A;  2JE6 B;  2MDR A;  2LBS B;  2DSY A;  2UU9 E;  4DR1 E;  1TN9 A;  5F3W A;  2C39 A;  3HUL A;  3WU6 A;  4X65 I;  1HNX I;  4R2C A;  2ZM6 E;  2O1U A;  2IER A;  4MU3 A;  2L2N A;  1P42 A;  3OML A;  4DV0 I;  4I3H A;  2HHH E;  1YUI A;  4K0K E;  3P3E A;  4NXM E;  4BA2 A;  3M99 B;  2YTO A;  2V86 A;  1EA6 A;  2YTF A;  4YHH E;  1GZ6 A;  1KYQ A;  2EMY A;  2HFU A;  2LT7 A;  3KZY A;  1T39 A;  2M4I A;  2LJP A;  3H1C A;  1X47 A;  3GME A;  4DR6 I;  2E1R A;  2E5L I;  2IOP A;  4JI7 E;  1IQS A;  2RTX A;  1MG7 A;  5ELW A;  3BGH A;  2NN6 D;  2NN6 F;  2EOJ A;  2EM0 A;  3KZZ A;  3ADL A;  1JK2 A;  2VQF I;  2RPC A;  4DXL A;  3HTX A;  1Z5A A;  1ZXM A;  3AUZ A;  1RHY A;  4USM A;  2M1S A;  3P76 A;  3ZZ0 A;  4RHB B;  5A69 A;  2GHF A;  2EM5 A;  4DPX A;  2YSP A;  1Y4S A;  4HEI A;  3M6A A;  4BHB A;  1A1F A;  2JPA A;  2X7I A;  2EPX A;  4B3T I;  4B3M I;  2RSM A;  1YZ9 A;  4R8O A;  2CZ9 A;  3C4B A;  1HK7 A;  3ZM7 A;  5IT9 Q;  2LMZ A;  1FKA E;  2LJH A;  1EH6 A;  2UUC E;  2YU5 A;  4B3T E;  2FV4 B;  1ZR9 A;  1EKZ A;  4X8W A;  4JI2 E;  1R6M A;  1S16 A;  3PYD A;  2FGG A;  5KL7 A;  4U3B A;  2LUQ A;  2EQ1 A;  4LF4 I;  3K6Q A;  2EM9 A;  5IWA I;  2JR1 A;  3BBG A;  2BBG A;  5DRP A;  1MEY C;  2NAB A;  4JI3 I;  2LJU A;  2EN3 A;  5BR8 E;  4JI2 I;  2PNZ A;  1J5E E;  1LLM C;  4DR4 I;  2RSI A;  2B7V A;  5JEA B;  3OTO I;  5LMN E;  4IFD C;  4NXN E;  4BC7 A;  5DRO A;  4DPW A;  3L00 A;  1SFE A;  2ADR A;  4IZJ D;  4LCH A;  3L7Z B;  1HNZ E;  5EL9 A;  3C6M A;  4DV7 I;  2EMK A;  2EOS A;  4FW9 A;  1Z0B A;  1HR0 E;  2O1W A;  1FJG I;  1UDN A;  2EOO A;  2V85 A;  2ZM6 I;  2PNZ B;  2WBS A;  4JI0 I;  1XNR E;  2EOZ A;  4DV5 E;  1N36 E;  3UK3 C;  1SR9 A;  5DNX A;  2HHH I;  3T1H E;  2XEX A;  2C37 A;  1YFH A;  4DV4 E;  1T4N A;  4DUY I;  5A2Q C;  2LRS A;  4MU1 A;  1N0U A;  1B69 A;  4LF8 E;  3J80 Q;  1EH8 A;  2Z5C A;  2YTP A;  1X6F A;  5AAS A;  2HK3 A;  4DR4 E;  3EQ1 A;  2CGE A;  1QU6 A;  2EM6 A;  2CSH A;  1K47 A;  4OX9 I;  4R2R A;  3H4L A;  4HXZ A;  2B9D A;  2EM2 A;  4LF6 I;  2EMW A;  4LF8 I;  1YYW A;  1IBL I;  1G2D C;  4JYA E;  3PYG A;  3AV0 A;  2DIX A;  5A6A A;  2L2K B;  1YYK A;  4F9B B;  2EWL A;  1N34 I;  4B3S I;  1FJG E;  4YY3 E;  1MGT A;  2PNL A;  5T6J A;  4F54 A;  4AQY E;  1ZM4 A;  1Z5C A;  2Z5C B;  4FK5 C;  2F8B A;  2V88 A;  1U2R A;  1Z0C A;  4IZK B;  4O5G A;  4DR7 E;  1N32 I;  2EOQ A;  1USV A;  4GKJ I;  3DF6 A;  1XMO I;  2JWO A;  2KOU A;  4WPY A;  1Y5Y A;  2DB2 A;  1Y6Z A;  4LFB I;  4AM3 A;  4FWD A;  4DUY E;  4X65 E;  5TSE A;  2PO0 B;  2EN2 A;  1OYP A;  1IBK E;  3F6G A;  2N3H A;  4WX9 A;  5IXM B;  3GLL A;  2ZBK B;  4LFA I;  5AC5 A;  4JI5 E;  2BA1 D;  2GS8 A;  2BA0 G;  5K36 E;  2NUG A;  4P7A A;  2I13 A;  2UXB E;  2WP8 B;  4IFD E;  2K7I A;  5FLX Q;  5KL5 A;  4IJD A;  2M7Q A;  1XMQ E;  2EMC A;  2EOH A;  4N4R B;  4Z7C A;  2DLQ A;  2EL4 A;  4X64 I;  2EOR A;  3J81 C;  3HQ1 A;  4FWH A;  2YU8 A;  3J80 C;  3J7A G;  4JI8 E;  3VYY A;  3OTO E;  4WSP A;  4LFC I;  4NXN I;  4OOG C;  2N3G A;  1TF3 A;  1YH8 A;  1USU A;  1WJP A;  3J7A M;  3THO B;  4HAC B;  1N32 E;  4IZJ B;  2YTQ A;  4R2S A;  2WP8 A;  2GO3 A;  4DR7 I;  2DGC A;  1A1I A;  4LPF A;  3DJW A;  2UXD I;  4PU9 A;  4JV5 I;  2V8Q B;  2EL5 A;  1WXR A;  5DRR A;  1Z1B A;  4UT4 A;  2F4V E;  2JE6 A;  4JI0 E;  4QNJ A;  4ZYG A;  2EN6 A;  2NUF A;  3ZKB A;  2DLK A;  2C39 B;  3P3G A;  4B3R I;  1ZBQ A;  1D6T A;  4F9C B;  4DV6 I;  4JI4 I;  2DMI A;  4M1K A;  2L3J A;  2BM1 A;  1Z0E A;  1X48 A;  2K4V A;  4IZJ A;  3J81 Q;  4LF9 I;  5A6B D;  2UUC I;  1KTV A;  3T1Y I;  2EQ0 A;  3UHM A;  1BBG A;  2MKD A;  2E1M A;  2O1T A;  2ELY A;  3ADI A;  2YTI A;  1PVG A;  3PYE A;  1L4S A;  3JAM C;  2H36 X;  2JXP A;  2EM7 A;  2B3T B;  1UDO A;  2EL6 A;  2LCE A;  3ECR A;  4JI3 E;  1NHH A;  4LOM A;  1EH7 A;  1H72 C;  1I94 I; 
#chains in the Genus database with same CATH homology
 2VE7 C;  2EZ6 A;  2R42 A;  4MYT A;  1FNM A;  4DR3 I;  4X66 E;  2LTS A;  1NHJ A;  4KQV A;  1UIL A;  3LNU A;  4FWG A;  4TUI A;  1H7U A;  5DNY A;  2VQF E;  1XMO E;  1Z0T A;  1ZXN A;  4RPF A;  3VYX A;  1NZ0 A;  2DEJ A;  4R03 A;  4DR5 I;  3PYF A;  4GKK E;  1Z59 A;  1ZM3 A;  2LE2 A;  5LL6 R;  1RC7 A;  1HNX E;  2Z5E A;  2WZO A;  3Q6N A;  2ODR D;  3QT8 A;  3QT5 A;  4DR5 E;  4TUG A;  3FIG A;  3HXL A;  4DUZ I;  5FLX C;  1UEK A;  2UXC E;  2KHX A;  4DV3 E;  5LMU E;  2WW4 A;  4DV1 E;  4DUZ E;  3B82 A;  3Q6M A;  4JYA I;  1DAR A;  1HNW I;  3K1J A;  4KHP I;  1OJ4 A;  2MC5 A;  2E5L E;  5IT9 C;  2VF1 A;  1PKP A;  1ZBT A;  4DR2 I;  4GEQ B;  1HR0 I;  4KHP E;  1RQ0 A;  2CPN A;  2EFG A;  4X62 I;  4HYM A;  3ZOQ B;  4B3M E;  2V2Z A;  3WU5 A;  3H09 A;  1UHZ A;  3Q1Q A;  2O1V A;  1XHK A;  4P78 A;  3LLH A;  1ZM9 A;  2V8P A;  4K0K I;  4FN5 A;  1I94 E;  1PIE A;  3VK6 A;  1Z0W A;  4DV2 I;  2ZIT A;  1WHN A;  4LTY A;  2FTX B;  3IWD A;  1ELO A;  4YHH I;  3ADG A;  3ZKD A;  5IWA E;  1Z5B A;  4DPT A;  4PRX A;  1EI1 A;  2YZT A;  2L2M A;  4M0V A;  1H73 A;  1B62 A;  4IZK A;  3KWR A;  4DPU A;  2DEI A;  1KKH A;  5GME A;  4X62 E;  3JTZ A;  2IOQ A;  3RMP A;  2J7K A;  1HNZ I;  5LMN I;  1ZM2 A;  2Q2E B;  4GKK I;  1X49 A;  2CG9 A;  2V34 A;  5CFF E;  2Z5B A;  1O0W A;  2RS7 A;  1T4L B;  1QZR A;  4USK A;  2B7T A;  3MSW A;  2V87 A;  4LFA E;  3T1Y E;  4M2Z A;  4DV2 E;  2LUP B;  2HFS A;  4JI5 I;  5ADZ A;  3J7Y p;  2NA2 A;  4DV3 I;  3IWB A;  1H7S A;  5L3J A;  3F0N A;  2GQ0 A;  2L33 A;  1XMQ I;  2Z5B B;  3WU3 A;  3ADJ A;  3JU0 A;  2NPF A;  3K85 A;  4HAC A;  2ODR C;  1H74 A;  3P1X A;  2V2V A;  2JVA A;  3F6H A;  4OX9 E;  1B63 A;  2A2C A;  2HK2 A;  4J8Z A;  4JG4 A;  4MYU A;  4LF6 E;  1KIJ A;  1J5E I;  2PNM A;  5AE3 A;  4JI6 E;  3LTO A;  2YT4 A;  2OI2 A;  3HPS A;  1RR9 A;  4URL A;  4UTG A;  4B3R E;  4AQY I;  1IBM E;  2LTR A;  4JI6 I;  4WYQ B;  1KVK A;  4DV6 E;  4XTJ A;  2VQE E;  2L3C A;  4KZS A;  1XNR I;  2JOB A;  3HPZ A;  4BMJ A;  4LF7 E;  1XNQ I;  4DR1 I;  1BKN A;  4DV1 I;  4F9A B;  4HY1 A;  2R3V A;  2L92 A;  1FWL A;  3GON A;  3J7A M;  1WHQ A;  3C4T A;  4DV0 E;  4LF4 E;  4X64 E;  2V83 A;  4NXM I;  1XNQ E;  4LF7 I;  2UUB I;  4N3O A;  4X66 I;  1YYO A;  3B78 A;  1J26 A;  2VF3 A;  5BR8 I;  4DR6 E;  3PRY A;  2UUB E;  2NUE A;  2F4V I;  3IWC A;  1N34 E;  2UXD E;  1Z0G A;  3ZZT A;  3CWV A;  4LF5 E;  4JI4 E;  3D4J A;  2V2Q A;  4P7D A;  4ED4 A;  4PRV A;  4I8O A;  4WFT A;  1WUU A;  4DPY A;  3K17 A;  4LFB E;  4DV5 I;  4DKK A;  3T1H I;  4M30 A;  2AJ4 A;  4LF5 I;  4BS9 A;  3JAM Q;  2MC6 A;  2UXC I;  3HJC A;  2V89 A;  3ZZU A;  3LPS A;  1MX0 A;  1DI2 A;  4DV4 I;  1A6F A;  4JI1 E;  5LMU I;  1FWK A;  4L8N A;  4JI8 I;  2IHR 1;  1FI4 A;  4Q28 A;  5A2Q Q;  4LFC E;  4JI1 I;  4WUD A;  4DR2 E;  1Y4U A;  4WUB A;  3WU4 A;  1IBM I;  2KON A;  4BBY A;  4DU7 A;  4JI7 I;  2L8T A;  1GQE A;  2HKJ A;  4WUC A;  4B3S E;  4DU8 A;  3QT6 A;  4JV5 E;  4BC9 A;  1N33 E;  1S4E A;  2L6M A;  2HKE A;  2BM0 A;  1N0V C;  4EMD A;  4GKJ E;  1IBK I;  4LF9 E;  2X36 A;  3V5R A;  4BCA A;  1NHI A;  3P06 A;  1N33 I;  3QT7 A;  2A2D A;  1Z0V A;  5AE2 A;  2UXB I;  1N36 I;  2G7H A;  2UU9 I;  4R1F A;  4LU9 A;  5FWK A;  2JOX A;  1MU5 A;  1RRE A;  2BV3 A;  5GMD A;  1T4O A;  4DMI A;  5AE1 A;  4DR3 E;  1HNW E;  4L5N C;  1STU A;  2DMY A;  2UUA E;  3V2U C;  1IBL E;  4ZVI A;  4P52 A;  2JY9 A;  3LML A;  4YY3 I;  2VQE I;  1DQ3 A;  1VIS A;  3B8H A;  2UUA I;  2RS6 A;  4DV7 E;  4Z7Y A;  2MDR A;  2LBS B;  2DSY A;  2UU9 E;  4DR1 E;  5F3W A;  1HNX I;  3HUL A;  3WU6 A;  4X65 I;  2ZM6 E;  2O1U A;  2L2N A;  3OML A;  4DV0 I;  4I3H A;  2HHH E;  4K0K E;  4NXM E;  1EA6 A;  2V86 A;  4YHH E;  1GZ6 A;  2HFU A;  2M4I A;  2LJP A;  1X47 A;  4DR6 I;  2E1R A;  2E5L I;  2IOP A;  4JI7 E;  2RTX A;  1MG7 A;  3ADL A;  2VQF I;  4DXL A;  3HTX A;  1Z5A A;  1ZXM A;  3AUZ A;  4USM A;  2M1S A;  3ZZ0 A;  4DPX A;  1Y4S A;  3M6A A;  2X7I A;  4B3T I;  4B3M I;  2RSM A;  1YZ9 A;  4R8O A;  2CZ9 A;  3C4B A;  1HK7 A;  3ZM7 A;  5IT9 Q;  2LMZ A;  1FKA E;  2LJH A;  2UUC E;  4B3T E;  2FV4 B;  1EKZ A;  4JI2 E;  4X8W A;  1S16 A;  3PYD A;  2FGG A;  2LUQ A;  4LF4 I;  3K6Q A;  5IWA I;  2JR1 A;  4JI3 I;  5BR8 E;  4JI2 I;  1J5E E;  4DR4 I;  3OTO I;  2B7V A;  5LMN E;  4NXN E;  4BC7 A;  4DPW A;  4IZJ D;  1HNZ E;  4DV7 I;  4FW9 A;  1Z0B A;  1HR0 E;  2O1W A;  1FJG I;  2V85 A;  2ZM6 I;  4JI0 I;  1XNR E;  4DV5 E;  1N36 E;  1SR9 A;  2HHH I;  3T1H E;  2XEX A;  4DV4 E;  1T4N A;  4DUY I;  5A2Q C;  2LRS A;  1N0U A;  4LF8 E;  3J80 Q;  2Z5C A;  5AAS A;  2HK3 A;  4DR4 E;  2CGE A;  1QU6 A;  1K47 A;  4OX9 I;  3H4L A;  4HXZ A;  2B9D A;  4LF6 I;  4LF8 I;  1YYW A;  1IBL I;  3PYG A;  4JYA E;  3AV0 A;  2DIX A;  2L2K B;  1YYK A;  4F9B B;  2EWL A;  1N34 I;  4B3S I;  1FJG E;  4YY3 E;  2PNL A;  5T6J A;  4F54 A;  4AQY E;  1ZM4 A;  1Z5C A;  2Z5C B;  4IZK B;  2F8B A;  2V88 A;  1U2R A;  1Z0C A;  4DR7 E;  1N32 I;  1USV A;  4GKJ I;  3DF6 A;  1XMO I;  2JWO A;  2KOU A;  4WPY A;  1Y6Z A;  2DB2 A;  4LFB I;  4FWD A;  4DUY E;  4X65 E;  1IBK E;  3F6G A;  2N3H A;  2ZBK B;  4LFA I;  4JI5 E;  2GS8 A;  2NUG A;  4P7A A;  2UXB E;  5FLX Q;  2M7Q A;  1XMQ E;  4Z7C A;  4X64 I;  3J81 C;  3HQ1 A;  4FWH A;  3J80 C;  3J7A G;  4JI8 E;  3VYY A;  3OTO E;  4WSP A;  4LFC I;  4NXN I;  4OOG C;  2N3G A;  1USU A;  4HAC B;  1N32 E;  4IZJ B;  4DR7 I;  3DJW A;  2UXD I;  4PU9 A;  4JV5 I;  2V8Q B;  1WXR A;  4UT4 A;  2F4V E;  4JI0 E;  2NUF A;  3ZKB A;  4B3R I;  1D6T A;  1ZBQ A;  4F9C B;  4DV6 I;  4JI4 I;  4M1K A;  2L3J A;  2BM1 A;  1Z0E A;  1X48 A;  2K4V A;  4IZJ A;  3J81 Q;  4LF9 I;  2UUC I;  1KTV A;  3T1Y I;  2E1M A;  2O1T A;  3ADI A;  1PVG A;  3PYE A;  3JAM C;  2H36 X;  2B3T B;  4JI3 E;  1NHH A;  1H72 C;  1I94 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...