4X62E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x62E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x62E02
4LF7I 4X64E 4EMDA 1ZBTA 3OTOE 4DPYA 4HACA 2LUQA 3LLHA 3ZZTA 4GKKI 3T1YE 1EKZA 4DR6E 2UUCE 2GS8A 1FKAE 2E5LE 1IBMI 2Q2EB 1XMQE 4DR5I 3J80Q 3QT7A 4LF9I 1PKPA 4HXZA 1YYWA 4JYAE 1B62A 5IT9Q 2BM1A 4KQVA 4DR1I 2ZBKB 5LL6R 4P52A 2R3VA 4DV3E 2ZM6I 2UXCE 5FLXQ 2RSMA 2YT4A 1H74A 3ZKDA 1Z0VA 1J5EE 3OTOI 4JI5E 3B8HA 1N0VC 2F4VI 3HULA 4X66I 2LJHA 1H7UA 1O0WA 4DV1E 4DXLA 3PYGA 2HKEA 2UXDI 1B63A 3M6AA 4I3HA 1FJGI 2MDRA 3J7Yp 2EZ6A 4JI5I 4JI7E 3ADGA 4AQYI 2L2MA 2WW4A 2UXCI 3JAMC 2AJ4A 4DR7E 1K47A 2RS6A 3GONA 2LTRA 1H7SA 4USMA 2DMYA 4B3RI 4USKA 3PYFA 2VQEI 1Z59A 4UTGA 2XEXA 4ED4A 4K0KE 2EFGA 2HK3A 4DU7A 3J81C 5FLXC 4DR5E 2HK2A 1VISA 4JYAI 2VF3A 4OX9E 4M1KA 4X65I 2NUEA 3K1JA 1OJ4A 1WUUA 4B3ME 1QU6A 1YYOA 1ZXMA 4RPFA 5LMUI 3HTXA 3QT8A 2UUAE 4B3MI 4R1FA 3LNUA 1RR9A 4P7AA 4LFAI 4DV2E 3T1HI 1HNXE 4FN5A 2DEIA 4LFCI 2LRSA 3K17A 3ZZ0A 4JV5E 4DR4I 1DARA 4LFBE 1N33I 1XMQI 3B78A 3VYYA 1ZM9A 4NXNI 1X49A 1I94E 4DR6I 4B3SE 4B3RE 2BV3A 4X64I 4FW9A 2DEJA 4DKKA 2V2ZA 5BR8E 1UILA 1Z5AA 1YZ9A 1ZM4A 1MG7A 1KTVA 4X62E 5IWAI 1KIJA 1BKNA 4WFTA 2N3HA 2VQEE 4B3TI 4M2ZA 1N34E 1N36I 2DB2A 3QT6A 2KHXA 1X47A 1NZ0A 4LFAE 4JI3E 1FNMA 1A6FA 4JI7I 2NA2A 1Z0CA 2A2CA 4PRXA 2V8PA 4JI4E 1IBME 1XHKA 2F4VE 5LMUE 3J7AG 4DV7E 4Z7YA 2X36A 4GKJE 4LF6I 5L3JA 1XMOE 1N33E 4GKJI 3JAMQ 2B3TB 4JI8I 3C4TA 4GKKE 4DR3E 1PVGA 3P1XA 1U2RA 1ZM2A 4ZVIA 4DV3I 5LMNE 4DR4E 1FWLA 2B7VA 1XNQE 2UUBE 2L3JA 1N32I 4HACB 1N0UA 4Z7CA 2N3GA 2X7IA 4DR7I 1Z0GA 4UT4A 1XNRE 1MX0A 2UUCI 4X8WA 2UXBE 4JI1I 1HR0I 4B3TE 4B3SI 4JI4I 4DUYI 4DU8A 4DV6I 3J80C 4WUBA 3ZM7A 2L2NA 1WHQA 4KHPE 4HY1A 1HNZI 4JI0E 1HNZE 3PYEA 1EI1A 3WU3A 3LPSA 4MYUA 5LMNI 4NXNE 4DV1I 2UU9I 1ZXNA 3J7AM 4YHHI 1Z0EA 2NUFA 2NUGA 4JV5I 1T4LB 4LFBI 4PU9A 4DR1E 1UHZA 2V2VA 3PYDA 1XNQI 1IBLE 2L3CA 4DV0I 1H73A 4LF7E 4X66E 2E1RA 5GMDA 2ZM6E 2UU9E 4WYQB 4DV0E 2L33A 1GQEA 3ADJA 5CFFE 4JI1E 2UXBI 3T1YI 1HNXI 1J26A 2JVAA 4JG4A 2J7KA 2RTXA 1Z0TA 2HHHI 2JY9A 3ADIA 1Z0BA 4LF9E 4HYMA 4DPWA 1PIEA 2OI2A 1EA6A 4FWDA 2E5LI 4LFCE 4JI8E 2LUPB 1Z0WA 4FWHA 2R42A 4K0KI 4JI0I 1RREA 1IBLI 1FWKA 4DPXA 4YY3I 4OX9I 4DR2E 4LF8E 4FWGA 4LF5E 4JI2E 1RQ0A 1Z5CA 4YY3E 5GMEA 2L2KB 1XMOI 2A2DA 3D4JA 4PRVA 4MYTA 1KKHA 4DV7I 1IBKI 1FJGE 3V5RA 1D6TA 4WUDA 1N34I 2BM0A 4DR2I 4LF8I 1IBKE 1QZRA 5A2QQ 2B7TA 3Q1QA 3F0NA 4DUZI 1S16A 3V2UC 1H72C 1NHJA 2RS7A 2VQFI 2HFSA 4DV2I 3LTOA 4DV6E 1ELOA 1X48A 1HR0E 1S4EA 2LJPA 4DV5E 2HHHE 4JI6I 1HNWE 1ZM3A 3ADLA 3T1HE 1J5EI 5BR8I 4DV5I 2UUBI 1HNWI 1N32E 1YYKA 4WUCA 2V34A 1T4NA 3ZZUA 3H4LA 4AQYE 1WHNA 4DR3I 1RC7A 1I94I 3CWVA 2VQFE 4XTJA 1N36E 4YHHE 2HKJA 2V2QA 3WU4A 5A2QC 1DI2A 1NHHA 2UXDE 2CPNA 4NXME 3WU6A 2ZITA 4DUYE 4DPTA 1UEKA 4JI6E 1STUA 4DV4I 4LF6E 4DUZE 1KVKA 2NPFA 4LF4I 5IWAE 5IT9C 3J81Q 4JI3I 2LTSA 4X65E 4KHPI 4URLA 3C4BA 2IHR1 1FI4A 4DV4E 3WU5A 4OOGC 4DPUA 1XNRI 4NXMI 4X62I 1MU5A 4M30A 4LF5I 2LBSB 3VYXA 3ZKBA 4JI2I 3QT5A 2DIXA 1NHIA 2HFUA 3B82A 1T4OA 2CZ9A 1Z5BA 2UUAI 4LF4E
chains in the Genus database with same CATH superfamily
5DROA 1X6HA 4BHBA 1BB8A 4LF7I 4X64E 5JEAD 3HPZA 4EMDA 2BBGA 2WBSA 1ZBTA 3OTOE 2YTGA 1IMUA 4HACA 4DPYA 2LUQA 3LLHA 3ZZTA 2CTDA 3T1YE 4GKKI 4ZYEA 1EKZA 5KL7A 2EM3A 2UUCE 4DR6E 2GS8A 2AE8A 1AH5A 2EN2A 1FKAE 3H1CA 2E5LE 4FW3A 3M85D 1IBMI 2Q2EB 1XMQE 3MSWA 4DR5I 3J80Q 3QT7A 4LF9I 1PKPA 3AUZA 2EOOA 4HXZA 5K36A 1YYWA 2EPMX 4JYAE 1B62A 5IT9Q 2BM1A 5C0XF 4ZYHA 4KQVA 4DR1I 2E72A 1SFEA 2ZBKB 5LL6R 1ZU1A 2NN6D 3IWCA 1NCSA 2VF1A 4P52A 3MHSC 4TUGA 2R3VA 1GTKA 4DV3E 2K4VA 2ZM6I 2UXCE 5FLXQ 2RQLA 4Q28A 2O1VA 5K36B 2YZTA 2RSMA 3HQ1A 2EOMA 2YT4A 1H74A 2MDGA 3ZKDA 1Z0VA 1BBGA 1J5EE 4RH8A 3OTOI 4JI5E 3B8HA 2ENCA 1N0VC 2F4VI 4O24A 3HULA 4X66I 5JEAF 2O1TA 2EPOA 4J3DA 2LJHA 1T39A 3NZKA 1QNTA 1H7UA 3EPJA 1RMDA 1O0WA 2YTJA 4DV1E 4DXLA 3PYGA 4LU9A 2HKEA 2UXDI 2YTQA 1B63A 3M6AA 4I3HA 2PNLA 4IZJD 1FJGI 2CVEA 2MDRA 2VESA 4IFDD 2JP9A 2DGCA 2VRDA 3J7Yp 2EZ6A 1UN6B 4JI5I 4IFDA 4KZSA 1A1JA 4JI7E 4F6NA 3ADGA 4AQYI 4F54A 2NN6C 2L2MA 2EMBA 2WW4A 2EL5A 2UXCI 3JAMC 2AJ4A 2Z5BB 4MLQA 4DR7E 1K47A 2RS6A 3GONA 1Z1BA 2EORA 2LTRA 4L8NA 4GZNC 1H7SA 2EM4A 4USMA 2DMYA 4B3RI 4USKA 2EMLA 5DRPA 1GZ6A 3PYFA 2VQEI 1Z59A 4MU0A 2C37A 2E1MA 1E3HA 4UTGA 2XEXA 2IOQA 4ED4A 4K0KE 1R6MA 2EFGA 4BBYA 2HK3A 4DU7A 2YRKA 3J81C 2MKNA 5FLXC 4DR5E 2JWOA 2BR2A 2HK2A 3FIGA 1AAYA 1VISA 1UDNA 2JE6A 2VF3A 4OX9E 4JYAI 3L7ZB 2O1WA 4IJDA 4M1KA 2NUEA 1Y4SA 3K1JA 1OJ4A 4X65I 1WUUA 4B3ME 1QU6A 1YYOA 1ZXMA 4RPFA 5LMUI 3HTXA 5K36D 2WZOA 3QT8A 4OO1F 1Y4UA 2I13A 1MEYC 1Y6ZA 2UUAE 2BA1D 4B3MI 4R1FA 3EPHA 1RR9A 3LNUA 4P7AA 2YTNA 2GLIA 4LFAI 3P3CA 1PJSA 4DV2E 3T1HI 3F6GA 1HNXE 3BBGA 2EJ4A 2DEIA 4FN5A 2LRSA 1LLMC 4LFCI 3K17A 3M99B 2CSHA 2LVHA 4JV5E 4R2QA 4U3BA 3ZZ0A 4DR4I 1DARA 3KZYA 2YTFA 4IS1C 4LFBE 1N33I 1X6FA 4QNJA 1TF6A 2JEAB 2EMCA 1XMQI 2GHFA 2EMFA 4R2RA 2L92A 2ELZA 4LCHA 4F9CB 3VYYA 3B78A 1ZM9A 2EPKX 4OO1A 4NXNI 4AIDA 1X49A 1I94E 4M9VC 4DR6I 4B3SE 2EM8A 4B3RE 2EOQA 4WSGA 1A1LA 2DSYA 2KONA 1G2DC 3Q6NA 2EL6A 2EOYA 4IZKB 2BV3A 3RMPA 2WNRA 1KJKA 4X64I 4FW9A 3Q6MA 2PO0B 2YU5A 1F2IG 1P47A 1MGTA 4BA1A 2HJJA 3M7ND 2V88A 3CDIA 2DEJA 4DKKA 4OO1B 4O4KA 2V2ZA 1KYQA 1UILA 5BR8E 2NN6F 5FWKA 5TSEA 3THOB 1Z5AA 2O3ZA 1WJPA 4F6MA 1YZ9A 4GEQB 2LT7A 4F9AB 1ZM4A 1MG7A 2HC5A 3P06A 4MU1A 1KTVA 4X62E 2R1FA 3P76A 4FW4A 4OO1C 2YRMA 2M7QA 5IWAI 3PS1A 1G2FC 4P78A 4WX9A 1KIJA 1BKNA 4WFTA 2EL4A 1USUA 2N3HA 2VQEE 4B3TI 4AIMA 4M2ZA 5DRQA 4P7DA 2WBUA 2B9DA 1N34E 1N36I 2EPCA 2EMAA 3EPKA 2BA1G 1YH8A 2DB2A 3QT6A 2KHXA 2GQ0A 3P3EA 1X47A 1NZ0A 2EPZA 4LFAE 4JI3E 1FNMA 4OZEA 2ENHA 1TN9A 1A6FA 2JXPA 4JI7I 2NA2A 1Z0CA 2A2CA 3HKMA 4PRXA 2V8PA 4JI4E 1IBME 1XHKA 2F4VE 5LMUE 1A1IA 2N8XA 1A1HA 2YTPA 3J7AG 3DJWA 4DV7E 2R76A 5F3WA 2LV2A 3PS3A 2LO3A 2EM6A 4Z7YA 2IOPA 2X36A 2JEBA 4KWYA 4GKJE 5C0XC 3MHHC 2V83A 4LF6I 5L3JA 2PNMA 1XMOE 2EMXA 3KZZA 4BC9A 1E3PA 5A6BA 1N33E 2PO1A 4GKJI 3JAMQ 2B3TB 1X3CA 2YSOA 2FTXB 5A6AA 5ELWA 4JI8I 4LCFA 2NABA 3C4TA 4GKKE 4DR3E 1PVGA 1DQ3A 2C38B 3P1XA 2Z5CB 3C6KA 2WNRB 2JYAA 2PRTA 1U2RA 1ZM2A 5JEAC 2NN6A 4ZVIA 4BA1B 2ADRA 1A1FA 5LMNE 4DV3I 4N4RB 2EQ3A 1VI7A 5A6JA 4NHRA 4DR4E 1FWLA 5DNXA 4AM3A 2B7VA 3DF6A 1XNQE 2UUBE 2ODRD 3IWBA 2EPXA 3JU0A 2L6MA 3AV0A 4BMJA 2V8QB 2L3JA 3P3GA 1N32I 3TQMA 2EPRA 4HACB 1N0UA 4R03A 2V87A 4LPFA 4IS9A 4I8OA 2KOUA 4Z7CA 2N3GA 2M9AA 3M85G 2X7IA 4DR7I 2ODRC 2ELYA 2EM2A 2WBTA 2C39B 2EMHA 4MLVA 1Z0GA 5T6JA 4UT4A 1XNRE 1MX0A 2Z5BA 4R2DA 2UUCI 3THNA 1WXRA 4X8WA 2UXBE 4JI1I 5K36E 1HR0I 4O43A 4B3TE 4B3SI 3BIDA 5AE2A 2EM7A 3OMLA 4JI4I 4DUYI 4DU8A 4NZVA 4R2AA 5DNYA 4DV6I 2YTDA 1OYRA 3J80C 3K6QA 4WUBA 3ZM7A 2L2NA 1WHQA 4KHPE 4FK5C 2YWQA 2EMZA 2K7IA 4R2SA 2PO2A 4HY1A 3HPSA 3U1KA 2EM0A 2EN7A 4OO1D 1HNZI 2EPLX 1EH6A 2I9IA 4JI0E 4LTYA 2EN8A 4F2JC 2EQ0A 4GQUA 4FW6A 2BR2B 1HNZE 1R6LA 3PYEA 1EI1A 3WU3A 3LPSA 4MYUA 4X9JA 3K85A 4NXNE 5LMNI 2CG9A 4DV1I 2UU9I 1ZXNA 4BA2A 4R8OA 2PO2B 3J7AM 4WSPA 4YHHI 2JT2A 4BS9A 1Z0EA 3BF2A 2NUFA 2NUGA 2NN6E 1PDAA 4JV5I 1OYPA 1T4LB 3DD6A 4ISAA 4LFBI 4PU9A 4DR1E 2EWLA 2MC6A 2EPNA 1UHZA 2V2VA 1OYSA 3PYDA 2EN4A 1XNQI 1X5WA 5IV8B 2NN6B 1IBLE 2L3CA 4DV0I 4IFDE 1Y5YA 1H73A 3C6MA 2EMYA 4X66E 1DGCA 4LF7E 2E1RA 2ZM6E 2UU9E 3GLLA 2A25A 3JTZA 4WYQB 4R2EA 5GMDA 2D9HA 2DLQA 1X6EA 4DV0E 2L33A 2EPPA 1GQEA 3ADJA 5CFFE 4TUIA 4JI1E 2GO4A 2UXBI 2DLKA 1UDSA 2EN3A 2EN1A 4BCAA 3T1YI 1HNXI 1J26A 1YUJA 3UHMA 2JVAA 3L00A 2JR1A 4JG4A 1PJTA 2J7KA 2RPCA 2EOEA 3UK3C 2JOXA 2RTXA 1Z0TA 4RHBB 5KL5A 1A1GA 2HHHI 2JY9A 2EM9A 3ZOQB 3ADIA 1Z0BA 4LF9E 4IZJB 2IESA 2BB8A 4HYMA 4DPWA 1PIEA 2OI2A 2EM5A 1EA6A 4FWDA 2E5LI 1ZR9A 2EMGA 2EOIA 3VHTB 4LFCE 4JI8E 4MDTA 3BGHA 2F1DA 4DMIA 2LUPB 2VE7C 1Z0WA 4FWHA 2R42A 3L7ZA 4K0KI 1N3GA 1L4SA 4JI0I 1RREA 5EKWA 4IZJA 1IBLI 2YTEA 4LCGA 3EQ1A 5ADZA 4MQYA 2ENAA 1FWKA 2M4IA 2EOHA 4DPXA 4YY3I 4OX9I 3VK6A 5C0XD 3KWRA 4DR2E 4LF8E 2YU8A 5AC5A 1EH7A 2GPIA 1A1KA 1P42A 4LF5E 1JK1A 2PNZA 1XXEA 2WCC3 4FWGA 2EOZA 4JI2E 1RQ0A 1Z5CA 4YY3E 5GMEA 5JEAE 2L2KB 4QNKA 1XMOI 2GO3A 2A2DA 3D4JA 4BA2B 2C37B 2G7HA 1IQSA 2DRPA 4Q35B 4PRVA 2EN6A 2LJUA 3ECRA 2BA0G 4MYTA 2YTIA 4R2CA 1KKHA 4DV7I 4J8ZA 2J7JA 1IBKI 4FW5A 4M0VA 1FJGE 3V5RA 1D6TA 4WUDA 1N34I 4LOMA 3M7NG 5A6KA 2BM0A 2JE6B 5AE3A 4O5GA 1IBKE 3CDJA 4DR2I 4LF8I 1QZRA 4IZKA 5A2QQ 2B7TA 2EOSA 2LCEA 1WRJA 2WP8A 2EOXA 2MC5A 2PO0A 3Q1QA 3F0NA 3HJCA 1RHYA 4DUZI 4MU4A 1S16A 4ZYDA 3V2UC 1H72C 1NHJA 2PO1B 2RS7A 5DRRA 5AASA 1Y60A 2HFSA 1ZBQA 3U1YA 2VQFI 4DV2I 1EH8A 1USVA 3LTOA 2EP3A 2EPAA 4DV6E 5AE1A 2JPAA 2JEAA 1ZAAC 4MU3A 1ELOA 1X48A 5A69A 1HR0E 1S4EA 2LJPA 5C0XA 4DV5E 2HHHE 5KL3A 2HGHA 2O1UA 4JI6I 1HNWE 1ZM3A 1NEIA 3ADLA 5DNLA 1BBOA 1IQOA 2EOJA 3T1HE 1J5EI 5BR8I 4DV5I 2UUBI 4OO1E 1HNWI 1YPNA 1N32E 1YHCA 1YYKA 3F6HA 4R2PA 4WUCA 2Z5EA 2V34A 5C0XE 4BC7A 5LLQA 4N3OA 1T4NA 1B69A 3EPLA 3ZZUA 5C0XB 3H4LA 4AQYE 1WHNA 4DR3I 2LE2A 5KL6A 2YSPA 2V85A 4FW7A 2PNZB 1RC7A 1UBDC 5IXMB 2YTOA 2BA0D 1I94I 3CWVA 5KL4A 2VQFE 4OKGA 3IWDA 4XTJA 1UDQA 3PRYA 4U3DA 1N36E 5K36C 4NBQA 4YHHE 2HKJA 3PS2A 2V2QA 3WU4A 5EL9A 5A2QC 1DI2A 1NHHA 2EMIA 2UXDE 2CPNA 4NXME 3WU6A 1UDOA 4WXCA 5KL2A 2ZITA 2EE8A 4DUYE 2EMKA 2LMZA 1YUIA 4DPTA 1UEKA 4JI6E 1STUA 4IFDF 4DV4I 2C38A 4LF6E 2WP8B 2FV4B 4DUZE 5AC4A 3HXLA 4HTGA 1KVKA 3B4TA 2NPFA 4BHCA 4LF4I 1SR9A 5IWAE 3KRNA 5IT9C 3J81Q 2EOFA 4JI3I 2EPUA 2LTSA 4X65E 4KHPI 2IERA 4URLA 5JEAB 1T38A 3C4BA 2DMIA 2MKDA 2IHR1 2F8BA 2CGEA 2V86A 2YRHA 2Q8UA 1FI4A 2EMWA 3LMLA 4F9BB 4DV4E 2EQ1A 3WU5A 3QG5C 2CT1A 4WPYA 4OOGC 2JEBB 4DPUA 1YSAC 2J65A 2RSIA 2C39A 1XNRI 4ZYGA 5JEAA 2V89A 1YFHA 2JOBA 4NXMI 4X62I 4IFDC 1MU5A 1TF3A 1HK7A 4M30A 2L8TA 2YPNA 2LBSB 4LF5I 1JK2A 4WXDA 3VYXA 3ZKBA 4JI2I 2H36X 3QT5A 2DIXA 2FGGA 1NHIA 2HFUA 2Z5CA 3GMEA 3GCMA 4HEIA 1PJQA 4IFDB 2M1SA 4L5NC 3H09A 1T4OA 3B82A 2CZ9A 1Z5BA 5A6BD 5K36F 2UUAI 4LF4E
chains in the Genus database with same CATH topology
4LF7I 4X64E 3HPZA 4EMDA 1ZBTA 3OTOE 4DPYA 4HACA 2LUQA 3LLHA 3ZZTA 4GKKI 3T1YE 1EKZA 4DR6E 2UUCE 2GS8A 1FKAE 2E5LE 1IBMI 2Q2EB 1XMQE 3MSWA 4DR5I 3J80Q 3QT7A 4LF9I 1PKPA 3AUZA 4HXZA 1YYWA 4JYAE 1B62A 5IT9Q 2BM1A 4KQVA 4DR1I 2ZBKB 5LL6R 3IWCA 2VF1A 4P52A 4TUGA 2R3VA 4DV3E 2K4VA 2ZM6I 2UXCE 5FLXQ 4Q28A 2O1VA 2YZTA 2RSMA 3HQ1A 2YT4A 1H74A 3ZKDA 1Z0VA 1J5EE 3OTOI 4JI5E 3B8HA 1N0VC 2F4VI 3HULA 4X66I 2O1TA 2LJHA 1H7UA 1O0WA 4DV1E 4DXLA 3PYGA 4LU9A 2HKEA 2UXDI 1B63A 3M6AA 4I3HA 2PNLA 4IZJD 1FJGI 2MDRA 3J7Yp 2EZ6A 4JI5I 4KZSA 4JI7E 3ADGA 4AQYI 4F54A 2L2MA 2WW4A 2UXCI 3JAMC 2AJ4A 2Z5BB 4DR7E 1K47A 2RS6A 3GONA 4L8NA 2LTRA 1H7SA 4USMA 2DMYA 4B3RI 4USKA 1GZ6A 3PYFA 2VQEI 1Z59A 2E1MA 4UTGA 2XEXA 2IOQA 4ED4A 4K0KE 2EFGA 4BBYA 2HK3A 4DU7A 3J81C 5FLXC 4DR5E 2JWOA 2HK2A 3FIGA 1VISA 4JYAI 2VF3A 4OX9E 2O1WA 4M1KA 4X65I 2NUEA 1Y4SA 3K1JA 1OJ4A 1WUUA 4B3ME 1QU6A 1YYOA 1ZXMA 4RPFA 5LMUI 3HTXA 2WZOA 3QT8A 1Y4UA 1Y6ZA 2UUAE 4B3MI 4R1FA 3LNUA 1RR9A 4P7AA 4LFAI 4DV2E 3T1HI 1HNXE 3F6GA 4FN5A 2DEIA 4LFCI 2LRSA 3K17A 3ZZ0A 4JV5E 4DR4I 1DARA 4LFBE 1N33I 1XMQI 2L92A 4F9CB 3VYYA 3B78A 1ZM9A 4NXNI 1X49A 1I94E 4DR6I 4B3SE 4B3RE 2DSYA 2KONA 3Q6NA 4IZKB 2BV3A 3RMPA 4X64I 4FW9A 3Q6MA 2V88A 2DEJA 4DKKA 2V2ZA 5BR8E 1UILA 5FWKA 1Z5AA 1YZ9A 4GEQB 4F9AB 1ZM4A 1MG7A 3P06A 1KTVA 4X62E 2M7QA 5IWAI 4P78A 1KIJA 1BKNA 4WFTA 1USUA 2N3HA 2VQEE 4B3TI 4M2ZA 4P7DA 2B9DA 1N34E 1N36I 2DB2A 3QT6A 2KHXA 2GQ0A 1X47A 1NZ0A 4LFAE 4JI3E 1FNMA 1A6FA 4JI7I 2NA2A 1Z0CA 2A2CA 4PRXA 2V8PA 4JI4E 1IBME 1XHKA 2F4VE 5LMUE 3J7AG 3DJWA 4DV7E 5F3WA 4Z7YA 2IOPA 2X36A 4GKJE 2V83A 4LF6I 5L3JA 2PNMA 1XMOE 4BC9A 1N33E 4GKJI 3JAMQ 2B3TB 4JI8I 2FTXB 3C4TA 4GKKE 4DR3E 1PVGA 1DQ3A 3P1XA 2Z5CB 1U2RA 1ZM2A 4ZVIA 4DV3I 5LMNE 4DR4E 1FWLA 2B7VA 3DF6A 1XNQE 2UUBE 2L3JA 2ODRD 3IWBA 3JU0A 2L6MA 3AV0A 4BMJA 2V8QB 1N32I 4HACB 1N0UA 4R03A 2V87A 4I8OA 2KOUA 4Z7CA 2N3GA 2X7IA 4DR7I 2ODRC 1Z0GA 5T6JA 4UT4A 1XNRE 1MX0A 2Z5BA 2UUCI 1WXRA 4X8WA 2UXBE 4JI1I 1HR0I 4B3TE 4B3SI 5AE2A 3OMLA 4JI4I 4DUYI 4DU8A 5DNYA 4DV6I 3J80C 3K6QA 4WUBA 3ZM7A 2L2NA 1WHQA 4KHPE 4HY1A 3HPSA 1HNZI 4JI0E 4LTYA 1HNZE 3PYEA 1EI1A 3WU3A 3LPSA 4MYUA 3K85A 4NXNE 5LMNI 2CG9A 4DV1I 2UU9I 1ZXNA 4R8OA 3J7AM 4WSPA 4YHHI 4BS9A 1Z0EA 2NUFA 2NUGA 4JV5I 1T4LB 4LFBI 4PU9A 4DR1E 2EWLA 2MC6A 1UHZA 2V2VA 3PYDA 1XNQI 1IBLE 2L3CA 4DV0I 1H73A 4LF7E 4X66E 2E1RA 5GMDA 2ZM6E 2UU9E 3JTZA 4WYQB 4DV0E 2L33A 1GQEA 3ADJA 5CFFE 4TUIA 4JI1E 2UXBI 3T1YI 4BCAA 1HNXI 1J26A 2JVAA 2JR1A 4JG4A 2J7KA 2JOXA 2RTXA 1Z0TA 2HHHI 2JY9A 3ZOQB 3ADIA 1Z0BA 4LF9E 4IZJB 4HYMA 4DPWA 1PIEA 2OI2A 1EA6A 4FWDA 2E5LI 4LFCE 4JI8E 4DMIA 2LUPB 2VE7C 1Z0WA 4FWHA 2R42A 4K0KI 4JI0I 1RREA 4IZJA 1IBLI 5ADZA 1FWKA 2M4IA 4DPXA 4YY3I 4OX9I 3VK6A 3KWRA 4DR2E 4LF8E 4FWGA 4LF5E 4JI2E 1RQ0A 1Z5CA 4YY3E 5GMEA 2L2KB 1XMOI 2A2DA 3D4JA 2G7HA 4PRVA 4MYTA 1KKHA 4DV7I 4J8ZA 1IBKI 4M0VA 1FJGE 3V5RA 1D6TA 4WUDA 1N34I 2BM0A 4DR2I 5AE3A 1IBKE 4LF8I 1QZRA 4IZKA 5A2QQ 2B7TA 2MC5A 3Q1QA 3F0NA 3HJCA 4DUZI 1S16A 3V2UC 1H72C 1NHJA 2RS7A 5AASA 2VQFI 2HFSA 1ZBQA 4DV2I 1USVA 3LTOA 4DV6E 5AE1A 1ELOA 1X48A 1HR0E 1S4EA 2LJPA 4DV5E 2HHHE 2O1UA 4JI6I 1HNWE 1ZM3A 3ADLA 3T1HE 1J5EI 5BR8I 4DV5I 2UUBI 1HNWI 1N32E 1YYKA 3F6HA 4WUCA 2Z5EA 2V34A 4BC7A 4N3OA 1T4NA 3ZZUA 3H4LA 4AQYE 1WHNA 4DR3I 2LE2A 2V85A 1RC7A 1I94I 3CWVA 2VQFE 3IWDA 4XTJA 3PRYA 1N36E 4YHHE 2HKJA 2V2QA 3WU4A 5A2QC 1DI2A 1NHHA 2UXDE 2CPNA 4NXME 3WU6A 2ZITA 4DUYE 2LMZA 4DPTA 1UEKA 4JI6E 1STUA 4DV4I 4LF6E 2FV4B 4DUZE 3HXLA 1KVKA 2NPFA 4LF4I 1SR9A 5IWAE 5IT9C 3J81Q 4JI3I 2LTSA 4X65E 4KHPI 4URLA 3C4BA 2IHR1 2F8BA 2CGEA 2V86A 1FI4A 3LMLA 4F9BB 4DV4E 3WU5A 4WPYA 4OOGC 4DPUA 1XNRI 2V89A 4NXMI 2JOBA 4X62I 1MU5A 1HK7A 4M30A 2L8TA 4LF5I 2LBSB 3VYXA 3ZKBA 4JI2I 2H36X 3QT5A 2DIXA 2FGGA 1NHIA 2HFUA 2Z5CA 2M1SA 4L5NC 3H09A 1T4OA 3B82A 2CZ9A 1Z5BA 2UUAI 4LF4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 I;  4X64 E;  4EMD A;  1ZBT A;  3OTO E;  4DPY A;  4HAC A;  2LUQ A;  3LLH A;  3ZZT A;  4GKK I;  3T1Y E;  1EKZ A;  4DR6 E;  2UUC E;  2GS8 A;  1FKA E;  2E5L E;  1IBM I;  2Q2E B;  1XMQ E;  4DR5 I;  3J80 Q;  3QT7 A;  4LF9 I;  1PKP A;  4HXZ A;  1YYW A;  4JYA E;  1B62 A;  5IT9 Q;  2BM1 A;  4KQV A;  4DR1 I;  2ZBK B;  5LL6 R;  4P52 A;  2R3V A;  4DV3 E;  2ZM6 I;  2UXC E;  5FLX Q;  2RSM A;  2YT4 A;  1H74 A;  3ZKD A;  1Z0V A;  1J5E E;  3OTO I;  4JI5 E;  3B8H A;  1N0V C;  2F4V I;  3HUL A;  4X66 I;  2LJH A;  1H7U A;  1O0W A;  4DV1 E;  4DXL A;  3PYG A;  2HKE A;  2UXD I;  1B63 A;  3M6A A;  4I3H A;  1FJG I;  2MDR A;  3J7Y p;  2EZ6 A;  4JI5 I;  4JI7 E;  3ADG A;  4AQY I;  2L2M A;  2WW4 A;  2UXC I;  3JAM C;  2AJ4 A;  4DR7 E;  1K47 A;  2RS6 A;  3GON A;  2LTR A;  1H7S A;  4USM A;  2DMY A;  4B3R I;  4USK A;  3PYF A;  2VQE I;  1Z59 A;  4UTG A;  2XEX A;  4ED4 A;  4K0K E;  2EFG A;  2HK3 A;  4DU7 A;  3J81 C;  5FLX C;  4DR5 E;  2HK2 A;  1VIS A;  4JYA I;  2VF3 A;  4OX9 E;  4M1K A;  4X65 I;  2NUE A;  3K1J A;  1OJ4 A;  1WUU A;  4B3M E;  1QU6 A;  1YYO A;  1ZXM A;  4RPF A;  5LMU I;  3HTX A;  3QT8 A;  2UUA E;  4B3M I;  4R1F A;  3LNU A;  1RR9 A;  4P7A A;  4LFA I;  4DV2 E;  3T1H I;  1HNX E;  4FN5 A;  2DEI A;  4LFC I;  2LRS A;  3K17 A;  3ZZ0 A;  4JV5 E;  4DR4 I;  1DAR A;  4LFB E;  1N33 I;  1XMQ I;  3B78 A;  3VYY A;  1ZM9 A;  4NXN I;  1X49 A;  1I94 E;  4DR6 I;  4B3S E;  4B3R E;  2BV3 A;  4X64 I;  4FW9 A;  2DEJ A;  4DKK A;  2V2Z A;  5BR8 E;  1UIL A;  1Z5A A;  1YZ9 A;  1ZM4 A;  1MG7 A;  1KTV A;  4X62 E;  5IWA I;  1KIJ A;  1BKN A;  4WFT A;  2N3H A;  2VQE E;  4B3T I;  4M2Z A;  1N34 E;  1N36 I;  2DB2 A;  3QT6 A;  2KHX A;  1X47 A;  1NZ0 A;  4LFA E;  4JI3 E;  1FNM A;  1A6F A;  4JI7 I;  2NA2 A;  1Z0C A;  2A2C A;  4PRX A;  2V8P A;  4JI4 E;  1IBM E;  1XHK A;  2F4V E;  5LMU E;  3J7A G;  4DV7 E;  4Z7Y A;  2X36 A;  4GKJ E;  4LF6 I;  5L3J A;  1XMO E;  1N33 E;  4GKJ I;  3JAM Q;  2B3T B;  4JI8 I;  3C4T A;  4GKK E;  4DR3 E;  1PVG A;  3P1X A;  1U2R A;  1ZM2 A;  4ZVI A;  4DV3 I;  5LMN E;  4DR4 E;  1FWL A;  2B7V A;  1XNQ E;  2UUB E;  2L3J A;  1N32 I;  4HAC B;  1N0U A;  4Z7C A;  2N3G A;  2X7I A;  4DR7 I;  1Z0G A;  4UT4 A;  1XNR E;  1MX0 A;  2UUC I;  4X8W A;  2UXB E;  4JI1 I;  1HR0 I;  4B3T E;  4B3S I;  4JI4 I;  4DUY I;  4DU8 A;  4DV6 I;  3J80 C;  4WUB A;  3ZM7 A;  2L2N A;  1WHQ A;  4KHP E;  4HY1 A;  1HNZ I;  4JI0 E;  1HNZ E;  3PYE A;  1EI1 A;  3WU3 A;  3LPS A;  4MYU A;  5LMN I;  4NXN E;  4DV1 I;  2UU9 I;  1ZXN A;  3J7A M;  4YHH I;  1Z0E A;  2NUF A;  2NUG A;  4JV5 I;  1T4L B;  4LFB I;  4PU9 A;  4DR1 E;  1UHZ A;  2V2V A;  3PYD A;  1XNQ I;  1IBL E;  2L3C A;  4DV0 I;  1H73 A;  4LF7 E;  4X66 E;  2E1R A;  5GMD A;  2ZM6 E;  2UU9 E;  4WYQ B;  4DV0 E;  2L33 A;  1GQE A;  3ADJ A;  5CFF E;  4JI1 E;  2UXB I;  3T1Y I;  1HNX I;  1J26 A;  2JVA A;  4JG4 A;  2J7K A;  2RTX A;  1Z0T A;  2HHH I;  2JY9 A;  3ADI A;  1Z0B A;  4LF9 E;  4HYM A;  4DPW A;  1PIE A;  2OI2 A;  1EA6 A;  4FWD A;  2E5L I;  4LFC E;  4JI8 E;  2LUP B;  1Z0W A;  4FWH A;  2R42 A;  4K0K I;  4JI0 I;  1RRE A;  1IBL I;  1FWK A;  4DPX A;  4YY3 I;  4OX9 I;  4DR2 E;  4LF8 E;  4FWG A;  4LF5 E;  4JI2 E;  1RQ0 A;  1Z5C A;  4YY3 E;  5GME A;  2L2K B;  1XMO I;  2A2D A;  3D4J A;  4PRV A;  4MYT A;  1KKH A;  4DV7 I;  1IBK I;  1FJG E;  3V5R A;  1D6T A;  4WUD A;  1N34 I;  2BM0 A;  4DR2 I;  4LF8 I;  1IBK E;  1QZR A;  5A2Q Q;  2B7T A;  3Q1Q A;  3F0N A;  4DUZ I;  1S16 A;  3V2U C;  1H72 C;  1NHJ A;  2RS7 A;  2VQF I;  2HFS A;  4DV2 I;  3LTO A;  4DV6 E;  1ELO A;  1X48 A;  1HR0 E;  1S4E A;  2LJP A;  4DV5 E;  2HHH E;  4JI6 I;  1HNW E;  1ZM3 A;  3ADL A;  3T1H E;  1J5E I;  5BR8 I;  4DV5 I;  2UUB I;  1HNW I;  1N32 E;  1YYK A;  4WUC A;  2V34 A;  1T4N A;  3ZZU A;  3H4L A;  4AQY E;  1WHN A;  4DR3 I;  1RC7 A;  1I94 I;  3CWV A;  2VQF E;  4XTJ A;  1N36 E;  4YHH E;  2HKJ A;  2V2Q A;  3WU4 A;  5A2Q C;  1DI2 A;  1NHH A;  2UXD E;  2CPN A;  4NXM E;  3WU6 A;  2ZIT A;  4DUY E;  4DPT A;  1UEK A;  4JI6 E;  1STU A;  4DV4 I;  4LF6 E;  4DUZ E;  1KVK A;  2NPF A;  4LF4 I;  5IWA E;  5IT9 C;  3J81 Q;  4JI3 I;  2LTS A;  4X65 E;  4KHP I;  4URL A;  3C4B A;  2IHR 1;  1FI4 A;  4DV4 E;  3WU5 A;  4OOG C;  4DPU A;  1XNR I;  4NXM I;  4X62 I;  1MU5 A;  4M30 A;  4LF5 I;  2LBS B;  3VYX A;  3ZKB A;  4JI2 I;  3QT5 A;  2DIX A;  1NHI A;  2HFU A;  3B82 A;  1T4O A;  2CZ9 A;  1Z5B A;  2UUA I;  4LF4 E; 
#chains in the Genus database with same CATH topology
 5DRO A;  1X6H A;  4BHB A;  1BB8 A;  4LF7 I;  4X64 E;  5JEA D;  3HPZ A;  4EMD A;  2BBG A;  2WBS A;  1ZBT A;  3OTO E;  2YTG A;  1IMU A;  4HAC A;  4DPY A;  2LUQ A;  3LLH A;  3ZZT A;  2CTD A;  3T1Y E;  4GKK I;  4ZYE A;  1EKZ A;  5KL7 A;  2EM3 A;  2UUC E;  4DR6 E;  2GS8 A;  2AE8 A;  1AH5 A;  2EN2 A;  1FKA E;  3H1C A;  2E5L E;  4FW3 A;  3M85 D;  1IBM I;  2Q2E B;  1XMQ E;  3MSW A;  4DR5 I;  3J80 Q;  3QT7 A;  4LF9 I;  1PKP A;  3AUZ A;  2EOO A;  4HXZ A;  5K36 A;  1YYW A;  2EPM X;  4JYA E;  1B62 A;  5IT9 Q;  2BM1 A;  5C0X F;  4ZYH A;  4KQV A;  4DR1 I;  2E72 A;  1SFE A;  2ZBK B;  5LL6 R;  1ZU1 A;  2NN6 D;  3IWC A;  1NCS A;  2VF1 A;  4P52 A;  3MHS C;  4TUG A;  2R3V A;  1GTK A;  4DV3 E;  2K4V A;  2ZM6 I;  2UXC E;  5FLX Q;  2RQL A;  4Q28 A;  2O1V A;  5K36 B;  2YZT A;  2RSM A;  3HQ1 A;  2EOM A;  2YT4 A;  1H74 A;  2MDG A;  3ZKD A;  1Z0V A;  1BBG A;  1J5E E;  4RH8 A;  3OTO I;  4JI5 E;  3B8H A;  2ENC A;  1N0V C;  2F4V I;  4O24 A;  3HUL A;  4X66 I;  5JEA F;  2O1T A;  2EPO A;  4J3D A;  2LJH A;  1T39 A;  3NZK A;  1QNT A;  1H7U A;  3EPJ A;  1RMD A;  1O0W A;  2YTJ A;  4DV1 E;  4DXL A;  3PYG A;  4LU9 A;  2HKE A;  2UXD I;  2YTQ A;  1B63 A;  3M6A A;  4I3H A;  2PNL A;  4IZJ D;  1FJG I;  2CVE A;  2MDR A;  2VES A;  4IFD D;  2JP9 A;  2DGC A;  2VRD A;  3J7Y p;  2EZ6 A;  1UN6 B;  4JI5 I;  4IFD A;  4KZS A;  1A1J A;  4JI7 E;  4F6N A;  3ADG A;  4AQY I;  4F54 A;  2NN6 C;  2L2M A;  2EMB A;  2WW4 A;  2EL5 A;  2UXC I;  3JAM C;  2AJ4 A;  2Z5B B;  4MLQ A;  4DR7 E;  1K47 A;  2RS6 A;  3GON A;  1Z1B A;  2EOR A;  2LTR A;  4L8N A;  4GZN C;  1H7S A;  2EM4 A;  4USM A;  2DMY A;  4B3R I;  4USK A;  2EML A;  5DRP A;  1GZ6 A;  3PYF A;  2VQE I;  1Z59 A;  4MU0 A;  2C37 A;  2E1M A;  1E3H A;  4UTG A;  2XEX A;  2IOQ A;  4ED4 A;  4K0K E;  1R6M A;  2EFG A;  4BBY A;  2HK3 A;  4DU7 A;  2YRK A;  3J81 C;  2MKN A;  5FLX C;  4DR5 E;  2JWO A;  2BR2 A;  2HK2 A;  3FIG A;  1AAY A;  1VIS A;  1UDN A;  2JE6 A;  2VF3 A;  4OX9 E;  4JYA I;  3L7Z B;  2O1W A;  4IJD A;  4M1K A;  2NUE A;  1Y4S A;  3K1J A;  1OJ4 A;  4X65 I;  1WUU A;  4B3M E;  1QU6 A;  1YYO A;  1ZXM A;  4RPF A;  5LMU I;  3HTX A;  5K36 D;  2WZO A;  3QT8 A;  4OO1 F;  1Y4U A;  2I13 A;  1MEY C;  1Y6Z A;  2UUA E;  2BA1 D;  4B3M I;  4R1F A;  3EPH A;  1RR9 A;  3LNU A;  4P7A A;  2YTN A;  2GLI A;  4LFA I;  3P3C A;  1PJS A;  4DV2 E;  3T1H I;  3F6G A;  1HNX E;  3BBG A;  2EJ4 A;  2DEI A;  4FN5 A;  2LRS A;  1LLM C;  4LFC I;  3K17 A;  3M99 B;  2CSH A;  2LVH A;  4JV5 E;  4R2Q A;  4U3B A;  3ZZ0 A;  4DR4 I;  1DAR A;  3KZY A;  2YTF A;  4IS1 C;  4LFB E;  1N33 I;  1X6F A;  4QNJ A;  1TF6 A;  2JEA B;  2EMC A;  1XMQ I;  2GHF A;  2EMF A;  4R2R A;  2L92 A;  2ELZ A;  4LCH A;  4F9C B;  3VYY A;  3B78 A;  1ZM9 A;  2EPK X;  4OO1 A;  4NXN I;  4AID A;  1X49 A;  1I94 E;  4M9V C;  4DR6 I;  4B3S E;  2EM8 A;  4B3R E;  2EOQ A;  4WSG A;  1A1L A;  2DSY A;  2KON A;  1G2D C;  3Q6N A;  2EL6 A;  2EOY A;  4IZK B;  2BV3 A;  3RMP A;  2WNR A;  1KJK A;  4X64 I;  4FW9 A;  3Q6M A;  2PO0 B;  2YU5 A;  1F2I G;  1P47 A;  1MGT A;  4BA1 A;  2HJJ A;  3M7N D;  2V88 A;  3CDI A;  2DEJ A;  4DKK A;  4OO1 B;  4O4K A;  2V2Z A;  1KYQ A;  1UIL A;  5BR8 E;  2NN6 F;  5FWK A;  5TSE A;  3THO B;  1Z5A A;  2O3Z A;  1WJP A;  4F6M A;  1YZ9 A;  4GEQ B;  2LT7 A;  4F9A B;  1ZM4 A;  1MG7 A;  2HC5 A;  3P06 A;  4MU1 A;  1KTV A;  4X62 E;  2R1F A;  3P76 A;  4FW4 A;  4OO1 C;  2YRM A;  2M7Q A;  5IWA I;  3PS1 A;  1G2F C;  4P78 A;  4WX9 A;  1KIJ A;  1BKN A;  4WFT A;  2EL4 A;  1USU A;  2N3H A;  2VQE E;  4B3T I;  4AIM A;  4M2Z A;  5DRQ A;  4P7D A;  2WBU A;  2B9D A;  1N34 E;  1N36 I;  2EPC A;  2EMA A;  3EPK A;  2BA1 G;  1YH8 A;  2DB2 A;  3QT6 A;  2KHX A;  2GQ0 A;  3P3E A;  1X47 A;  1NZ0 A;  2EPZ A;  4LFA E;  4JI3 E;  1FNM A;  4OZE A;  2ENH A;  1TN9 A;  1A6F A;  2JXP A;  4JI7 I;  2NA2 A;  1Z0C A;  2A2C A;  3HKM A;  4PRX A;  2V8P A;  4JI4 E;  1IBM E;  1XHK A;  2F4V E;  5LMU E;  1A1I A;  2N8X A;  1A1H A;  2YTP A;  3J7A G;  3DJW A;  4DV7 E;  2R76 A;  5F3W A;  2LV2 A;  3PS3 A;  2LO3 A;  2EM6 A;  4Z7Y A;  2IOP A;  2X36 A;  2JEB A;  4KWY A;  4GKJ E;  5C0X C;  3MHH C;  2V83 A;  4LF6 I;  5L3J A;  2PNM A;  1XMO E;  2EMX A;  3KZZ A;  4BC9 A;  1E3P A;  5A6B A;  1N33 E;  2PO1 A;  4GKJ I;  3JAM Q;  2B3T B;  1X3C A;  2YSO A;  2FTX B;  5A6A A;  5ELW A;  4JI8 I;  4LCF A;  2NAB A;  3C4T A;  4GKK E;  4DR3 E;  1PVG A;  1DQ3 A;  2C38 B;  3P1X A;  2Z5C B;  3C6K A;  2WNR B;  2JYA A;  2PRT A;  1U2R A;  1ZM2 A;  5JEA C;  2NN6 A;  4ZVI A;  4BA1 B;  2ADR A;  1A1F A;  5LMN E;  4DV3 I;  4N4R B;  2EQ3 A;  1VI7 A;  5A6J A;  4NHR A;  4DR4 E;  1FWL A;  5DNX A;  4AM3 A;  2B7V A;  3DF6 A;  1XNQ E;  2UUB E;  2ODR D;  3IWB A;  2EPX A;  3JU0 A;  2L6M A;  3AV0 A;  4BMJ A;  2V8Q B;  2L3J A;  3P3G A;  1N32 I;  3TQM A;  2EPR A;  4HAC B;  1N0U A;  4R03 A;  2V87 A;  4LPF A;  4IS9 A;  4I8O A;  2KOU A;  4Z7C A;  2N3G A;  2M9A A;  3M85 G;  2X7I A;  4DR7 I;  2ODR C;  2ELY A;  2EM2 A;  2WBT A;  2C39 B;  2EMH A;  4MLV A;  1Z0G A;  5T6J A;  4UT4 A;  1XNR E;  1MX0 A;  2Z5B A;  4R2D A;  2UUC I;  3THN A;  1WXR A;  4X8W A;  2UXB E;  4JI1 I;  5K36 E;  1HR0 I;  4O43 A;  4B3T E;  4B3S I;  3BID A;  5AE2 A;  2EM7 A;  3OML A;  4JI4 I;  4DUY I;  4DU8 A;  4NZV A;  4R2A A;  5DNY A;  4DV6 I;  2YTD A;  1OYR A;  3J80 C;  3K6Q A;  4WUB A;  3ZM7 A;  2L2N A;  1WHQ A;  4KHP E;  4FK5 C;  2YWQ A;  2EMZ A;  2K7I A;  4R2S A;  2PO2 A;  4HY1 A;  3HPS A;  3U1K A;  2EM0 A;  2EN7 A;  4OO1 D;  1HNZ I;  2EPL X;  1EH6 A;  2I9I A;  4JI0 E;  4LTY A;  2EN8 A;  4F2J C;  2EQ0 A;  4GQU A;  4FW6 A;  2BR2 B;  1HNZ E;  1R6L A;  3PYE A;  1EI1 A;  3WU3 A;  3LPS A;  4MYU A;  4X9J A;  3K85 A;  4NXN E;  5LMN I;  2CG9 A;  4DV1 I;  2UU9 I;  1ZXN A;  4BA2 A;  4R8O A;  2PO2 B;  3J7A M;  4WSP A;  4YHH I;  2JT2 A;  4BS9 A;  1Z0E A;  3BF2 A;  2NUF A;  2NUG A;  2NN6 E;  1PDA A;  4JV5 I;  1OYP A;  1T4L B;  3DD6 A;  4ISA A;  4LFB I;  4PU9 A;  4DR1 E;  2EWL A;  2MC6 A;  2EPN A;  1UHZ A;  2V2V A;  1OYS A;  3PYD A;  2EN4 A;  1XNQ I;  1X5W A;  5IV8 B;  2NN6 B;  1IBL E;  2L3C A;  4DV0 I;  4IFD E;  1Y5Y A;  1H73 A;  3C6M A;  2EMY A;  4X66 E;  1DGC A;  4LF7 E;  2E1R A;  2ZM6 E;  2UU9 E;  3GLL A;  2A25 A;  3JTZ A;  4WYQ B;  4R2E A;  5GMD A;  2D9H A;  2DLQ A;  1X6E A;  4DV0 E;  2L33 A;  2EPP A;  1GQE A;  3ADJ A;  5CFF E;  4TUI A;  4JI1 E;  2GO4 A;  2UXB I;  2DLK A;  1UDS A;  2EN3 A;  2EN1 A;  4BCA A;  3T1Y I;  1HNX I;  1J26 A;  1YUJ A;  3UHM A;  2JVA A;  3L00 A;  2JR1 A;  4JG4 A;  1PJT A;  2J7K A;  2RPC A;  2EOE A;  3UK3 C;  2JOX A;  2RTX A;  1Z0T A;  4RHB B;  5KL5 A;  1A1G A;  2HHH I;  2JY9 A;  2EM9 A;  3ZOQ B;  3ADI A;  1Z0B A;  4LF9 E;  4IZJ B;  2IES A;  2BB8 A;  4HYM A;  4DPW A;  1PIE A;  2OI2 A;  2EM5 A;  1EA6 A;  4FWD A;  2E5L I;  1ZR9 A;  2EMG A;  2EOI A;  3VHT B;  4LFC E;  4JI8 E;  4MDT A;  3BGH A;  2F1D A;  4DMI A;  2LUP B;  2VE7 C;  1Z0W A;  4FWH A;  2R42 A;  3L7Z A;  4K0K I;  1N3G A;  1L4S A;  4JI0 I;  1RRE A;  5EKW A;  4IZJ A;  1IBL I;  2YTE A;  4LCG A;  3EQ1 A;  5ADZ A;  4MQY A;  2ENA A;  1FWK A;  2M4I A;  2EOH A;  4DPX A;  4YY3 I;  4OX9 I;  3VK6 A;  5C0X D;  3KWR A;  4DR2 E;  4LF8 E;  2YU8 A;  5AC5 A;  1EH7 A;  2GPI A;  1A1K A;  1P42 A;  4LF5 E;  1JK1 A;  2PNZ A;  1XXE A;  2WCC 3;  4FWG A;  2EOZ A;  4JI2 E;  1RQ0 A;  1Z5C A;  4YY3 E;  5GME A;  5JEA E;  2L2K B;  4QNK A;  1XMO I;  2GO3 A;  2A2D A;  3D4J A;  4BA2 B;  2C37 B;  2G7H A;  1IQS A;  2DRP A;  4Q35 B;  4PRV A;  2EN6 A;  2LJU A;  3ECR A;  2BA0 G;  4MYT A;  2YTI A;  4R2C A;  1KKH A;  4DV7 I;  4J8Z A;  2J7J A;  1IBK I;  4FW5 A;  4M0V A;  1FJG E;  3V5R A;  1D6T A;  4WUD A;  1N34 I;  4LOM A;  3M7N G;  5A6K A;  2BM0 A;  2JE6 B;  5AE3 A;  4O5G A;  1IBK E;  3CDJ A;  4DR2 I;  4LF8 I;  1QZR A;  4IZK A;  5A2Q Q;  2B7T A;  2EOS A;  2LCE A;  1WRJ A;  2WP8 A;  2EOX A;  2MC5 A;  2PO0 A;  3Q1Q A;  3F0N A;  3HJC A;  1RHY A;  4DUZ I;  4MU4 A;  1S16 A;  4ZYD A;  3V2U C;  1H72 C;  1NHJ A;  2PO1 B;  2RS7 A;  5DRR A;  5AAS A;  1Y60 A;  2HFS A;  1ZBQ A;  3U1Y A;  2VQF I;  4DV2 I;  1EH8 A;  1USV A;  3LTO A;  2EP3 A;  2EPA A;  4DV6 E;  5AE1 A;  2JPA A;  2JEA A;  1ZAA C;  4MU3 A;  1ELO A;  1X48 A;  5A69 A;  1HR0 E;  1S4E A;  2LJP A;  5C0X A;  4DV5 E;  2HHH E;  5KL3 A;  2HGH A;  2O1U A;  4JI6 I;  1HNW E;  1ZM3 A;  1NEI A;  3ADL A;  5DNL A;  1BBO A;  1IQO A;  2EOJ A;  3T1H E;  1J5E I;  5BR8 I;  4DV5 I;  2UUB I;  4OO1 E;  1HNW I;  1YPN A;  1N32 E;  1YHC A;  1YYK A;  3F6H A;  4R2P A;  4WUC A;  2Z5E A;  2V34 A;  5C0X E;  4BC7 A;  5LLQ A;  4N3O A;  1T4N A;  1B69 A;  3EPL A;  3ZZU A;  5C0X B;  3H4L A;  4AQY E;  1WHN A;  4DR3 I;  2LE2 A;  5KL6 A;  2YSP A;  2V85 A;  4FW7 A;  2PNZ B;  1RC7 A;  1UBD C;  5IXM B;  2YTO A;  2BA0 D;  1I94 I;  3CWV A;  5KL4 A;  2VQF E;  4OKG A;  3IWD A;  4XTJ A;  1UDQ A;  3PRY A;  4U3D A;  1N36 E;  5K36 C;  4NBQ A;  4YHH E;  2HKJ A;  3PS2 A;  2V2Q A;  3WU4 A;  5EL9 A;  5A2Q C;  1DI2 A;  1NHH A;  2EMI A;  2UXD E;  2CPN A;  4NXM E;  3WU6 A;  1UDO A;  4WXC A;  5KL2 A;  2ZIT A;  2EE8 A;  4DUY E;  2EMK A;  2LMZ A;  1YUI A;  4DPT A;  1UEK A;  4JI6 E;  1STU A;  4IFD F;  4DV4 I;  2C38 A;  4LF6 E;  2WP8 B;  2FV4 B;  4DUZ E;  5AC4 A;  3HXL A;  4HTG A;  1KVK A;  3B4T A;  2NPF A;  4BHC A;  4LF4 I;  1SR9 A;  5IWA E;  3KRN A;  5IT9 C;  3J81 Q;  2EOF A;  4JI3 I;  2EPU A;  2LTS A;  4X65 E;  4KHP I;  2IER A;  4URL A;  5JEA B;  1T38 A;  3C4B A;  2DMI A;  2MKD A;  2IHR 1;  2F8B A;  2CGE A;  2V86 A;  2YRH A;  2Q8U A;  1FI4 A;  2EMW A;  3LML A;  4F9B B;  4DV4 E;  2EQ1 A;  3WU5 A;  3QG5 C;  2CT1 A;  4WPY A;  4OOG C;  2JEB B;  4DPU A;  1YSA C;  2J65 A;  2RSI A;  2C39 A;  1XNR I;  4ZYG A;  5JEA A;  2V89 A;  1YFH A;  2JOB A;  4NXM I;  4X62 I;  4IFD C;  1MU5 A;  1TF3 A;  1HK7 A;  4M30 A;  2L8T A;  2YPN A;  2LBS B;  4LF5 I;  1JK2 A;  4WXD A;  3VYX A;  3ZKB A;  4JI2 I;  2H36 X;  3QT5 A;  2DIX A;  2FGG A;  1NHI A;  2HFU A;  2Z5C A;  3GME A;  3GCM A;  4HEI A;  1PJQ A;  4IFD B;  2M1S A;  4L5N C;  3H09 A;  1T4O A;  3B82 A;  2CZ9 A;  1Z5B A;  5A6B D;  5K36 F;  2UUA I;  4LF4 E; 
#chains in the Genus database with same CATH homology
 4LF7 I;  4X64 E;  3HPZ A;  4EMD A;  1ZBT A;  3OTO E;  4DPY A;  4HAC A;  2LUQ A;  3LLH A;  3ZZT A;  4GKK I;  3T1Y E;  1EKZ A;  4DR6 E;  2UUC E;  2GS8 A;  1FKA E;  2E5L E;  1IBM I;  2Q2E B;  1XMQ E;  3MSW A;  4DR5 I;  3J80 Q;  3QT7 A;  4LF9 I;  1PKP A;  3AUZ A;  4HXZ A;  1YYW A;  4JYA E;  1B62 A;  5IT9 Q;  2BM1 A;  4KQV A;  4DR1 I;  2ZBK B;  5LL6 R;  3IWC A;  2VF1 A;  4P52 A;  4TUG A;  2R3V A;  4DV3 E;  2K4V A;  2ZM6 I;  2UXC E;  5FLX Q;  4Q28 A;  2O1V A;  2YZT A;  2RSM A;  3HQ1 A;  2YT4 A;  1H74 A;  3ZKD A;  1Z0V A;  1J5E E;  3OTO I;  4JI5 E;  3B8H A;  1N0V C;  2F4V I;  3HUL A;  4X66 I;  2O1T A;  2LJH A;  1H7U A;  1O0W A;  4DV1 E;  4DXL A;  3PYG A;  4LU9 A;  2HKE A;  2UXD I;  1B63 A;  3M6A A;  4I3H A;  2PNL A;  4IZJ D;  1FJG I;  2MDR A;  3J7Y p;  2EZ6 A;  4JI5 I;  4KZS A;  4JI7 E;  3ADG A;  4AQY I;  4F54 A;  2L2M A;  2WW4 A;  2UXC I;  3JAM C;  2AJ4 A;  2Z5B B;  4DR7 E;  1K47 A;  2RS6 A;  3GON A;  4L8N A;  2LTR A;  1H7S A;  4USM A;  2DMY A;  4B3R I;  4USK A;  1GZ6 A;  3PYF A;  2VQE I;  1Z59 A;  2E1M A;  4UTG A;  2XEX A;  2IOQ A;  4ED4 A;  4K0K E;  2EFG A;  4BBY A;  2HK3 A;  4DU7 A;  3J81 C;  5FLX C;  4DR5 E;  2JWO A;  2HK2 A;  3FIG A;  1VIS A;  4JYA I;  2VF3 A;  4OX9 E;  2O1W A;  4M1K A;  4X65 I;  2NUE A;  1Y4S A;  3K1J A;  1OJ4 A;  1WUU A;  4B3M E;  1QU6 A;  1YYO A;  1ZXM A;  4RPF A;  5LMU I;  3HTX A;  2WZO A;  3QT8 A;  1Y4U A;  1Y6Z A;  2UUA E;  4B3M I;  4R1F A;  3LNU A;  1RR9 A;  4P7A A;  4LFA I;  4DV2 E;  3T1H I;  1HNX E;  3F6G A;  4FN5 A;  2DEI A;  4LFC I;  2LRS A;  3K17 A;  3ZZ0 A;  4JV5 E;  4DR4 I;  1DAR A;  4LFB E;  1N33 I;  1XMQ I;  2L92 A;  4F9C B;  3VYY A;  3B78 A;  1ZM9 A;  4NXN I;  1X49 A;  1I94 E;  4DR6 I;  4B3S E;  4B3R E;  2DSY A;  2KON A;  3Q6N A;  4IZK B;  2BV3 A;  3RMP A;  4X64 I;  4FW9 A;  3Q6M A;  2V88 A;  2DEJ A;  4DKK A;  2V2Z A;  5BR8 E;  1UIL A;  5FWK A;  1Z5A A;  1YZ9 A;  4GEQ B;  4F9A B;  1ZM4 A;  1MG7 A;  3P06 A;  1KTV A;  4X62 E;  2M7Q A;  5IWA I;  4P78 A;  1KIJ A;  1BKN A;  4WFT A;  1USU A;  2N3H A;  2VQE E;  4B3T I;  4M2Z A;  4P7D A;  2B9D A;  1N34 E;  1N36 I;  2DB2 A;  3QT6 A;  2KHX A;  2GQ0 A;  1X47 A;  1NZ0 A;  4LFA E;  4JI3 E;  1FNM A;  1A6F A;  4JI7 I;  2NA2 A;  1Z0C A;  2A2C A;  4PRX A;  2V8P A;  4JI4 E;  1IBM E;  1XHK A;  2F4V E;  5LMU E;  3J7A G;  3DJW A;  4DV7 E;  5F3W A;  4Z7Y A;  2IOP A;  2X36 A;  4GKJ E;  2V83 A;  4LF6 I;  5L3J A;  2PNM A;  1XMO E;  4BC9 A;  1N33 E;  4GKJ I;  3JAM Q;  2B3T B;  4JI8 I;  2FTX B;  3C4T A;  4GKK E;  4DR3 E;  1PVG A;  1DQ3 A;  3P1X A;  2Z5C B;  1U2R A;  1ZM2 A;  4ZVI A;  4DV3 I;  5LMN E;  4DR4 E;  1FWL A;  2B7V A;  3DF6 A;  1XNQ E;  2UUB E;  2L3J A;  2ODR D;  3IWB A;  3JU0 A;  2L6M A;  3AV0 A;  4BMJ A;  2V8Q B;  1N32 I;  4HAC B;  1N0U A;  4R03 A;  2V87 A;  4I8O A;  2KOU A;  4Z7C A;  2N3G A;  2X7I A;  4DR7 I;  2ODR C;  1Z0G A;  5T6J A;  4UT4 A;  1XNR E;  1MX0 A;  2Z5B A;  2UUC I;  1WXR A;  4X8W A;  2UXB E;  4JI1 I;  1HR0 I;  4B3T E;  4B3S I;  5AE2 A;  3OML A;  4JI4 I;  4DUY I;  4DU8 A;  5DNY A;  4DV6 I;  3J80 C;  3K6Q A;  4WUB A;  3ZM7 A;  2L2N A;  1WHQ A;  4KHP E;  4HY1 A;  3HPS A;  1HNZ I;  4JI0 E;  4LTY A;  1HNZ E;  3PYE A;  1EI1 A;  3WU3 A;  3LPS A;  4MYU A;  3K85 A;  4NXN E;  5LMN I;  2CG9 A;  4DV1 I;  2UU9 I;  1ZXN A;  4R8O A;  3J7A M;  4WSP A;  4YHH I;  4BS9 A;  1Z0E A;  2NUF A;  2NUG A;  4JV5 I;  1T4L B;  4LFB I;  4PU9 A;  4DR1 E;  2EWL A;  2MC6 A;  1UHZ A;  2V2V A;  3PYD A;  1XNQ I;  1IBL E;  2L3C A;  4DV0 I;  1H73 A;  4LF7 E;  4X66 E;  2E1R A;  5GMD A;  2ZM6 E;  2UU9 E;  3JTZ A;  4WYQ B;  4DV0 E;  2L33 A;  1GQE A;  3ADJ A;  5CFF E;  4TUI A;  4JI1 E;  2UXB I;  3T1Y I;  4BCA A;  1HNX I;  1J26 A;  2JVA A;  2JR1 A;  4JG4 A;  2J7K A;  2JOX A;  2RTX A;  1Z0T A;  2HHH I;  2JY9 A;  3ZOQ B;  3ADI A;  1Z0B A;  4LF9 E;  4IZJ B;  4HYM A;  4DPW A;  1PIE A;  2OI2 A;  1EA6 A;  4FWD A;  2E5L I;  4LFC E;  4JI8 E;  4DMI A;  2LUP B;  2VE7 C;  1Z0W A;  4FWH A;  2R42 A;  4K0K I;  4JI0 I;  1RRE A;  4IZJ A;  1IBL I;  5ADZ A;  1FWK A;  2M4I A;  4DPX A;  4YY3 I;  4OX9 I;  3VK6 A;  3KWR A;  4DR2 E;  4LF8 E;  4FWG A;  4LF5 E;  4JI2 E;  1RQ0 A;  1Z5C A;  4YY3 E;  5GME A;  2L2K B;  1XMO I;  2A2D A;  3D4J A;  2G7H A;  4PRV A;  4MYT A;  1KKH A;  4DV7 I;  4J8Z A;  1IBK I;  4M0V A;  1FJG E;  3V5R A;  1D6T A;  4WUD A;  1N34 I;  2BM0 A;  4DR2 I;  5AE3 A;  1IBK E;  4LF8 I;  1QZR A;  4IZK A;  5A2Q Q;  2B7T A;  2MC5 A;  3Q1Q A;  3F0N A;  3HJC A;  4DUZ I;  1S16 A;  3V2U C;  1H72 C;  1NHJ A;  2RS7 A;  5AAS A;  2VQF I;  2HFS A;  1ZBQ A;  4DV2 I;  1USV A;  3LTO A;  4DV6 E;  5AE1 A;  1ELO A;  1X48 A;  1HR0 E;  1S4E A;  2LJP A;  4DV5 E;  2HHH E;  2O1U A;  4JI6 I;  1HNW E;  1ZM3 A;  3ADL A;  3T1H E;  1J5E I;  5BR8 I;  4DV5 I;  2UUB I;  1HNW I;  1N32 E;  1YYK A;  3F6H A;  4WUC A;  2Z5E A;  2V34 A;  4BC7 A;  4N3O A;  1T4N A;  3ZZU A;  3H4L A;  4AQY E;  1WHN A;  4DR3 I;  2LE2 A;  2V85 A;  1RC7 A;  1I94 I;  3CWV A;  2VQF E;  3IWD A;  4XTJ A;  3PRY A;  1N36 E;  4YHH E;  2HKJ A;  2V2Q A;  3WU4 A;  5A2Q C;  1DI2 A;  1NHH A;  2UXD E;  2CPN A;  4NXM E;  3WU6 A;  2ZIT A;  4DUY E;  2LMZ A;  4DPT A;  1UEK A;  4JI6 E;  1STU A;  4DV4 I;  4LF6 E;  2FV4 B;  4DUZ E;  3HXL A;  1KVK A;  2NPF A;  4LF4 I;  1SR9 A;  5IWA E;  5IT9 C;  3J81 Q;  4JI3 I;  2LTS A;  4X65 E;  4KHP I;  4URL A;  3C4B A;  2IHR 1;  2F8B A;  2CGE A;  2V86 A;  1FI4 A;  3LML A;  4F9B B;  4DV4 E;  3WU5 A;  4WPY A;  4OOG C;  4DPU A;  1XNR I;  2V89 A;  4NXM I;  2JOB A;  4X62 I;  1MU5 A;  1HK7 A;  4M30 A;  2L8T A;  4LF5 I;  2LBS B;  3VYX A;  3ZKB A;  4JI2 I;  2H36 X;  3QT5 A;  2DIX A;  2FGG A;  1NHI A;  2HFU A;  2Z5C A;  2M1S A;  4L5N C;  3H09 A;  1T4O A;  3B82 A;  2CZ9 A;  1Z5B A;  2UUA I;  4LF4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...