4X62E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x62E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x62E02
4LF4E 1HR0E 4DUYI 1ZM9A 4YY3I 1N33I 2L2NA 1NHHA 4EMDA 2HK3A 4JI2E 1XNQE 4YY3E 1EA6A 4DPXA 4DV2I 5LMUE 1X48A 2R3VA 1BKNA 4MYTA 4KHPE 1GQEA 1ZXMA 2UUBI 2LUQA 1XMQE 2EFGA 2HHHI 4JI1E 1HNZI 5BR8E 2DB2A 2HKEA 4FWDA 1N0VC 1PVGA 1S16A 2RTXA 4YHHE 2A2CA 1S4EA 4DV3E 3M6AA 1UILA 3J80Q 1H73A 1X49A 2RSMA 2DEIA 2UXBE 1I94E 2N3HA 5GMDA 4Z7YA 4R1FA 3F0NA 2UXCE 3J7Yp 4GKKE 1WUUA 3T1YI 4LFCE 1Z0CA 4DV1I 2R42A 4X62E 4GKKI 1IBKE 2NPFA 5IT9Q 3V5RA 4X62I 1OJ4A 3PYDA 1IBKI 3ZZTA 2EZ6A 1KKHA 1STUA 2RS6A 4B3MI 1Z0VA 3GONA 5IWAE 4FN5A 1XMOI 2V2ZA 1B63A 1H7UA 4DPWA 1Z0EA 1ELOA 4JI5E 4M30A 2LBSB 1H74A 1NZ0A 1UEKA 2CZ9A 2UXDE 2J7KA 1N0UA 3ZZ0A 4HXZA 4OX9E 2UUAI 3CWVA 1FWLA 4B3SI 1HNWI 2V8PA 4JV5I 3ZKBA 2IHR1 3D4JA 4P52A 2B7TA 1N36E 2VQFE 4DPUA 2L2MA 2MDRA 4PU9A 2LRSA 3T1HI 4MYUA 4ED4A 3HULA 4FW9A 4X65E 2L2KB 2KHXA 4DR2E 2UUBE 4DR3I 3T1HE 1O0WA 4GKJI 1HR0I 1H7SA 4DR2I 1N33E 4GKJE 1J5EE 4K0KE 3WU3A 1DI2A 4DV6I 1J5EI 4K0KI 4LF4I 1Z0WA 4DUYE 1T4LB 2B7VA 1YZ9A 2V2VA 4KQVA 3WU4A 5LMUI 3ADGA 4RPFA 2LJPA 3PYFA 3J7AG 4JG4A 4DR5E 4NXNI 4JI7I 4WUCA 2ZBKB 4DV4I 2VQEI 1QU6A 4DXLA 4DV4E 1FI4A 1VISA 1I94I 4LF5E 2JY9A 2UXCI 4DR6I 2BV3A 4LFCI 2F4VE 4PRVA 5FLXC 4LF6E 2ZM6E 4X8WA 3B82A 1WHQA 4JI3I 3ADLA 3WU5A 4LF6I 1HNXI 3LTOA 3P1XA 4DR7I 2B3TB 3B78A 4DR4I 4LF8I 2YT4A 2AJ4A 3QT8A 1XMOE 4DR4E 1T4NA 4B3RE 1KVKA 3ADJA 4B3ME 3VYXA 5IT9C 1H72C 2HKJA 5IWAI 4LF9E 3C4BA 2HFSA 2DEJA 1WHNA 3ZZUA 1MX0A 1HNWE 4JI4E 4JI8I 1N34I 1MG7A 4PRXA 4NXMI 5LMNE 1N36I 2BM0A 1FJGE 4USKA 2UUAE 1IBMI 1Z0BA 2E1RA 4DU8A 3K17A 3J80C 4FWHA 2OI2A 1FNMA 1K47A 2UUCE 1U2RA 2VF3A 2UU9I 1EKZA 4AQYE 2UUCI 4X64I 1X47A 2UU9E 2V2QA 3LLHA 4M1KA 1YYKA 2X7IA 4X64E 1NHIA 1MU5A 1B62A 1Z0GA 3QT5A 4DUZE 1IBLE 4LFAE 1J26A 4X66I 1Z59A 1XNQI 1KTVA 5A2QQ 4DV2E 4LF7E 2ZITA 4JI6I 2RS7A 4LF7I 4HACA 3ZM7A 1N32E 4WFTA 1Z5AA 3VYYA 2X36A 1XHKA 4JYAI 3JAMQ 4DV3I 1HNZE 2HFUA 5BR8I 4DV7E 2HK2A 1QZRA 4JYAE 4DV7I 3JAMC 3ZKDA 2NUFA 4P7AA 3V2UC 5FLXQ 1UHZA 3J81Q 2UXBI 1ZM4A 2N3GA 2F4VI 1Z5BA 4HY1A 4DV1E 4JI3E 2L3JA 1XNRI 1FWKA 1PKPA 5L3JA 1XNRE 4DV5I 4WUBA 5A2QC 4HACB 3K1JA 4B3RI 2NA2A 2LUPB 3J81C 1KIJA 4DPYA 3OTOE 3PYEA 5LL6R 4B3SE 3C4TA 1ZM2A 2VQFI 4M2ZA 3HTXA 2LTSA 4XTJA 2CPNA 2XEXA 1IBME 4DV0E 4X65I 4DR1E 4JI0E 3WU6A 4DV0I 1ZXNA 4LFBE 4OOGC 1NHJA 4B3TI 4DV6E 4URLA 4WYQB 4JI2I 1A6FA 1ZM3A 4DUZI 1IBLI 4LFAI 4USMA 1RR9A 4JI6E 4KHPI 1RQ0A 4NXNE 4X66E 4Z7CA 3H4LA 2V34A 4DPTA 1N32I 4DU7A 2HHHE 4JI1I 2LTRA 4DR5I 4JI7E 1XMQI 4ZVIA 2BM1A 1T4OA 4LF5I 3Q1QA 2VQEE 5GMEA 4YHHI 3T1YE 3ADIA 3QT7A 4DR6E 2DMYA 2LJHA 1ZBTA 1HNXE 2NUEA 2DIXA 1YYWA 1EI1A 2ZM6I 4DR7E 2JVAA 1RREA 4DV5E 4LF8E 3LPSA 3J7AM 1FKAE 4UTGA 4LF9I 4UT4A 2GS8A 4JI5I 4DKKA 4FWGA 4WUDA 2UXDI 1YYOA 3OTOI 5CFFE 2Q2EB 2WW4A 3LNUA 1PIEA 4JI8E 1N34E 4NXME 2E5LE 5LMNI 2L3CA 2NUGA 2E5LI 1Z0TA 4JI4I 4I3HA 4OX9I 1FJGI 2L33A 3B8HA 4JV5E 1RC7A 4JI0I 1D6TA 1DARA 4B3TE 2A2DA 4AQYI 4HYMA 3QT6A 4DR1I 3PYGA 1Z5CA 4DR3E 4LFBI
chains in the Genus database with same CATH superfamily
2EOIA 3PS2A 4LF4E 1HR0E 3M7ND 1ZBQA 1ZM9A 4DUYI 4YY3I 4IFDA 3C6KA 2L2NA 1N33I 2YZTA 1NHHA 2EMFA 2YTDA 4EMDA 2HK3A 4JI2E 2EM0A 2I13A 4YY3E 1P47A 1XNQE 2BA1G 2EMGA 1EA6A 4DPXA 5LMUE 4DV2I 2EN6A 1X48A 4IJDA 4WXDA 3JTZA 2BR2B 2R3VA 1BKNA 4MYTA 3M99B 1EH7A 2PO2A 4KHPE 3Q6NA 1GQEA 1ZXMA 3CDJA 2EQ0A 4R03A 3AV0A 2UUBI 2LUQA 4ZYEA 1XMQE 2ENCA 2EM4A 5KL7A 1G2DC 2EFGA 4R2QA 2EM3A 2HHHI 5C0XD 4JI1E 2EORA 1HNZI 2YTNA 5BR8E 4BHBA 2DB2A 2HKEA 4FW7A 4FWDA 3M85D 1N0VC 1PVGA 1S16A 2RTXA 4YHHE 2A2CA 1S4EA 4DV3E 3M6AA 1UILA 3J80Q 2EMIA 1H73A 1HK7A 1X49A 4P78A 2RSMA 5JEAF 2DEIA 2M1SA 4MLVA 1I94E 2UXBE 2N3HA 4TUGA 4OO1C 5K36E 5GMDA 4Z7YA 2EPRA 3F0NA 2UXCE 4R1FA 1PJQA 4R2CA 3J7Yp 4GKKE 2EP3A 2KOUA 1WUUA 3T1YI 4LFCE 1Z0CA 4WSPA 2R42A 5DNXA 4DV1I 3THOB 4X62E 1EH6A 4IFDB 4GKKI 1IBKE 2NPFA 5IT9Q 3V5RA 4X62I 1OJ4A 1ZR9A 2HC5A 3PYDA 1IBKI 4WPYA 1YUJA 4Q28A 5EL9A 4WX9A 3ZZTA 2EZ6A 2EOHA 1KKHA 2PNLA 4FW4A 2LJUA 1STUA 2RS6A 5JEAC 4B3MI 1Z0VA 2WBUA 3GONA 5IWAE 5A6KA 4FN5A 1XMOI 1SFEA 2V2ZA 2EN8A 1B63A 1H7UA 4IZKB 4DPWA 1Z0EA 1ELOA 4JI5E 4M30A 2LBSB 1H74A 1NZ0A 2YTFA 1KJKA 2WP8A 2CT1A 4GZNC 1Y6ZA 1UEKA 1R6LA 2N8XA 2EJ4A 2CZ9A 1X3CA 2UXDE 1TF6A 2EM5A 2J7KA 4LCHA 4OO1F 5K36F 4L8NA 1N0UA 3ZZ0A 2LE2A 3UK3C 4M0VA 4HXZA 4OX9E 5KL3A 2A25A 1BBGA 4TUIA 3CWVA 2UUAI 2KONA 2GHFA 1FWLA 4B3SI 2JWOA 1HNWI 2V8PA 4JV5I 4MDTA 3ZKBA 2EPNA 4BC9A 2IHR1 1GZ6A 4O24A 2EQ1A 3MHSC 2B7TA 4R2PA 1N36E 3D4JA 4KWYA 2YTEA 2VQFE 2L2MA 2MDRA 4PU9A 4DPUA 1F2IG 2L92A 1Y5YA 1LLMC 1B69A 2LRSA 1SR9A 1BBOA 4MU4A 4MYUA 2EMYA 5DRPA 3T1HI 2EQ3A 3FIGA 4ED4A 3HULA 4FW9A 2EWLA 5AC5A 2KHXA 4X65E 2NABA 2L2KB 4DR2E 3T1HE 1O0WA 2UUBE 2PNZA 4BA1A 4DR3I 4GKJI 3U1YA 1HR0I 2LO3A 1DQ3A 1H7SA 1N33E 2IERA 2M7QA 4R2DA 4DR2I 2JP9A 4GKJE 4MU3A 4IFDD 1J5EE 4HEIA 4K0KE 2LT7A 2PO0B 3WU3A 1A1HA 4OO1D 1DI2A 2EPPA 1TN9A 4DV6I 1J5EI 4K0KI 2YTGA 4LF4I 1Z0WA 5C0XB 4DUYE 1T4LB 2B7VA 4FW3A 4IZKA 2ODRC 4AM3A 2PO1A 1YZ9A 2V2VA 5FWKA 2PRTA 4KQVA 3WU4A 5LMUI 3ADGA 2YU5A 3IWDA 2LJPA 3PYFA 4RPFA 3J7AG 4JG4A 4HTGA 4DR5E 4BA2B 4OO1E 2O3ZA 2EOQA 4NXNI 4JI7I 2BA1D 1NEIA 1KYQA 1WJPA 4WUCA 1G2FC 2ZBKB 5C0XF 4DV4I 2VQEI 1QU6A 1IQOA 1XXEA 3EPKA 2Z5EA 4R8OA 4DXLA 1A1FA 4DV4E 4R2AA 1FI4A 1VISA 3PS3A 1I94I 2PO2B 1IMUA 2RQLA 4LF5E 1X6HA 2JY9A 2UXCI 4DR6I 1MGTA 2J7JA 2EPCA 2EPUA 3QG5C 2BV3A 2NN6A 3PS1A 3F6GA 3B4TA 4LFCI 2PNZB 2F4VE 2BA0D 4PRVA 1EH8A 4FW5A 2DLKA 5FLXC 4LF6E 2ZM6E 4O5GA 4X8WA 2GQ0A 3B82A 3L00A 3DJWA 1WHQA 2R76A 2MC5A 4O4KA 1UDQA 4JI3I 3ADLA 3WU5A 1PDAA 4LF6I 1HNXI 1R6MA 3KZYA 3HKMA 2BA0G 3LTOA 1E3PA 1UDSA 2EPZA 2V88A 3P1XA 5KL5A 2EMZA 5A6AA 4DR7I 3GLLA 2B3TB 4O43A 3B78A 2PO1B 4DR4I 4LF8I 3CDIA 2YT4A 4OO1B 2AJ4A 3BIDA 2CSHA 2K4VA 3QT8A 2EOMA 1XMOE 1T38A 1A1LA 3DD6A 4DR4E 1T4NA 2EMAA 1YUIA 4B3RE 3ADJA 1KVKA 4B3ME 3VYXA 5IT9C 2ELZA 2EN7A 1H72C 2O1VA 2EOYA 2HKJA 5IWAI 4LF9E 2GPIA 3C4BA 2EN1A 4LOMA 4R2SA 2HFSA 3C6MA 1UDNA 5ELWA 2EOEA 2DEJA 3NZKA 4X9JA 2YRMA 2JEAB 1WHNA 2Z5CB 2EPMX 3ZZUA 2EM8A 1MX0A 5KL4A 1HNWE 2IOQA 4JI4E 3ECRA 4BA1B 4JI8I 1N34I 1MG7A 4PRXA 4NXMI 2C39A 1PJTA 2Q8UA 3F6HA 3MSWA 5LMNE 1YH8A 1N36I 2EMXA 2YTPA 1FJGE 2BM0A 4USKA 2UUAE 1IBMI 1Z0BA 2E1RA 5K36A 2EOJA 2EMWA 1DGCA 3EPLA 4MLQA 3J80C 3K17A 4DU8A 1JK2A 4FWHA 1A1IA 2OI2A 3EPJA 4P7DA 2MKDA 1FNMA 4BS9A 2EMBA 1K47A 4QNKA 4BCAA 2E72A 3H09A 3HQ1A 2UUCE 1U2RA 2VF3A 1N3GA 2C37A 2UU9I 1EKZA 1UN6B 3UHMA 5JEAB 4AQYE 2UUCI 2YTQA 2F1DA 5IV8B 2GO3A 4LPFA 1ZAAC 4OO1A 1X47A 1X6EA 2VRDA 3AUZA 2UU9E 2V87A 2V2QA 3BF2A 3LLHA 3K85A 4IZJA 2YTIA 2M4IA 4M1KA 1YYKA 2X7IA 4RH8A 4ZYGA 4X64E 1NHIA 2HGHA 4Q35B 2WCC3 1MU5A 1B62A 3K6QA 4WSGA 4BHCA 1Z0GA 4DUZE 1IBLE 4LFAE 1J26A 2CG9A 4X66I 1Z59A 2JE6A 2EPKX 3M7NG 4F6MA 2EL4A 3TQMA 1KTVA 1XNQI 5A2QQ 4DV2E 4LF7E 2ZITA 4JI6I 1Z1BA 2NN6F 2JEAA 2EMLA 3IWBA 2Z5CA 2RS7A 2JEBB 2EPAA 4HACA 4LF7I 3ZM7A 2F8BA 5A6BA 1N32E 4X64I 2V89A 2R1FA 4WFTA 4IS1C 1UDOA 1Z5AA 3VYYA 5C0XA 2ELYA 2EMCA 1XHKA 4LTYA 2X36A 5DRQA 2BB8A 2EN3A 5A6BD 3GCMA 3JAMQ 4DV3I 4JYAI 5AE2A 4BC7A 1HNZE 2VE7C 2HFUA 5BR8I 5T6JA 4DV7E 1QZRA 5IXMB 2HK2A 2WNRA 5DRRA 5JEAD 4JYAE 1E3HA 1X5WA 3EQ1A 2EM9A 5DNYA 1Y60A 4R2RA 4DV7I 3JAMC 1OYRA 3ZKDA 5KL2A 2NUFA 1YSAC 2NN6E 2Z5BB 4P7AA 1UHZA 3V2UC 3P06A 5FLXQ 3J81Q 2UXBI 1YFHA 1ZM4A 2N3GA 2F4VI 1Z5BA 2O1WA 5AASA 2GLIA 2JPAA 2M9AA 3DF6A 3JU0A 4IZJB 4HY1A 4DV1E 4JI3E 4N4RB 5A69A 2L3JA 1XNRI 2EM7A 3LMLA 1FWKA 3HPSA 1PKPA 3P76A 4FK5C 3KRNA 3PRYA 4F9AB 1XNRE 2BR2A 5L3JA 4DV5I 1Y4UA 4WUBA 4NZVA 3KZZA 5A2QC 2YTJA 2WBSA 2EN2A 2K7IA 4HACB 2MC6A 2YRHA 2C38A 3L7ZA 2EPOA 2JOBA 4NBQA 3K1JA 3IWCA 4B3RI 5K36B 2NN6D 3HPZA 5C0XC 2EMHA 2NA2A 4ZYHA 2LUPB 3J81C 1JK1A 1KIJA 4L5NC 2GO4A 4DPYA 5AE1A 4DMIA 5LLQA 2NN6C 3OTOE 3PYEA 2JOXA 5LL6R 2HJJA 4B3SE 2CGEA 4RHBB 2G7HA 2ENAA 4BBYA 3EPHA 3C4TA 4J3DA 1ZM2A 4U3BA 1UBDC 2VQFI 4M2ZA 3HTXA 4AIMA 2LTSA 4XTJA 1L4SA 2CPNA 2XEXA 4J8ZA 2EL6A 2FV4B 4DV0E 1IBME 4X65I 2EE8A 2JR1A 2DMIA 2FGGA 5DROA 4DR1E 3HJCA 4JI0E 3WU6A 4DV0I 1ZXNA 4LFBE 2WZOA 4OOGC 1NHJA 4QNJA 4B3TI 5K36C 2V86A 2LV2A 4DV6E 1AAYA 1MEYC 2JEBA 4URLA 5AE3A 4WYQB 4N3OA 1A6FA 4JI2I 2YPNA 1ZM3A 3U1KA 4OZEA 4DUZI 1IBLI 4LFAI 2YSPA 1T39A 5JEAE 2C38B 2EPLX 1A1JA 1USVA 2EPXA 4USMA 1RR9A 3RMPA 4JI6E 2V83A 2EOFA 4KHPI 2PNMA 2EN4A 4F9BB 1RQ0A 4GQUA 4GEQB 2VESA 5KL6A 4NXNE 1USUA 4X66E 4Z7CA 3H4LA 2C37B 2O1UA 2DRPA 2V34A 4DPTA 2D9HA 5JEAA 1GTKA 2E1MA 3VK6A 2HHHE 4DU7A 1N32I 2EOXA 4JI1I 2LTRA 2O1TA 2V8QB 2EOZA 4FW6A 5TSEA 4DR5I 4MQYA 2WBTA 4JI7E 1IQSA 4NHRA 1XMQI 3ZOQB 1Y4SA 4OKGA 2BM1A 4ZVIA 2EOSA 1NCSA 4MU0A 4ISAA 1T4OA 4LF5I 3Q1QA 4BMJA 2VQEE 4IZJD 3Q6MA 5GMEA 3KWRA 5F3WA 3OMLA 2C39B 5C0XE 4YHHI 1OYPA 1WRJA 3T1YE 2EM6A 4M9VC 1YHCA 3ADIA 3QT7A 4IS9A 4DR6E 2DMYA 2LJHA 5AC4A 3QT5A 1ZBTA 1HNXE 1WXRA 2DGCA 2AE8A 2NUEA 2IESA 2DSYA 1RMDA 2DIXA 4I8OA 2B9DA 4KZSA 1YYWA 1EI1A 2PO0A 5EKWA 1X6FA 4ZYDA 2ZM6I 4DR7E 2JVAA 3MHHC 1RREA 2LMZA 2FTXB 4IFDF 2EM2A 5K36D 4DV5E 2L8TA 4F6NA 3BGHA 4LF8E 2WNRB 3LPSA 3J7AM 2YWQA 1FKAE 2H36X 2JT2A 3THNA 1OYSA 3P3GA 4UTGA 1A1GA 2DLQA 4R2EA 3H1CA 2L6MA 4LF9I 4UT4A 2GS8A 2EMKA 3GMEA 4JI5I 1BB8A 3P3EA 4DKKA 4FWGA 2YRKA 1TF3A 3VHTB 1PJSA 1VI7A 2JE6B 4WUDA 2V85A 2UXDI 1YPNA 2RSIA 1YYOA 3OTOI 2CTDA 2LVHA 5CFFE 2Q2EB 2WW4A 3LNUA 2BBGA 1AH5A 1PIEA 4LCGA 4JI8E 1N34E 4NXME 2E5LE 4IFDE 5A6JA 5LMNI 2YSOA 2RPCA 1RHYA 4LCFA 4U3DA 2L3CA 1A1KA 2NUGA 2ODRD 1P42A 2E5LI 2EOOA 5DNLA 1Z0TA 1QNTA 3BBGA 2NN6B 4JI4I 4LU9A 3M85G 4I3HA 3L7ZB 4OX9I 2ENHA 2ADRA 1ZU1A 2JYAA 3HXLA 2YU8A 4F2JC 4AIDA 2L33A 3B8HA 4F54A 4JV5E 2WP8B 1FJGI 1RC7A 4JI0I 4IFDC 2J65A 2EL5A 4P52A 1D6TA 1DARA 2VF1A 2YTOA 4WXCA 4B3TE 2A2DA 4AQYI 2IOPA 2JXPA 2MDGA 4F9CB 4HYMA 2MKNA 2Z5BA 3QT6A 4DR1I 2CVEA 3P3CA 3PYGA 4BA2A 2LCEA 4MU1A 1Z5CA 4DR3E 4LFBI 2I9IA 5ADZA
chains in the Genus database with same CATH topology
4LF4E 1HR0E 1ZBQA 1ZM9A 4DUYI 4YY3I 1N33I 2L2NA 2YZTA 1NHHA 4EMDA 2HK3A 4JI2E 1XNQE 4YY3E 1EA6A 4DPXA 4DV2I 5LMUE 1X48A 2R3VA 3JTZA 1BKNA 4MYTA 4KHPE 3Q6NA 1GQEA 1ZXMA 4R03A 3AV0A 2UUBI 2LUQA 1XMQE 2EFGA 2HHHI 4JI1E 1HNZI 5BR8E 2DB2A 2HKEA 4FWDA 1N0VC 1PVGA 1S16A 2RTXA 4YHHE 2A2CA 1S4EA 4DV3E 3M6AA 1UILA 3J80Q 1H73A 1HK7A 1X49A 4P78A 2RSMA 2DEIA 2M1SA 2UXBE 1I94E 2N3HA 4TUGA 5GMDA 4Z7YA 4R1FA 3F0NA 2UXCE 3J7Yp 4GKKE 2KOUA 1WUUA 3T1YI 4LFCE 1Z0CA 4WSPA 2R42A 4DV1I 4X62E 4GKKI 1IBKE 2NPFA 5IT9Q 3V5RA 4X62I 1OJ4A 3PYDA 1IBKI 4WPYA 4Q28A 3ZZTA 2EZ6A 2PNLA 1KKHA 1STUA 2RS6A 4B3MI 1Z0VA 3GONA 5IWAE 4FN5A 1XMOI 2V2ZA 1B63A 1H7UA 4IZKB 4DPWA 1Z0EA 1ELOA 4JI5E 4M30A 2LBSB 1H74A 1NZ0A 1Y6ZA 1UEKA 2CZ9A 2UXDE 2J7KA 4L8NA 1N0UA 3ZZ0A 2LE2A 4M0VA 4HXZA 4OX9E 2UUAI 4TUIA 3CWVA 2KONA 1FWLA 4B3SI 1HNWI 2JWOA 2V8PA 4JV5I 3ZKBA 4BC9A 2IHR1 1GZ6A 3D4JA 4P52A 2B7TA 1N36E 2VQFE 4DPUA 2L2MA 2MDRA 4PU9A 2L92A 2LRSA 1SR9A 3T1HI 4MYUA 3FIGA 4ED4A 3HULA 4FW9A 2EWLA 4X65E 2KHXA 2L2KB 4DR2E 2UUBE 3T1HE 4DR3I 1O0WA 4GKJI 1HR0I 1DQ3A 1H7SA 1N33E 4DR2I 2M7QA 4GKJE 1J5EE 4K0KE 3WU3A 1DI2A 4DV6I 1J5EI 4K0KI 4LF4I 1Z0WA 4DUYE 1T4LB 2B7VA 4IZKA 2ODRC 1YZ9A 2V2VA 5FWKA 4KQVA 3WU4A 5LMUI 3ADGA 3IWDA 2LJPA 4RPFA 3PYFA 3J7AG 4JG4A 4DR5E 4NXNI 4JI7I 4WUCA 2ZBKB 4DV4I 2VQEI 1QU6A 2Z5EA 4R8OA 4DXLA 4DV4E 1FI4A 1VISA 1I94I 4LF5E 2JY9A 2UXCI 4DR6I 2BV3A 3F6GA 4LFCI 2F4VE 4PRVA 5FLXC 4LF6E 2ZM6E 4X8WA 2GQ0A 3B82A 3DJWA 1WHQA 4JI3I 2MC5A 3ADLA 3WU5A 4LF6I 1HNXI 3LTOA 2V88A 3P1XA 4DR7I 2B3TB 3B78A 4DR4I 4LF8I 2YT4A 2AJ4A 2K4VA 3QT8A 1XMOE 4DR4E 1T4NA 4B3RE 1KVKA 3ADJA 4B3ME 3VYXA 5IT9C 1H72C 2O1VA 2HKJA 5IWAI 4LF9E 3C4BA 2HFSA 2DEJA 1WHNA 2Z5CB 3ZZUA 1MX0A 1HNWE 2IOQA 4JI4E 4JI8I 1N34I 1MG7A 4PRXA 4NXMI 3F6HA 3MSWA 5LMNE 1N36I 2BM0A 1FJGE 4USKA 2UUAE 1IBMI 1Z0BA 2E1RA 4DU8A 3K17A 3J80C 4FWHA 2OI2A 4P7DA 1FNMA 4BS9A 1K47A 4BCAA 3H09A 3HQ1A 2UUCE 1U2RA 2VF3A 2UU9I 1EKZA 4AQYE 2UUCI 4X64I 1X47A 2UU9E 2V2QA 3AUZA 3K85A 2V87A 3LLHA 4IZJA 2M4IA 4M1KA 1YYKA 2X7IA 4X64E 1NHIA 1MU5A 1B62A 3K6QA 1Z0GA 2CG9A 3QT5A 4DUZE 1IBLE 4LFAE 1J26A 4X66I 1Z59A 1XNQI 1KTVA 5A2QQ 4DV2E 4LF7E 2ZITA 4JI6I 3IWBA 2Z5CA 2RS7A 4LF7I 4HACA 3ZM7A 2F8BA 1N32E 2V89A 4WFTA 1Z5AA 3VYYA 2X36A 1XHKA 4LTYA 4JYAI 3JAMQ 4DV3I 5AE2A 4BC7A 1HNZE 2VE7C 2HFUA 5BR8I 5T6JA 4DV7E 1QZRA 2HK2A 4JYAE 5DNYA 4DV7I 3JAMC 3ZKDA 2NUFA 2Z5BB 4P7AA 3V2UC 1UHZA 5FLXQ 3P06A 3J81Q 2UXBI 1ZM4A 2N3GA 2F4VI 1Z5BA 2O1WA 5AASA 3DF6A 3JU0A 4IZJB 4HY1A 4DV1E 4JI3E 2L3JA 1XNRI 3LMLA 1FWKA 3HPSA 1PKPA 3PRYA 4F9AB 1XNRE 5L3JA 4DV5I 1Y4UA 4WUBA 5A2QC 4HACB 2MC6A 2JOBA 3K1JA 3IWCA 4B3RI 3HPZA 2NA2A 2LUPB 3J81C 1KIJA 4L5NC 4DPYA 5AE1A 4DMIA 3OTOE 3PYEA 2JOXA 5LL6R 4B3SE 2CGEA 2G7HA 4BBYA 3C4TA 1ZM2A 2VQFI 4M2ZA 3HTXA 2LTSA 4XTJA 2CPNA 2XEXA 4J8ZA 2FV4B 4DV0E 1IBME 4X65I 2JR1A 2FGGA 4DR1E 3HJCA 4JI0E 3WU6A 4DV0I 1ZXNA 4LFBE 2WZOA 4OOGC 1NHJA 4B3TI 2V86A 4DV6E 4URLA 5AE3A 4WYQB 4N3OA 1A6FA 4JI2I 1ZM3A 4DUZI 1IBLI 4LFAI 4USMA 1USVA 1RR9A 3RMPA 4JI6E 2V83A 4KHPI 2PNMA 4F9BB 1RQ0A 4GEQB 4NXNE 1USUA 4X66E 4Z7CA 3H4LA 2O1UA 2V34A 4DPTA 1N32I 3VK6A 2E1MA 4DU7A 2HHHE 4JI1I 2LTRA 2O1TA 2V8QB 4DR5I 4JI7E 1XMQI 3ZOQB 1Y4SA 4ZVIA 2BM1A 1T4OA 4LF5I 3Q1QA 4BMJA 2VQEE 4IZJD 3Q6MA 5GMEA 3KWRA 5F3WA 3OMLA 4YHHI 3T1YE 3ADIA 3QT7A 4DR6E 2DMYA 2LJHA 1ZBTA 1HNXE 1WXRA 2NUEA 2DSYA 2DIXA 4I8OA 2B9DA 4KZSA 1YYWA 1EI1A 2ZM6I 4DR7E 2JVAA 1RREA 2LMZA 2FTXB 4DV5E 2L8TA 4LF8E 3LPSA 3J7AM 1FKAE 2H36X 4UTGA 2L6MA 4LF9I 4UT4A 2GS8A 4JI5I 4DKKA 4FWGA 4WUDA 2V85A 2UXDI 1YYOA 3OTOI 5CFFE 2Q2EB 2WW4A 3LNUA 1PIEA 4JI8E 1N34E 4NXME 2E5LE 5LMNI 2L3CA 2NUGA 2ODRD 2E5LI 1Z0TA 4JI4I 4LU9A 4I3HA 4OX9I 3HXLA 1FJGI 2L33A 3B8HA 4F54A 4JV5E 1RC7A 4JI0I 1D6TA 1DARA 2VF1A 4B3TE 2A2DA 4AQYI 2IOPA 4F9CB 4HYMA 2Z5BA 3QT6A 4DR1I 3PYGA 1Z5CA 4DR3E 4LFBI 5ADZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF4 E;  1HR0 E;  4DUY I;  1ZM9 A;  4YY3 I;  1N33 I;  2L2N A;  1NHH A;  4EMD A;  2HK3 A;  4JI2 E;  1XNQ E;  4YY3 E;  1EA6 A;  4DPX A;  4DV2 I;  5LMU E;  1X48 A;  2R3V A;  1BKN A;  4MYT A;  4KHP E;  1GQE A;  1ZXM A;  2UUB I;  2LUQ A;  1XMQ E;  2EFG A;  2HHH I;  4JI1 E;  1HNZ I;  5BR8 E;  2DB2 A;  2HKE A;  4FWD A;  1N0V C;  1PVG A;  1S16 A;  2RTX A;  4YHH E;  2A2C A;  1S4E A;  4DV3 E;  3M6A A;  1UIL A;  3J80 Q;  1H73 A;  1X49 A;  2RSM A;  2DEI A;  2UXB E;  1I94 E;  2N3H A;  5GMD A;  4Z7Y A;  4R1F A;  3F0N A;  2UXC E;  3J7Y p;  4GKK E;  1WUU A;  3T1Y I;  4LFC E;  1Z0C A;  4DV1 I;  2R42 A;  4X62 E;  4GKK I;  1IBK E;  2NPF A;  5IT9 Q;  3V5R A;  4X62 I;  1OJ4 A;  3PYD A;  1IBK I;  3ZZT A;  2EZ6 A;  1KKH A;  1STU A;  2RS6 A;  4B3M I;  1Z0V A;  3GON A;  5IWA E;  4FN5 A;  1XMO I;  2V2Z A;  1B63 A;  1H7U A;  4DPW A;  1Z0E A;  1ELO A;  4JI5 E;  4M30 A;  2LBS B;  1H74 A;  1NZ0 A;  1UEK A;  2CZ9 A;  2UXD E;  2J7K A;  1N0U A;  3ZZ0 A;  4HXZ A;  4OX9 E;  2UUA I;  3CWV A;  1FWL A;  4B3S I;  1HNW I;  2V8P A;  4JV5 I;  3ZKB A;  2IHR 1;  3D4J A;  4P52 A;  2B7T A;  1N36 E;  2VQF E;  4DPU A;  2L2M A;  2MDR A;  4PU9 A;  2LRS A;  3T1H I;  4MYU A;  4ED4 A;  3HUL A;  4FW9 A;  4X65 E;  2L2K B;  2KHX A;  4DR2 E;  2UUB E;  4DR3 I;  3T1H E;  1O0W A;  4GKJ I;  1HR0 I;  1H7S A;  4DR2 I;  1N33 E;  4GKJ E;  1J5E E;  4K0K E;  3WU3 A;  1DI2 A;  4DV6 I;  1J5E I;  4K0K I;  4LF4 I;  1Z0W A;  4DUY E;  1T4L B;  2B7V A;  1YZ9 A;  2V2V A;  4KQV A;  3WU4 A;  5LMU I;  3ADG A;  4RPF A;  2LJP A;  3PYF A;  3J7A G;  4JG4 A;  4DR5 E;  4NXN I;  4JI7 I;  4WUC A;  2ZBK B;  4DV4 I;  2VQE I;  1QU6 A;  4DXL A;  4DV4 E;  1FI4 A;  1VIS A;  1I94 I;  4LF5 E;  2JY9 A;  2UXC I;  4DR6 I;  2BV3 A;  4LFC I;  2F4V E;  4PRV A;  5FLX C;  4LF6 E;  2ZM6 E;  4X8W A;  3B82 A;  1WHQ A;  4JI3 I;  3ADL A;  3WU5 A;  4LF6 I;  1HNX I;  3LTO A;  3P1X A;  4DR7 I;  2B3T B;  3B78 A;  4DR4 I;  4LF8 I;  2YT4 A;  2AJ4 A;  3QT8 A;  1XMO E;  4DR4 E;  1T4N A;  4B3R E;  1KVK A;  3ADJ A;  4B3M E;  3VYX A;  5IT9 C;  1H72 C;  2HKJ A;  5IWA I;  4LF9 E;  3C4B A;  2HFS A;  2DEJ A;  1WHN A;  3ZZU A;  1MX0 A;  1HNW E;  4JI4 E;  4JI8 I;  1N34 I;  1MG7 A;  4PRX A;  4NXM I;  5LMN E;  1N36 I;  2BM0 A;  1FJG E;  4USK A;  2UUA E;  1IBM I;  1Z0B A;  2E1R A;  4DU8 A;  3K17 A;  3J80 C;  4FWH A;  2OI2 A;  1FNM A;  1K47 A;  2UUC E;  1U2R A;  2VF3 A;  2UU9 I;  1EKZ A;  4AQY E;  2UUC I;  4X64 I;  1X47 A;  2UU9 E;  2V2Q A;  3LLH A;  4M1K A;  1YYK A;  2X7I A;  4X64 E;  1NHI A;  1MU5 A;  1B62 A;  1Z0G A;  3QT5 A;  4DUZ E;  1IBL E;  4LFA E;  1J26 A;  4X66 I;  1Z59 A;  1XNQ I;  1KTV A;  5A2Q Q;  4DV2 E;  4LF7 E;  2ZIT A;  4JI6 I;  2RS7 A;  4LF7 I;  4HAC A;  3ZM7 A;  1N32 E;  4WFT A;  1Z5A A;  3VYY A;  2X36 A;  1XHK A;  4JYA I;  3JAM Q;  4DV3 I;  1HNZ E;  2HFU A;  5BR8 I;  4DV7 E;  2HK2 A;  1QZR A;  4JYA E;  4DV7 I;  3JAM C;  3ZKD A;  2NUF A;  4P7A A;  3V2U C;  5FLX Q;  1UHZ A;  3J81 Q;  2UXB I;  1ZM4 A;  2N3G A;  2F4V I;  1Z5B A;  4HY1 A;  4DV1 E;  4JI3 E;  2L3J A;  1XNR I;  1FWK A;  1PKP A;  5L3J A;  1XNR E;  4DV5 I;  4WUB A;  5A2Q C;  4HAC B;  3K1J A;  4B3R I;  2NA2 A;  2LUP B;  3J81 C;  1KIJ A;  4DPY A;  3OTO E;  3PYE A;  5LL6 R;  4B3S E;  3C4T A;  1ZM2 A;  2VQF I;  4M2Z A;  3HTX A;  2LTS A;  4XTJ A;  2CPN A;  2XEX A;  1IBM E;  4DV0 E;  4X65 I;  4DR1 E;  4JI0 E;  3WU6 A;  4DV0 I;  1ZXN A;  4LFB E;  4OOG C;  1NHJ A;  4B3T I;  4DV6 E;  4URL A;  4WYQ B;  4JI2 I;  1A6F A;  1ZM3 A;  4DUZ I;  1IBL I;  4LFA I;  4USM A;  1RR9 A;  4JI6 E;  4KHP I;  1RQ0 A;  4NXN E;  4X66 E;  4Z7C A;  3H4L A;  2V34 A;  4DPT A;  1N32 I;  4DU7 A;  2HHH E;  4JI1 I;  2LTR A;  4DR5 I;  4JI7 E;  1XMQ I;  4ZVI A;  2BM1 A;  1T4O A;  4LF5 I;  3Q1Q A;  2VQE E;  5GME A;  4YHH I;  3T1Y E;  3ADI A;  3QT7 A;  4DR6 E;  2DMY A;  2LJH A;  1ZBT A;  1HNX E;  2NUE A;  2DIX A;  1YYW A;  1EI1 A;  2ZM6 I;  4DR7 E;  2JVA A;  1RRE A;  4DV5 E;  4LF8 E;  3LPS A;  3J7A M;  1FKA E;  4UTG A;  4LF9 I;  4UT4 A;  2GS8 A;  4JI5 I;  4DKK A;  4FWG A;  4WUD A;  2UXD I;  1YYO A;  3OTO I;  5CFF E;  2Q2E B;  2WW4 A;  3LNU A;  1PIE A;  4JI8 E;  1N34 E;  4NXM E;  2E5L E;  5LMN I;  2L3C A;  2NUG A;  2E5L I;  1Z0T A;  4JI4 I;  4I3H A;  4OX9 I;  1FJG I;  2L33 A;  3B8H A;  4JV5 E;  1RC7 A;  4JI0 I;  1D6T A;  1DAR A;  4B3T E;  2A2D A;  4AQY I;  4HYM A;  3QT6 A;  4DR1 I;  3PYG A;  1Z5C A;  4DR3 E;  4LFB I; 
#chains in the Genus database with same CATH topology
 2EOI A;  3PS2 A;  4LF4 E;  1HR0 E;  3M7N D;  1ZBQ A;  1ZM9 A;  4DUY I;  4YY3 I;  4IFD A;  3C6K A;  2L2N A;  1N33 I;  2YZT A;  1NHH A;  2EMF A;  2YTD A;  4EMD A;  2HK3 A;  4JI2 E;  2EM0 A;  2I13 A;  4YY3 E;  1P47 A;  1XNQ E;  2BA1 G;  2EMG A;  1EA6 A;  4DPX A;  5LMU E;  4DV2 I;  2EN6 A;  1X48 A;  4IJD A;  4WXD A;  3JTZ A;  2BR2 B;  2R3V A;  1BKN A;  4MYT A;  3M99 B;  1EH7 A;  2PO2 A;  4KHP E;  3Q6N A;  1GQE A;  1ZXM A;  3CDJ A;  2EQ0 A;  4R03 A;  3AV0 A;  2UUB I;  2LUQ A;  4ZYE A;  1XMQ E;  2ENC A;  2EM4 A;  5KL7 A;  1G2D C;  2EFG A;  4R2Q A;  2EM3 A;  2HHH I;  5C0X D;  4JI1 E;  2EOR A;  1HNZ I;  2YTN A;  5BR8 E;  4BHB A;  2DB2 A;  2HKE A;  4FW7 A;  4FWD A;  3M85 D;  1N0V C;  1PVG A;  1S16 A;  2RTX A;  4YHH E;  2A2C A;  1S4E A;  4DV3 E;  3M6A A;  1UIL A;  3J80 Q;  2EMI A;  1H73 A;  1HK7 A;  1X49 A;  4P78 A;  2RSM A;  5JEA F;  2DEI A;  2M1S A;  4MLV A;  1I94 E;  2UXB E;  2N3H A;  4TUG A;  4OO1 C;  5K36 E;  5GMD A;  4Z7Y A;  2EPR A;  3F0N A;  2UXC E;  4R1F A;  1PJQ A;  4R2C A;  3J7Y p;  4GKK E;  2EP3 A;  2KOU A;  1WUU A;  3T1Y I;  4LFC E;  1Z0C A;  4WSP A;  2R42 A;  5DNX A;  4DV1 I;  3THO B;  4X62 E;  1EH6 A;  4IFD B;  4GKK I;  1IBK E;  2NPF A;  5IT9 Q;  3V5R A;  4X62 I;  1OJ4 A;  1ZR9 A;  2HC5 A;  3PYD A;  1IBK I;  4WPY A;  1YUJ A;  4Q28 A;  5EL9 A;  4WX9 A;  3ZZT A;  2EZ6 A;  2EOH A;  1KKH A;  2PNL A;  4FW4 A;  2LJU A;  1STU A;  2RS6 A;  5JEA C;  4B3M I;  1Z0V A;  2WBU A;  3GON A;  5IWA E;  5A6K A;  4FN5 A;  1XMO I;  1SFE A;  2V2Z A;  2EN8 A;  1B63 A;  1H7U A;  4IZK B;  4DPW A;  1Z0E A;  1ELO A;  4JI5 E;  4M30 A;  2LBS B;  1H74 A;  1NZ0 A;  2YTF A;  1KJK A;  2WP8 A;  2CT1 A;  4GZN C;  1Y6Z A;  1UEK A;  1R6L A;  2N8X A;  2EJ4 A;  2CZ9 A;  1X3C A;  2UXD E;  1TF6 A;  2EM5 A;  2J7K A;  4LCH A;  4OO1 F;  5K36 F;  4L8N A;  1N0U A;  3ZZ0 A;  2LE2 A;  3UK3 C;  4M0V A;  4HXZ A;  4OX9 E;  5KL3 A;  2A25 A;  1BBG A;  4TUI A;  3CWV A;  2UUA I;  2KON A;  2GHF A;  1FWL A;  4B3S I;  2JWO A;  1HNW I;  2V8P A;  4JV5 I;  4MDT A;  3ZKB A;  2EPN A;  4BC9 A;  2IHR 1;  1GZ6 A;  4O24 A;  2EQ1 A;  3MHS C;  2B7T A;  4R2P A;  1N36 E;  3D4J A;  4KWY A;  2YTE A;  2VQF E;  2L2M A;  2MDR A;  4PU9 A;  4DPU A;  1F2I G;  2L92 A;  1Y5Y A;  1LLM C;  1B69 A;  2LRS A;  1SR9 A;  1BBO A;  4MU4 A;  4MYU A;  2EMY A;  5DRP A;  3T1H I;  2EQ3 A;  3FIG A;  4ED4 A;  3HUL A;  4FW9 A;  2EWL A;  5AC5 A;  2KHX A;  4X65 E;  2NAB A;  2L2K B;  4DR2 E;  3T1H E;  1O0W A;  2UUB E;  2PNZ A;  4BA1 A;  4DR3 I;  4GKJ I;  3U1Y A;  1HR0 I;  2LO3 A;  1DQ3 A;  1H7S A;  1N33 E;  2IER A;  2M7Q A;  4R2D A;  4DR2 I;  2JP9 A;  4GKJ E;  4MU3 A;  4IFD D;  1J5E E;  4HEI A;  4K0K E;  2LT7 A;  2PO0 B;  3WU3 A;  1A1H A;  4OO1 D;  1DI2 A;  2EPP A;  1TN9 A;  4DV6 I;  1J5E I;  4K0K I;  2YTG A;  4LF4 I;  1Z0W A;  5C0X B;  4DUY E;  1T4L B;  2B7V A;  4FW3 A;  4IZK A;  2ODR C;  4AM3 A;  2PO1 A;  1YZ9 A;  2V2V A;  5FWK A;  2PRT A;  4KQV A;  3WU4 A;  5LMU I;  3ADG A;  2YU5 A;  3IWD A;  2LJP A;  3PYF A;  4RPF A;  3J7A G;  4JG4 A;  4HTG A;  4DR5 E;  4BA2 B;  4OO1 E;  2O3Z A;  2EOQ A;  4NXN I;  4JI7 I;  2BA1 D;  1NEI A;  1KYQ A;  1WJP A;  4WUC A;  1G2F C;  2ZBK B;  5C0X F;  4DV4 I;  2VQE I;  1QU6 A;  1IQO A;  1XXE A;  3EPK A;  2Z5E A;  4R8O A;  4DXL A;  1A1F A;  4DV4 E;  4R2A A;  1FI4 A;  1VIS A;  3PS3 A;  1I94 I;  2PO2 B;  1IMU A;  2RQL A;  4LF5 E;  1X6H A;  2JY9 A;  2UXC I;  4DR6 I;  1MGT A;  2J7J A;  2EPC A;  2EPU A;  3QG5 C;  2BV3 A;  2NN6 A;  3PS1 A;  3F6G A;  3B4T A;  4LFC I;  2PNZ B;  2F4V E;  2BA0 D;  4PRV A;  1EH8 A;  4FW5 A;  2DLK A;  5FLX C;  4LF6 E;  2ZM6 E;  4O5G A;  4X8W A;  2GQ0 A;  3B82 A;  3L00 A;  3DJW A;  1WHQ A;  2R76 A;  2MC5 A;  4O4K A;  1UDQ A;  4JI3 I;  3ADL A;  3WU5 A;  1PDA A;  4LF6 I;  1HNX I;  1R6M A;  3KZY A;  3HKM A;  2BA0 G;  3LTO A;  1E3P A;  1UDS A;  2EPZ A;  2V88 A;  3P1X A;  5KL5 A;  2EMZ A;  5A6A A;  4DR7 I;  3GLL A;  2B3T B;  4O43 A;  3B78 A;  2PO1 B;  4DR4 I;  4LF8 I;  3CDI A;  2YT4 A;  4OO1 B;  2AJ4 A;  3BID A;  2CSH A;  2K4V A;  3QT8 A;  2EOM A;  1XMO E;  1T38 A;  1A1L A;  3DD6 A;  4DR4 E;  1T4N A;  2EMA A;  1YUI A;  4B3R E;  3ADJ A;  1KVK A;  4B3M E;  3VYX A;  5IT9 C;  2ELZ A;  2EN7 A;  1H72 C;  2O1V A;  2EOY A;  2HKJ A;  5IWA I;  4LF9 E;  2GPI A;  3C4B A;  2EN1 A;  4LOM A;  4R2S A;  2HFS A;  3C6M A;  1UDN A;  5ELW A;  2EOE A;  2DEJ A;  3NZK A;  4X9J A;  2YRM A;  2JEA B;  1WHN A;  2Z5C B;  2EPM X;  3ZZU A;  2EM8 A;  1MX0 A;  5KL4 A;  1HNW E;  2IOQ A;  4JI4 E;  3ECR A;  4BA1 B;  4JI8 I;  1N34 I;  1MG7 A;  4PRX A;  4NXM I;  2C39 A;  1PJT A;  2Q8U A;  3F6H A;  3MSW A;  5LMN E;  1YH8 A;  1N36 I;  2EMX A;  2YTP A;  1FJG E;  2BM0 A;  4USK A;  2UUA E;  1IBM I;  1Z0B A;  2E1R A;  5K36 A;  2EOJ A;  2EMW A;  1DGC A;  3EPL A;  4MLQ A;  3J80 C;  3K17 A;  4DU8 A;  1JK2 A;  4FWH A;  1A1I A;  2OI2 A;  3EPJ A;  4P7D A;  2MKD A;  1FNM A;  4BS9 A;  2EMB A;  1K47 A;  4QNK A;  4BCA A;  2E72 A;  3H09 A;  3HQ1 A;  2UUC E;  1U2R A;  2VF3 A;  1N3G A;  2C37 A;  2UU9 I;  1EKZ A;  1UN6 B;  3UHM A;  5JEA B;  4AQY E;  2UUC I;  2YTQ A;  2F1D A;  5IV8 B;  2GO3 A;  4LPF A;  1ZAA C;  4OO1 A;  1X47 A;  1X6E A;  2VRD A;  3AUZ A;  2UU9 E;  2V87 A;  2V2Q A;  3BF2 A;  3LLH A;  3K85 A;  4IZJ A;  2YTI A;  2M4I A;  4M1K A;  1YYK A;  2X7I A;  4RH8 A;  4ZYG A;  4X64 E;  1NHI A;  2HGH A;  4Q35 B;  2WCC 3;  1MU5 A;  1B62 A;  3K6Q A;  4WSG A;  4BHC A;  1Z0G A;  4DUZ E;  1IBL E;  4LFA E;  1J26 A;  2CG9 A;  4X66 I;  1Z59 A;  2JE6 A;  2EPK X;  3M7N G;  4F6M A;  2EL4 A;  3TQM A;  1KTV A;  1XNQ I;  5A2Q Q;  4DV2 E;  4LF7 E;  2ZIT A;  4JI6 I;  1Z1B A;  2NN6 F;  2JEA A;  2EML A;  3IWB A;  2Z5C A;  2RS7 A;  2JEB B;  2EPA A;  4HAC A;  4LF7 I;  3ZM7 A;  2F8B A;  5A6B A;  1N32 E;  4X64 I;  2V89 A;  2R1F A;  4WFT A;  4IS1 C;  1UDO A;  1Z5A A;  3VYY A;  5C0X A;  2ELY A;  2EMC A;  1XHK A;  4LTY A;  2X36 A;  5DRQ A;  2BB8 A;  2EN3 A;  5A6B D;  3GCM A;  3JAM Q;  4DV3 I;  4JYA I;  5AE2 A;  4BC7 A;  1HNZ E;  2VE7 C;  2HFU A;  5BR8 I;  5T6J A;  4DV7 E;  1QZR A;  5IXM B;  2HK2 A;  2WNR A;  5DRR A;  5JEA D;  4JYA E;  1E3H A;  1X5W A;  3EQ1 A;  2EM9 A;  5DNY A;  1Y60 A;  4R2R A;  4DV7 I;  3JAM C;  1OYR A;  3ZKD A;  5KL2 A;  2NUF A;  1YSA C;  2NN6 E;  2Z5B B;  4P7A A;  1UHZ A;  3V2U C;  3P06 A;  5FLX Q;  3J81 Q;  2UXB I;  1YFH A;  1ZM4 A;  2N3G A;  2F4V I;  1Z5B A;  2O1W A;  5AAS A;  2GLI A;  2JPA A;  2M9A A;  3DF6 A;  3JU0 A;  4IZJ B;  4HY1 A;  4DV1 E;  4JI3 E;  4N4R B;  5A69 A;  2L3J A;  1XNR I;  2EM7 A;  3LML A;  1FWK A;  3HPS A;  1PKP A;  3P76 A;  4FK5 C;  3KRN A;  3PRY A;  4F9A B;  1XNR E;  2BR2 A;  5L3J A;  4DV5 I;  1Y4U A;  4WUB A;  4NZV A;  3KZZ A;  5A2Q C;  2YTJ A;  2WBS A;  2EN2 A;  2K7I A;  4HAC B;  2MC6 A;  2YRH A;  2C38 A;  3L7Z A;  2EPO A;  2JOB A;  4NBQ A;  3K1J A;  3IWC A;  4B3R I;  5K36 B;  2NN6 D;  3HPZ A;  5C0X C;  2EMH A;  2NA2 A;  4ZYH A;  2LUP B;  3J81 C;  1JK1 A;  1KIJ A;  4L5N C;  2GO4 A;  4DPY A;  5AE1 A;  4DMI A;  5LLQ A;  2NN6 C;  3OTO E;  3PYE A;  2JOX A;  5LL6 R;  2HJJ A;  4B3S E;  2CGE A;  4RHB B;  2G7H A;  2ENA A;  4BBY A;  3EPH A;  3C4T A;  4J3D A;  1ZM2 A;  4U3B A;  1UBD C;  2VQF I;  4M2Z A;  3HTX A;  4AIM A;  2LTS A;  4XTJ A;  1L4S A;  2CPN A;  2XEX A;  4J8Z A;  2EL6 A;  2FV4 B;  4DV0 E;  1IBM E;  4X65 I;  2EE8 A;  2JR1 A;  2DMI A;  2FGG A;  5DRO A;  4DR1 E;  3HJC A;  4JI0 E;  3WU6 A;  4DV0 I;  1ZXN A;  4LFB E;  2WZO A;  4OOG C;  1NHJ A;  4QNJ A;  4B3T I;  5K36 C;  2V86 A;  2LV2 A;  4DV6 E;  1AAY A;  1MEY C;  2JEB A;  4URL A;  5AE3 A;  4WYQ B;  4N3O A;  1A6F A;  4JI2 I;  2YPN A;  1ZM3 A;  3U1K A;  4OZE A;  4DUZ I;  1IBL I;  4LFA I;  2YSP A;  1T39 A;  5JEA E;  2C38 B;  2EPL X;  1A1J A;  1USV A;  2EPX A;  4USM A;  1RR9 A;  3RMP A;  4JI6 E;  2V83 A;  2EOF A;  4KHP I;  2PNM A;  2EN4 A;  4F9B B;  1RQ0 A;  4GQU A;  4GEQ B;  2VES A;  5KL6 A;  4NXN E;  1USU A;  4X66 E;  4Z7C A;  3H4L A;  2C37 B;  2O1U A;  2DRP A;  2V34 A;  4DPT A;  2D9H A;  5JEA A;  1GTK A;  2E1M A;  3VK6 A;  2HHH E;  4DU7 A;  1N32 I;  2EOX A;  4JI1 I;  2LTR A;  2O1T A;  2V8Q B;  2EOZ A;  4FW6 A;  5TSE A;  4DR5 I;  4MQY A;  2WBT A;  4JI7 E;  1IQS A;  4NHR A;  1XMQ I;  3ZOQ B;  1Y4S A;  4OKG A;  2BM1 A;  4ZVI A;  2EOS A;  1NCS A;  4MU0 A;  4ISA A;  1T4O A;  4LF5 I;  3Q1Q A;  4BMJ A;  2VQE E;  4IZJ D;  3Q6M A;  5GME A;  3KWR A;  5F3W A;  3OML A;  2C39 B;  5C0X E;  4YHH I;  1OYP A;  1WRJ A;  3T1Y E;  2EM6 A;  4M9V C;  1YHC A;  3ADI A;  3QT7 A;  4IS9 A;  4DR6 E;  2DMY A;  2LJH A;  5AC4 A;  3QT5 A;  1ZBT A;  1HNX E;  1WXR A;  2DGC A;  2AE8 A;  2NUE A;  2IES A;  2DSY A;  1RMD A;  2DIX A;  4I8O A;  2B9D A;  4KZS A;  1YYW A;  1EI1 A;  2PO0 A;  5EKW A;  1X6F A;  4ZYD A;  2ZM6 I;  4DR7 E;  2JVA A;  3MHH C;  1RRE A;  2LMZ A;  2FTX B;  4IFD F;  2EM2 A;  5K36 D;  4DV5 E;  2L8T A;  4F6N A;  3BGH A;  4LF8 E;  2WNR B;  3LPS A;  3J7A M;  2YWQ A;  1FKA E;  2H36 X;  2JT2 A;  3THN A;  1OYS A;  3P3G A;  4UTG A;  1A1G A;  2DLQ A;  4R2E A;  3H1C A;  2L6M A;  4LF9 I;  4UT4 A;  2GS8 A;  2EMK A;  3GME A;  4JI5 I;  1BB8 A;  3P3E A;  4DKK A;  4FWG A;  2YRK A;  1TF3 A;  3VHT B;  1PJS A;  1VI7 A;  2JE6 B;  4WUD A;  2V85 A;  2UXD I;  1YPN A;  2RSI A;  1YYO A;  3OTO I;  2CTD A;  2LVH A;  5CFF E;  2Q2E B;  2WW4 A;  3LNU A;  2BBG A;  1AH5 A;  1PIE A;  4LCG A;  4JI8 E;  1N34 E;  4NXM E;  2E5L E;  4IFD E;  5A6J A;  5LMN I;  2YSO A;  2RPC A;  1RHY A;  4LCF A;  4U3D A;  2L3C A;  1A1K A;  2NUG A;  2ODR D;  1P42 A;  2E5L I;  2EOO A;  5DNL A;  1Z0T A;  1QNT A;  3BBG A;  2NN6 B;  4JI4 I;  4LU9 A;  3M85 G;  4I3H A;  3L7Z B;  4OX9 I;  2ENH A;  2ADR A;  1ZU1 A;  2JYA A;  3HXL A;  2YU8 A;  4F2J C;  4AID A;  2L33 A;  3B8H A;  4F54 A;  4JV5 E;  2WP8 B;  1FJG I;  1RC7 A;  4JI0 I;  4IFD C;  2J65 A;  2EL5 A;  4P52 A;  1D6T A;  1DAR A;  2VF1 A;  2YTO A;  4WXC A;  4B3T E;  2A2D A;  4AQY I;  2IOP A;  2JXP A;  2MDG A;  4F9C B;  4HYM A;  2MKN A;  2Z5B A;  3QT6 A;  4DR1 I;  2CVE A;  3P3C A;  3PYG A;  4BA2 A;  2LCE A;  4MU1 A;  1Z5C A;  4DR3 E;  4LFB I;  2I9I A;  5ADZ A; 
#chains in the Genus database with same CATH homology
 4LF4 E;  1HR0 E;  1ZBQ A;  1ZM9 A;  4DUY I;  4YY3 I;  1N33 I;  2L2N A;  2YZT A;  1NHH A;  4EMD A;  2HK3 A;  4JI2 E;  1XNQ E;  4YY3 E;  1EA6 A;  4DPX A;  4DV2 I;  5LMU E;  1X48 A;  2R3V A;  3JTZ A;  1BKN A;  4MYT A;  4KHP E;  3Q6N A;  1GQE A;  1ZXM A;  4R03 A;  3AV0 A;  2UUB I;  2LUQ A;  1XMQ E;  2EFG A;  2HHH I;  4JI1 E;  1HNZ I;  5BR8 E;  2DB2 A;  2HKE A;  4FWD A;  1N0V C;  1PVG A;  1S16 A;  2RTX A;  4YHH E;  2A2C A;  1S4E A;  4DV3 E;  3M6A A;  1UIL A;  3J80 Q;  1H73 A;  1HK7 A;  1X49 A;  4P78 A;  2RSM A;  2DEI A;  2M1S A;  2UXB E;  1I94 E;  2N3H A;  4TUG A;  5GMD A;  4Z7Y A;  4R1F A;  3F0N A;  2UXC E;  3J7Y p;  4GKK E;  2KOU A;  1WUU A;  3T1Y I;  4LFC E;  1Z0C A;  4WSP A;  2R42 A;  4DV1 I;  4X62 E;  4GKK I;  1IBK E;  2NPF A;  5IT9 Q;  3V5R A;  4X62 I;  1OJ4 A;  3PYD A;  1IBK I;  4WPY A;  4Q28 A;  3ZZT A;  2EZ6 A;  2PNL A;  1KKH A;  1STU A;  2RS6 A;  4B3M I;  1Z0V A;  3GON A;  5IWA E;  4FN5 A;  1XMO I;  2V2Z A;  1B63 A;  1H7U A;  4IZK B;  4DPW A;  1Z0E A;  1ELO A;  4JI5 E;  4M30 A;  2LBS B;  1H74 A;  1NZ0 A;  1Y6Z A;  1UEK A;  2CZ9 A;  2UXD E;  2J7K A;  4L8N A;  1N0U A;  3ZZ0 A;  2LE2 A;  4M0V A;  4HXZ A;  4OX9 E;  2UUA I;  4TUI A;  3CWV A;  2KON A;  1FWL A;  4B3S I;  1HNW I;  2JWO A;  2V8P A;  4JV5 I;  3ZKB A;  4BC9 A;  2IHR 1;  1GZ6 A;  3D4J A;  4P52 A;  2B7T A;  1N36 E;  2VQF E;  4DPU A;  2L2M A;  2MDR A;  4PU9 A;  2L92 A;  2LRS A;  1SR9 A;  3T1H I;  4MYU A;  3FIG A;  4ED4 A;  3HUL A;  4FW9 A;  2EWL A;  4X65 E;  2KHX A;  2L2K B;  4DR2 E;  2UUB E;  3T1H E;  4DR3 I;  1O0W A;  4GKJ I;  1HR0 I;  1DQ3 A;  1H7S A;  1N33 E;  4DR2 I;  2M7Q A;  4GKJ E;  1J5E E;  4K0K E;  3WU3 A;  1DI2 A;  4DV6 I;  1J5E I;  4K0K I;  4LF4 I;  1Z0W A;  4DUY E;  1T4L B;  2B7V A;  4IZK A;  2ODR C;  1YZ9 A;  2V2V A;  5FWK A;  4KQV A;  3WU4 A;  5LMU I;  3ADG A;  3IWD A;  2LJP A;  4RPF A;  3PYF A;  3J7A G;  4JG4 A;  4DR5 E;  4NXN I;  4JI7 I;  4WUC A;  2ZBK B;  4DV4 I;  2VQE I;  1QU6 A;  2Z5E A;  4R8O A;  4DXL A;  4DV4 E;  1FI4 A;  1VIS A;  1I94 I;  4LF5 E;  2JY9 A;  2UXC I;  4DR6 I;  2BV3 A;  3F6G A;  4LFC I;  2F4V E;  4PRV A;  5FLX C;  4LF6 E;  2ZM6 E;  4X8W A;  2GQ0 A;  3B82 A;  3DJW A;  1WHQ A;  4JI3 I;  2MC5 A;  3ADL A;  3WU5 A;  4LF6 I;  1HNX I;  3LTO A;  2V88 A;  3P1X A;  4DR7 I;  2B3T B;  3B78 A;  4DR4 I;  4LF8 I;  2YT4 A;  2AJ4 A;  2K4V A;  3QT8 A;  1XMO E;  4DR4 E;  1T4N A;  4B3R E;  1KVK A;  3ADJ A;  4B3M E;  3VYX A;  5IT9 C;  1H72 C;  2O1V A;  2HKJ A;  5IWA I;  4LF9 E;  3C4B A;  2HFS A;  2DEJ A;  1WHN A;  2Z5C B;  3ZZU A;  1MX0 A;  1HNW E;  2IOQ A;  4JI4 E;  4JI8 I;  1N34 I;  1MG7 A;  4PRX A;  4NXM I;  3F6H A;  3MSW A;  5LMN E;  1N36 I;  2BM0 A;  1FJG E;  4USK A;  2UUA E;  1IBM I;  1Z0B A;  2E1R A;  4DU8 A;  3K17 A;  3J80 C;  4FWH A;  2OI2 A;  4P7D A;  1FNM A;  4BS9 A;  1K47 A;  4BCA A;  3H09 A;  3HQ1 A;  2UUC E;  1U2R A;  2VF3 A;  2UU9 I;  1EKZ A;  4AQY E;  2UUC I;  4X64 I;  1X47 A;  2UU9 E;  2V2Q A;  3AUZ A;  3K85 A;  2V87 A;  3LLH A;  4IZJ A;  2M4I A;  4M1K A;  1YYK A;  2X7I A;  4X64 E;  1NHI A;  1MU5 A;  1B62 A;  3K6Q A;  1Z0G A;  2CG9 A;  3QT5 A;  4DUZ E;  1IBL E;  4LFA E;  1J26 A;  4X66 I;  1Z59 A;  1XNQ I;  1KTV A;  5A2Q Q;  4DV2 E;  4LF7 E;  2ZIT A;  4JI6 I;  3IWB A;  2Z5C A;  2RS7 A;  4LF7 I;  4HAC A;  3ZM7 A;  2F8B A;  1N32 E;  2V89 A;  4WFT A;  1Z5A A;  3VYY A;  2X36 A;  1XHK A;  4LTY A;  4JYA I;  3JAM Q;  4DV3 I;  5AE2 A;  4BC7 A;  1HNZ E;  2VE7 C;  2HFU A;  5BR8 I;  5T6J A;  4DV7 E;  1QZR A;  2HK2 A;  4JYA E;  5DNY A;  4DV7 I;  3JAM C;  3ZKD A;  2NUF A;  2Z5B B;  4P7A A;  3V2U C;  1UHZ A;  5FLX Q;  3P06 A;  3J81 Q;  2UXB I;  1ZM4 A;  2N3G A;  2F4V I;  1Z5B A;  2O1W A;  5AAS A;  3DF6 A;  3JU0 A;  4IZJ B;  4HY1 A;  4DV1 E;  4JI3 E;  2L3J A;  1XNR I;  3LML A;  1FWK A;  3HPS A;  1PKP A;  3PRY A;  4F9A B;  1XNR E;  5L3J A;  4DV5 I;  1Y4U A;  4WUB A;  5A2Q C;  4HAC B;  2MC6 A;  2JOB A;  3K1J A;  3IWC A;  4B3R I;  3HPZ A;  2NA2 A;  2LUP B;  3J81 C;  1KIJ A;  4L5N C;  4DPY A;  5AE1 A;  4DMI A;  3OTO E;  3PYE A;  2JOX A;  5LL6 R;  4B3S E;  2CGE A;  2G7H A;  4BBY A;  3C4T A;  1ZM2 A;  2VQF I;  4M2Z A;  3HTX A;  2LTS A;  4XTJ A;  2CPN A;  2XEX A;  4J8Z A;  2FV4 B;  4DV0 E;  1IBM E;  4X65 I;  2JR1 A;  2FGG A;  4DR1 E;  3HJC A;  4JI0 E;  3WU6 A;  4DV0 I;  1ZXN A;  4LFB E;  2WZO A;  4OOG C;  1NHJ A;  4B3T I;  2V86 A;  4DV6 E;  4URL A;  5AE3 A;  4WYQ B;  4N3O A;  1A6F A;  4JI2 I;  1ZM3 A;  4DUZ I;  1IBL I;  4LFA I;  4USM A;  1USV A;  1RR9 A;  3RMP A;  4JI6 E;  2V83 A;  4KHP I;  2PNM A;  4F9B B;  1RQ0 A;  4GEQ B;  4NXN E;  1USU A;  4X66 E;  4Z7C A;  3H4L A;  2O1U A;  2V34 A;  4DPT A;  1N32 I;  3VK6 A;  2E1M A;  4DU7 A;  2HHH E;  4JI1 I;  2LTR A;  2O1T A;  2V8Q B;  4DR5 I;  4JI7 E;  1XMQ I;  3ZOQ B;  1Y4S A;  4ZVI A;  2BM1 A;  1T4O A;  4LF5 I;  3Q1Q A;  4BMJ A;  2VQE E;  4IZJ D;  3Q6M A;  5GME A;  3KWR A;  5F3W A;  3OML A;  4YHH I;  3T1Y E;  3ADI A;  3QT7 A;  4DR6 E;  2DMY A;  2LJH A;  1ZBT A;  1HNX E;  1WXR A;  2NUE A;  2DSY A;  2DIX A;  4I8O A;  2B9D A;  4KZS A;  1YYW A;  1EI1 A;  2ZM6 I;  4DR7 E;  2JVA A;  1RRE A;  2LMZ A;  2FTX B;  4DV5 E;  2L8T A;  4LF8 E;  3LPS A;  3J7A M;  1FKA E;  2H36 X;  4UTG A;  2L6M A;  4LF9 I;  4UT4 A;  2GS8 A;  4JI5 I;  4DKK A;  4FWG A;  4WUD A;  2V85 A;  2UXD I;  1YYO A;  3OTO I;  5CFF E;  2Q2E B;  2WW4 A;  3LNU A;  1PIE A;  4JI8 E;  1N34 E;  4NXM E;  2E5L E;  5LMN I;  2L3C A;  2NUG A;  2ODR D;  2E5L I;  1Z0T A;  4JI4 I;  4LU9 A;  4I3H A;  4OX9 I;  3HXL A;  1FJG I;  2L33 A;  3B8H A;  4F54 A;  4JV5 E;  1RC7 A;  4JI0 I;  1D6T A;  1DAR A;  2VF1 A;  4B3T E;  2A2D A;  4AQY I;  2IOP A;  4F9C B;  4HYM A;  2Z5B A;  3QT6 A;  4DR1 I;  3PYG A;  1Z5C A;  4DR3 E;  4LFB I;  5ADZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...