4X62I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x62I00
4LF5E 4DV5I 4KHPI 1N36I 2VF3A 3J80Q 2WW4A 1HNXE 1IBLI 2BM0A 1B63A 2BM1A 4DV4I 4FW9A 4DV6E 4DR5E 3LPSA 3CWVA 1FWLA 4JI2I 4DR4I 1QZRA 1UEKA 4DV7E 1MG7A 4LF9I 1Z0CA 4RPFA 4FWGA 4B3SE 1Z0EA 4NXNE 1XMQE 3ZZTA 4FN5A 3JAMQ 4JI4I 1N33E 5IT9Q 3J81C 1RREA 4DR7E 4UTGA 4DR1E 4JI7E 1ZM9A 1IBKI 4B3RE 4DV2I 4YY3I 1IBLE 4YHHI 4WUBA 4DV0I 4FWHA 4ZVIA 2F4VE 4EMDA 2VQFI 3D4JA 1J5EI 4DUZE 3WU3A 4ED4A 5LMUE 2VQEE 3PYEA 2AJ4A 4R1FA 4X65I 1H73A 4P7AA 4B3SI 2UXBE 4B3ME 4X62I 2UUBE 4NXMI 5IWAE 4DR1I 4JYAI 4DR6E 3B78A 1IBME 4LFBI 1FJGE 3J7AM 4DPWA 4USMA 4B3RI 1ZM3A 4AQYE 1NHIA 4LF6E 3ZZUA 3LTOA 1ZXNA 2UUCI 4JI3I 1NHHA 4HACB 4DUYE 2ZBKB 5L3JA 1Z0GA 5LMUI 4LF7E 1H74A 2HKEA 4JI5E 1KVKA 1Z0VA 1N32E 4JI8E 1Z0BA 3B8HA 5IWAI 4X64E 4DV1E 2OI2A 4MYTA 5FLXC 4K0KE 1I94I 2LJPA 3HULA 4GKJE 4Z7CA 1WUUA 1EI1A 4X66I 3PYDA 3ZM7A 4HXZA 4HYMA 2HK2A 4DV4E 1VISA 4DPXA 2ZITA 1HNZE 3GONA 1XNRI 4HY1A 1ZM4A 4LF7I 2UUAE 4KQVA 2EFGA 1NZ0A 4DV3I 4DR7I 5FLXQ 5A2QC 4JI8I 3JAMC 4JI0E 1Z5CA 5GMEA 2HK3A 1HR0E 4WUCA 4DV2E 4YY3E 1Z5BA 4DU7A 2ZM6E 4YHHE 1N33I 3T1HI 1A6FA 4LFAI 3T1YI 2UXCI 1J5EE 4JI6I 1PIEA 2E5LE 3OTOI 4X66E 4DR2I 2HFUA 4DV0E 4X65E 2CZ9A 1N0VC 3M6AA 4OX9E 4LF5I 2V8PA 1N36E 1EA6A 2X7IA 2XEXA 1MX0A 4UT4A 4DR3I 2UUBI 4NXME 4M1KA 1BKNA 4AQYI 2J7KA 1KIJA 3T1HE 4LF9E 4DR6I 3V2UC 1IBMI 4LFBE 1H7UA 1DARA 1RR9A 2E5LI 1H72C 4DXLA 4DV6I 5BR8I 4LF4I 4DR5I 3Q1QA 1N34I 4LF6I 4WUDA 3QT8A 4URLA 4Z7YA 1K47A 2HKJA 2V34A 4LF8I 4X64I 4DU8A 1N0UA 1Z0TA 2A2CA 2UU9I 1HNWI 2R42A 4JV5E 1XMOE 1OJ4A 2UXDI 4GKJI 3ZKDA 1IBKE 3J7AG 2DEIA 1FI4A 5LMNE 1H7SA 1ELOA 2HFSA 4B3TI 4LFCE 1U2RA 3ZZ0A 3WU6A 1Z5AA 4PU9A 2UXBI 4JG4A 3QT6A 1S4EA 2Q2EB 3LNUA 1N34E 4JYAE 3B82A 2VQEI 3V5RA 1FJGI 4DPYA 4LF8E 4JI1E 4GKKE 4X62E 1S16A 2UU9E 4P52A 4XTJA 2V2QA 1XMOI 1ZM2A 2UXDE 4DV7I 1HNXI 4JI0I 1FNMA 3F0NA 3OTOE 1HR0I 4DR2E 5LMNI 2A2DA 2GS8A 4JI4E 1FWKA 3ZKBA 2UUCE 4JI5I 1D6TA 3T1YE 2UXCE 4JI6E 1B62A 3J81Q 2HHHE 4DUYI 1PKPA 4DV1I 3J80C 1XMQI 1XNQE 4DPTA 2E1RA 4JI1I 2F4VI 4JI7I 3WU4A 4OX9I 4GKKI 1N32I 1FKAE 5LL6R 3QT5A 4K0KI 1PVGA 3K17A 2R3VA 2VQFE 4DR3E 2V2ZA 1KKHA 1XHKA 4B3MI 1KTVA 1XNRE 4DUZI 4DV3E 2UUAI 5A2QQ 2HHHI 2NPFA 3WU5A 1HNZI 5BR8E 4LF4E 1XNQI 1HNWE 3QT7A 1NHJA 4DV5E 4KHPE 3PYGA 4JV5I 2DEJA 1ZXMA 4I3HA 2X36A 4LFAE 3PYFA 4DPUA 2BV3A 2ZM6I 4JI2E 4DR4E 4PRVA 4USKA 4LFCI 4B3TE 1Z0WA 4PRXA 1Z59A 4JI3E 5IT9C 2V2VA 4NXNI 4MYUA 5GMDA 3H4LA 1I94E 4FWDA 4HACA 3K1JA 1MU5A
chains in the Genus database with same CATH superfamily
4LF5E 3CDIA 4DV5I 4KHPI 5DRQA 2NN6B 5K36B 1N36I 2VF3A 3J80Q 4OO1C 2WW4A 1HNXE 2J65A 1IBLI 2BM0A 1B63A 1RHYA 2BM1A 2JEBB 4DV4I 1YH8A 3GLLA 4FW7A 4FW9A 4DV6E 4DR5E 3LPSA 2CG9A 1FWLA 3CWVA 4JI2I 4DR4I 1QZRA 1UEKA 4DV7E 1MG7A 4LF9I 1Z0CA 4RPFA 4FWGA 5JEAE 2WP8A 1Z0EA 4B3SE 4NXNE 1XMQE 3ZZTA 4FN5A 3JAMQ 3CDJA 4JI4I 1N33E 5IT9Q 3J81C 1RREA 1UDOA 4DR7E 4UTGA 4DR1E 1UDNA 4JI7E 1ZM9A 4MDTA 1IBKI 2Z5BA 4B3RE 2C39A 4DV2I 4YY3I 1IBLE 4YHHI 5C0XE 4WUBA 4DV0I 4FWHA 4ZVIA 2F4VE 4EMDA 3M85D 2VQFI 4OO1E 3D4JA 1J5EI 3M85G 4DUZE 3L7ZB 3WU3A 5JEAF 4BA2B 4ED4A 5LMUE 4IZKB 2VQEE 3PYEA 5C0XD 2AJ4A 4R1FA 4X65I 2BR2A 2NN6F 1H73A 4P7AA 4AIMA 4B3SI 2O1UA 2UXBE 4B3ME 4X62I 2UUBE 3GCMA 4NXMI 4BA1A 5IWAE 2GO3A 1Y5YA 4IS9A 4QNJA 4DR1I 4JYAI 4DR6E 3B78A 1IBME 4LFBI 1FJGE 3J7AM 4IZJD 4DPWA 4MU3A 1OYPA 4USMA 4B3RI 1ZM3A 4AQYE 4IFDB 1NHIA 1Y6ZA 4FW5A 4LF6E 4IFDC 4LCFA 3ZZUA 3LTOA 1ZXNA 5JEAC 2UUCI 4JI3I 1NHHA 4HACB 4DUYE 3PS2A 2ZBKB 5L3JA 1Z0GA 5LMUI 2C37B 4LF7E 1H74A 3P3CA 3P06A 2HKEA 4JI5E 1KVKA 1Z0VA 1N32E 4JI8E 1Z0BA 3B8HA 5EL9A 5IWAI 4X64E 2JE6B 4DV1E 2WNRB 2OI2A 3P3EA 4MYTA 3DD6A 5FLXC 4K0KE 4QNKA 3L7ZA 1I94I 2LJPA 4IFDE 3HULA 3PRYA 2PNMA 4GKJE 4Z7CA 1WUUA 2BA1D 1OYSA 1EI1A 4X66I 4LCHA 3PYDA 3ZM7A 4HXZA 1USUA 3Q6NA 4HYMA 2Z5CA 2HK2A 4DV4E 3GMEA 1VISA 4DPXA 5K36D 2ZITA 1HNZE 3GONA 1XNRI 4HY1A 1ZM4A 4LF7I 3H1CA 2EFGA 1NZ0A 4KQVA 4DV3I 2UUAE 5FLXQ 4DR7I 4ISAA 5A2QC 5C0XA 4JI8I 2JEAB 3JAMC 4IFDF 5EKWA 4JI0E 4IZJA 1Z5CA 5GMEA 2HK3A 1HR0E 4WUCA 4OO1D 4DV2E 4YY3E 1Z5BA 4DU7A 2ZM6E 4YHHE 1N33I 5FWKA 3T1HI 2NN6D 4IZKA 4LCGA 1A6FA 4LFAI 4FW6A 3T1YI 1J5EE 4JI6I 2PO2A 2UXCI 1PIEA 2E5LE 3OTOI 1XXEA 4X66E 4DR2I 2HFUA 3KRNA 4MU0A 1R6LA 4DV0E 4X65E 2CZ9A 1N0VC 2VESA 2Z5BB 2C38A 3M6AA 4FW3A 4OX9E 4OO1F 4LF5I 2NN6C 1UDSA 2O1WA 5JEAD 2JT2A 2V8PA 1N36E 1EA6A 4N3OA 2AE8A 5DNLA 3HKMA 2X7IA 2XEXA 1MX0A 4MU4A 4UT4A 2O3ZA 4MU1A 1YHCA 4LOMA 3NZKA 4DR3I 2UUBI 2PO0A 4NXME 2CVEA 1OYRA 4M1KA 1BKNA 4AQYI 2IESA 2J7KA 1Y4UA 1KIJA 3T1HE 2GQ0A 2BA1G 4LF9E 4DR6I 3V2UC 1IBMI 4LFBE 1H7UA 1DARA 1RR9A 5K36E 2E5LI 2CGEA 2NN6E 3M7NG 1H72C 4DXLA 4DV6I 2O1TA 5BR8I 4LF4I 5K36A 4DR5I 3Q1QA 3B4TA 2O1VA 1N34I 1R6MA 4WUDA 4LF6I 3QT8A 4URLA 4Z7YA 1K47A 2HKJA 2GO4A 2V34A 4LF8I 4X64I 4DU8A 1N0UA 1Z0TA 2A2CA 2UU9I 1HNWI 2R42A 2PNLA 4BA2A 4JV5E 5DRPA 1XMOE 1OJ4A 2UXDI 4GKJI 2C37A 3ZKDA 3P3GA 2IOPA 1IBKE 3J7AG 2DEIA 1FI4A 5LMNE 1H7SA 4OO1B 1ELOA 4MQYA 2HFSA 4B3TI 4LFCE 1U2RA 5C0XB 5DRRA 3ZZ0A 3M7ND 3WU6A 1Z5AA 3HJCA 4PU9A 2UXBI 1Y60A 4JG4A 3QT6A 4OKGA 1S4EA 2PNZA 2Q2EB 4FW4A 3LNUA 1N34E 2C39B 5K36F 4JYAE 3B82A 2VQEI 3V5RA 1FJGI 4DPYA 2F1DA 4LF8E 4U3DA 4JI1E 1HK7A 4GKKE 4X62E 1S16A 2UU9E 4AM3A 1UDQA 2Z5EA 4P52A 4XTJA 2Z5CB 2IOQA 2V2QA 1E3PA 2WP8B 1XMOI 1ZM2A 4J3DA 2UXDE 4DV7I 1HNXI 4NBQA 4JI0I 1FNMA 3F0NA 3OTOE 4BA1B 1HR0I 4OZEA 4AIDA 4DR2E 5LMNI 5ELWA 2A2DA 2GS8A 4JI4E 1FWKA 4IZJB 3UHMA 3ZKBA 2UUCE 5K36C 3U1YA 4JI5I 1D6TA 3T1YE 5DNXA 2UXCE 4JI6E 1B62A 3J81Q 2HHHE 3K85A 5JEAA 4DUYI 1PKPA 4DV1I 4LPFA 2IERA 3J80C 1XMQI 4IFDA 1XNQE 4DPTA 2E1RA 2PO1B 4JI1I 2F4VI 4JI7I 3WU4A 4OX9I 4GKKI 1N32I 1FKAE 5LL6R 3QT5A 2C38B 2BA0D 3Q6MA 4IFDD 4K0KI 1PVGA 3K17A 2NN6A 2R3VA 2VQFE 2BA0G 4DR3E 2V2ZA 1KKHA 1XHKA 4B3MI 1KTVA 1Y4SA 1XNRE 4DUZI 2JEBA 4DV3E 2UUAI 5A2QQ 5C0XF 2PO0B 5DROA 2HHHI 2NPFA 1E3HA 1VI7A 2PO2B 3WU5A 1HNZI 5BR8E 4LF4E 1XNQI 1HNWE 3QT7A 1NHJA 4DV5E 4KHPE 3PYGA 4JV5I 2DEJA 1ZXMA 4I3HA 4GQUA 2X36A 4LFAE 3PYFA 2BR2B 4DPUA 1USVA 2BV3A 3P76A 2PNZB 3PS1A 5C0XC 4U3BA 2ZM6I 4JI2E 4DR4E 5JEAB 4PRVA 4USKA 4LFCI 2JE6A 4B3TE 1Z0WA 2WNRA 4PRXA 2JEAA 1Z59A 4JI3E 5IT9C 3U1KA 3PS3A 2PO1A 2V2VA 4NXNI 4MYUA 5GMDA 3H4LA 1I94E 4FWDA 4HACA 3K1JA 1MU5A 4OO1A 1P42A
chains in the Genus database with same CATH topology
4LF5E 4DV5I 4KHPI 1N36I 2VF3A 3J80Q 2WW4A 1HNXE 1IBLI 2BM0A 1B63A 2BM1A 4DV4I 4FW9A 4DV6E 4DR5E 3LPSA 2CG9A 1FWLA 3CWVA 4JI2I 4DR4I 1QZRA 1UEKA 4DV7E 1MG7A 4LF9I 1Z0CA 4RPFA 4FWGA 4B3SE 1Z0EA 4NXNE 1XMQE 3ZZTA 4FN5A 3JAMQ 4JI4I 1N33E 5IT9Q 3J81C 1RREA 4DR7E 4UTGA 4DR1E 4JI7E 1ZM9A 1IBKI 2Z5BA 4B3RE 4DV2I 4YY3I 1IBLE 4YHHI 4WUBA 4DV0I 4FWHA 4ZVIA 2F4VE 4EMDA 2VQFI 3D4JA 1J5EI 4DUZE 3WU3A 4ED4A 5LMUE 4IZKB 2VQEE 3PYEA 2AJ4A 4R1FA 4X65I 1H73A 4P7AA 4B3SI 2O1UA 2UXBE 4B3ME 4X62I 2UUBE 4NXMI 5IWAE 4DR1I 4JYAI 4DR6E 3B78A 1IBME 4LFBI 1FJGE 3J7AM 4IZJD 4DPWA 4USMA 4B3RI 1ZM3A 4AQYE 1NHIA 1Y6ZA 4LF6E 3ZZUA 3LTOA 1ZXNA 2UUCI 4JI3I 1NHHA 4HACB 4DUYE 2ZBKB 5L3JA 1Z0GA 5LMUI 4LF7E 1H74A 3P06A 2HKEA 4JI5E 1KVKA 1Z0VA 1N32E 4JI8E 1Z0BA 3B8HA 5IWAI 4X64E 4DV1E 2OI2A 4MYTA 5FLXC 4K0KE 1I94I 2LJPA 3HULA 3PRYA 2PNMA 4GKJE 4Z7CA 1WUUA 1EI1A 4X66I 3PYDA 3ZM7A 4HXZA 1USUA 3Q6NA 4HYMA 2Z5CA 2HK2A 4DV4E 1VISA 4DPXA 2ZITA 1HNZE 3GONA 1XNRI 4HY1A 1ZM4A 4LF7I 2UUAE 4KQVA 2EFGA 1NZ0A 4DV3I 4DR7I 5FLXQ 5A2QC 4JI8I 3JAMC 4JI0E 4IZJA 1Z5CA 5GMEA 2HK3A 1HR0E 4WUCA 4DV2E 4YY3E 2ZM6E 1Z5BA 4DU7A 4YHHE 1N33I 5FWKA 3T1HI 4IZKA 1A6FA 4LFAI 3T1YI 2UXCI 1J5EE 4JI6I 1PIEA 2E5LE 3OTOI 4X66E 4DR2I 2HFUA 4DV0E 4X65E 2CZ9A 1N0VC 2Z5BB 3M6AA 4OX9E 4LF5I 2O1WA 2V8PA 1N36E 1EA6A 4N3OA 2X7IA 2XEXA 1MX0A 4UT4A 4DR3I 2UUBI 4NXME 4M1KA 1BKNA 4AQYI 2J7KA 1Y4UA 1KIJA 3T1HE 2GQ0A 4LF9E 4DR6I 3V2UC 1IBMI 4LFBE 1H7UA 1DARA 1RR9A 2E5LI 2CGEA 1H72C 4DXLA 4DV6I 2O1TA 5BR8I 4LF4I 4DR5I 3Q1QA 2O1VA 1N34I 4WUDA 4LF6I 3QT8A 4URLA 4Z7YA 1K47A 2HKJA 2V34A 4LF8I 4X64I 4DU8A 1N0UA 1Z0TA 2A2CA 2UU9I 1HNWI 2R42A 2PNLA 4JV5E 1XMOE 1OJ4A 2UXDI 4GKJI 3ZKDA 2IOPA 1IBKE 3J7AG 2DEIA 1FI4A 5LMNE 1H7SA 1ELOA 2HFSA 4B3TI 4LFCE 1U2RA 3ZZ0A 3WU6A 1Z5AA 3HJCA 4PU9A 2UXBI 4JG4A 3QT6A 1S4EA 2Q2EB 3LNUA 1N34E 4JYAE 3B82A 2VQEI 3V5RA 1FJGI 4DPYA 4LF8E 4JI1E 1HK7A 4GKKE 4X62E 1S16A 2UU9E 2Z5EA 4P52A 4XTJA 2Z5CB 2IOQA 2V2QA 1XMOI 1ZM2A 2UXDE 4DV7I 1HNXI 4JI0I 1FNMA 3F0NA 3OTOE 1HR0I 4DR2E 5LMNI 2A2DA 2GS8A 4JI4E 1FWKA 4IZJB 3ZKBA 2UUCE 4JI5I 1D6TA 3T1YE 2UXCE 4JI6E 1B62A 3J81Q 2HHHE 3K85A 4DUYI 1PKPA 4DV1I 3J80C 1XMQI 1XNQE 4DPTA 2E1RA 4JI1I 2F4VI 4JI7I 3WU4A 4OX9I 4GKKI 1N32I 1FKAE 5LL6R 3QT5A 3Q6MA 4K0KI 1PVGA 3K17A 2R3VA 2VQFE 4DR3E 2V2ZA 1KKHA 1XHKA 4B3MI 1KTVA 1Y4SA 1XNRE 4DUZI 4DV3E 2UUAI 5A2QQ 2HHHI 2NPFA 3WU5A 1HNZI 5BR8E 4LF4E 1XNQI 1HNWE 3QT7A 1NHJA 4DV5E 4KHPE 3PYGA 4JV5I 2DEJA 1ZXMA 4I3HA 2X36A 4LFAE 3PYFA 4DPUA 1USVA 2BV3A 2ZM6I 4JI2E 4DR4E 4PRVA 4USKA 4LFCI 4B3TE 1Z0WA 4PRXA 1Z59A 4JI3E 5IT9C 2V2VA 4NXNI 4MYUA 5GMDA 3H4LA 1I94E 4FWDA 4HACA 3K1JA 1MU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF5 E;  4DV5 I;  4KHP I;  1N36 I;  2VF3 A;  3J80 Q;  2WW4 A;  1HNX E;  1IBL I;  2BM0 A;  1B63 A;  2BM1 A;  4DV4 I;  4FW9 A;  4DV6 E;  4DR5 E;  3LPS A;  3CWV A;  1FWL A;  4JI2 I;  4DR4 I;  1QZR A;  1UEK A;  4DV7 E;  1MG7 A;  4LF9 I;  1Z0C A;  4RPF A;  4FWG A;  4B3S E;  1Z0E A;  4NXN E;  1XMQ E;  3ZZT A;  4FN5 A;  3JAM Q;  4JI4 I;  1N33 E;  5IT9 Q;  3J81 C;  1RRE A;  4DR7 E;  4UTG A;  4DR1 E;  4JI7 E;  1ZM9 A;  1IBK I;  4B3R E;  4DV2 I;  4YY3 I;  1IBL E;  4YHH I;  4WUB A;  4DV0 I;  4FWH A;  4ZVI A;  2F4V E;  4EMD A;  2VQF I;  3D4J A;  1J5E I;  4DUZ E;  3WU3 A;  4ED4 A;  5LMU E;  2VQE E;  3PYE A;  2AJ4 A;  4R1F A;  4X65 I;  1H73 A;  4P7A A;  4B3S I;  2UXB E;  4B3M E;  4X62 I;  2UUB E;  4NXM I;  5IWA E;  4DR1 I;  4JYA I;  4DR6 E;  3B78 A;  1IBM E;  4LFB I;  1FJG E;  3J7A M;  4DPW A;  4USM A;  4B3R I;  1ZM3 A;  4AQY E;  1NHI A;  4LF6 E;  3ZZU A;  3LTO A;  1ZXN A;  2UUC I;  4JI3 I;  1NHH A;  4HAC B;  4DUY E;  2ZBK B;  5L3J A;  1Z0G A;  5LMU I;  4LF7 E;  1H74 A;  2HKE A;  4JI5 E;  1KVK A;  1Z0V A;  1N32 E;  4JI8 E;  1Z0B A;  3B8H A;  5IWA I;  4X64 E;  4DV1 E;  2OI2 A;  4MYT A;  5FLX C;  4K0K E;  1I94 I;  2LJP A;  3HUL A;  4GKJ E;  4Z7C A;  1WUU A;  1EI1 A;  4X66 I;  3PYD A;  3ZM7 A;  4HXZ A;  4HYM A;  2HK2 A;  4DV4 E;  1VIS A;  4DPX A;  2ZIT A;  1HNZ E;  3GON A;  1XNR I;  4HY1 A;  1ZM4 A;  4LF7 I;  2UUA E;  4KQV A;  2EFG A;  1NZ0 A;  4DV3 I;  4DR7 I;  5FLX Q;  5A2Q C;  4JI8 I;  3JAM C;  4JI0 E;  1Z5C A;  5GME A;  2HK3 A;  1HR0 E;  4WUC A;  4DV2 E;  4YY3 E;  1Z5B A;  4DU7 A;  2ZM6 E;  4YHH E;  1N33 I;  3T1H I;  1A6F A;  4LFA I;  3T1Y I;  2UXC I;  1J5E E;  4JI6 I;  1PIE A;  2E5L E;  3OTO I;  4X66 E;  4DR2 I;  2HFU A;  4DV0 E;  4X65 E;  2CZ9 A;  1N0V C;  3M6A A;  4OX9 E;  4LF5 I;  2V8P A;  1N36 E;  1EA6 A;  2X7I A;  2XEX A;  1MX0 A;  4UT4 A;  4DR3 I;  2UUB I;  4NXM E;  4M1K A;  1BKN A;  4AQY I;  2J7K A;  1KIJ A;  3T1H E;  4LF9 E;  4DR6 I;  3V2U C;  1IBM I;  4LFB E;  1H7U A;  1DAR A;  1RR9 A;  2E5L I;  1H72 C;  4DXL A;  4DV6 I;  5BR8 I;  4LF4 I;  4DR5 I;  3Q1Q A;  1N34 I;  4LF6 I;  4WUD A;  3QT8 A;  4URL A;  4Z7Y A;  1K47 A;  2HKJ A;  2V34 A;  4LF8 I;  4X64 I;  4DU8 A;  1N0U A;  1Z0T A;  2A2C A;  2UU9 I;  1HNW I;  2R42 A;  4JV5 E;  1XMO E;  1OJ4 A;  2UXD I;  4GKJ I;  3ZKD A;  1IBK E;  3J7A G;  2DEI A;  1FI4 A;  5LMN E;  1H7S A;  1ELO A;  2HFS A;  4B3T I;  4LFC E;  1U2R A;  3ZZ0 A;  3WU6 A;  1Z5A A;  4PU9 A;  2UXB I;  4JG4 A;  3QT6 A;  1S4E A;  2Q2E B;  3LNU A;  1N34 E;  4JYA E;  3B82 A;  2VQE I;  3V5R A;  1FJG I;  4DPY A;  4LF8 E;  4JI1 E;  4GKK E;  4X62 E;  1S16 A;  2UU9 E;  4P52 A;  4XTJ A;  2V2Q A;  1XMO I;  1ZM2 A;  2UXD E;  4DV7 I;  1HNX I;  4JI0 I;  1FNM A;  3F0N A;  3OTO E;  1HR0 I;  4DR2 E;  5LMN I;  2A2D A;  2GS8 A;  4JI4 E;  1FWK A;  3ZKB A;  2UUC E;  4JI5 I;  1D6T A;  3T1Y E;  2UXC E;  4JI6 E;  1B62 A;  3J81 Q;  2HHH E;  4DUY I;  1PKP A;  4DV1 I;  3J80 C;  1XMQ I;  1XNQ E;  4DPT A;  2E1R A;  4JI1 I;  2F4V I;  4JI7 I;  3WU4 A;  4OX9 I;  4GKK I;  1N32 I;  1FKA E;  5LL6 R;  3QT5 A;  4K0K I;  1PVG A;  3K17 A;  2R3V A;  2VQF E;  4DR3 E;  2V2Z A;  1KKH A;  1XHK A;  4B3M I;  1KTV A;  1XNR E;  4DUZ I;  4DV3 E;  2UUA I;  5A2Q Q;  2HHH I;  2NPF A;  3WU5 A;  1HNZ I;  5BR8 E;  4LF4 E;  1XNQ I;  1HNW E;  3QT7 A;  1NHJ A;  4DV5 E;  4KHP E;  3PYG A;  4JV5 I;  2DEJ A;  1ZXM A;  4I3H A;  2X36 A;  4LFA E;  3PYF A;  4DPU A;  2BV3 A;  2ZM6 I;  4JI2 E;  4DR4 E;  4PRV A;  4USK A;  4LFC I;  4B3T E;  1Z0W A;  4PRX A;  1Z59 A;  4JI3 E;  5IT9 C;  2V2V A;  4NXN I;  4MYU A;  5GMD A;  3H4L A;  1I94 E;  4FWD A;  4HAC A;  3K1J A;  1MU5 A; 
#chains in the Genus database with same CATH topology
 4LF5 E;  3CDI A;  4DV5 I;  4KHP I;  5DRQ A;  2NN6 B;  5K36 B;  1N36 I;  2VF3 A;  3J80 Q;  4OO1 C;  2WW4 A;  1HNX E;  2J65 A;  1IBL I;  2BM0 A;  1B63 A;  1RHY A;  2BM1 A;  2JEB B;  4DV4 I;  1YH8 A;  3GLL A;  4FW7 A;  4FW9 A;  4DV6 E;  4DR5 E;  3LPS A;  2CG9 A;  1FWL A;  3CWV A;  4JI2 I;  4DR4 I;  1QZR A;  1UEK A;  4DV7 E;  1MG7 A;  4LF9 I;  1Z0C A;  4RPF A;  4FWG A;  5JEA E;  2WP8 A;  1Z0E A;  4B3S E;  4NXN E;  1XMQ E;  3ZZT A;  4FN5 A;  3JAM Q;  3CDJ A;  4JI4 I;  1N33 E;  5IT9 Q;  3J81 C;  1RRE A;  1UDO A;  4DR7 E;  4UTG A;  4DR1 E;  1UDN A;  4JI7 E;  1ZM9 A;  4MDT A;  1IBK I;  2Z5B A;  4B3R E;  2C39 A;  4DV2 I;  4YY3 I;  1IBL E;  4YHH I;  5C0X E;  4WUB A;  4DV0 I;  4FWH A;  4ZVI A;  2F4V E;  4EMD A;  3M85 D;  2VQF I;  4OO1 E;  3D4J A;  1J5E I;  3M85 G;  4DUZ E;  3L7Z B;  3WU3 A;  5JEA F;  4BA2 B;  4ED4 A;  5LMU E;  4IZK B;  2VQE E;  3PYE A;  5C0X D;  2AJ4 A;  4R1F A;  4X65 I;  2BR2 A;  2NN6 F;  1H73 A;  4P7A A;  4AIM A;  4B3S I;  2O1U A;  2UXB E;  4B3M E;  4X62 I;  2UUB E;  3GCM A;  4NXM I;  4BA1 A;  5IWA E;  2GO3 A;  1Y5Y A;  4IS9 A;  4QNJ A;  4DR1 I;  4JYA I;  4DR6 E;  3B78 A;  1IBM E;  4LFB I;  1FJG E;  3J7A M;  4IZJ D;  4DPW A;  4MU3 A;  1OYP A;  4USM A;  4B3R I;  1ZM3 A;  4AQY E;  4IFD B;  1NHI A;  1Y6Z A;  4FW5 A;  4LF6 E;  4IFD C;  4LCF A;  3ZZU A;  3LTO A;  1ZXN A;  5JEA C;  2UUC I;  4JI3 I;  1NHH A;  4HAC B;  4DUY E;  3PS2 A;  2ZBK B;  5L3J A;  1Z0G A;  5LMU I;  2C37 B;  4LF7 E;  1H74 A;  3P3C A;  3P06 A;  2HKE A;  4JI5 E;  1KVK A;  1Z0V A;  1N32 E;  4JI8 E;  1Z0B A;  3B8H A;  5EL9 A;  5IWA I;  4X64 E;  2JE6 B;  4DV1 E;  2WNR B;  2OI2 A;  3P3E A;  4MYT A;  3DD6 A;  5FLX C;  4K0K E;  4QNK A;  3L7Z A;  1I94 I;  2LJP A;  4IFD E;  3HUL A;  3PRY A;  2PNM A;  4GKJ E;  4Z7C A;  1WUU A;  2BA1 D;  1OYS A;  1EI1 A;  4X66 I;  4LCH A;  3PYD A;  3ZM7 A;  4HXZ A;  1USU A;  3Q6N A;  4HYM A;  2Z5C A;  2HK2 A;  4DV4 E;  3GME A;  1VIS A;  4DPX A;  5K36 D;  2ZIT A;  1HNZ E;  3GON A;  1XNR I;  4HY1 A;  1ZM4 A;  4LF7 I;  3H1C A;  2EFG A;  1NZ0 A;  4KQV A;  4DV3 I;  2UUA E;  5FLX Q;  4DR7 I;  4ISA A;  5A2Q C;  5C0X A;  4JI8 I;  2JEA B;  3JAM C;  4IFD F;  5EKW A;  4JI0 E;  4IZJ A;  1Z5C A;  5GME A;  2HK3 A;  1HR0 E;  4WUC A;  4OO1 D;  4DV2 E;  4YY3 E;  1Z5B A;  4DU7 A;  2ZM6 E;  4YHH E;  1N33 I;  5FWK A;  3T1H I;  2NN6 D;  4IZK A;  4LCG A;  1A6F A;  4LFA I;  4FW6 A;  3T1Y I;  1J5E E;  4JI6 I;  2PO2 A;  2UXC I;  1PIE A;  2E5L E;  3OTO I;  1XXE A;  4X66 E;  4DR2 I;  2HFU A;  3KRN A;  4MU0 A;  1R6L A;  4DV0 E;  4X65 E;  2CZ9 A;  1N0V C;  2VES A;  2Z5B B;  2C38 A;  3M6A A;  4FW3 A;  4OX9 E;  4OO1 F;  4LF5 I;  2NN6 C;  1UDS A;  2O1W A;  5JEA D;  2JT2 A;  2V8P A;  1N36 E;  1EA6 A;  4N3O A;  2AE8 A;  5DNL A;  3HKM A;  2X7I A;  2XEX A;  1MX0 A;  4MU4 A;  4UT4 A;  2O3Z A;  4MU1 A;  1YHC A;  4LOM A;  3NZK A;  4DR3 I;  2UUB I;  2PO0 A;  4NXM E;  2CVE A;  1OYR A;  4M1K A;  1BKN A;  4AQY I;  2IES A;  2J7K A;  1Y4U A;  1KIJ A;  3T1H E;  2GQ0 A;  2BA1 G;  4LF9 E;  4DR6 I;  3V2U C;  1IBM I;  4LFB E;  1H7U A;  1DAR A;  1RR9 A;  5K36 E;  2E5L I;  2CGE A;  2NN6 E;  3M7N G;  1H72 C;  4DXL A;  4DV6 I;  2O1T A;  5BR8 I;  4LF4 I;  5K36 A;  4DR5 I;  3Q1Q A;  3B4T A;  2O1V A;  1N34 I;  1R6M A;  4WUD A;  4LF6 I;  3QT8 A;  4URL A;  4Z7Y A;  1K47 A;  2HKJ A;  2GO4 A;  2V34 A;  4LF8 I;  4X64 I;  4DU8 A;  1N0U A;  1Z0T A;  2A2C A;  2UU9 I;  1HNW I;  2R42 A;  2PNL A;  4BA2 A;  4JV5 E;  5DRP A;  1XMO E;  1OJ4 A;  2UXD I;  4GKJ I;  2C37 A;  3ZKD A;  3P3G A;  2IOP A;  1IBK E;  3J7A G;  2DEI A;  1FI4 A;  5LMN E;  1H7S A;  4OO1 B;  1ELO A;  4MQY A;  2HFS A;  4B3T I;  4LFC E;  1U2R A;  5C0X B;  5DRR A;  3ZZ0 A;  3M7N D;  3WU6 A;  1Z5A A;  3HJC A;  4PU9 A;  2UXB I;  1Y60 A;  4JG4 A;  3QT6 A;  4OKG A;  1S4E A;  2PNZ A;  2Q2E B;  4FW4 A;  3LNU A;  1N34 E;  2C39 B;  5K36 F;  4JYA E;  3B82 A;  2VQE I;  3V5R A;  1FJG I;  4DPY A;  2F1D A;  4LF8 E;  4U3D A;  4JI1 E;  1HK7 A;  4GKK E;  4X62 E;  1S16 A;  2UU9 E;  4AM3 A;  1UDQ A;  2Z5E A;  4P52 A;  4XTJ A;  2Z5C B;  2IOQ A;  2V2Q A;  1E3P A;  2WP8 B;  1XMO I;  1ZM2 A;  4J3D A;  2UXD E;  4DV7 I;  1HNX I;  4NBQ A;  4JI0 I;  1FNM A;  3F0N A;  3OTO E;  4BA1 B;  1HR0 I;  4OZE A;  4AID A;  4DR2 E;  5LMN I;  5ELW A;  2A2D A;  2GS8 A;  4JI4 E;  1FWK A;  4IZJ B;  3UHM A;  3ZKB A;  2UUC E;  5K36 C;  3U1Y A;  4JI5 I;  1D6T A;  3T1Y E;  5DNX A;  2UXC E;  4JI6 E;  1B62 A;  3J81 Q;  2HHH E;  3K85 A;  5JEA A;  4DUY I;  1PKP A;  4DV1 I;  4LPF A;  2IER A;  3J80 C;  1XMQ I;  4IFD A;  1XNQ E;  4DPT A;  2E1R A;  2PO1 B;  4JI1 I;  2F4V I;  4JI7 I;  3WU4 A;  4OX9 I;  4GKK I;  1N32 I;  1FKA E;  5LL6 R;  3QT5 A;  2C38 B;  2BA0 D;  3Q6M A;  4IFD D;  4K0K I;  1PVG A;  3K17 A;  2NN6 A;  2R3V A;  2VQF E;  2BA0 G;  4DR3 E;  2V2Z A;  1KKH A;  1XHK A;  4B3M I;  1KTV A;  1Y4S A;  1XNR E;  4DUZ I;  2JEB A;  4DV3 E;  2UUA I;  5A2Q Q;  5C0X F;  2PO0 B;  5DRO A;  2HHH I;  2NPF A;  1E3H A;  1VI7 A;  2PO2 B;  3WU5 A;  1HNZ I;  5BR8 E;  4LF4 E;  1XNQ I;  1HNW E;  3QT7 A;  1NHJ A;  4DV5 E;  4KHP E;  3PYG A;  4JV5 I;  2DEJ A;  1ZXM A;  4I3H A;  4GQU A;  2X36 A;  4LFA E;  3PYF A;  2BR2 B;  4DPU A;  1USV A;  2BV3 A;  3P76 A;  2PNZ B;  3PS1 A;  5C0X C;  4U3B A;  2ZM6 I;  4JI2 E;  4DR4 E;  5JEA B;  4PRV A;  4USK A;  4LFC I;  2JE6 A;  4B3T E;  1Z0W A;  2WNR A;  4PRX A;  2JEA A;  1Z59 A;  4JI3 E;  5IT9 C;  3U1K A;  3PS3 A;  2PO1 A;  2V2V A;  4NXN I;  4MYU A;  5GMD A;  3H4L A;  1I94 E;  4FWD A;  4HAC A;  3K1J A;  1MU5 A;  4OO1 A;  1P42 A; 
#chains in the Genus database with same CATH homology
 4LF5 E;  4DV5 I;  4KHP I;  1N36 I;  2VF3 A;  3J80 Q;  2WW4 A;  1HNX E;  1IBL I;  2BM0 A;  1B63 A;  2BM1 A;  4DV4 I;  4FW9 A;  4DV6 E;  4DR5 E;  3LPS A;  2CG9 A;  1FWL A;  3CWV A;  4JI2 I;  4DR4 I;  1QZR A;  1UEK A;  4DV7 E;  1MG7 A;  4LF9 I;  1Z0C A;  4RPF A;  4FWG A;  4B3S E;  1Z0E A;  4NXN E;  1XMQ E;  3ZZT A;  4FN5 A;  3JAM Q;  4JI4 I;  1N33 E;  5IT9 Q;  3J81 C;  1RRE A;  4DR7 E;  4UTG A;  4DR1 E;  4JI7 E;  1ZM9 A;  1IBK I;  2Z5B A;  4B3R E;  4DV2 I;  4YY3 I;  1IBL E;  4YHH I;  4WUB A;  4DV0 I;  4FWH A;  4ZVI A;  2F4V E;  4EMD A;  2VQF I;  3D4J A;  1J5E I;  4DUZ E;  3WU3 A;  4ED4 A;  5LMU E;  4IZK B;  2VQE E;  3PYE A;  2AJ4 A;  4R1F A;  4X65 I;  1H73 A;  4P7A A;  4B3S I;  2O1U A;  2UXB E;  4B3M E;  4X62 I;  2UUB E;  4NXM I;  5IWA E;  4DR1 I;  4JYA I;  4DR6 E;  3B78 A;  1IBM E;  4LFB I;  1FJG E;  3J7A M;  4IZJ D;  4DPW A;  4USM A;  4B3R I;  1ZM3 A;  4AQY E;  1NHI A;  1Y6Z A;  4LF6 E;  3ZZU A;  3LTO A;  1ZXN A;  2UUC I;  4JI3 I;  1NHH A;  4HAC B;  4DUY E;  2ZBK B;  5L3J A;  1Z0G A;  5LMU I;  4LF7 E;  1H74 A;  3P06 A;  2HKE A;  4JI5 E;  1KVK A;  1Z0V A;  1N32 E;  4JI8 E;  1Z0B A;  3B8H A;  5IWA I;  4X64 E;  4DV1 E;  2OI2 A;  4MYT A;  5FLX C;  4K0K E;  1I94 I;  2LJP A;  3HUL A;  3PRY A;  2PNM A;  4GKJ E;  4Z7C A;  1WUU A;  1EI1 A;  4X66 I;  3PYD A;  3ZM7 A;  4HXZ A;  1USU A;  3Q6N A;  4HYM A;  2Z5C A;  2HK2 A;  4DV4 E;  1VIS A;  4DPX A;  2ZIT A;  1HNZ E;  3GON A;  1XNR I;  4HY1 A;  1ZM4 A;  4LF7 I;  2UUA E;  4KQV A;  2EFG A;  1NZ0 A;  4DV3 I;  4DR7 I;  5FLX Q;  5A2Q C;  4JI8 I;  3JAM C;  4JI0 E;  4IZJ A;  1Z5C A;  5GME A;  2HK3 A;  1HR0 E;  4WUC A;  4DV2 E;  4YY3 E;  2ZM6 E;  1Z5B A;  4DU7 A;  4YHH E;  1N33 I;  5FWK A;  3T1H I;  4IZK A;  1A6F A;  4LFA I;  3T1Y I;  2UXC I;  1J5E E;  4JI6 I;  1PIE A;  2E5L E;  3OTO I;  4X66 E;  4DR2 I;  2HFU A;  4DV0 E;  4X65 E;  2CZ9 A;  1N0V C;  2Z5B B;  3M6A A;  4OX9 E;  4LF5 I;  2O1W A;  2V8P A;  1N36 E;  1EA6 A;  4N3O A;  2X7I A;  2XEX A;  1MX0 A;  4UT4 A;  4DR3 I;  2UUB I;  4NXM E;  4M1K A;  1BKN A;  4AQY I;  2J7K A;  1Y4U A;  1KIJ A;  3T1H E;  2GQ0 A;  4LF9 E;  4DR6 I;  3V2U C;  1IBM I;  4LFB E;  1H7U A;  1DAR A;  1RR9 A;  2E5L I;  2CGE A;  1H72 C;  4DXL A;  4DV6 I;  2O1T A;  5BR8 I;  4LF4 I;  4DR5 I;  3Q1Q A;  2O1V A;  1N34 I;  4WUD A;  4LF6 I;  3QT8 A;  4URL A;  4Z7Y A;  1K47 A;  2HKJ A;  2V34 A;  4LF8 I;  4X64 I;  4DU8 A;  1N0U A;  1Z0T A;  2A2C A;  2UU9 I;  1HNW I;  2R42 A;  2PNL A;  4JV5 E;  1XMO E;  1OJ4 A;  2UXD I;  4GKJ I;  3ZKD A;  2IOP A;  1IBK E;  3J7A G;  2DEI A;  1FI4 A;  5LMN E;  1H7S A;  1ELO A;  2HFS A;  4B3T I;  4LFC E;  1U2R A;  3ZZ0 A;  3WU6 A;  1Z5A A;  3HJC A;  4PU9 A;  2UXB I;  4JG4 A;  3QT6 A;  1S4E A;  2Q2E B;  3LNU A;  1N34 E;  4JYA E;  3B82 A;  2VQE I;  3V5R A;  1FJG I;  4DPY A;  4LF8 E;  4JI1 E;  1HK7 A;  4GKK E;  4X62 E;  1S16 A;  2UU9 E;  2Z5E A;  4P52 A;  4XTJ A;  2Z5C B;  2IOQ A;  2V2Q A;  1XMO I;  1ZM2 A;  2UXD E;  4DV7 I;  1HNX I;  4JI0 I;  1FNM A;  3F0N A;  3OTO E;  1HR0 I;  4DR2 E;  5LMN I;  2A2D A;  2GS8 A;  4JI4 E;  1FWK A;  4IZJ B;  3ZKB A;  2UUC E;  4JI5 I;  1D6T A;  3T1Y E;  2UXC E;  4JI6 E;  1B62 A;  3J81 Q;  2HHH E;  3K85 A;  4DUY I;  1PKP A;  4DV1 I;  3J80 C;  1XMQ I;  1XNQ E;  4DPT A;  2E1R A;  4JI1 I;  2F4V I;  4JI7 I;  3WU4 A;  4OX9 I;  4GKK I;  1N32 I;  1FKA E;  5LL6 R;  3QT5 A;  3Q6M A;  4K0K I;  1PVG A;  3K17 A;  2R3V A;  2VQF E;  4DR3 E;  2V2Z A;  1KKH A;  1XHK A;  4B3M I;  1KTV A;  1Y4S A;  1XNR E;  4DUZ I;  4DV3 E;  2UUA I;  5A2Q Q;  2HHH I;  2NPF A;  3WU5 A;  1HNZ I;  5BR8 E;  4LF4 E;  1XNQ I;  1HNW E;  3QT7 A;  1NHJ A;  4DV5 E;  4KHP E;  3PYG A;  4JV5 I;  2DEJ A;  1ZXM A;  4I3H A;  2X36 A;  4LFA E;  3PYF A;  4DPU A;  1USV A;  2BV3 A;  2ZM6 I;  4JI2 E;  4DR4 E;  4PRV A;  4USK A;  4LFC I;  4B3T E;  1Z0W A;  4PRX A;  1Z59 A;  4JI3 E;  5IT9 C;  2V2V A;  4NXN I;  4MYU A;  5GMD A;  3H4L A;  1I94 E;  4FWD A;  4HAC A;  3K1J A;  1MU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...