4X62I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x62I00
2UUAE 5LL6R 4B3SE 1N0UA 1Z0VA 1ZM4A 1H74A 1HNZI 4X65I 4DR5E 4HXZA 4PU9A 4B3MI 4JYAI 4B3TI 3QT5A 2E1RA 4DV7E 2ZBKB 4DV2E 2HK2A 5L3JA 4JI3I 4DR2I 1Z59A 2R42A 4JI1I 3OTOE 4DV6I 1HR0I 2HFSA 3T1YE 3V2UC 5BR8E 3J7AM 4DR3E 2UXDE 4FW9A 1Z0CA 4GKKI 2VQFE 2E5LE 1I94E 4ZVIA 3QT8A 4LF7E 4JI6I 1Z0BA 4HYMA 2V2ZA 1XNRE 1Z0GA 3B78A 3LTOA 5FLXC 4X66I 3ZKBA 4ED4A 1K47A 4LF4E 4KQVA 3LNUA 2ZM6I 4DV4E 3Q1QA 4DUYI 1MU5A 4GKJI 4LF8E 1XNQE 4LF9I 3J81C 3JAMC 4YY3I 1KVKA 4B3RI 4DV3I 4DR6E 3CWVA 4URLA 4JV5I 1HNXI 4M1KA 1IBMI 2A2CA 2V2VA 2VQEI 4JI4I 1HNWE 1KKHA 2R3VA 4LFAE 4JI7E 3T1HE 3K1JA 5IWAE 3ZZ0A 1WUUA 5GMDA 1IBKI 2UUCI 4JI2E 4DR4E 1XMOE 5IT9C 4JI5E 2WW4A 1NHIA 2UUAI 1H73A 2HHHE 4UTGA 1N0VC 1EA6A 4EMDA 4WUBA 4B3SI 4DU7A 2UXCE 4UT4A 1S16A 1N33E 1FJGE 5FLXQ 1ELOA 1XMQE 4FWHA 4DR5I 1EI1A 1N36E 4DV1E 1H7SA 1KTVA 4DV7I 4DV2I 4DPTA 2BM1A 1ZXMA 2X7IA 1KIJA 3J81Q 5GMEA 3JAMQ 4PRXA 4DR1E 2AJ4A 1FNMA 3OTOI 3PYDA 4DV0E 1U2RA 3T1YI 3D4JA 5BR8I 5LMUE 2BM0A 4DUZE 4DR3I 1IBLI 1BKNA 4JI0E 2UXDI 2VQFI 2E5LI 1I94I 3K17A 4LF7I 4AQYE 1XNRI 1N34E 2EFGA 1NZ0A 1FI4A 4LFCE 4OX9E 2CZ9A 1Z5AA 3J7AG 1OJ4A 2UUBE 5IT9Q 1N32E 4DPWA 1PIEA 2UU9E 4LF4I 2DEJA 1Z5CA 4DV4I 4LF8I 2XEXA 4DR7E 1XNQI 4FWDA 4USMA 4DR6I 3H4LA 2HKJA 1QZRA 1H7UA 3WU4A 1HNWI 4LFAI 3ZZTA 3T1HI 4JI8E 4JI7I 5IWAI 2V34A 4DV5E 2ZITA 4I3HA 1NHHA 4K0KE 1B63A 3PYFA 4NXME 1Z0EA 2BV3A 4JI2I 4DR4I 1XMOI 2A2DA 4JI5I 4LF6E 1Z5BA 2HHHI 1FWLA 5LMNE 3PYEA 2UXCI 2HKEA 5A2QC 2HK3A 3LPSA 1N33I 4WUCA 1FJGI 4LFBE 1D6TA 1VISA 3GONA 3ZM7A 1XMQI 3B8HA 4HACB 4LF5E 1N36I 2V2QA 4HACA 4DV1I 2V8PA 2F4VE 1J5EE 4NXNE 2UXBE 4KHPE 4YHHE 3QT7A 3V5RA 4X62E 4FWGA 4PRVA 4DV0I 5LMUI 4X64E 4DUZI 4JI0I 3PYGA 4FN5A 3HULA 1MX0A 1PKPA 4JG4A 4AQYI 1N34I 4DU8A 4LFCI 4OX9I 2DEIA 4Z7CA 2X36A 2UUBI 1Z0WA 1N32I 1HNZE 2UU9I 4X65E 4B3ME 1FKAE 4JYAE 1S4EA 4B3TE 1DARA 2GS8A 1ZM2A 5A2QQ 1ZXNA 4DR7I 4JI3E 3ZKDA 3J80C 4DR2E 3B82A 4HY1A 1IBLE 4JI1E 2VF3A 2NPFA 4DV6E 1HR0E 4MYUA 4DXLA 1FWKA 4GKKE 1RREA 2HFUA 4Z7YA 4JI8I 1ZM3A 4DV5I 4JI6E 2LJPA 4WUDA 4K0KI 4NXMI 4DPYA 1Z0TA 3WU3A 1A6FA 3F0NA 1UEKA 4LF6I 4X66E 2ZM6E 4P7AA 5LMNI 4XTJA 4USKA 2OI2A 4DUYE 4GKJE 4R1FA 1PVGA 4LF9E 1MG7A 4LFBI 1NHJA 4DPUA 4YY3E 4B3RE 1ZM9A 4DV3E 4LF5I 1XHKA 1H72C 4JV5E 1HNXE 2F4VI 1IBME 1J5EI 4NXNI 2VQEE 3ZZUA 4JI4E 2Q2EB 2UXBI 4KHPI 4YHHI 4X62I 3J80Q 3WU5A 1RR9A 1B62A 1IBKE 2UUCE 2J7KA 4X64I 4RPFA 4DR1I 3QT6A 4DPXA 4MYTA 3M6AA 3WU6A 4P52A
chains in the Genus database with same CATH superfamily
3NZKA 2UUAE 3PS3A 3PS2A 5LL6R 2BA0G 4B3SE 3CDJA 2NN6B 4OO1D 4BA1B 1N0UA 2BA0D 1YHCA 1Z0VA 1ZM4A 1H74A 1HNZI 4X65I 4DR5E 4HXZA 4PU9A 4B3MI 3PS1A 4JYAI 4B3TI 4OO1C 3QT5A 2Z5EA 2PO0B 2E1RA 4DV7E 3P06A 2ZBKB 4DV2E 2HK2A 5L3JA 4JI3I 4BA2B 4DR2I 4BA2A 1Z59A 2R42A 4JI1I 4FW4A 3OTOE 4DV6I 1HR0I 4OO1E 2HFSA 3T1YE 3V2UC 4IFDF 4OZEA 5BR8E 3J7AM 4DR3E 2UXDE 4FW9A 1Z0CA 4LCFA 4GKKI 2VQFE 2E5LE 1I94E 1OYSA 4ZVIA 3P3GA 3QT8A 4LF7E 1E3HA 1Z0BA 4GQUA 5JEAE 4HYMA 4JI6I 2V2ZA 1XNRE 5C0XD 1Z0GA 3B78A 4IFDA 2PO2B 2PO2A 3LTOA 4FW3A 3P76A 5FLXC 4X66I 3ZKBA 4ED4A 1K47A 4LF4E 4KQVA 3HKMA 3LNUA 2ZM6I 5C0XC 4DV4E 3Q1QA 2PNLA 2WP8A 4DUYI 1MU5A 4GKJI 2C38B 4LF8E 1XNQE 4LF9I 3J81C 2C38A 2J65A 3JAMC 4YY3I 5C0XE 1KVKA 4B3RI 4DV3I 4DR6E 3CDIA 3CWVA 4URLA 4JV5I 5EKWA 1HNXI 4M1KA 1IBMI 2A2CA 2V2VA 3L7ZA 2VQEI 3K85A 4JI4I 3Q6NA 1HNWE 4AIMA 1KKHA 2R3VA 1Y4SA 4LFAE 1RHYA 4JI7E 3T1HE 3K1JA 5IWAE 3ZZ0A 1WUUA 5GMDA 1E3PA 1IBKI 2UUCI 4MU4A 4IFDD 4JI2E 2IOPA 4DR4E 2JEBB 4LCHA 1XMOE 5IT9C 2O1UA 2JEBA 4JI5E 2WW4A 5EL9A 4FW6A 1NHIA 5JEAB 2NN6F 1H73A 2UUAI 1UDNA 2HHHE 4UTGA 1N0VC 1EA6A 4EMDA 4WUBA 4B3SI 3H1CA 1UDOA 4DU7A 2UXCE 4UT4A 4IFDC 1S16A 1N33E 1FJGE 5FLXQ 1ELOA 1XMQE 5K36B 4FWHA 4DR5I 1EI1A 2NN6A 5K36A 4BA1A 1N36E 4DV1E 4LOMA 1H7SA 1KTVA 4DV7I 5DRRA 4DV2I 4DPTA 2BM1A 1ZXMA 2X7IA 1USVA 1KIJA 3J81Q 5GMEA 3JAMQ 4PRXA 4DR1E 2O3ZA 2AJ4A 1FNMA 4NBQA 3OTOI 2O1WA 2PO0A 3PYDA 3HJCA 4DV0E 1U2RA 3T1YI 3D4JA 4MU1A 2JT2A 5DNXA 5BR8I 5LMUE 2BM0A 4DUZE 4IZKB 4DR3I 1IBLI 1BKNA 4JI0E 2UXDI 4IZKA 2VQFI 5DRQA 2E5LI 1I94I 3K17A 4LF7I 2GO3A 4AQYE 1XNRI 1N34E 5DRPA 2EFGA 1NZ0A 1FI4A 3GMEA 4LFCE 4OX9E 2CZ9A 1Z5AA 3J7AG 1OJ4A 1UDQA 2UUBE 5IT9Q 3PRYA 1N32E 4DPWA 1PIEA 2UU9E 4LF4I 4LCGA 2NN6D 2DEJA 1Y6ZA 1Z5CA 4DV4I 4IS9A 3GCMA 4LF8I 2XEXA 4DR7E 1XNQI 4FWDA 4IZJB 3GLLA 4USMA 4DR6I 2NN6C 3H4LA 1HK7A 2IERA 2HKJA 1QZRA 2WNRB 1H7UA 2WNRA 3WU4A 1HNWI 4J3DA 4LFAI 3ZZTA 3T1HI 4JI8E 4JI7I 5IWAI 2V34A 4DV5E 2ZITA 4I3HA 2Z5BB 1NHHA 4K0KE 2Z5BA 1B63A 3PYFA 2BR2B 4NXME 1Z0EA 2CGEA 5JEAF 1R6LA 2BV3A 4JI2I 4DR4I 2Z5CB 3P3EA 1XMOI 2Z5CA 2A2DA 4OO1B 4JI5I 4AIDA 4OO1A 4LF6E 1Z5BA 3U1KA 2HHHI 3B4TA 4LPFA 1FWLA 5LMNE 1OYPA 4QNJA 3PYEA 2UXCI 2HKEA 5A2QC 2HK3A 5K36F 3LPSA 5JEAA 1N33I 4WUCA 1FJGI 4LFBE 1D6TA 1VISA 3GONA 3ZM7A 1XMQI 3B8HA 3U1YA 4HACB 4LF5E 1N36I 2V2QA 4HACA 4DV1I 2V8PA 2F4VE 2C37B 1J5EE 4NXNE 2C37A 2UXBE 4KHPE 4YHHE 3QT7A 3V5RA 4IFDE 4X62E 5DNLA 5FWKA 4FWGA 2BA1G 4PRVA 4DV0I 2O1VA 3UHMA 5LMUI 4X64E 2PO1B 5C0XB 4DUZI 4JI0I 1Y4UA 2PO1A 3PYGA 5C0XA 4FN5A 2BA1D 3HULA 1MX0A 2CG9A 1PKPA 4JG4A 4AQYI 1N34I 4ISAA 5DROA 2PNZB 4DU8A 4LFCI 4OX9I 2DEIA 2PNZA 4Z7CA 5JEAD 2X36A 2UUBI 2C39B 1Z0WA 1N32I 2C39A 1HNZE 2UU9I 4X65E 4B3ME 1FKAE 4JYAE 1S4EA 4B3TE 1DARA 2JEAB 2GS8A 1ZM2A 4QNKA 5JEAC 5A2QQ 4AM3A 2JEAA 1ZXNA 4DR7I 4JI3E 5K36D 3ZKDA 3J80C 4MDTA 3B82A 1USUA 4DR2E 1VI7A 4HY1A 1IBLE 4JI1E 1YH8A 2VF3A 2JE6B 2NPFA 4DV6E 1HR0E 4MYUA 2JE6A 4DXLA 1FWKA 4FW5A 4IZJA 4MU3A 4U3DA 4GKKE 5K36C 1RREA 2HFUA 4IFDB 4Z7YA 4JI8I 1ZM3A 4DV5I 4JI6E 2LJPA 4WUDA 4K0KI 4OO1F 2GQ0A 4NXMI 4DPYA 3Q6MA 1Z0TA 2NN6E 5K36E 5ELWA 3WU3A 4N3OA 1A6FA 4MU0A 3F0NA 2WP8B 1UEKA 2IESA 4X66E 4LF6I 2AE8A 2BR2A 1UDSA 4FW7A 2ZM6E 4P7AA 5LMNI 2GO4A 4XTJA 4USKA 2OI2A 1Y5YA 4DUYE 4GKJE 4R1FA 1PVGA 2PNMA 4LF9E 3L7ZB 1MG7A 3M7NG 4LFBI 1NHJA 4DPUA 4YY3E 4B3RE 1ZM9A 4DV3E 4LF5I 1XHKA 1H72C 4JV5E 1HNXE 2F4VI 1R6MA 3M7ND 1IBME 1J5EI 4NXNI 2VQEE 4U3BA 4IZJD 2IOQA 4MQYA 3ZZUA 4JI4E 2Q2EB 2UXBI 4KHPI 4YHHI 4X62I 2CVEA 3J80Q 5C0XF 1OYRA 3KRNA 3M85G 3WU5A 1Y60A 1RR9A 1B62A 1IBKE 3DD6A 2UUCE 2J7KA 2VESA 4X64I 1XXEA 1P42A 2F1DA 3P3CA 4RPFA 4DR1I 3QT6A 3M85D 4OKGA 4DPXA 2O1TA 4MYTA 3M6AA 3WU6A 4P52A
chains in the Genus database with same CATH topology
2UUAE 5LL6R 4B3SE 1N0UA 1Z0VA 1ZM4A 1H74A 1HNZI 4X65I 4DR5E 4HXZA 4PU9A 4B3MI 4JYAI 4B3TI 3QT5A 2Z5EA 2E1RA 4DV7E 3P06A 2ZBKB 4DV2E 2HK2A 5L3JA 4JI3I 4DR2I 1Z59A 2R42A 4JI1I 3OTOE 4DV6I 1HR0I 2HFSA 3T1YE 3V2UC 5BR8E 3J7AM 4DR3E 2UXDE 4FW9A 1Z0CA 4GKKI 2VQFE 2E5LE 1I94E 4ZVIA 3QT8A 4LF7E 4JI6I 1Z0BA 4HYMA 2V2ZA 1XNRE 1Z0GA 3B78A 3LTOA 5FLXC 4X66I 3ZKBA 4ED4A 1K47A 4LF4E 4KQVA 3LNUA 2ZM6I 4DV4E 3Q1QA 2PNLA 4DUYI 1MU5A 4GKJI 4LF8E 1XNQE 4LF9I 3J81C 3JAMC 4YY3I 1KVKA 4B3RI 4DV3I 4DR6E 3CWVA 4URLA 4JV5I 1HNXI 4M1KA 1IBMI 2A2CA 2V2VA 2VQEI 3K85A 4JI4I 3Q6NA 1HNWE 1KKHA 2R3VA 1Y4SA 4LFAE 4JI7E 3T1HE 3K1JA 5IWAE 3ZZ0A 1WUUA 5GMDA 1IBKI 2UUCI 4JI2E 2IOPA 4DR4E 1XMOE 5IT9C 2O1UA 4JI5E 2WW4A 1NHIA 2UUAI 1H73A 2HHHE 4UTGA 1N0VC 1EA6A 4EMDA 4WUBA 4B3SI 4DU7A 2UXCE 4UT4A 1S16A 1N33E 1FJGE 5FLXQ 1ELOA 1XMQE 4FWHA 4DR5I 1EI1A 1N36E 4DV1E 1H7SA 1KTVA 4DV7I 4DV2I 4DPTA 2BM1A 1ZXMA 2X7IA 1USVA 1KIJA 3J81Q 5GMEA 3JAMQ 4PRXA 4DR1E 2AJ4A 1FNMA 3OTOI 2O1WA 3PYDA 3HJCA 4DV0E 1U2RA 3T1YI 3D4JA 5BR8I 5LMUE 2BM0A 4DUZE 4IZKB 4DR3I 1IBLI 1BKNA 4JI0E 2UXDI 4IZKA 2VQFI 2E5LI 1I94I 3K17A 4LF7I 4AQYE 1XNRI 1N34E 2EFGA 1NZ0A 1FI4A 4LFCE 4OX9E 2CZ9A 1Z5AA 3J7AG 1OJ4A 2UUBE 5IT9Q 3PRYA 1N32E 4DPWA 1PIEA 2UU9E 4LF4I 2DEJA 1Y6ZA 1Z5CA 4DV4I 4LF8I 2XEXA 4DR7E 1XNQI 4FWDA 4IZJB 4USMA 4DR6I 3H4LA 1HK7A 2HKJA 1QZRA 1H7UA 3WU4A 1HNWI 4LFAI 3ZZTA 3T1HI 4JI8E 4JI7I 5IWAI 2V34A 4DV5E 2ZITA 4I3HA 2Z5BB 1NHHA 4K0KE 2Z5BA 1B63A 3PYFA 4NXME 1Z0EA 2CGEA 2BV3A 4JI2I 4DR4I 2Z5CB 1XMOI 2Z5CA 2A2DA 4JI5I 4LF6E 1Z5BA 2HHHI 1FWLA 5LMNE 3PYEA 2UXCI 2HKEA 5A2QC 2HK3A 3LPSA 1N33I 4WUCA 1FJGI 4LFBE 1D6TA 1VISA 3GONA 3ZM7A 1XMQI 3B8HA 4HACB 4LF5E 1N36I 2V2QA 4HACA 4DV1I 2V8PA 2F4VE 1J5EE 4NXNE 2UXBE 4KHPE 4YHHE 3QT7A 3V5RA 4X62E 5FWKA 4FWGA 4PRVA 4DV0I 2O1VA 5LMUI 4X64E 4DUZI 4JI0I 1Y4UA 3PYGA 4FN5A 3HULA 1MX0A 2CG9A 1PKPA 4JG4A 4AQYI 1N34I 4DU8A 4LFCI 4OX9I 2DEIA 4Z7CA 2X36A 2UUBI 1Z0WA 1N32I 1HNZE 2UU9I 4X65E 4B3ME 1FKAE 4JYAE 1S4EA 4B3TE 1DARA 2GS8A 1ZM2A 5A2QQ 1ZXNA 4DR7I 4JI3E 3ZKDA 3J80C 4DR2E 3B82A 1USUA 4HY1A 1IBLE 4JI1E 2VF3A 2NPFA 4DV6E 1HR0E 4MYUA 4DXLA 1FWKA 4IZJA 4GKKE 1RREA 2HFUA 4Z7YA 4JI8I 1ZM3A 4DV5I 4JI6E 2LJPA 4WUDA 4K0KI 2GQ0A 4NXMI 4DPYA 3Q6MA 1Z0TA 3WU3A 4N3OA 1A6FA 3F0NA 1UEKA 4LF6I 4X66E 2ZM6E 4P7AA 5LMNI 4XTJA 4USKA 2OI2A 4DUYE 4GKJE 4R1FA 1PVGA 2PNMA 4LF9E 1MG7A 4LFBI 1NHJA 4DPUA 4YY3E 4B3RE 1ZM9A 4DV3E 4LF5I 1XHKA 1H72C 4JV5E 1HNXE 2F4VI 1IBME 1J5EI 4NXNI 2VQEE 4IZJD 2IOQA 3ZZUA 4JI4E 2Q2EB 2UXBI 4KHPI 4YHHI 4X62I 3J80Q 3WU5A 1RR9A 1B62A 1IBKE 2UUCE 2J7KA 4X64I 4RPFA 4DR1I 3QT6A 4DPXA 2O1TA 4MYTA 3M6AA 3WU6A 4P52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUA E;  5LL6 R;  4B3S E;  1N0U A;  1Z0V A;  1ZM4 A;  1H74 A;  1HNZ I;  4X65 I;  4DR5 E;  4HXZ A;  4PU9 A;  4B3M I;  4JYA I;  4B3T I;  3QT5 A;  2E1R A;  4DV7 E;  2ZBK B;  4DV2 E;  2HK2 A;  5L3J A;  4JI3 I;  4DR2 I;  1Z59 A;  2R42 A;  4JI1 I;  3OTO E;  4DV6 I;  1HR0 I;  2HFS A;  3T1Y E;  3V2U C;  5BR8 E;  3J7A M;  4DR3 E;  2UXD E;  4FW9 A;  1Z0C A;  4GKK I;  2VQF E;  2E5L E;  1I94 E;  4ZVI A;  3QT8 A;  4LF7 E;  4JI6 I;  1Z0B A;  4HYM A;  2V2Z A;  1XNR E;  1Z0G A;  3B78 A;  3LTO A;  5FLX C;  4X66 I;  3ZKB A;  4ED4 A;  1K47 A;  4LF4 E;  4KQV A;  3LNU A;  2ZM6 I;  4DV4 E;  3Q1Q A;  4DUY I;  1MU5 A;  4GKJ I;  4LF8 E;  1XNQ E;  4LF9 I;  3J81 C;  3JAM C;  4YY3 I;  1KVK A;  4B3R I;  4DV3 I;  4DR6 E;  3CWV A;  4URL A;  4JV5 I;  1HNX I;  4M1K A;  1IBM I;  2A2C A;  2V2V A;  2VQE I;  4JI4 I;  1HNW E;  1KKH A;  2R3V A;  4LFA E;  4JI7 E;  3T1H E;  3K1J A;  5IWA E;  3ZZ0 A;  1WUU A;  5GMD A;  1IBK I;  2UUC I;  4JI2 E;  4DR4 E;  1XMO E;  5IT9 C;  4JI5 E;  2WW4 A;  1NHI A;  2UUA I;  1H73 A;  2HHH E;  4UTG A;  1N0V C;  1EA6 A;  4EMD A;  4WUB A;  4B3S I;  4DU7 A;  2UXC E;  4UT4 A;  1S16 A;  1N33 E;  1FJG E;  5FLX Q;  1ELO A;  1XMQ E;  4FWH A;  4DR5 I;  1EI1 A;  1N36 E;  4DV1 E;  1H7S A;  1KTV A;  4DV7 I;  4DV2 I;  4DPT A;  2BM1 A;  1ZXM A;  2X7I A;  1KIJ A;  3J81 Q;  5GME A;  3JAM Q;  4PRX A;  4DR1 E;  2AJ4 A;  1FNM A;  3OTO I;  3PYD A;  4DV0 E;  1U2R A;  3T1Y I;  3D4J A;  5BR8 I;  5LMU E;  2BM0 A;  4DUZ E;  4DR3 I;  1IBL I;  1BKN A;  4JI0 E;  2UXD I;  2VQF I;  2E5L I;  1I94 I;  3K17 A;  4LF7 I;  4AQY E;  1XNR I;  1N34 E;  2EFG A;  1NZ0 A;  1FI4 A;  4LFC E;  4OX9 E;  2CZ9 A;  1Z5A A;  3J7A G;  1OJ4 A;  2UUB E;  5IT9 Q;  1N32 E;  4DPW A;  1PIE A;  2UU9 E;  4LF4 I;  2DEJ A;  1Z5C A;  4DV4 I;  4LF8 I;  2XEX A;  4DR7 E;  1XNQ I;  4FWD A;  4USM A;  4DR6 I;  3H4L A;  2HKJ A;  1QZR A;  1H7U A;  3WU4 A;  1HNW I;  4LFA I;  3ZZT A;  3T1H I;  4JI8 E;  4JI7 I;  5IWA I;  2V34 A;  4DV5 E;  2ZIT A;  4I3H A;  1NHH A;  4K0K E;  1B63 A;  3PYF A;  4NXM E;  1Z0E A;  2BV3 A;  4JI2 I;  4DR4 I;  1XMO I;  2A2D A;  4JI5 I;  4LF6 E;  1Z5B A;  2HHH I;  1FWL A;  5LMN E;  3PYE A;  2UXC I;  2HKE A;  5A2Q C;  2HK3 A;  3LPS A;  1N33 I;  4WUC A;  1FJG I;  4LFB E;  1D6T A;  1VIS A;  3GON A;  3ZM7 A;  1XMQ I;  3B8H A;  4HAC B;  4LF5 E;  1N36 I;  2V2Q A;  4HAC A;  4DV1 I;  2V8P A;  2F4V E;  1J5E E;  4NXN E;  2UXB E;  4KHP E;  4YHH E;  3QT7 A;  3V5R A;  4X62 E;  4FWG A;  4PRV A;  4DV0 I;  5LMU I;  4X64 E;  4DUZ I;  4JI0 I;  3PYG A;  4FN5 A;  3HUL A;  1MX0 A;  1PKP A;  4JG4 A;  4AQY I;  1N34 I;  4DU8 A;  4LFC I;  4OX9 I;  2DEI A;  4Z7C A;  2X36 A;  2UUB I;  1Z0W A;  1N32 I;  1HNZ E;  2UU9 I;  4X65 E;  4B3M E;  1FKA E;  4JYA E;  1S4E A;  4B3T E;  1DAR A;  2GS8 A;  1ZM2 A;  5A2Q Q;  1ZXN A;  4DR7 I;  4JI3 E;  3ZKD A;  3J80 C;  4DR2 E;  3B82 A;  4HY1 A;  1IBL E;  4JI1 E;  2VF3 A;  2NPF A;  4DV6 E;  1HR0 E;  4MYU A;  4DXL A;  1FWK A;  4GKK E;  1RRE A;  2HFU A;  4Z7Y A;  4JI8 I;  1ZM3 A;  4DV5 I;  4JI6 E;  2LJP A;  4WUD A;  4K0K I;  4NXM I;  4DPY A;  1Z0T A;  3WU3 A;  1A6F A;  3F0N A;  1UEK A;  4LF6 I;  4X66 E;  2ZM6 E;  4P7A A;  5LMN I;  4XTJ A;  4USK A;  2OI2 A;  4DUY E;  4GKJ E;  4R1F A;  1PVG A;  4LF9 E;  1MG7 A;  4LFB I;  1NHJ A;  4DPU A;  4YY3 E;  4B3R E;  1ZM9 A;  4DV3 E;  4LF5 I;  1XHK A;  1H72 C;  4JV5 E;  1HNX E;  2F4V I;  1IBM E;  1J5E I;  4NXN I;  2VQE E;  3ZZU A;  4JI4 E;  2Q2E B;  2UXB I;  4KHP I;  4YHH I;  4X62 I;  3J80 Q;  3WU5 A;  1RR9 A;  1B62 A;  1IBK E;  2UUC E;  2J7K A;  4X64 I;  4RPF A;  4DR1 I;  3QT6 A;  4DPX A;  4MYT A;  3M6A A;  3WU6 A;  4P52 A; 
#chains in the Genus database with same CATH topology
 3NZK A;  2UUA E;  3PS3 A;  3PS2 A;  5LL6 R;  2BA0 G;  4B3S E;  3CDJ A;  2NN6 B;  4OO1 D;  4BA1 B;  1N0U A;  2BA0 D;  1YHC A;  1Z0V A;  1ZM4 A;  1H74 A;  1HNZ I;  4X65 I;  4DR5 E;  4HXZ A;  4PU9 A;  4B3M I;  3PS1 A;  4JYA I;  4B3T I;  4OO1 C;  3QT5 A;  2Z5E A;  2PO0 B;  2E1R A;  4DV7 E;  3P06 A;  2ZBK B;  4DV2 E;  2HK2 A;  5L3J A;  4JI3 I;  4BA2 B;  4DR2 I;  4BA2 A;  1Z59 A;  2R42 A;  4JI1 I;  4FW4 A;  3OTO E;  4DV6 I;  1HR0 I;  4OO1 E;  2HFS A;  3T1Y E;  3V2U C;  4IFD F;  4OZE A;  5BR8 E;  3J7A M;  4DR3 E;  2UXD E;  4FW9 A;  1Z0C A;  4LCF A;  4GKK I;  2VQF E;  2E5L E;  1I94 E;  1OYS A;  4ZVI A;  3P3G A;  3QT8 A;  4LF7 E;  1E3H A;  1Z0B A;  4GQU A;  5JEA E;  4HYM A;  4JI6 I;  2V2Z A;  1XNR E;  5C0X D;  1Z0G A;  3B78 A;  4IFD A;  2PO2 B;  2PO2 A;  3LTO A;  4FW3 A;  3P76 A;  5FLX C;  4X66 I;  3ZKB A;  4ED4 A;  1K47 A;  4LF4 E;  4KQV A;  3HKM A;  3LNU A;  2ZM6 I;  5C0X C;  4DV4 E;  3Q1Q A;  2PNL A;  2WP8 A;  4DUY I;  1MU5 A;  4GKJ I;  2C38 B;  4LF8 E;  1XNQ E;  4LF9 I;  3J81 C;  2C38 A;  2J65 A;  3JAM C;  4YY3 I;  5C0X E;  1KVK A;  4B3R I;  4DV3 I;  4DR6 E;  3CDI A;  3CWV A;  4URL A;  4JV5 I;  5EKW A;  1HNX I;  4M1K A;  1IBM I;  2A2C A;  2V2V A;  3L7Z A;  2VQE I;  3K85 A;  4JI4 I;  3Q6N A;  1HNW E;  4AIM A;  1KKH A;  2R3V A;  1Y4S A;  4LFA E;  1RHY A;  4JI7 E;  3T1H E;  3K1J A;  5IWA E;  3ZZ0 A;  1WUU A;  5GMD A;  1E3P A;  1IBK I;  2UUC I;  4MU4 A;  4IFD D;  4JI2 E;  2IOP A;  4DR4 E;  2JEB B;  4LCH A;  1XMO E;  5IT9 C;  2O1U A;  2JEB A;  4JI5 E;  2WW4 A;  5EL9 A;  4FW6 A;  1NHI A;  5JEA B;  2NN6 F;  1H73 A;  2UUA I;  1UDN A;  2HHH E;  4UTG A;  1N0V C;  1EA6 A;  4EMD A;  4WUB A;  4B3S I;  3H1C A;  1UDO A;  4DU7 A;  2UXC E;  4UT4 A;  4IFD C;  1S16 A;  1N33 E;  1FJG E;  5FLX Q;  1ELO A;  1XMQ E;  5K36 B;  4FWH A;  4DR5 I;  1EI1 A;  2NN6 A;  5K36 A;  4BA1 A;  1N36 E;  4DV1 E;  4LOM A;  1H7S A;  1KTV A;  4DV7 I;  5DRR A;  4DV2 I;  4DPT A;  2BM1 A;  1ZXM A;  2X7I A;  1USV A;  1KIJ A;  3J81 Q;  5GME A;  3JAM Q;  4PRX A;  4DR1 E;  2O3Z A;  2AJ4 A;  1FNM A;  4NBQ A;  3OTO I;  2O1W A;  2PO0 A;  3PYD A;  3HJC A;  4DV0 E;  1U2R A;  3T1Y I;  3D4J A;  4MU1 A;  2JT2 A;  5DNX A;  5BR8 I;  5LMU E;  2BM0 A;  4DUZ E;  4IZK B;  4DR3 I;  1IBL I;  1BKN A;  4JI0 E;  2UXD I;  4IZK A;  2VQF I;  5DRQ A;  2E5L I;  1I94 I;  3K17 A;  4LF7 I;  2GO3 A;  4AQY E;  1XNR I;  1N34 E;  5DRP A;  2EFG A;  1NZ0 A;  1FI4 A;  3GME A;  4LFC E;  4OX9 E;  2CZ9 A;  1Z5A A;  3J7A G;  1OJ4 A;  1UDQ A;  2UUB E;  5IT9 Q;  3PRY A;  1N32 E;  4DPW A;  1PIE A;  2UU9 E;  4LF4 I;  4LCG A;  2NN6 D;  2DEJ A;  1Y6Z A;  1Z5C A;  4DV4 I;  4IS9 A;  3GCM A;  4LF8 I;  2XEX A;  4DR7 E;  1XNQ I;  4FWD A;  4IZJ B;  3GLL A;  4USM A;  4DR6 I;  2NN6 C;  3H4L A;  1HK7 A;  2IER A;  2HKJ A;  1QZR A;  2WNR B;  1H7U A;  2WNR A;  3WU4 A;  1HNW I;  4J3D A;  4LFA I;  3ZZT A;  3T1H I;  4JI8 E;  4JI7 I;  5IWA I;  2V34 A;  4DV5 E;  2ZIT A;  4I3H A;  2Z5B B;  1NHH A;  4K0K E;  2Z5B A;  1B63 A;  3PYF A;  2BR2 B;  4NXM E;  1Z0E A;  2CGE A;  5JEA F;  1R6L A;  2BV3 A;  4JI2 I;  4DR4 I;  2Z5C B;  3P3E A;  1XMO I;  2Z5C A;  2A2D A;  4OO1 B;  4JI5 I;  4AID A;  4OO1 A;  4LF6 E;  1Z5B A;  3U1K A;  2HHH I;  3B4T A;  4LPF A;  1FWL A;  5LMN E;  1OYP A;  4QNJ A;  3PYE A;  2UXC I;  2HKE A;  5A2Q C;  2HK3 A;  5K36 F;  3LPS A;  5JEA A;  1N33 I;  4WUC A;  1FJG I;  4LFB E;  1D6T A;  1VIS A;  3GON A;  3ZM7 A;  1XMQ I;  3B8H A;  3U1Y A;  4HAC B;  4LF5 E;  1N36 I;  2V2Q A;  4HAC A;  4DV1 I;  2V8P A;  2F4V E;  2C37 B;  1J5E E;  4NXN E;  2C37 A;  2UXB E;  4KHP E;  4YHH E;  3QT7 A;  3V5R A;  4IFD E;  4X62 E;  5DNL A;  5FWK A;  4FWG A;  2BA1 G;  4PRV A;  4DV0 I;  2O1V A;  3UHM A;  5LMU I;  4X64 E;  2PO1 B;  5C0X B;  4DUZ I;  4JI0 I;  1Y4U A;  2PO1 A;  3PYG A;  5C0X A;  4FN5 A;  2BA1 D;  3HUL A;  1MX0 A;  2CG9 A;  1PKP A;  4JG4 A;  4AQY I;  1N34 I;  4ISA A;  5DRO A;  2PNZ B;  4DU8 A;  4LFC I;  4OX9 I;  2DEI A;  2PNZ A;  4Z7C A;  5JEA D;  2X36 A;  2UUB I;  2C39 B;  1Z0W A;  1N32 I;  2C39 A;  1HNZ E;  2UU9 I;  4X65 E;  4B3M E;  1FKA E;  4JYA E;  1S4E A;  4B3T E;  1DAR A;  2JEA B;  2GS8 A;  1ZM2 A;  4QNK A;  5JEA C;  5A2Q Q;  4AM3 A;  2JEA A;  1ZXN A;  4DR7 I;  4JI3 E;  5K36 D;  3ZKD A;  3J80 C;  4MDT A;  3B82 A;  1USU A;  4DR2 E;  1VI7 A;  4HY1 A;  1IBL E;  4JI1 E;  1YH8 A;  2VF3 A;  2JE6 B;  2NPF A;  4DV6 E;  1HR0 E;  4MYU A;  2JE6 A;  4DXL A;  1FWK A;  4FW5 A;  4IZJ A;  4MU3 A;  4U3D A;  4GKK E;  5K36 C;  1RRE A;  2HFU A;  4IFD B;  4Z7Y A;  4JI8 I;  1ZM3 A;  4DV5 I;  4JI6 E;  2LJP A;  4WUD A;  4K0K I;  4OO1 F;  2GQ0 A;  4NXM I;  4DPY A;  3Q6M A;  1Z0T A;  2NN6 E;  5K36 E;  5ELW A;  3WU3 A;  4N3O A;  1A6F A;  4MU0 A;  3F0N A;  2WP8 B;  1UEK A;  2IES A;  4X66 E;  4LF6 I;  2AE8 A;  2BR2 A;  1UDS A;  4FW7 A;  2ZM6 E;  4P7A A;  5LMN I;  2GO4 A;  4XTJ A;  4USK A;  2OI2 A;  1Y5Y A;  4DUY E;  4GKJ E;  4R1F A;  1PVG A;  2PNM A;  4LF9 E;  3L7Z B;  1MG7 A;  3M7N G;  4LFB I;  1NHJ A;  4DPU A;  4YY3 E;  4B3R E;  1ZM9 A;  4DV3 E;  4LF5 I;  1XHK A;  1H72 C;  4JV5 E;  1HNX E;  2F4V I;  1R6M A;  3M7N D;  1IBM E;  1J5E I;  4NXN I;  2VQE E;  4U3B A;  4IZJ D;  2IOQ A;  4MQY A;  3ZZU A;  4JI4 E;  2Q2E B;  2UXB I;  4KHP I;  4YHH I;  4X62 I;  2CVE A;  3J80 Q;  5C0X F;  1OYR A;  3KRN A;  3M85 G;  3WU5 A;  1Y60 A;  1RR9 A;  1B62 A;  1IBK E;  3DD6 A;  2UUC E;  2J7K A;  2VES A;  4X64 I;  1XXE A;  1P42 A;  2F1D A;  3P3C A;  4RPF A;  4DR1 I;  3QT6 A;  3M85 D;  4OKG A;  4DPX A;  2O1T A;  4MYT A;  3M6A A;  3WU6 A;  4P52 A; 
#chains in the Genus database with same CATH homology
 2UUA E;  5LL6 R;  4B3S E;  1N0U A;  1Z0V A;  1ZM4 A;  1H74 A;  1HNZ I;  4X65 I;  4DR5 E;  4HXZ A;  4PU9 A;  4B3M I;  4JYA I;  4B3T I;  3QT5 A;  2Z5E A;  2E1R A;  4DV7 E;  3P06 A;  2ZBK B;  4DV2 E;  2HK2 A;  5L3J A;  4JI3 I;  4DR2 I;  1Z59 A;  2R42 A;  4JI1 I;  3OTO E;  4DV6 I;  1HR0 I;  2HFS A;  3T1Y E;  3V2U C;  5BR8 E;  3J7A M;  4DR3 E;  2UXD E;  4FW9 A;  1Z0C A;  4GKK I;  2VQF E;  2E5L E;  1I94 E;  4ZVI A;  3QT8 A;  4LF7 E;  4JI6 I;  1Z0B A;  4HYM A;  2V2Z A;  1XNR E;  1Z0G A;  3B78 A;  3LTO A;  5FLX C;  4X66 I;  3ZKB A;  4ED4 A;  1K47 A;  4LF4 E;  4KQV A;  3LNU A;  2ZM6 I;  4DV4 E;  3Q1Q A;  2PNL A;  4DUY I;  1MU5 A;  4GKJ I;  4LF8 E;  1XNQ E;  4LF9 I;  3J81 C;  3JAM C;  4YY3 I;  1KVK A;  4B3R I;  4DV3 I;  4DR6 E;  3CWV A;  4URL A;  4JV5 I;  1HNX I;  4M1K A;  1IBM I;  2A2C A;  2V2V A;  2VQE I;  3K85 A;  4JI4 I;  3Q6N A;  1HNW E;  1KKH A;  2R3V A;  1Y4S A;  4LFA E;  4JI7 E;  3T1H E;  3K1J A;  5IWA E;  3ZZ0 A;  1WUU A;  5GMD A;  1IBK I;  2UUC I;  4JI2 E;  2IOP A;  4DR4 E;  1XMO E;  5IT9 C;  2O1U A;  4JI5 E;  2WW4 A;  1NHI A;  2UUA I;  1H73 A;  2HHH E;  4UTG A;  1N0V C;  1EA6 A;  4EMD A;  4WUB A;  4B3S I;  4DU7 A;  2UXC E;  4UT4 A;  1S16 A;  1N33 E;  1FJG E;  5FLX Q;  1ELO A;  1XMQ E;  4FWH A;  4DR5 I;  1EI1 A;  1N36 E;  4DV1 E;  1H7S A;  1KTV A;  4DV7 I;  4DV2 I;  4DPT A;  2BM1 A;  1ZXM A;  2X7I A;  1USV A;  1KIJ A;  3J81 Q;  5GME A;  3JAM Q;  4PRX A;  4DR1 E;  2AJ4 A;  1FNM A;  3OTO I;  2O1W A;  3PYD A;  3HJC A;  4DV0 E;  1U2R A;  3T1Y I;  3D4J A;  5BR8 I;  5LMU E;  2BM0 A;  4DUZ E;  4IZK B;  4DR3 I;  1IBL I;  1BKN A;  4JI0 E;  2UXD I;  4IZK A;  2VQF I;  2E5L I;  1I94 I;  3K17 A;  4LF7 I;  4AQY E;  1XNR I;  1N34 E;  2EFG A;  1NZ0 A;  1FI4 A;  4LFC E;  4OX9 E;  2CZ9 A;  1Z5A A;  3J7A G;  1OJ4 A;  2UUB E;  5IT9 Q;  3PRY A;  1N32 E;  4DPW A;  1PIE A;  2UU9 E;  4LF4 I;  2DEJ A;  1Y6Z A;  1Z5C A;  4DV4 I;  4LF8 I;  2XEX A;  4DR7 E;  1XNQ I;  4FWD A;  4IZJ B;  4USM A;  4DR6 I;  3H4L A;  1HK7 A;  2HKJ A;  1QZR A;  1H7U A;  3WU4 A;  1HNW I;  4LFA I;  3ZZT A;  3T1H I;  4JI8 E;  4JI7 I;  5IWA I;  2V34 A;  4DV5 E;  2ZIT A;  4I3H A;  2Z5B B;  1NHH A;  4K0K E;  2Z5B A;  1B63 A;  3PYF A;  4NXM E;  1Z0E A;  2CGE A;  2BV3 A;  4JI2 I;  4DR4 I;  2Z5C B;  1XMO I;  2Z5C A;  2A2D A;  4JI5 I;  4LF6 E;  1Z5B A;  2HHH I;  1FWL A;  5LMN E;  3PYE A;  2UXC I;  2HKE A;  5A2Q C;  2HK3 A;  3LPS A;  1N33 I;  4WUC A;  1FJG I;  4LFB E;  1D6T A;  1VIS A;  3GON A;  3ZM7 A;  1XMQ I;  3B8H A;  4HAC B;  4LF5 E;  1N36 I;  2V2Q A;  4HAC A;  4DV1 I;  2V8P A;  2F4V E;  1J5E E;  4NXN E;  2UXB E;  4KHP E;  4YHH E;  3QT7 A;  3V5R A;  4X62 E;  5FWK A;  4FWG A;  4PRV A;  4DV0 I;  2O1V A;  5LMU I;  4X64 E;  4DUZ I;  4JI0 I;  1Y4U A;  3PYG A;  4FN5 A;  3HUL A;  1MX0 A;  2CG9 A;  1PKP A;  4JG4 A;  4AQY I;  1N34 I;  4DU8 A;  4LFC I;  4OX9 I;  2DEI A;  4Z7C A;  2X36 A;  2UUB I;  1Z0W A;  1N32 I;  1HNZ E;  2UU9 I;  4X65 E;  4B3M E;  1FKA E;  4JYA E;  1S4E A;  4B3T E;  1DAR A;  2GS8 A;  1ZM2 A;  5A2Q Q;  1ZXN A;  4DR7 I;  4JI3 E;  3ZKD A;  3J80 C;  4DR2 E;  3B82 A;  1USU A;  4HY1 A;  1IBL E;  4JI1 E;  2VF3 A;  2NPF A;  4DV6 E;  1HR0 E;  4MYU A;  4DXL A;  1FWK A;  4IZJ A;  4GKK E;  1RRE A;  2HFU A;  4Z7Y A;  4JI8 I;  1ZM3 A;  4DV5 I;  4JI6 E;  2LJP A;  4WUD A;  4K0K I;  2GQ0 A;  4NXM I;  4DPY A;  3Q6M A;  1Z0T A;  3WU3 A;  4N3O A;  1A6F A;  3F0N A;  1UEK A;  4LF6 I;  4X66 E;  2ZM6 E;  4P7A A;  5LMN I;  4XTJ A;  4USK A;  2OI2 A;  4DUY E;  4GKJ E;  4R1F A;  1PVG A;  2PNM A;  4LF9 E;  1MG7 A;  4LFB I;  1NHJ A;  4DPU A;  4YY3 E;  4B3R E;  1ZM9 A;  4DV3 E;  4LF5 I;  1XHK A;  1H72 C;  4JV5 E;  1HNX E;  2F4V I;  1IBM E;  1J5E I;  4NXN I;  2VQE E;  4IZJ D;  2IOQ A;  3ZZU A;  4JI4 E;  2Q2E B;  2UXB I;  4KHP I;  4YHH I;  4X62 I;  3J80 Q;  3WU5 A;  1RR9 A;  1B62 A;  1IBK E;  2UUC E;  2J7K A;  4X64 I;  4RPF A;  4DR1 I;  3QT6 A;  4DPX A;  2O1T A;  4MYT A;  3M6A A;  3WU6 A;  4P52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...