4X64E

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4x64E01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x64E02
5A2QC 1VISA 2WW4A 4YHHI 4B3RE 4NXNI 2E1RA 1YYKA 3ZZUA 4HACA 2L2NA 2A2CA 4WYQB 3LTOA 4DU7A 3LLHA 5LL6R 1K47A 1ZM4A 2J7KA 3J81C 2DIXA 1QZRA 3QT5A 4JI2E 2F4VE 1IBMI 4DXLA 4MYUA 1N32E 1HNZE 1HR0E 1MG7A 4DUYE 1XNQE 1A6FA 4GKKI 1NHHA 3PYEA 5BR8I 1Z0WA 1H72C 5LMNI 4FWDA 4B3TE 1RQ0A 4DR7I 4DV6E 1EA6A 1T4LB 4KQVA 1FI4A 4DR6I 4FN5A 1N33I 4DPXA 4DPYA 4LF8I 4DPWA 2E5LE 2MDRA 3HULA 1U2RA 1ZBTA 2ZBKB 5IT9C 1J5EE 1ZM3A 1WUUA 1Z0CA 3OTOI 1S4EA 4OX9I 1FWKA 3J7AG 4DV7I 3T1YE 1EKZA 2L2KB 1N36E 1Z5CA 4JYAI 1N34E 4JI1E 4JV5I 2LTRA 2NUFA 3GONA 4DPUA 1D6TA 2V2ZA 4DR3E 3B78A 3V5RA 2DMYA 2UUCE 4LFBE 2NA2A 4JI7E 2LRSA 2RSMA 4X8WA 3LNUA 3F0NA 4PU9A 4LF4I 3VYYA 4Z7YA 4NXMI 4JI6E 3Q1QA 3T1HI 4AQYE 2UXDE 3WU5A 5LMUI 4DV4I 1T4OA 4FWHA 2HHHI 4YY3E 3ZKDA 4X64I 4DPTA 4MYTA 1B63A 4DR1E 1ZXMA 4JI8E 2NUGA 5IWAE 1MU5A 4JI3E 2AJ4A 4X62I 4DV0I 1HNXI 2UXCE 4X66E 1FJGE 1XNRE 4DV2E 2EFGA 2ZITA 4K0KE 1B62A 4LF5E 2NUEA 2R42A 4EMDA 3J7AM 1IBLI 1Z5BA 3QT7A 4GKJE 1N32I 1WHNA 2LTSA 4DV5E 2LBSB 2LUPB 4DUYI 4JI0E 1XMQE 2HFUA 2UUBE 4LF7I 2X36A 4XTJA 2GS8A 1HNWE 3PYGA 3C4BA 1H7UA 4LF9I 2RS7A 4DR2I 4X65I 2HKEA 2VQFE 4DV1E 4ED4A 3ADLA 4B3ME 4P52A 4JI5E 2UU9I 4LFCE 4DR5E 4KHPI 1KVKA 2UUAE 4UTGA 4DUZE 1Z0BA 4WUDA 1RREA 4YHHE 3PYDA 4R1FA 1X48A 3QT6A 4NXNE 2N3GA 4B3SI 4M2ZA 1Z0VA 2JY9A 4OOGC 2XEXA 1I94I 5FLXQ 4DV3I 3ZZ0A 2L33A 3ADGA 1FNMA 1N34I 2LJHA 1X47A 4JI4I 2IHR1 2LUQA 1IBME 1PVGA 2V34A 1MX0A 1YZ9A 2HKJA 3VYXA 4JI7I 4GKKE 1OJ4A 5BR8E 5LMNE 3ADJA 2UXBI 4DR7E 3ADIA 5L3JA 1XMOI 1BKNA 1UILA 3M6AA 3WU4A 4FWGA 1YYOA 3K17A 4DR6E 1N33E 1IBKI 4LF6E 4LF8E 3PYFA 4DU8A 1H7SA 3C4TA 4JI3I 2BM1A 4UT4A 2N3HA 3OTOE 2OI2A 3LPSA 4LFAE 3WU6A 2JVAA 4OX9E 2VQEI 1XNRI 4DV2I 1H73A 2V2VA 4JYAE 1EI1A 3J80Q 4B3RI 4JV5E 3B8HA 2CPNA 1Z0EA 1GQEA 2DB2A 2X7IA 2NPFA 2YT4A 4HXZA 2DEIA 1Z59A 4DR4E 2RTXA 4JI2I 2F4VI 3P1XA 4LF4E 2ZM6E 4FW9A 4NXME 1HNZI 1HR0I 1XNQI 5GMEA 4WFTA 1KTVA 1NHIA 1FKAE 4ZVIA 1N0UA 1PKPA 3HTXA 4B3TI 2HHHE 1RR9A 4I3HA 4X64E 4DV6I 3JAMQ 5GMDA 1J26A 4HACB 1RC7A 5A2QQ 2Q2EB 4HY1A 1T4NA 4X62E 1ELOA 4DV0E 1HNXE 5CFFE 2KHXA 2E5LI 1ZM2A 2B7VA 1YYWA 3J81Q 5FLXC 1J5EI 1IBLE 2VF3A 3H4LA 2R3VA 1ZXNA 3T1YI 1S16A 2L2MA 2CZ9A 1N36I 3K1JA 4JI1I 1PIEA 4M1KA 4LF7E 2B7TA 1KKHA 4LF9E 4DR3I 1DARA 4DR2E 3ZKBA 4X65E 1Z5AA 4DKKA 2UUCI 4LFBI 1WHQA 2V8PA 4JG4A 4LF6I 4Z7CA 2UU9E 1DI2A 2HK3A 4KHPE 3J7Yp 4PRVA 2HK2A 2B3TB 4JI6I 3WU3A 2RS6A 4AQYI 2UXDI 1NZ0A 2L3JA 4B3SE 4LFAI 1FWLA 1I94E 4DV3E 5IT9Q 4YY3I 2BM0A 1UEKA 3B82A 4DR1I 2L3CA 2BV3A 4JI4E 4JI8I 5IWAI 4WUCA 1STUA 2LJPA 2DEJA 1KIJA 2UXCI 4USMA 4X66I 1Z0GA 3J80C 1FJGI 4DV7E 4DR4I 1NHJA 4K0KI 4HYMA 4URLA 4PRXA 4LF5I 2UXBE 2ZM6I 4GKJI 1QU6A 4DV5I 2HFSA 1XMOE 4JI0I 1X49A 1XMQI 4P7AA 4USKA 3ZM7A 3QT8A 2UUBI 1HNWI 3CWVA 1IBKE 4M30A 3D4JA 3ZZTA 1XHKA 1N0VC 2V2QA 2VQFI 4DV1I 2A2DA 4B3MI 3T1HE 4RPFA 1O0WA 5LMUE 1UHZA 4DV4E 3JAMC 4JI5I 4LFCI 4DR5I 2UUAI 1H74A 1ZM9A 3V2UC 1Z0TA 2EZ6A 4WUBA 4DUZI 2VQEE
chains in the Genus database with same CATH superfamily
5A2QC 4IFDB 1VISA 1HK7A 2EMLA 2WW4A 4YHHI 4RH8A 2YTOA 5AC5A 2J65A 4FW6A 3OMLA 4R2CA 4B3RE 4NXNI 2E1RA 1YFHA 2GQ0A 2EOHA 1YYKA 2WZOA 3UHMA 3ZZUA 4HACA 2L2NA 2A2CA 4WYQB 3LTOA 5AASA 4DU7A 5JEAD 3LLHA 5LL6R 4IZJB 5DNLA 1K47A 5A6KA 1ZM4A 2J7KA 2VF1A 3HPSA 1OYSA 5K36C 2LE2A 3J81C 2NN6A 2DIXA 1QZRA 3GCMA 3JTZA 4GZNC 2I13A 3QT5A 1WJPA 5DRRA 2O1TA 4F9CB 5JEAA 4JI2E 4Q35B 3KWRA 2BR2B 4IZKB 2F4VE 3K85A 1IBMI 4AM3A 4R8OA 4DXLA 4MYUA 4NZVA 1N32E 2EMXA 4R2EA 1Y4UA 4L5NC 1X6HA 4IS1C 1HNZE 2JEBB 1HR0E 3HQ1A 1MG7A 4DUYE 4MU3A 1XNQE 2WBTA 1A6FA 4NBQA 1YHCA 4GKKI 1NHHA 3PYEA 5BR8I 1Z0WA 1H72C 5LMNI 4FWDA 5ELWA 2MC5A 4B3TE 1WXRA 1RQ0A 4DR7I 4DV6E 1YUIA 5C0XC 1EA6A 1A1IA 1EH6A 2RQLA 3ZOQB 1T4LB 3M7ND 1AH5A 2EN4A 1A1KA 4KQVA 4BBYA 2K4VA 1FI4A 1P47A 1NEIA 4FN5A 4DR6I 1N33I 2FTXB 4LU9A 2CT1A 4DPXA 4DPYA 4LF8I 2PNMA 4DPWA 2E5LE 2MDRA 2IESA 3HULA 2YRHA 1U2RA 1ZBTA 4LPFA 2E1MA 2ZBKB 1JK2A 4U3DA 2M1SA 5IT9C 1J5EE 4R2QA 1ZM3A 4BA2B 1WUUA 4P7DA 1Z0CA 1XXEA 3OTOI 2BA1D 4F2JC 1S4EA 2ODRC 4OX9I 4OO1D 1FWKA 3J7AG 4DV7I 3T1YE 2EZ6A 2PO2A 3C6KA 1EKZA 4J8ZA 2L2KB 3RMPA 1N36E 1Z5CA 2C39A 1N34E 2WNRA 2C38A 3B4TA 3L7ZB 4JI1E 3C6MA 3P3CA 1E3HA 4JV5I 2LTRA 4BA1B 2C37A 1YPNA 4OO1A 2NUFA 2EP3A 4BHBA 3GONA 2BBGA 4DPUA 1D6TA 3JU0A 4FW4A 2YRKA 2LJUA 2DMIA 2V2ZA 4DR3E 2WCC3 4NHRA 3KRNA 3B78A 3V5RA 2DMYA 5K36B 2Z5BA 2UUCE 2WP8A 4LFBE 2NA2A 2EPXA 4JI7E 3MSWA 1SFEA 2EM2A 2EPZA 2LRSA 2RSMA 4WPYA 3KZZA 4X8WA 3F0NA 5EKWA 1P42A 4LCFA 4PU9A 1EH8A 2NN6C 1UDQA 3EPHA 2JP9A 1UN6B 4LF4I 1Y6ZA 3VYYA 2L6MA 3BGHA 4Z7YA 4NXMI 3HPZA 4Q28A 4JI6E 3Q1QA 1KJKA 3T1HI 2V85A 4AQYE 2EN7A 4KWYA 2UXDE 3WU5A 2EOFA 5LMUI 2EM6A 4DV4I 2EOQA 1T4OA 2KOUA 4OKGA 4MQYA 4FWHA 5K36F 1JK1A 3VK6A 2VRDA 2HHHI 4YY3E 3ZKDA 4X64I 5TSEA 1A1LA 1IQOA 4DPTA 4MYTA 1B63A 4DR1E 2ENCA 1ZXMA 5T6JA 4JI8E 2L92A 2NUGA 1L4SA 2IOPA 5IWAE 4IFDD 1MU5A 2ENAA 4JI3E 4LOMA 3AV0A 2JWOA 2DRPA 3CDJA 2AJ4A 2PNLA 3U1YA 4X62I 5KL3A 4DV0I 1HNXI 2CVEA 2EOSA 2UXCE 1BBOA 4X66E 2EOIA 4MLQA 3EPLA 2ENHA 1FJGE 4HEIA 1XNRE 4DV2E 2EFGA 2ZITA 3IWDA 1B69A 4K0KE 3Q6NA 4IFDA 4IZJD 1B62A 3BF2A 2EOMA 4MLVA 2EWLA 4O24A 4LF5E 2NUEA 2R42A 3H1CA 4EMDA 1Z5BA 1IBLI 3J7AM 3QT7A 5EL9A 4GKJE 1N32I 4OZEA 2LT7A 1WHNA 2EQ3A 2LTSA 1X6FA 3MHHC 4DV5E 2LBSB 2EPNA 2LUPB 5A6JA 4DUYI 4JI0E 2DLKA 3F6HA 1XMQE 2HFUA 5A6AA 2EN8A 2JYAA 4IZJA 4GQUA 2UUBE 2EL6A 4LF7I 2EOZA 1A1GA 2EMCA 2X36A 4XTJA 2GS8A 1HNWE 3PYGA 3C4BA 2EPMX 1H7UA 2Z5CB 4BMJA 4LF9I 4ZYGA 2BA0G 4IZKA 5K36E 2BR2A 2AE8A 2RS7A 5ADZA 4ISAA 4N3OA 4DR2I 4OO1C 2WBUA 1BB8A 2VQFE 4DV1E 2GO3A 2HKEA 4QNJA 4X65I 4ED4A 3ADLA 2JEAB 2LO3A 2GHFA 4B3ME 2JEBA 3BIDA 4P52A 1G2FC 4HTGA 1TN9A 2CGEA 4JI5E 2HGHA 4LFCE 3HKMA 2UU9I 4DR5E 1E3PA 4KHPI 1KVKA 2UUAE 1T39A 2PNZB 1GZ6A 4F9AB 4UTGA 2JT2A 2DLQA 2EOXA 4DUZE 1Z0BA 4WUDA 1RREA 2EOJA 5A69A 4YHHE 4BC9A 2RSIA 3PYDA 2D9HA 2YRMA 2CSHA 1RHYA 2DSYA 2EPOA 2YPNA 4R1FA 2EM7A 2RPCA 1X48A 1G2DC 3QT6A 5DRQA 2WBSA 4NXNE 4QNKA 2N3GA 4B3SI 5IXMB 4M2ZA 2EN3A 1Z0VA 2JY9A 2V8QB 4OOGC 2XEXA 2A25A 2GPIA 5FLXQ 4DV3I 1I94I 1WRJA 3AUZA 3U1KA 3ZZ0A 3L00A 4ZYDA 2L33A 3ADGA 1FNMA 1N34I 4R2PA 3IWBA 2LJHA 1X47A 4BS9A 4JI4I 2IHR1 1UDOA 2LUQA 1IBME 1PVGA 2V34A 2YTQA 2PO0B 2YTGA 2M4IA 1YZ9A 1MX0A 3M85G 2HKJA 2O1UA 4BA2A 3VYXA 2N8XA 2EMAA 4JI7I 4GKKE 2YSPA 3MHSC 1USUA 5DRPA 1OJ4A 5BR8E 4O5GA 1X5WA 2EPAA 3PRYA 5LMNE 5AC4A 3ADJA 5IV8B 1MEYC 3L7ZA 1A1JA 2UXBI 1USVA 2EMBA 1DGCA 5K36D 1UBDC 1UDNA 4IFDC 4BA1A 4DR7E 2EL5A 2H36X 2JXPA 4N4RB 3ADIA 5L3JA 1ZR9A 1XMOI 1BKNA 1UILA 4ZYHA 3M6AA 2EORA 2B9DA 3WU4A 1PDAA 4LTYA 5K36A 5KL4A 4FWGA 1YYOA 3K17A 4DR6E 1N33E 2EMWA 1ZBQA 4BC7A 1IBKI 1Y4SA 4LF6E 2WNRB 4LF8E 2C38B 2O1WA 1F2IG 3CDIA 4RHBB 4BCAA 4IJDA 5JEAC 3PYFA 4DU8A 1H7SA 2YTJA 2R1FA 2EN1A 3C4TA 3VHTB 4F6MA 2EPCA 2NN6E 4FW3A 2BM1A 2EOOA 1N36I 4JI3I 3LMLA 4J3DA 4UT4A 4LCGA 2N3HA 3OTOE 2OI2A 3LPSA 4LFAE 3WU6A 2I9IA 2JVAA 4OX9E 2L8TA 2YSOA 2JPAA 3GLLA 2VQEI 1XNRI 4DV2I 1H73A 2Z5EA 4O43A 2V87A 2KONA 2V2VA 2GLIA 1A1HA 4R2RA 4JYAE 2IOQA 5C0XB 1EI1A 3J80Q 4B3RI 2JE6A 4JV5E 3B8HA 2CPNA 3H09A 1YH8A 1Z0EA 1GQEA 1A1FA 2DB2A 2X7IA 2NPFA 5DNXA 4MDTA 2YT4A 4WSGA 4HXZA 3Q6MA 2DEIA 5AE3A 2EM9A 2PO1B 1Z59A 2PRTA 2EM4A 4DR4E 2YTPA 2RTXA 2FV4B 5KL6A 4JI2I 1LLMC 2F4VI 2EQ0A 3P1XA 2EPLX 5C0XF 3PS3A 2JEAA 4LF4E 2F8BA 2ZM6E 2YTIA 3PS1A 2YTDA 4FK5C 4FW9A 2BB8A 4NXME 2EOEA 1HNZI 2ADRA 1HR0I 4BHCA 2BA0D 1XNQI 5GMEA 5DROA 4ZYEA 4WFTA 2LV2A 1KTVA 1NHIA 1FKAE 4ZVIA 3DD6A 1N0UA 2EMGA 1PKPA 2EM0A 3HTXA 2V83A 2HHHE 4MU1A 4B3TI 4JYAI 1RR9A 4I3HA 4X64E 1Y60A 3JAMQ 4DV6I 4DMIA 2Z5CA 1Z1BA 5GMDA 3LNUA 1J26A 2NN6D 3F6GA 1T38A 4HACB 1RC7A 5A2QQ 2HJJA 3K6QA 1R6LA 2Q2EB 2ELYA 3THNA 4FW5A 2EJ4A 3BBGA 4HY1A 1T4NA 3GMEA 4X62E 1ELOA 2NN6B 4R2AA 5LLQA 4OO1E 2Q8UA 3KZYA 5AE1A 2YTFA 4DV0E 1HNXE 1Y5YA 2EE8A 5CFFE 2KHXA 4U3BA 2E5LI 2EPUA 1ZM2A 2PNZA 2B7VA 5JEAB 2EM5A 1R6MA 1YYWA 3J81Q 5FLXC 1J5EI 2MKNA 1IBLE 2EMKA 2VF3A 3H4LA 2R3VA 2YU8A 1ZXNA 2YU5A 2V86A 1SR9A 3M99B 1IQSA 2ELZA 2DGCA 5C0XE 3T1YI 2G7HA 3EPJA 2EM8A 1PJSA 1S16A 2L2MA 2LVHA 1N3GA 2CZ9A 2VESA 3HJCA 3K1JA 2EL4A 3EQ1A 2NN6F 2YTEA 4FW7A 4JI1I 4AIMA 1PIEA 3M85D 1X3CA 2R76A 4LF7E 4M1KA 2B7TA 4WSPA 2CTDA 1KKHA 2MDGA 2FGGA 5KL7A 3P06A 5JEAF 2M7QA 5AE2A 4LF9E 2EMHA 3NZKA 3DJWA 4DR3I 1DARA 4DR2E 3ZKBA 3FIGA 2MC6A 4X65E 1Z5AA 4F54A 2J7JA 4DKKA 2PO0A 2UUCI 4M0VA 4LFBI 2EOYA 4TUIA 1WHQA 5F3WA 1GTKA 2F1DA 4GEQB 2V8PA 4JG4A 3EPKA 4LF6I 4R2DA 3DF6A 4Z7CA 2UU9E 1DI2A 3HXLA 2HK3A 4KHPE 3J7Yp 5KL5A 4PRVA 2EM3A 4X9JA 4F9BB 1ZU1A 3M7NG 2HK2A 3PS2A 2B3TB 2O1VA 1TF6A 3WU3A 4JI6I 4IFDF 2RS6A 3TQMA 4AQYI 1YUJA 1DQ3A 2EPPA 4WXDA 2UXDI 4KZSA 1NZ0A 2L3JA 4B3SE 1TF3A 4LFAI 4IFDE 4AIDA 1FWLA 2PO2B 1I94E 4DV3E 5IT9Q 2NABA 4YY3I 4O4KA 2C39B 2BM0A 4P78A 2MKDA 1EH7A 2EMYA 1UEKA 3B82A 5KL2A 1IMUA 4DR1I 2C37B 2LCEA 2L3CA 2BV3A 4OO1B 4JI4E 2HC5A 2BA1G 4TUGA 4JI8I 5IWAI 4WUCA 1STUA 1BBGA 1PJQA 2LJPA 2EN2A 2EPRA 2CG9A 5C0XD 2JOXA 2DEJA 2Z5BB 2WP8B 5JEAE 1KIJA 2UXCI 4USMA 4X66I 1Z0GA 5A6BD 3J80C 1FJGI 3UK3C 2M9AA 4DV7E 1KYQA 2V89A 4DR4I 1NHJA 1OYPA 3IWCA 2YTNA 4HYMA 4URLA 4LCHA 4PRXA 4K0KI 4LF5I 1RMDA 5C0XA 2UXBE 2IERA 2ZM6I 2VE7C 4GKJI 2EMZA 2YZTA 4OO1F 1QU6A 3P3EA 4DV5I 2EPKX 5A6BA 4I8OA 2HFSA 1MGTA 3P3GA 1XMOE 2JR1A 4JI0I 1X49A 4WX9A 1XMQI 1PJTA 4MU0A 4P7AA 4USKA 1OYRA 2EQ1A 3ZM7A 3QT8A 2UUBI 1QNTA 1NCSA 2PO1A 1HNWI 2ODRD 3QG5C 3THOB 3CWVA 2O3ZA 4MU4A 1IBKE 4L8NA 5DNYA 4WXCA 4M30A 1UDSA 3D4JA 2JE6B 2K7IA 3ZZTA 1XHKA 1N0VC 2GO4A 2V2QA 1AAYA 2VQFI 4DV1I 4M9VC 4R2SA 2A2DA 5FWKA 3P76A 1ZAAC 4B3MI 4F6NA 4R03A 1YSAC 3T1HE 3ECRA 2E72A 4RPFA 1X6EA 2LMZA 1O0WA 2V88A 5LMUE 1UHZA 4DV4E 2EMFA 3JAMC 1VI7A 4LFCI 2EN6A 4IS9A 4DR5I 4JI5I 2YWQA 2UUAI 1H74A 1ZM9A 3V2UC 1Z0TA 2EMIA 2JOBA 4WUBA 4DUZI 2VQEE
chains in the Genus database with same CATH topology
5A2QC 1VISA 1HK7A 2WW4A 4YHHI 3OMLA 4B3RE 4NXNI 2E1RA 2GQ0A 1YYKA 2WZOA 3ZZUA 4HACA 2L2NA 2A2CA 4WYQB 3LTOA 5AASA 4DU7A 3LLHA 5LL6R 4IZJB 1K47A 1ZM4A 2J7KA 2VF1A 3HPSA 2LE2A 3J81C 2DIXA 1QZRA 3JTZA 3QT5A 2O1TA 4F9CB 4JI2E 4IZKB 3KWRA 2F4VE 3K85A 1IBMI 4R8OA 4DXLA 4MYUA 1N32E 1Y4UA 4L5NC 1HNZE 1HR0E 3HQ1A 1MG7A 4DUYE 1XNQE 1A6FA 4GKKI 1NHHA 3PYEA 5BR8I 1Z0WA 1H72C 5LMNI 4FWDA 2MC5A 4B3TE 1WXRA 1RQ0A 4DR7I 4DV6E 1EA6A 3ZOQB 1T4LB 4KQVA 4BBYA 2K4VA 1FI4A 4DR6I 4FN5A 1N33I 2FTXB 4LU9A 4DPXA 4DPYA 4LF8I 2PNMA 4DPWA 2E5LE 2MDRA 3HULA 1U2RA 1ZBTA 2E1MA 2ZBKB 2M1SA 5IT9C 1J5EE 1ZM3A 1WUUA 4P7DA 1Z0CA 3OTOI 1S4EA 2ODRC 4OX9I 1FWKA 3J7AG 4DV7I 3T1YE 2EZ6A 1EKZA 4J8ZA 2L2KB 3RMPA 1N36E 1Z5CA 4JYAI 1N34E 4JI1E 4JV5I 2LTRA 2NUFA 3GONA 4DPUA 1D6TA 3JU0A 2JOBA 2V2ZA 4DR3E 3B78A 3V5RA 2DMYA 2Z5BA 2UUCE 4LFBE 2NA2A 4JI7E 2LRSA 2RSMA 3MSWA 4WPYA 4X8WA 3LNUA 3F0NA 4PU9A 4LF4I 1Y6ZA 3VYYA 2L6MA 4Z7YA 4NXMI 3HPZA 4Q28A 4JI6E 3Q1QA 3T1HI 4AQYE 2V85A 2UXDE 3WU5A 5LMUI 4DV4I 1T4OA 2KOUA 4FWHA 3VK6A 2HHHI 4YY3E 3ZKDA 4X64I 4DPTA 4MYTA 1B63A 4DR1E 1ZXMA 5T6JA 4JI8E 2L92A 2NUGA 2IOPA 5IWAE 1MU5A 4JI3E 3AV0A 2JWOA 2AJ4A 2PNLA 4X62I 4DV0I 1HNXI 2UXCE 4X66E 1FJGE 1XNRE 4DV2E 2EFGA 2ZITA 3IWDA 4K0KE 3Q6NA 4IZJD 1B62A 2EWLA 4LF5E 2NUEA 2R42A 4EMDA 1IBLI 3J7AM 1Z5BA 3QT7A 4GKJE 1N32I 1WHNA 2LTSA 4DV5E 2LBSB 2LUPB 4DUYI 4JI0E 3F6HA 1XMQE 2HFUA 4IZJA 2UUBE 4LF7I 2X36A 4XTJA 2GS8A 1HNWE 3PYGA 3C4BA 1H7UA 2Z5CB 4BMJA 4LF9I 4IZKA 2RS7A 5ADZA 4N3OA 4DR2I 4X65I 2HKEA 2VQFE 4DV1E 4ED4A 3ADLA 4B3ME 4P52A 2CGEA 4JI5E 2UU9I 4LFCE 4DR5E 4KHPI 1KVKA 2UUAE 1GZ6A 4F9AB 4UTGA 4DUZE 1Z0BA 4WUDA 1RREA 4YHHE 4BC9A 3PYDA 2DSYA 4R1FA 1X48A 3QT6A 4NXNE 2N3GA 4B3SI 4M2ZA 1Z0VA 2JY9A 2V8QB 4OOGC 2XEXA 1I94I 5FLXQ 4DV3I 3AUZA 3ZZ0A 2L33A 3ADGA 1FNMA 1N34I 3IWBA 2LJHA 1X47A 4BS9A 4JI4I 2IHR1 2LUQA 1IBME 1PVGA 2V34A 1MX0A 2M4IA 1YZ9A 2HKJA 2O1UA 3VYXA 4JI7I 4GKKE 1USUA 1OJ4A 5BR8E 3PRYA 5LMNE 3ADJA 2UXBI 1USVA 4DR7E 2H36X 3ADIA 5L3JA 1XMOI 1BKNA 1UILA 3M6AA 3WU4A 2B9DA 4LTYA 4FWGA 1YYOA 3K17A 4DR6E 1N33E 1ZBQA 4BC7A 1IBKI 1Y4SA 4LF6E 4LF8E 2O1WA 4BCAA 3PYFA 4DU8A 1H7SA 3C4TA 4JI3I 2BM1A 3LMLA 4UT4A 2N3HA 3OTOE 2OI2A 3LPSA 4LFAE 3WU6A 2JVAA 4OX9E 2L8TA 2VQEI 1XNRI 4DV2I 1H73A 2Z5EA 2V87A 2KONA 2V2VA 2IOQA 4JYAE 1EI1A 3J80Q 4B3RI 4JV5E 3B8HA 2CPNA 3H09A 1Z0EA 1GQEA 2DB2A 2X7IA 2NPFA 2YT4A 4HXZA 3Q6MA 2DEIA 5AE3A 1Z59A 4DR4E 2RTXA 2FV4B 4JI2I 2F4VI 3P1XA 4LF4E 2F8BA 2ZM6E 4FW9A 4NXME 1HNZI 1HR0I 1XNQI 5GMEA 4WFTA 1KTVA 1NHIA 1FKAE 4ZVIA 1N0UA 1PKPA 3HTXA 4B3TI 2V83A 2HHHE 1RR9A 4I3HA 4X64E 4DV6I 3JAMQ 4DMIA 2Z5CA 5GMDA 1J26A 3F6GA 4HACB 1RC7A 5A2QQ 3K6QA 2Q2EB 4HY1A 1T4NA 4X62E 1ELOA 4DV0E 1HNXE 5AE1A 5CFFE 2KHXA 2E5LI 1ZM2A 2B7VA 1YYWA 3J81Q 5FLXC 1J5EI 1IBLE 2VF3A 3H4LA 2R3VA 1ZXNA 2V86A 1SR9A 3T1YI 2G7HA 3HJCA 1S16A 2L2MA 2CZ9A 1N36I 3K1JA 4JI1I 1PIEA 4M1KA 4LF7E 2B7TA 4WSPA 1KKHA 2FGGA 3P06A 2M7QA 5AE2A 4LF9E 3DJWA 4DR3I 1DARA 4DR2E 3ZKBA 3FIGA 2MC6A 4X65E 1Z5AA 4DKKA 2UUCI 4LFBI 4M0VA 4TUIA 1WHQA 5F3WA 2V8PA 4GEQB 4JG4A 4LF6I 3DF6A 4Z7CA 2UU9E 1DI2A 3HXLA 2HK3A 4KHPE 3J7Yp 4PRVA 4F9BB 2HK2A 2B3TB 2O1VA 4JI6I 3WU3A 2RS6A 4AQYI 1DQ3A 2UXDI 4KZSA 1NZ0A 2L3JA 4B3SE 4LFAI 1FWLA 1I94E 4DV3E 5IT9Q 4YY3I 2BM0A 4P78A 1UEKA 3B82A 4DR1I 2L3CA 2BV3A 4JI4E 4TUGA 4JI8I 5IWAI 4WUCA 1STUA 2LJPA 2CG9A 2JOXA 2DEJA 2Z5BB 1KIJA 2UXCI 4USMA 4X66I 1Z0GA 3J80C 1FJGI 4DV7E 2V89A 4DR4I 1NHJA 4K0KI 3IWCA 4HYMA 4URLA 4PRXA 4LF5I 2UXBE 2ZM6I 4GKJI 2VE7C 2YZTA 1QU6A 4DV5I 4I8OA 2HFSA 1XMOE 2JR1A 4JI0I 1X49A 1XMQI 4P7AA 4USKA 3ZM7A 3QT8A 2UUBI 1HNWI 2ODRD 3CWVA 1IBKE 4L8NA 5DNYA 4M30A 3D4JA 3ZZTA 1XHKA 1N0VC 2V2QA 2VQFI 4DV1I 2A2DA 5FWKA 4B3MI 4R03A 3T1HE 4RPFA 2LMZA 1O0WA 2V88A 5LMUE 1UHZA 4DV4E 3JAMC 4JI5I 4LFCI 4DR5I 2UUAI 1H74A 1ZM9A 3V2UC 1Z0TA 4F54A 4WUBA 4DUZI 2VQEE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A2Q C;  1VIS A;  2WW4 A;  4YHH I;  4B3R E;  4NXN I;  2E1R A;  1YYK A;  3ZZU A;  4HAC A;  2L2N A;  2A2C A;  4WYQ B;  3LTO A;  4DU7 A;  3LLH A;  5LL6 R;  1K47 A;  1ZM4 A;  2J7K A;  3J81 C;  2DIX A;  1QZR A;  3QT5 A;  4JI2 E;  2F4V E;  1IBM I;  4DXL A;  4MYU A;  1N32 E;  1HNZ E;  1HR0 E;  1MG7 A;  4DUY E;  1XNQ E;  1A6F A;  4GKK I;  1NHH A;  3PYE A;  5BR8 I;  1Z0W A;  1H72 C;  5LMN I;  4FWD A;  4B3T E;  1RQ0 A;  4DR7 I;  4DV6 E;  1EA6 A;  1T4L B;  4KQV A;  1FI4 A;  4DR6 I;  4FN5 A;  1N33 I;  4DPX A;  4DPY A;  4LF8 I;  4DPW A;  2E5L E;  2MDR A;  3HUL A;  1U2R A;  1ZBT A;  2ZBK B;  5IT9 C;  1J5E E;  1ZM3 A;  1WUU A;  1Z0C A;  3OTO I;  1S4E A;  4OX9 I;  1FWK A;  3J7A G;  4DV7 I;  3T1Y E;  1EKZ A;  2L2K B;  1N36 E;  1Z5C A;  4JYA I;  1N34 E;  4JI1 E;  4JV5 I;  2LTR A;  2NUF A;  3GON A;  4DPU A;  1D6T A;  2V2Z A;  4DR3 E;  3B78 A;  3V5R A;  2DMY A;  2UUC E;  4LFB E;  2NA2 A;  4JI7 E;  2LRS A;  2RSM A;  4X8W A;  3LNU A;  3F0N A;  4PU9 A;  4LF4 I;  3VYY A;  4Z7Y A;  4NXM I;  4JI6 E;  3Q1Q A;  3T1H I;  4AQY E;  2UXD E;  3WU5 A;  5LMU I;  4DV4 I;  1T4O A;  4FWH A;  2HHH I;  4YY3 E;  3ZKD A;  4X64 I;  4DPT A;  4MYT A;  1B63 A;  4DR1 E;  1ZXM A;  4JI8 E;  2NUG A;  5IWA E;  1MU5 A;  4JI3 E;  2AJ4 A;  4X62 I;  4DV0 I;  1HNX I;  2UXC E;  4X66 E;  1FJG E;  1XNR E;  4DV2 E;  2EFG A;  2ZIT A;  4K0K E;  1B62 A;  4LF5 E;  2NUE A;  2R42 A;  4EMD A;  3J7A M;  1IBL I;  1Z5B A;  3QT7 A;  4GKJ E;  1N32 I;  1WHN A;  2LTS A;  4DV5 E;  2LBS B;  2LUP B;  4DUY I;  4JI0 E;  1XMQ E;  2HFU A;  2UUB E;  4LF7 I;  2X36 A;  4XTJ A;  2GS8 A;  1HNW E;  3PYG A;  3C4B A;  1H7U A;  4LF9 I;  2RS7 A;  4DR2 I;  4X65 I;  2HKE A;  2VQF E;  4DV1 E;  4ED4 A;  3ADL A;  4B3M E;  4P52 A;  4JI5 E;  2UU9 I;  4LFC E;  4DR5 E;  4KHP I;  1KVK A;  2UUA E;  4UTG A;  4DUZ E;  1Z0B A;  4WUD A;  1RRE A;  4YHH E;  3PYD A;  4R1F A;  1X48 A;  3QT6 A;  4NXN E;  2N3G A;  4B3S I;  4M2Z A;  1Z0V A;  2JY9 A;  4OOG C;  2XEX A;  1I94 I;  5FLX Q;  4DV3 I;  3ZZ0 A;  2L33 A;  3ADG A;  1FNM A;  1N34 I;  2LJH A;  1X47 A;  4JI4 I;  2IHR 1;  2LUQ A;  1IBM E;  1PVG A;  2V34 A;  1MX0 A;  1YZ9 A;  2HKJ A;  3VYX A;  4JI7 I;  4GKK E;  1OJ4 A;  5BR8 E;  5LMN E;  3ADJ A;  2UXB I;  4DR7 E;  3ADI A;  5L3J A;  1XMO I;  1BKN A;  1UIL A;  3M6A A;  3WU4 A;  4FWG A;  1YYO A;  3K17 A;  4DR6 E;  1N33 E;  1IBK I;  4LF6 E;  4LF8 E;  3PYF A;  4DU8 A;  1H7S A;  3C4T A;  4JI3 I;  2BM1 A;  4UT4 A;  2N3H A;  3OTO E;  2OI2 A;  3LPS A;  4LFA E;  3WU6 A;  2JVA A;  4OX9 E;  2VQE I;  1XNR I;  4DV2 I;  1H73 A;  2V2V A;  4JYA E;  1EI1 A;  3J80 Q;  4B3R I;  4JV5 E;  3B8H A;  2CPN A;  1Z0E A;  1GQE A;  2DB2 A;  2X7I A;  2NPF A;  2YT4 A;  4HXZ A;  2DEI A;  1Z59 A;  4DR4 E;  2RTX A;  4JI2 I;  2F4V I;  3P1X A;  4LF4 E;  2ZM6 E;  4FW9 A;  4NXM E;  1HNZ I;  1HR0 I;  1XNQ I;  5GME A;  4WFT A;  1KTV A;  1NHI A;  1FKA E;  4ZVI A;  1N0U A;  1PKP A;  3HTX A;  4B3T I;  2HHH E;  1RR9 A;  4I3H A;  4X64 E;  4DV6 I;  3JAM Q;  5GMD A;  1J26 A;  4HAC B;  1RC7 A;  5A2Q Q;  2Q2E B;  4HY1 A;  1T4N A;  4X62 E;  1ELO A;  4DV0 E;  1HNX E;  5CFF E;  2KHX A;  2E5L I;  1ZM2 A;  2B7V A;  1YYW A;  3J81 Q;  5FLX C;  1J5E I;  1IBL E;  2VF3 A;  3H4L A;  2R3V A;  1ZXN A;  3T1Y I;  1S16 A;  2L2M A;  2CZ9 A;  1N36 I;  3K1J A;  4JI1 I;  1PIE A;  4M1K A;  4LF7 E;  2B7T A;  1KKH A;  4LF9 E;  4DR3 I;  1DAR A;  4DR2 E;  3ZKB A;  4X65 E;  1Z5A A;  4DKK A;  2UUC I;  4LFB I;  1WHQ A;  2V8P A;  4JG4 A;  4LF6 I;  4Z7C A;  2UU9 E;  1DI2 A;  2HK3 A;  4KHP E;  3J7Y p;  4PRV A;  2HK2 A;  2B3T B;  4JI6 I;  3WU3 A;  2RS6 A;  4AQY I;  2UXD I;  1NZ0 A;  2L3J A;  4B3S E;  4LFA I;  1FWL A;  1I94 E;  4DV3 E;  5IT9 Q;  4YY3 I;  2BM0 A;  1UEK A;  3B82 A;  4DR1 I;  2L3C A;  2BV3 A;  4JI4 E;  4JI8 I;  5IWA I;  4WUC A;  1STU A;  2LJP A;  2DEJ A;  1KIJ A;  2UXC I;  4USM A;  4X66 I;  1Z0G A;  3J80 C;  1FJG I;  4DV7 E;  4DR4 I;  1NHJ A;  4K0K I;  4HYM A;  4URL A;  4PRX A;  4LF5 I;  2UXB E;  2ZM6 I;  4GKJ I;  1QU6 A;  4DV5 I;  2HFS A;  1XMO E;  4JI0 I;  1X49 A;  1XMQ I;  4P7A A;  4USK A;  3ZM7 A;  3QT8 A;  2UUB I;  1HNW I;  3CWV A;  1IBK E;  4M30 A;  3D4J A;  3ZZT A;  1XHK A;  1N0V C;  2V2Q A;  2VQF I;  4DV1 I;  2A2D A;  4B3M I;  3T1H E;  4RPF A;  1O0W A;  5LMU E;  1UHZ A;  4DV4 E;  3JAM C;  4JI5 I;  4LFC I;  4DR5 I;  2UUA I;  1H74 A;  1ZM9 A;  3V2U C;  1Z0T A;  2EZ6 A;  4WUB A;  4DUZ I;  2VQE E; 
#chains in the Genus database with same CATH topology
 5A2Q C;  4IFD B;  1VIS A;  1HK7 A;  2EML A;  2WW4 A;  4YHH I;  4RH8 A;  2YTO A;  5AC5 A;  2J65 A;  4FW6 A;  3OML A;  4R2C A;  4B3R E;  4NXN I;  2E1R A;  1YFH A;  2GQ0 A;  2EOH A;  1YYK A;  2WZO A;  3UHM A;  3ZZU A;  4HAC A;  2L2N A;  2A2C A;  4WYQ B;  3LTO A;  5AAS A;  4DU7 A;  5JEA D;  3LLH A;  5LL6 R;  4IZJ B;  5DNL A;  1K47 A;  5A6K A;  1ZM4 A;  2J7K A;  2VF1 A;  3HPS A;  1OYS A;  5K36 C;  2LE2 A;  3J81 C;  2NN6 A;  2DIX A;  1QZR A;  3GCM A;  3JTZ A;  4GZN C;  2I13 A;  3QT5 A;  1WJP A;  5DRR A;  2O1T A;  4F9C B;  5JEA A;  4JI2 E;  4Q35 B;  3KWR A;  2BR2 B;  4IZK B;  2F4V E;  3K85 A;  1IBM I;  4AM3 A;  4R8O A;  4DXL A;  4MYU A;  4NZV A;  1N32 E;  2EMX A;  4R2E A;  1Y4U A;  4L5N C;  1X6H A;  4IS1 C;  1HNZ E;  2JEB B;  1HR0 E;  3HQ1 A;  1MG7 A;  4DUY E;  4MU3 A;  1XNQ E;  2WBT A;  1A6F A;  4NBQ A;  1YHC A;  4GKK I;  1NHH A;  3PYE A;  5BR8 I;  1Z0W A;  1H72 C;  5LMN I;  4FWD A;  5ELW A;  2MC5 A;  4B3T E;  1WXR A;  1RQ0 A;  4DR7 I;  4DV6 E;  1YUI A;  5C0X C;  1EA6 A;  1A1I A;  1EH6 A;  2RQL A;  3ZOQ B;  1T4L B;  3M7N D;  1AH5 A;  2EN4 A;  1A1K A;  4KQV A;  4BBY A;  2K4V A;  1FI4 A;  1P47 A;  1NEI A;  4FN5 A;  4DR6 I;  1N33 I;  2FTX B;  4LU9 A;  2CT1 A;  4DPX A;  4DPY A;  4LF8 I;  2PNM A;  4DPW A;  2E5L E;  2MDR A;  2IES A;  3HUL A;  2YRH A;  1U2R A;  1ZBT A;  4LPF A;  2E1M A;  2ZBK B;  1JK2 A;  4U3D A;  2M1S A;  5IT9 C;  1J5E E;  4R2Q A;  1ZM3 A;  4BA2 B;  1WUU A;  4P7D A;  1Z0C A;  1XXE A;  3OTO I;  2BA1 D;  4F2J C;  1S4E A;  2ODR C;  4OX9 I;  4OO1 D;  1FWK A;  3J7A G;  4DV7 I;  3T1Y E;  2EZ6 A;  2PO2 A;  3C6K A;  1EKZ A;  4J8Z A;  2L2K B;  3RMP A;  1N36 E;  1Z5C A;  2C39 A;  1N34 E;  2WNR A;  2C38 A;  3B4T A;  3L7Z B;  4JI1 E;  3C6M A;  3P3C A;  1E3H A;  4JV5 I;  2LTR A;  4BA1 B;  2C37 A;  1YPN A;  4OO1 A;  2NUF A;  2EP3 A;  4BHB A;  3GON A;  2BBG A;  4DPU A;  1D6T A;  3JU0 A;  4FW4 A;  2YRK A;  2LJU A;  2DMI A;  2V2Z A;  4DR3 E;  2WCC 3;  4NHR A;  3KRN A;  3B78 A;  3V5R A;  2DMY A;  5K36 B;  2Z5B A;  2UUC E;  2WP8 A;  4LFB E;  2NA2 A;  2EPX A;  4JI7 E;  3MSW A;  1SFE A;  2EM2 A;  2EPZ A;  2LRS A;  2RSM A;  4WPY A;  3KZZ A;  4X8W A;  3F0N A;  5EKW A;  1P42 A;  4LCF A;  4PU9 A;  1EH8 A;  2NN6 C;  1UDQ A;  3EPH A;  2JP9 A;  1UN6 B;  4LF4 I;  1Y6Z A;  3VYY A;  2L6M A;  3BGH A;  4Z7Y A;  4NXM I;  3HPZ A;  4Q28 A;  4JI6 E;  3Q1Q A;  1KJK A;  3T1H I;  2V85 A;  4AQY E;  2EN7 A;  4KWY A;  2UXD E;  3WU5 A;  2EOF A;  5LMU I;  2EM6 A;  4DV4 I;  2EOQ A;  1T4O A;  2KOU A;  4OKG A;  4MQY A;  4FWH A;  5K36 F;  1JK1 A;  3VK6 A;  2VRD A;  2HHH I;  4YY3 E;  3ZKD A;  4X64 I;  5TSE A;  1A1L A;  1IQO A;  4DPT A;  4MYT A;  1B63 A;  4DR1 E;  2ENC A;  1ZXM A;  5T6J A;  4JI8 E;  2L92 A;  2NUG A;  1L4S A;  2IOP A;  5IWA E;  4IFD D;  1MU5 A;  2ENA A;  4JI3 E;  4LOM A;  3AV0 A;  2JWO A;  2DRP A;  3CDJ A;  2AJ4 A;  2PNL A;  3U1Y A;  4X62 I;  5KL3 A;  4DV0 I;  1HNX I;  2CVE A;  2EOS A;  2UXC E;  1BBO A;  4X66 E;  2EOI A;  4MLQ A;  3EPL A;  2ENH A;  1FJG E;  4HEI A;  1XNR E;  4DV2 E;  2EFG A;  2ZIT A;  3IWD A;  1B69 A;  4K0K E;  3Q6N A;  4IFD A;  4IZJ D;  1B62 A;  3BF2 A;  2EOM A;  4MLV A;  2EWL A;  4O24 A;  4LF5 E;  2NUE A;  2R42 A;  3H1C A;  4EMD A;  1Z5B A;  1IBL I;  3J7A M;  3QT7 A;  5EL9 A;  4GKJ E;  1N32 I;  4OZE A;  2LT7 A;  1WHN A;  2EQ3 A;  2LTS A;  1X6F A;  3MHH C;  4DV5 E;  2LBS B;  2EPN A;  2LUP B;  5A6J A;  4DUY I;  4JI0 E;  2DLK A;  3F6H A;  1XMQ E;  2HFU A;  5A6A A;  2EN8 A;  2JYA A;  4IZJ A;  4GQU A;  2UUB E;  2EL6 A;  4LF7 I;  2EOZ A;  1A1G A;  2EMC A;  2X36 A;  4XTJ A;  2GS8 A;  1HNW E;  3PYG A;  3C4B A;  2EPM X;  1H7U A;  2Z5C B;  4BMJ A;  4LF9 I;  4ZYG A;  2BA0 G;  4IZK A;  5K36 E;  2BR2 A;  2AE8 A;  2RS7 A;  5ADZ A;  4ISA A;  4N3O A;  4DR2 I;  4OO1 C;  2WBU A;  1BB8 A;  2VQF E;  4DV1 E;  2GO3 A;  2HKE A;  4QNJ A;  4X65 I;  4ED4 A;  3ADL A;  2JEA B;  2LO3 A;  2GHF A;  4B3M E;  2JEB A;  3BID A;  4P52 A;  1G2F C;  4HTG A;  1TN9 A;  2CGE A;  4JI5 E;  2HGH A;  4LFC E;  3HKM A;  2UU9 I;  4DR5 E;  1E3P A;  4KHP I;  1KVK A;  2UUA E;  1T39 A;  2PNZ B;  1GZ6 A;  4F9A B;  4UTG A;  2JT2 A;  2DLQ A;  2EOX A;  4DUZ E;  1Z0B A;  4WUD A;  1RRE A;  2EOJ A;  5A69 A;  4YHH E;  4BC9 A;  2RSI A;  3PYD A;  2D9H A;  2YRM A;  2CSH A;  1RHY A;  2DSY A;  2EPO A;  2YPN A;  4R1F A;  2EM7 A;  2RPC A;  1X48 A;  1G2D C;  3QT6 A;  5DRQ A;  2WBS A;  4NXN E;  4QNK A;  2N3G A;  4B3S I;  5IXM B;  4M2Z A;  2EN3 A;  1Z0V A;  2JY9 A;  2V8Q B;  4OOG C;  2XEX A;  2A25 A;  2GPI A;  5FLX Q;  4DV3 I;  1I94 I;  1WRJ A;  3AUZ A;  3U1K A;  3ZZ0 A;  3L00 A;  4ZYD A;  2L33 A;  3ADG A;  1FNM A;  1N34 I;  4R2P A;  3IWB A;  2LJH A;  1X47 A;  4BS9 A;  4JI4 I;  2IHR 1;  1UDO A;  2LUQ A;  1IBM E;  1PVG A;  2V34 A;  2YTQ A;  2PO0 B;  2YTG A;  2M4I A;  1YZ9 A;  1MX0 A;  3M85 G;  2HKJ A;  2O1U A;  4BA2 A;  3VYX A;  2N8X A;  2EMA A;  4JI7 I;  4GKK E;  2YSP A;  3MHS C;  1USU A;  5DRP A;  1OJ4 A;  5BR8 E;  4O5G A;  1X5W A;  2EPA A;  3PRY A;  5LMN E;  5AC4 A;  3ADJ A;  5IV8 B;  1MEY C;  3L7Z A;  1A1J A;  2UXB I;  1USV A;  2EMB A;  1DGC A;  5K36 D;  1UBD C;  1UDN A;  4IFD C;  4BA1 A;  4DR7 E;  2EL5 A;  2H36 X;  2JXP A;  4N4R B;  3ADI A;  5L3J A;  1ZR9 A;  1XMO I;  1BKN A;  1UIL A;  4ZYH A;  3M6A A;  2EOR A;  2B9D A;  3WU4 A;  1PDA A;  4LTY A;  5K36 A;  5KL4 A;  4FWG A;  1YYO A;  3K17 A;  4DR6 E;  1N33 E;  2EMW A;  1ZBQ A;  4BC7 A;  1IBK I;  1Y4S A;  4LF6 E;  2WNR B;  4LF8 E;  2C38 B;  2O1W A;  1F2I G;  3CDI A;  4RHB B;  4BCA A;  4IJD A;  5JEA C;  3PYF A;  4DU8 A;  1H7S A;  2YTJ A;  2R1F A;  2EN1 A;  3C4T A;  3VHT B;  4F6M A;  2EPC A;  2NN6 E;  4FW3 A;  2BM1 A;  2EOO A;  1N36 I;  4JI3 I;  3LML A;  4J3D A;  4UT4 A;  4LCG A;  2N3H A;  3OTO E;  2OI2 A;  3LPS A;  4LFA E;  3WU6 A;  2I9I A;  2JVA A;  4OX9 E;  2L8T A;  2YSO A;  2JPA A;  3GLL A;  2VQE I;  1XNR I;  4DV2 I;  1H73 A;  2Z5E A;  4O43 A;  2V87 A;  2KON A;  2V2V A;  2GLI A;  1A1H A;  4R2R A;  4JYA E;  2IOQ A;  5C0X B;  1EI1 A;  3J80 Q;  4B3R I;  2JE6 A;  4JV5 E;  3B8H A;  2CPN A;  3H09 A;  1YH8 A;  1Z0E A;  1GQE A;  1A1F A;  2DB2 A;  2X7I A;  2NPF A;  5DNX A;  4MDT A;  2YT4 A;  4WSG A;  4HXZ A;  3Q6M A;  2DEI A;  5AE3 A;  2EM9 A;  2PO1 B;  1Z59 A;  2PRT A;  2EM4 A;  4DR4 E;  2YTP A;  2RTX A;  2FV4 B;  5KL6 A;  4JI2 I;  1LLM C;  2F4V I;  2EQ0 A;  3P1X A;  2EPL X;  5C0X F;  3PS3 A;  2JEA A;  4LF4 E;  2F8B A;  2ZM6 E;  2YTI A;  3PS1 A;  2YTD A;  4FK5 C;  4FW9 A;  2BB8 A;  4NXM E;  2EOE A;  1HNZ I;  2ADR A;  1HR0 I;  4BHC A;  2BA0 D;  1XNQ I;  5GME A;  5DRO A;  4ZYE A;  4WFT A;  2LV2 A;  1KTV A;  1NHI A;  1FKA E;  4ZVI A;  3DD6 A;  1N0U A;  2EMG A;  1PKP A;  2EM0 A;  3HTX A;  2V83 A;  2HHH E;  4MU1 A;  4B3T I;  4JYA I;  1RR9 A;  4I3H A;  4X64 E;  1Y60 A;  3JAM Q;  4DV6 I;  4DMI A;  2Z5C A;  1Z1B A;  5GMD A;  3LNU A;  1J26 A;  2NN6 D;  3F6G A;  1T38 A;  4HAC B;  1RC7 A;  5A2Q Q;  2HJJ A;  3K6Q A;  1R6L A;  2Q2E B;  2ELY A;  3THN A;  4FW5 A;  2EJ4 A;  3BBG A;  4HY1 A;  1T4N A;  3GME A;  4X62 E;  1ELO A;  2NN6 B;  4R2A A;  5LLQ A;  4OO1 E;  2Q8U A;  3KZY A;  5AE1 A;  2YTF A;  4DV0 E;  1HNX E;  1Y5Y A;  2EE8 A;  5CFF E;  2KHX A;  4U3B A;  2E5L I;  2EPU A;  1ZM2 A;  2PNZ A;  2B7V A;  5JEA B;  2EM5 A;  1R6M A;  1YYW A;  3J81 Q;  5FLX C;  1J5E I;  2MKN A;  1IBL E;  2EMK A;  2VF3 A;  3H4L A;  2R3V A;  2YU8 A;  1ZXN A;  2YU5 A;  2V86 A;  1SR9 A;  3M99 B;  1IQS A;  2ELZ A;  2DGC A;  5C0X E;  3T1Y I;  2G7H A;  3EPJ A;  2EM8 A;  1PJS A;  1S16 A;  2L2M A;  2LVH A;  1N3G A;  2CZ9 A;  2VES A;  3HJC A;  3K1J A;  2EL4 A;  3EQ1 A;  2NN6 F;  2YTE A;  4FW7 A;  4JI1 I;  4AIM A;  1PIE A;  3M85 D;  1X3C A;  2R76 A;  4LF7 E;  4M1K A;  2B7T A;  4WSP A;  2CTD A;  1KKH A;  2MDG A;  2FGG A;  5KL7 A;  3P06 A;  5JEA F;  2M7Q A;  5AE2 A;  4LF9 E;  2EMH A;  3NZK A;  3DJW A;  4DR3 I;  1DAR A;  4DR2 E;  3ZKB A;  3FIG A;  2MC6 A;  4X65 E;  1Z5A A;  4F54 A;  2J7J A;  4DKK A;  2PO0 A;  2UUC I;  4M0V A;  4LFB I;  2EOY A;  4TUI A;  1WHQ A;  5F3W A;  1GTK A;  2F1D A;  4GEQ B;  2V8P A;  4JG4 A;  3EPK A;  4LF6 I;  4R2D A;  3DF6 A;  4Z7C A;  2UU9 E;  1DI2 A;  3HXL A;  2HK3 A;  4KHP E;  3J7Y p;  5KL5 A;  4PRV A;  2EM3 A;  4X9J A;  4F9B B;  1ZU1 A;  3M7N G;  2HK2 A;  3PS2 A;  2B3T B;  2O1V A;  1TF6 A;  3WU3 A;  4JI6 I;  4IFD F;  2RS6 A;  3TQM A;  4AQY I;  1YUJ A;  1DQ3 A;  2EPP A;  4WXD A;  2UXD I;  4KZS A;  1NZ0 A;  2L3J A;  4B3S E;  1TF3 A;  4LFA I;  4IFD E;  4AID A;  1FWL A;  2PO2 B;  1I94 E;  4DV3 E;  5IT9 Q;  2NAB A;  4YY3 I;  4O4K A;  2C39 B;  2BM0 A;  4P78 A;  2MKD A;  1EH7 A;  2EMY A;  1UEK A;  3B82 A;  5KL2 A;  1IMU A;  4DR1 I;  2C37 B;  2LCE A;  2L3C A;  2BV3 A;  4OO1 B;  4JI4 E;  2HC5 A;  2BA1 G;  4TUG A;  4JI8 I;  5IWA I;  4WUC A;  1STU A;  1BBG A;  1PJQ A;  2LJP A;  2EN2 A;  2EPR A;  2CG9 A;  5C0X D;  2JOX A;  2DEJ A;  2Z5B B;  2WP8 B;  5JEA E;  1KIJ A;  2UXC I;  4USM A;  4X66 I;  1Z0G A;  5A6B D;  3J80 C;  1FJG I;  3UK3 C;  2M9A A;  4DV7 E;  1KYQ A;  2V89 A;  4DR4 I;  1NHJ A;  1OYP A;  3IWC A;  2YTN A;  4HYM A;  4URL A;  4LCH A;  4PRX A;  4K0K I;  4LF5 I;  1RMD A;  5C0X A;  2UXB E;  2IER A;  2ZM6 I;  2VE7 C;  4GKJ I;  2EMZ A;  2YZT A;  4OO1 F;  1QU6 A;  3P3E A;  4DV5 I;  2EPK X;  5A6B A;  4I8O A;  2HFS A;  1MGT A;  3P3G A;  1XMO E;  2JR1 A;  4JI0 I;  1X49 A;  4WX9 A;  1XMQ I;  1PJT A;  4MU0 A;  4P7A A;  4USK A;  1OYR A;  2EQ1 A;  3ZM7 A;  3QT8 A;  2UUB I;  1QNT A;  1NCS A;  2PO1 A;  1HNW I;  2ODR D;  3QG5 C;  3THO B;  3CWV A;  2O3Z A;  4MU4 A;  1IBK E;  4L8N A;  5DNY A;  4WXC A;  4M30 A;  1UDS A;  3D4J A;  2JE6 B;  2K7I A;  3ZZT A;  1XHK A;  1N0V C;  2GO4 A;  2V2Q A;  1AAY A;  2VQF I;  4DV1 I;  4M9V C;  4R2S A;  2A2D A;  5FWK A;  3P76 A;  1ZAA C;  4B3M I;  4F6N A;  4R03 A;  1YSA C;  3T1H E;  3ECR A;  2E72 A;  4RPF A;  1X6E A;  2LMZ A;  1O0W A;  2V88 A;  5LMU E;  1UHZ A;  4DV4 E;  2EMF A;  3JAM C;  1VI7 A;  4LFC I;  2EN6 A;  4IS9 A;  4DR5 I;  4JI5 I;  2YWQ A;  2UUA I;  1H74 A;  1ZM9 A;  3V2U C;  1Z0T A;  2EMI A;  2JOB A;  4WUB A;  4DUZ I;  2VQE E; 
#chains in the Genus database with same CATH homology
 5A2Q C;  1VIS A;  1HK7 A;  2WW4 A;  4YHH I;  3OML A;  4B3R E;  4NXN I;  2E1R A;  2GQ0 A;  1YYK A;  2WZO A;  3ZZU A;  4HAC A;  2L2N A;  2A2C A;  4WYQ B;  3LTO A;  5AAS A;  4DU7 A;  3LLH A;  5LL6 R;  4IZJ B;  1K47 A;  1ZM4 A;  2J7K A;  2VF1 A;  3HPS A;  2LE2 A;  3J81 C;  2DIX A;  1QZR A;  3JTZ A;  3QT5 A;  2O1T A;  4F9C B;  4JI2 E;  4IZK B;  3KWR A;  2F4V E;  3K85 A;  1IBM I;  4R8O A;  4DXL A;  4MYU A;  1N32 E;  1Y4U A;  4L5N C;  1HNZ E;  1HR0 E;  3HQ1 A;  1MG7 A;  4DUY E;  1XNQ E;  1A6F A;  4GKK I;  1NHH A;  3PYE A;  5BR8 I;  1Z0W A;  1H72 C;  5LMN I;  4FWD A;  2MC5 A;  4B3T E;  1WXR A;  1RQ0 A;  4DR7 I;  4DV6 E;  1EA6 A;  3ZOQ B;  1T4L B;  4KQV A;  4BBY A;  2K4V A;  1FI4 A;  4DR6 I;  4FN5 A;  1N33 I;  2FTX B;  4LU9 A;  4DPX A;  4DPY A;  4LF8 I;  2PNM A;  4DPW A;  2E5L E;  2MDR A;  3HUL A;  1U2R A;  1ZBT A;  2E1M A;  2ZBK B;  2M1S A;  5IT9 C;  1J5E E;  1ZM3 A;  1WUU A;  4P7D A;  1Z0C A;  3OTO I;  1S4E A;  2ODR C;  4OX9 I;  1FWK A;  3J7A G;  4DV7 I;  3T1Y E;  2EZ6 A;  1EKZ A;  4J8Z A;  2L2K B;  3RMP A;  1N36 E;  1Z5C A;  4JYA I;  1N34 E;  4JI1 E;  4JV5 I;  2LTR A;  2NUF A;  3GON A;  4DPU A;  1D6T A;  3JU0 A;  2JOB A;  2V2Z A;  4DR3 E;  3B78 A;  3V5R A;  2DMY A;  2Z5B A;  2UUC E;  4LFB E;  2NA2 A;  4JI7 E;  2LRS A;  2RSM A;  3MSW A;  4WPY A;  4X8W A;  3LNU A;  3F0N A;  4PU9 A;  4LF4 I;  1Y6Z A;  3VYY A;  2L6M A;  4Z7Y A;  4NXM I;  3HPZ A;  4Q28 A;  4JI6 E;  3Q1Q A;  3T1H I;  4AQY E;  2V85 A;  2UXD E;  3WU5 A;  5LMU I;  4DV4 I;  1T4O A;  2KOU A;  4FWH A;  3VK6 A;  2HHH I;  4YY3 E;  3ZKD A;  4X64 I;  4DPT A;  4MYT A;  1B63 A;  4DR1 E;  1ZXM A;  5T6J A;  4JI8 E;  2L92 A;  2NUG A;  2IOP A;  5IWA E;  1MU5 A;  4JI3 E;  3AV0 A;  2JWO A;  2AJ4 A;  2PNL A;  4X62 I;  4DV0 I;  1HNX I;  2UXC E;  4X66 E;  1FJG E;  1XNR E;  4DV2 E;  2EFG A;  2ZIT A;  3IWD A;  4K0K E;  3Q6N A;  4IZJ D;  1B62 A;  2EWL A;  4LF5 E;  2NUE A;  2R42 A;  4EMD A;  1IBL I;  3J7A M;  1Z5B A;  3QT7 A;  4GKJ E;  1N32 I;  1WHN A;  2LTS A;  4DV5 E;  2LBS B;  2LUP B;  4DUY I;  4JI0 E;  3F6H A;  1XMQ E;  2HFU A;  4IZJ A;  2UUB E;  4LF7 I;  2X36 A;  4XTJ A;  2GS8 A;  1HNW E;  3PYG A;  3C4B A;  1H7U A;  2Z5C B;  4BMJ A;  4LF9 I;  4IZK A;  2RS7 A;  5ADZ A;  4N3O A;  4DR2 I;  4X65 I;  2HKE A;  2VQF E;  4DV1 E;  4ED4 A;  3ADL A;  4B3M E;  4P52 A;  2CGE A;  4JI5 E;  2UU9 I;  4LFC E;  4DR5 E;  4KHP I;  1KVK A;  2UUA E;  1GZ6 A;  4F9A B;  4UTG A;  4DUZ E;  1Z0B A;  4WUD A;  1RRE A;  4YHH E;  4BC9 A;  3PYD A;  2DSY A;  4R1F A;  1X48 A;  3QT6 A;  4NXN E;  2N3G A;  4B3S I;  4M2Z A;  1Z0V A;  2JY9 A;  2V8Q B;  4OOG C;  2XEX A;  1I94 I;  5FLX Q;  4DV3 I;  3AUZ A;  3ZZ0 A;  2L33 A;  3ADG A;  1FNM A;  1N34 I;  3IWB A;  2LJH A;  1X47 A;  4BS9 A;  4JI4 I;  2IHR 1;  2LUQ A;  1IBM E;  1PVG A;  2V34 A;  1MX0 A;  2M4I A;  1YZ9 A;  2HKJ A;  2O1U A;  3VYX A;  4JI7 I;  4GKK E;  1USU A;  1OJ4 A;  5BR8 E;  3PRY A;  5LMN E;  3ADJ A;  2UXB I;  1USV A;  4DR7 E;  2H36 X;  3ADI A;  5L3J A;  1XMO I;  1BKN A;  1UIL A;  3M6A A;  3WU4 A;  2B9D A;  4LTY A;  4FWG A;  1YYO A;  3K17 A;  4DR6 E;  1N33 E;  1ZBQ A;  4BC7 A;  1IBK I;  1Y4S A;  4LF6 E;  4LF8 E;  2O1W A;  4BCA A;  3PYF A;  4DU8 A;  1H7S A;  3C4T A;  4JI3 I;  2BM1 A;  3LML A;  4UT4 A;  2N3H A;  3OTO E;  2OI2 A;  3LPS A;  4LFA E;  3WU6 A;  2JVA A;  4OX9 E;  2L8T A;  2VQE I;  1XNR I;  4DV2 I;  1H73 A;  2Z5E A;  2V87 A;  2KON A;  2V2V A;  2IOQ A;  4JYA E;  1EI1 A;  3J80 Q;  4B3R I;  4JV5 E;  3B8H A;  2CPN A;  3H09 A;  1Z0E A;  1GQE A;  2DB2 A;  2X7I A;  2NPF A;  2YT4 A;  4HXZ A;  3Q6M A;  2DEI A;  5AE3 A;  1Z59 A;  4DR4 E;  2RTX A;  2FV4 B;  4JI2 I;  2F4V I;  3P1X A;  4LF4 E;  2F8B A;  2ZM6 E;  4FW9 A;  4NXM E;  1HNZ I;  1HR0 I;  1XNQ I;  5GME A;  4WFT A;  1KTV A;  1NHI A;  1FKA E;  4ZVI A;  1N0U A;  1PKP A;  3HTX A;  4B3T I;  2V83 A;  2HHH E;  1RR9 A;  4I3H A;  4X64 E;  4DV6 I;  3JAM Q;  4DMI A;  2Z5C A;  5GMD A;  1J26 A;  3F6G A;  4HAC B;  1RC7 A;  5A2Q Q;  3K6Q A;  2Q2E B;  4HY1 A;  1T4N A;  4X62 E;  1ELO A;  4DV0 E;  1HNX E;  5AE1 A;  5CFF E;  2KHX A;  2E5L I;  1ZM2 A;  2B7V A;  1YYW A;  3J81 Q;  5FLX C;  1J5E I;  1IBL E;  2VF3 A;  3H4L A;  2R3V A;  1ZXN A;  2V86 A;  1SR9 A;  3T1Y I;  2G7H A;  3HJC A;  1S16 A;  2L2M A;  2CZ9 A;  1N36 I;  3K1J A;  4JI1 I;  1PIE A;  4M1K A;  4LF7 E;  2B7T A;  4WSP A;  1KKH A;  2FGG A;  3P06 A;  2M7Q A;  5AE2 A;  4LF9 E;  3DJW A;  4DR3 I;  1DAR A;  4DR2 E;  3ZKB A;  3FIG A;  2MC6 A;  4X65 E;  1Z5A A;  4DKK A;  2UUC I;  4LFB I;  4M0V A;  4TUI A;  1WHQ A;  5F3W A;  2V8P A;  4GEQ B;  4JG4 A;  4LF6 I;  3DF6 A;  4Z7C A;  2UU9 E;  1DI2 A;  3HXL A;  2HK3 A;  4KHP E;  3J7Y p;  4PRV A;  4F9B B;  2HK2 A;  2B3T B;  2O1V A;  4JI6 I;  3WU3 A;  2RS6 A;  4AQY I;  1DQ3 A;  2UXD I;  4KZS A;  1NZ0 A;  2L3J A;  4B3S E;  4LFA I;  1FWL A;  1I94 E;  4DV3 E;  5IT9 Q;  4YY3 I;  2BM0 A;  4P78 A;  1UEK A;  3B82 A;  4DR1 I;  2L3C A;  2BV3 A;  4JI4 E;  4TUG A;  4JI8 I;  5IWA I;  4WUC A;  1STU A;  2LJP A;  2CG9 A;  2JOX A;  2DEJ A;  2Z5B B;  1KIJ A;  2UXC I;  4USM A;  4X66 I;  1Z0G A;  3J80 C;  1FJG I;  4DV7 E;  2V89 A;  4DR4 I;  1NHJ A;  4K0K I;  3IWC A;  4HYM A;  4URL A;  4PRX A;  4LF5 I;  2UXB E;  2ZM6 I;  4GKJ I;  2VE7 C;  2YZT A;  1QU6 A;  4DV5 I;  4I8O A;  2HFS A;  1XMO E;  2JR1 A;  4JI0 I;  1X49 A;  1XMQ I;  4P7A A;  4USK A;  3ZM7 A;  3QT8 A;  2UUB I;  1HNW I;  2ODR D;  3CWV A;  1IBK E;  4L8N A;  5DNY A;  4M30 A;  3D4J A;  3ZZT A;  1XHK A;  1N0V C;  2V2Q A;  2VQF I;  4DV1 I;  2A2D A;  5FWK A;  4B3M I;  4R03 A;  3T1H E;  4RPF A;  2LMZ A;  1O0W A;  2V88 A;  5LMU E;  1UHZ A;  4DV4 E;  3JAM C;  4JI5 I;  4LFC I;  4DR5 I;  2UUA I;  1H74 A;  1ZM9 A;  3V2U C;  1Z0T A;  4F54 A;  4WUB A;  4DUZ I;  2VQE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...