4X64I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x64I00
1Z0WA 4DR2I 4YHHE 3B82A 4GKJI 2E1RA 1IBME 4JI5I 2WW4A 2UUCI 4LF8E 4R1FA 1XMQE 4DR4E 1KKHA 4KHPI 2UXCE 1N33I 5LMNI 1ZM9A 5FLXQ 2HKJA 4X66E 4X62E 4PRXA 3D4JA 5LMUI 4JI0E 1XMOE 5GMDA 4DV2I 3JAMC 4GKKE 1N0UA 3PYFA 4DR1I 1XNQI 4P52A 4LFAE 4FWHA 5BR8E 2VQEE 1DARA 1RR9A 4HACA 2A2CA 2NPFA 1NHIA 1UEKA 4WUDA 4X65I 3ZZUA 1MU5A 4LF7E 3ZZ0A 4DV5I 4DPWA 4DV3E 1U2RA 4FWDA 1S4EA 3J81C 4LFBI 4JI1E 4NXNI 4UT4A 4B3TI 3Q1QA 1HNWE 4DUZE 3LNUA 2HK3A 2UU9I 4B3SE 4DU7A 4JV5I 1ZM2A 1XHKA 4LF9I 4P7AA 4DV0I 3V5RA 4PRVA 4ED4A 2ZBKB 4DV6E 1J5EI 4B3ME 2DEIA 4UTGA 2R42A 2UXDI 1H73A 4NXME 4B3RE 4JYAI 4PU9A 1HNXI 1H74A 4JI2E 4DR5I 1Z0CA 5A2QQ 4MYTA 4JI3I 4RPFA 2VQFI 4YY3I 2CZ9A 4JI8E 2HFUA 5FLXC 1NZ0A 4YHHI 4DR7E 1IBMI 4JG4A 5LL6R 2X7IA 4ZVIA 4LF4E 4FW9A 4KQVA 1PKPA 4DPTA 2HKEA 5GMEA 1XMQI 4DU8A 1I94E 1KIJA 3T1YE 2UXCI 3J80Q 1XNRE 3LTOA 3QT5A 1KVKA 3B78A 3OTOE 3QT6A 1Z5CA 4DV1E 4X62I 1Z0VA 1IBKE 4OX9I 1ZM3A 4DR2E 4GKJE 1Z0TA 4USKA 2UUBI 1HNZE 2F4VE 4JI0I 4DR6E 1XMOI 4JI5E 2UUCE 4JI6I 2HHHI 4USMA 4GKKI 2UXBE 4URLA 1N0VC 4LFAI 4KHPE 2ZM6I 5BR8I 4DUYE 5LMNE 1N32I 1FI4A 4AQYE 5LMUE 2VF3A 3HULA 4MYUA 4DV3I 4JI7I 2XEXA 3M6AA 3K1JA 5IT9C 3WU3A 1WUUA 4I3HA 1B63A 1NHHA 5L3JA 1FJGE 1N34E 4DPYA 4DUZI 2UUAE 4FN5A 4LF5I 3WU6A 4B3SI 4EMDA 4X65E 4DV4E 1EA6A 1B62A 4DV5E 4DPXA 3ZZTA 1BKNA 4DV6I 4Z7CA 4B3MI 5IWAE 4LFBE 1N36I 4NXNE 4B3TE 4NXMI 2LJPA 3T1HI 3LPSA 4DR3E 4JI2I 4LF6I 4X64E 1Z59A 1Z0GA 1IBLE 3J80C 4JI4I 4JI8I 1Z0BA 1ZM4A 1PIEA 1VISA 3H4LA 4LF4I 1J5EE 4LF8I 4K0KE 1I94I 1HNXE 4DR4I 3T1YI 1PVGA 1HR0E 3ZKDA 3OTOI 4LFCE 2E5LE 3PYGA 1K47A 4YY3E 1IBKI 2AJ4A 4X66I 2EFGA 1MG7A 4DV7E 1HNZI 1EI1A 2F4VI 4DR6I 2UXBI 2HFSA 2BM1A 2DEJA 3K17A 4HY1A 4DUYI 1S16A 2VQEI 1N33E 4AQYI 2V8PA 4OX9E 2UUBE 2GS8A 4LF7I 1ELOA 4DXLA 1A6FA 4JI6E 3QT8A 2HHHE 1FNMA 2V34A 2Q2EB 4DV2E 4DR1E 2ZM6E 2BM0A 1XNQE 1FJGI 3GONA 1N34I 4JI1I 2UUAI 1N32E 1ZXNA 2V2QA 1HNWI 4DV4I 2R3VA 3JAMQ 1Z5AA 4JI7E 2V2VA 1QZRA 5A2QC 4WUCA 1D6TA 1FKAE 4DPUA 5IWAI 2V2ZA 1Z0EA 3PYEA 3ZKBA 1H7UA 4Z7YA 4DR3I 3CWVA 3B8HA 4LF5E 4B3RI 4X64I 4HYMA 3J7AM 4XTJA 3J7AG 3V2UC 2UU9E 1MX0A 1IBLI 1Z5BA 4JV5E 2HK2A 5IT9Q 1ZXMA 4LF9E 2BV3A 1NHJA 2J7KA 4HACB 4M1KA 4DV0E 4DR7I 1H72C 3J81Q 1FWKA 3WU5A 3F0NA 2X36A 1RREA 4HXZA 1N36E 4K0KI 3T1HE 2ZITA 3WU4A 2UXDE 1FWLA 1HR0I 4LF6E 2A2DA 4JYAE 3QT7A 3PYDA 4LFCI 2E5LI 4DR5E 1XNRI 4WUBA 1OJ4A 1KTVA 4FWGA 4DV1I 4JI4E 1H7SA 2OI2A 4JI3E 2VQFE 4DV7I 3ZM7A
chains in the Genus database with same CATH superfamily
2O1UA 3M7ND 1Z0WA 4DR2I 4YHHE 3B82A 4GKJI 2E1RA 3GLLA 1IBME 3KRNA 4JI5I 2WW4A 2UUCI 5C0XA 3P76A 4LF8E 4R1FA 2PNZB 5DRPA 3L7ZA 1XMQE 4DR4E 1KKHA 4KHPI 2UXCE 1N33I 5LMNI 1ZM9A 1XXEA 5FLXQ 2HKJA 4U3BA 4X66E 2NN6B 4X62E 4PRXA 3D4JA 5LMUI 4MU3A 3U1YA 4LOMA 4JI0E 2JE6A 1XMOE 5K36D 5GMDA 2Z5BB 4DV2I 3JAMC 4GKKE 2BR2B 1N0UA 3PYFA 4DR1I 4ISAA 3P3EA 4FW7A 1XNQI 4P52A 4LFAE 4FWHA 2Z5EA 5BR8E 2VQEE 1DARA 1RR9A 2JEBA 5K36E 4HACA 2A2CA 3NZKA 2NPFA 1NHIA 1UEKA 2PO1A 4WUDA 5K36C 4X65I 3P3GA 3ZZUA 1MU5A 4LF7E 2JEAA 2VESA 1HK7A 3ZZ0A 4DV5I 4DPWA 4DV3E 1U2RA 4AIMA 4FWDA 1S4EA 3PS2A 3HJCA 4FW3A 3J81C 4LFBI 4JI1E 2J65A 5DNXA 2C38B 2O1TA 4NXNI 4UT4A 4B3TI 4BA1B 3Q1QA 5JEAE 1HNWE 4DUZE 3LNUA 4LCFA 2HK3A 1E3HA 2UU9I 4OO1D 4B3SE 5JEAC 1RHYA 4DU7A 4JV5I 1ZM2A 1XHKA 4IFDE 5K36B 4LF9I 2CG9A 4P7AA 4DV0I 4IFDC 3V5RA 4PRVA 4ED4A 1YH8A 2ZBKB 5EKWA 4DV6E 1J5EI 2O1VA 5DROA 4B3ME 4BA2B 2DEIA 2NN6A 4UTGA 2R42A 2UXDI 1H73A 2IOQA 4NXME 4B3RE 4JYAI 4PU9A 4QNJA 1HNXI 1H74A 4JI2E 4QNKA 2NN6E 4DR5I 2WP8B 3M85D 1Z0CA 5A2QQ 2NN6C 4MYTA 2Z5BA 4JI3I 4RPFA 2VQFI 4YY3I 2CZ9A 4MQYA 5JEAB 2BA0G 4JI8E 2HFUA 2O3ZA 2C39B 5FLXC 1NZ0A 4YHHI 4DR7E 1IBMI 4JG4A 5LL6R 1OYRA 1E3PA 4IFDB 2WNRB 2X7IA 4ZVIA 4LF4E 4FW9A 4KQVA 1PKPA 5DRRA 4DPTA 1Y5YA 2HKEA 5GMEA 1XMQI 4DU8A 1I94E 1KIJA 4OO1B 4IZJA 2GO4A 3T1YE 2UXCI 3J80Q 1XNRE 3LTOA 3QT5A 1KVKA 3B78A 3OTOE 3QT6A 1Z5CA 2IESA 3H1CA 4DV1E 5C0XD 4X62I 1Z0VA 1IBKE 4OX9I 1ZM3A 4DR2E 4GKJE 1Z0TA 4USKA 4N3OA 2BA1G 4LCHA 1HNZE 2UUBI 4JI0I 2F4VE 4DR6E 1XMOI 4JI5E 2UUCE 4JI6I 4BA1A 3GMEA 2HHHI 4USMA 4GKKI 2UXBE 1USVA 4URLA 1N0VC 5DNLA 3P06A 2PO2B 4LFAI 4KHPE 2ZM6I 4IS9A 5ELWA 5K36A 5BR8I 1USUA 4DUYE 3M7NG 5LMNE 1N32I 1FI4A 4AQYE 5JEAF 5LMUE 2VF3A 3HULA 3K85A 2C37B 4MYUA 4DV3I 4JI7I 4IFDF 3Q6MA 2XEXA 3M6AA 3K1JA 2Z5CA 5IT9C 3WU3A 1WUUA 4I3HA 1B63A 1NHHA 5L3JA 5JEAA 1FJGE 1R6MA 1N34E 4DPYA 2C39A 4DUZI 2UUAE 4FN5A 4LF5I 3WU6A 4B3SI 4EMDA 4MU1A 4FW5A 4X65E 4LCGA 4IFDA 4DV4E 2NN6F 4MDTA 1EA6A 1UDQA 1B62A 4DV5E 4DPXA 4NBQA 2PNZA 4OO1A 3ZZTA 1BKNA 4DV6I 3HKMA 4Z7CA 4OKGA 4OO1E 4B3MI 3PS3A 1UDNA 5IWAE 4LFBE 3U1KA 3GCMA 1N36I 4OO1C 2PNMA 4NXNE 4B3TE 4NXMI 2LJPA 3T1HI 3LPSA 4DR3E 4JI2I 4LF6I 4X64E 1Z59A 1Z0GA 4MU0A 1IBLE 1Y4SA 4OZEA 3J80C 2JEBB 4JI8I 4JI4I 4FW4A 2BR2A 4IZKB 1Z0BA 2PO2A 2CVEA 2O1WA 5EL9A 1ZM4A 1Y6ZA 1PIEA 2PO0B 1VISA 3H4LA 4LF4I 1J5EE 2GQ0A 1OYSA 3B4TA 4LF8I 2F1DA 2AE8A 4K0KE 1I94I 1HNXE 5FWKA 4DR4I 3T1YI 1PVGA 1HR0E 3ZKDA 3OTOI 4LFCE 2E5LE 3DD6A 5DRQA 4AM3A 3PYGA 1K47A 4YY3E 1IBKI 2AJ4A 4X66I 2EFGA 5K36F 4U3DA 1MG7A 4DV7E 4IZJD 1EI1A 1VI7A 1HNZI 2F4VI 4DR6I 2C38A 2UXBI 3CDJA 3M85G 2HFSA 5C0XE 1R6LA 2BM1A 2DEJA 1Y60A 4AIDA 5C0XC 3K17A 4HY1A 4DUYI 1S16A 2VQEI 1N33E 2JT2A 4AQYI 3PRYA 2V8PA 4OX9E 3PS1A 2UUBE 2GS8A 4LF7I 1ELOA 4DXLA 1A6FA 4JI6E 4BA2A 3QT8A 2HHHE 1FNMA 2V34A 2Q2EB 4DV2E 3Q6NA 4DR1E 2IERA 2WP8A 2ZM6E 2BM0A 1XNQE 3P3CA 3GONA 4OO1F 1FJGI 1YHCA 2GO3A 1N34I 4JI1I 2UUAI 1N32E 1ZXNA 4IZKA 5C0XB 2IOPA 2CGEA 2V2QA 1HNWI 2PO0A 4IZJB 3L7ZB 4DV4I 1Y4UA 4MU4A 2WNRA 2R3VA 3JAMQ 1Z5AA 4JI7E 5JEAD 2V2VA 1QZRA 5A2QC 4WUCA 1D6TA 1FKAE 1OYPA 4DPUA 5IWAI 2BA0D 4IFDD 2V2ZA 1Z0EA 3PYEA 1UDSA 3ZKBA 1H7UA 3CDIA 4Z7YA 4DR3I 3CWVA 2JE6B 3B8HA 4LF5E 3UHMA 4X64I 4B3RI 4HYMA 3J7AM 4XTJA 3J7AG 3V2UC 2UU9E 1MX0A 1IBLI 1Z5BA 4JV5E 2PNLA 2HK2A 5IT9Q 4FW6A 1ZXMA 4GQUA 4LF9E 2BV3A 1NHJA 2J7KA 4HACB 4M1KA 2NN6D 4DV0E 1UDOA 4DR7I 2PO1B 1H72C 4J3DA 3J81Q 1FWKA 3WU5A 3F0NA 2X36A 2JEAB 1RREA 4HXZA 1N36E 4K0KI 3T1HE 2BA1D 2ZITA 3WU4A 2UXDE 1FWLA 5C0XF 1HR0I 2Z5CB 4LF6E 2A2DA 4JYAE 3QT7A 3PYDA 4LPFA 4LFCI 2E5LI 4DR5E 1XNRI 2C37A 4WUBA 1OJ4A 1KTVA 4FWGA 1P42A 4DV1I 4JI4E 1H7SA 2OI2A 4JI3E 2VQFE 4DV7I 3ZM7A
chains in the Genus database with same CATH topology
2O1UA 1Z0WA 4DR2I 4YHHE 3B82A 4GKJI 2E1RA 1IBME 4JI5I 2WW4A 2UUCI 4LF8E 4R1FA 1XMQE 4DR4E 1KKHA 4KHPI 2UXCE 1N33I 5LMNI 1ZM9A 5FLXQ 2HKJA 4X66E 4X62E 4PRXA 3D4JA 5LMUI 4JI0E 1XMOE 5GMDA 2Z5BB 4DV2I 3JAMC 4GKKE 1N0UA 3PYFA 4DR1I 1XNQI 4P52A 4LFAE 4FWHA 2Z5EA 5BR8E 2VQEE 1DARA 1RR9A 4HACA 2A2CA 2NPFA 1NHIA 1UEKA 4WUDA 4X65I 3ZZUA 1MU5A 4LF7E 1HK7A 3ZZ0A 4DV5I 4DPWA 4DV3E 1U2RA 4FWDA 1S4EA 3HJCA 3J81C 4LFBI 4JI1E 2O1TA 4NXNI 4UT4A 4B3TI 3Q1QA 1HNWE 4DUZE 3LNUA 2HK3A 2UU9I 4B3SE 4DU7A 4JV5I 1ZM2A 1XHKA 4LF9I 2CG9A 4P7AA 4DV0I 3V5RA 4PRVA 4ED4A 2ZBKB 4DV6E 1J5EI 2O1VA 4B3ME 2DEIA 4UTGA 2R42A 2UXDI 1H73A 2IOQA 4NXME 4B3RE 4JYAI 4PU9A 1HNXI 1H74A 4JI2E 4DR5I 1Z0CA 5A2QQ 4MYTA 2Z5BA 4JI3I 4RPFA 2VQFI 4YY3I 2CZ9A 4JI8E 2HFUA 5FLXC 1NZ0A 4YHHI 4DR7E 1IBMI 4JG4A 5LL6R 2X7IA 4ZVIA 4LF4E 4FW9A 4KQVA 1PKPA 4DPTA 2HKEA 5GMEA 1XMQI 4DU8A 1I94E 1KIJA 4IZJA 3T1YE 2UXCI 3J80Q 1XNRE 3LTOA 3QT5A 1KVKA 3B78A 3OTOE 3QT6A 1Z5CA 4DV1E 4X62I 1Z0VA 1IBKE 4OX9I 1ZM3A 4DR2E 4GKJE 1Z0TA 4USKA 4N3OA 2UUBI 1HNZE 2F4VE 4JI0I 4DR6E 1XMOI 4JI5E 2UUCE 4JI6I 2HHHI 4USMA 4GKKI 2UXBE 1USVA 4URLA 1N0VC 3P06A 4LFAI 4KHPE 2ZM6I 5BR8I 1USUA 4DUYE 5LMNE 1N32I 1FI4A 4AQYE 5LMUE 2VF3A 3HULA 3K85A 4MYUA 4DV3I 4JI7I 3Q6MA 2XEXA 3M6AA 3K1JA 2Z5CA 5IT9C 3WU3A 1WUUA 4I3HA 1B63A 1NHHA 5L3JA 1FJGE 1N34E 4DPYA 4DUZI 2UUAE 4FN5A 4LF5I 3WU6A 4B3SI 4EMDA 4X65E 4DV4E 1EA6A 1B62A 4DV5E 4DPXA 3ZZTA 1BKNA 4DV6I 4Z7CA 4B3MI 5IWAE 4LFBE 1N36I 2PNMA 4NXNE 4B3TE 4NXMI 2LJPA 3T1HI 3LPSA 4DR3E 4JI2I 4LF6I 4X64E 1Z59A 1Z0GA 1IBLE 1Y4SA 3J80C 4JI4I 4JI8I 4IZKB 1Z0BA 2O1WA 1ZM4A 1Y6ZA 1PIEA 1VISA 3H4LA 4LF4I 1J5EE 2GQ0A 4LF8I 4K0KE 1I94I 1HNXE 5FWKA 4DR4I 3T1YI 1PVGA 1HR0E 3ZKDA 3OTOI 4LFCE 2E5LE 3PYGA 1K47A 4YY3E 1IBKI 2AJ4A 4X66I 2EFGA 1MG7A 4DV7E 4IZJD 1EI1A 1HNZI 2F4VI 4DR6I 2UXBI 2HFSA 2BM1A 2DEJA 3K17A 4HY1A 4DUYI 1S16A 2VQEI 1N33E 4AQYI 3PRYA 2V8PA 4OX9E 2UUBE 2GS8A 4LF7I 1ELOA 4DXLA 1A6FA 4JI6E 3QT8A 2HHHE 1FNMA 2V34A 2Q2EB 4DV2E 3Q6NA 4DR1E 2ZM6E 2BM0A 1XNQE 1FJGI 3GONA 1N34I 4JI1I 2UUAI 1N32E 1ZXNA 4IZKA 2IOPA 2CGEA 2V2QA 1HNWI 4IZJB 4DV4I 1Y4UA 2R3VA 3JAMQ 1Z5AA 4JI7E 2V2VA 1QZRA 5A2QC 4WUCA 1D6TA 1FKAE 4DPUA 5IWAI 2V2ZA 1Z0EA 3PYEA 3ZKBA 1H7UA 4Z7YA 4DR3I 3CWVA 3B8HA 4LF5E 4B3RI 4X64I 4HYMA 3J7AM 4XTJA 3J7AG 3V2UC 2UU9E 1MX0A 1IBLI 1Z5BA 4JV5E 2PNLA 2HK2A 5IT9Q 1ZXMA 4LF9E 2BV3A 1NHJA 2J7KA 4HACB 4M1KA 4DV0E 4DR7I 1H72C 3J81Q 1FWKA 3WU5A 3F0NA 2X36A 1RREA 4HXZA 1N36E 4K0KI 3T1HE 2ZITA 3WU4A 2UXDE 1FWLA 1HR0I 2Z5CB 4LF6E 2A2DA 4JYAE 3QT7A 3PYDA 4LFCI 2E5LI 4DR5E 1XNRI 4WUBA 1OJ4A 1KTVA 4FWGA 4DV1I 4JI4E 1H7SA 2OI2A 4JI3E 2VQFE 4DV7I 3ZM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0W A;  4DR2 I;  4YHH E;  3B82 A;  4GKJ I;  2E1R A;  1IBM E;  4JI5 I;  2WW4 A;  2UUC I;  4LF8 E;  4R1F A;  1XMQ E;  4DR4 E;  1KKH A;  4KHP I;  2UXC E;  1N33 I;  5LMN I;  1ZM9 A;  5FLX Q;  2HKJ A;  4X66 E;  4X62 E;  4PRX A;  3D4J A;  5LMU I;  4JI0 E;  1XMO E;  5GMD A;  4DV2 I;  3JAM C;  4GKK E;  1N0U A;  3PYF A;  4DR1 I;  1XNQ I;  4P52 A;  4LFA E;  4FWH A;  5BR8 E;  2VQE E;  1DAR A;  1RR9 A;  4HAC A;  2A2C A;  2NPF A;  1NHI A;  1UEK A;  4WUD A;  4X65 I;  3ZZU A;  1MU5 A;  4LF7 E;  3ZZ0 A;  4DV5 I;  4DPW A;  4DV3 E;  1U2R A;  4FWD A;  1S4E A;  3J81 C;  4LFB I;  4JI1 E;  4NXN I;  4UT4 A;  4B3T I;  3Q1Q A;  1HNW E;  4DUZ E;  3LNU A;  2HK3 A;  2UU9 I;  4B3S E;  4DU7 A;  4JV5 I;  1ZM2 A;  1XHK A;  4LF9 I;  4P7A A;  4DV0 I;  3V5R A;  4PRV A;  4ED4 A;  2ZBK B;  4DV6 E;  1J5E I;  4B3M E;  2DEI A;  4UTG A;  2R42 A;  2UXD I;  1H73 A;  4NXM E;  4B3R E;  4JYA I;  4PU9 A;  1HNX I;  1H74 A;  4JI2 E;  4DR5 I;  1Z0C A;  5A2Q Q;  4MYT A;  4JI3 I;  4RPF A;  2VQF I;  4YY3 I;  2CZ9 A;  4JI8 E;  2HFU A;  5FLX C;  1NZ0 A;  4YHH I;  4DR7 E;  1IBM I;  4JG4 A;  5LL6 R;  2X7I A;  4ZVI A;  4LF4 E;  4FW9 A;  4KQV A;  1PKP A;  4DPT A;  2HKE A;  5GME A;  1XMQ I;  4DU8 A;  1I94 E;  1KIJ A;  3T1Y E;  2UXC I;  3J80 Q;  1XNR E;  3LTO A;  3QT5 A;  1KVK A;  3B78 A;  3OTO E;  3QT6 A;  1Z5C A;  4DV1 E;  4X62 I;  1Z0V A;  1IBK E;  4OX9 I;  1ZM3 A;  4DR2 E;  4GKJ E;  1Z0T A;  4USK A;  2UUB I;  1HNZ E;  2F4V E;  4JI0 I;  4DR6 E;  1XMO I;  4JI5 E;  2UUC E;  4JI6 I;  2HHH I;  4USM A;  4GKK I;  2UXB E;  4URL A;  1N0V C;  4LFA I;  4KHP E;  2ZM6 I;  5BR8 I;  4DUY E;  5LMN E;  1N32 I;  1FI4 A;  4AQY E;  5LMU E;  2VF3 A;  3HUL A;  4MYU A;  4DV3 I;  4JI7 I;  2XEX A;  3M6A A;  3K1J A;  5IT9 C;  3WU3 A;  1WUU A;  4I3H A;  1B63 A;  1NHH A;  5L3J A;  1FJG E;  1N34 E;  4DPY A;  4DUZ I;  2UUA E;  4FN5 A;  4LF5 I;  3WU6 A;  4B3S I;  4EMD A;  4X65 E;  4DV4 E;  1EA6 A;  1B62 A;  4DV5 E;  4DPX A;  3ZZT A;  1BKN A;  4DV6 I;  4Z7C A;  4B3M I;  5IWA E;  4LFB E;  1N36 I;  4NXN E;  4B3T E;  4NXM I;  2LJP A;  3T1H I;  3LPS A;  4DR3 E;  4JI2 I;  4LF6 I;  4X64 E;  1Z59 A;  1Z0G A;  1IBL E;  3J80 C;  4JI4 I;  4JI8 I;  1Z0B A;  1ZM4 A;  1PIE A;  1VIS A;  3H4L A;  4LF4 I;  1J5E E;  4LF8 I;  4K0K E;  1I94 I;  1HNX E;  4DR4 I;  3T1Y I;  1PVG A;  1HR0 E;  3ZKD A;  3OTO I;  4LFC E;  2E5L E;  3PYG A;  1K47 A;  4YY3 E;  1IBK I;  2AJ4 A;  4X66 I;  2EFG A;  1MG7 A;  4DV7 E;  1HNZ I;  1EI1 A;  2F4V I;  4DR6 I;  2UXB I;  2HFS A;  2BM1 A;  2DEJ A;  3K17 A;  4HY1 A;  4DUY I;  1S16 A;  2VQE I;  1N33 E;  4AQY I;  2V8P A;  4OX9 E;  2UUB E;  2GS8 A;  4LF7 I;  1ELO A;  4DXL A;  1A6F A;  4JI6 E;  3QT8 A;  2HHH E;  1FNM A;  2V34 A;  2Q2E B;  4DV2 E;  4DR1 E;  2ZM6 E;  2BM0 A;  1XNQ E;  1FJG I;  3GON A;  1N34 I;  4JI1 I;  2UUA I;  1N32 E;  1ZXN A;  2V2Q A;  1HNW I;  4DV4 I;  2R3V A;  3JAM Q;  1Z5A A;  4JI7 E;  2V2V A;  1QZR A;  5A2Q C;  4WUC A;  1D6T A;  1FKA E;  4DPU A;  5IWA I;  2V2Z A;  1Z0E A;  3PYE A;  3ZKB A;  1H7U A;  4Z7Y A;  4DR3 I;  3CWV A;  3B8H A;  4LF5 E;  4B3R I;  4X64 I;  4HYM A;  3J7A M;  4XTJ A;  3J7A G;  3V2U C;  2UU9 E;  1MX0 A;  1IBL I;  1Z5B A;  4JV5 E;  2HK2 A;  5IT9 Q;  1ZXM A;  4LF9 E;  2BV3 A;  1NHJ A;  2J7K A;  4HAC B;  4M1K A;  4DV0 E;  4DR7 I;  1H72 C;  3J81 Q;  1FWK A;  3WU5 A;  3F0N A;  2X36 A;  1RRE A;  4HXZ A;  1N36 E;  4K0K I;  3T1H E;  2ZIT A;  3WU4 A;  2UXD E;  1FWL A;  1HR0 I;  4LF6 E;  2A2D A;  4JYA E;  3QT7 A;  3PYD A;  4LFC I;  2E5L I;  4DR5 E;  1XNR I;  4WUB A;  1OJ4 A;  1KTV A;  4FWG A;  4DV1 I;  4JI4 E;  1H7S A;  2OI2 A;  4JI3 E;  2VQF E;  4DV7 I;  3ZM7 A; 
#chains in the Genus database with same CATH topology
 2O1U A;  3M7N D;  1Z0W A;  4DR2 I;  4YHH E;  3B82 A;  4GKJ I;  2E1R A;  3GLL A;  1IBM E;  3KRN A;  4JI5 I;  2WW4 A;  2UUC I;  5C0X A;  3P76 A;  4LF8 E;  4R1F A;  2PNZ B;  5DRP A;  3L7Z A;  1XMQ E;  4DR4 E;  1KKH A;  4KHP I;  2UXC E;  1N33 I;  5LMN I;  1ZM9 A;  1XXE A;  5FLX Q;  2HKJ A;  4U3B A;  4X66 E;  2NN6 B;  4X62 E;  4PRX A;  3D4J A;  5LMU I;  4MU3 A;  3U1Y A;  4LOM A;  4JI0 E;  2JE6 A;  1XMO E;  5K36 D;  5GMD A;  2Z5B B;  4DV2 I;  3JAM C;  4GKK E;  2BR2 B;  1N0U A;  3PYF A;  4DR1 I;  4ISA A;  3P3E A;  4FW7 A;  1XNQ I;  4P52 A;  4LFA E;  4FWH A;  2Z5E A;  5BR8 E;  2VQE E;  1DAR A;  1RR9 A;  2JEB A;  5K36 E;  4HAC A;  2A2C A;  3NZK A;  2NPF A;  1NHI A;  1UEK A;  2PO1 A;  4WUD A;  5K36 C;  4X65 I;  3P3G A;  3ZZU A;  1MU5 A;  4LF7 E;  2JEA A;  2VES A;  1HK7 A;  3ZZ0 A;  4DV5 I;  4DPW A;  4DV3 E;  1U2R A;  4AIM A;  4FWD A;  1S4E A;  3PS2 A;  3HJC A;  4FW3 A;  3J81 C;  4LFB I;  4JI1 E;  2J65 A;  5DNX A;  2C38 B;  2O1T A;  4NXN I;  4UT4 A;  4B3T I;  4BA1 B;  3Q1Q A;  5JEA E;  1HNW E;  4DUZ E;  3LNU A;  4LCF A;  2HK3 A;  1E3H A;  2UU9 I;  4OO1 D;  4B3S E;  5JEA C;  1RHY A;  4DU7 A;  4JV5 I;  1ZM2 A;  1XHK A;  4IFD E;  5K36 B;  4LF9 I;  2CG9 A;  4P7A A;  4DV0 I;  4IFD C;  3V5R A;  4PRV A;  4ED4 A;  1YH8 A;  2ZBK B;  5EKW A;  4DV6 E;  1J5E I;  2O1V A;  5DRO A;  4B3M E;  4BA2 B;  2DEI A;  2NN6 A;  4UTG A;  2R42 A;  2UXD I;  1H73 A;  2IOQ A;  4NXM E;  4B3R E;  4JYA I;  4PU9 A;  4QNJ A;  1HNX I;  1H74 A;  4JI2 E;  4QNK A;  2NN6 E;  4DR5 I;  2WP8 B;  3M85 D;  1Z0C A;  5A2Q Q;  2NN6 C;  4MYT A;  2Z5B A;  4JI3 I;  4RPF A;  2VQF I;  4YY3 I;  2CZ9 A;  4MQY A;  5JEA B;  2BA0 G;  4JI8 E;  2HFU A;  2O3Z A;  2C39 B;  5FLX C;  1NZ0 A;  4YHH I;  4DR7 E;  1IBM I;  4JG4 A;  5LL6 R;  1OYR A;  1E3P A;  4IFD B;  2WNR B;  2X7I A;  4ZVI A;  4LF4 E;  4FW9 A;  4KQV A;  1PKP A;  5DRR A;  4DPT A;  1Y5Y A;  2HKE A;  5GME A;  1XMQ I;  4DU8 A;  1I94 E;  1KIJ A;  4OO1 B;  4IZJ A;  2GO4 A;  3T1Y E;  2UXC I;  3J80 Q;  1XNR E;  3LTO A;  3QT5 A;  1KVK A;  3B78 A;  3OTO E;  3QT6 A;  1Z5C A;  2IES A;  3H1C A;  4DV1 E;  5C0X D;  4X62 I;  1Z0V A;  1IBK E;  4OX9 I;  1ZM3 A;  4DR2 E;  4GKJ E;  1Z0T A;  4USK A;  4N3O A;  2BA1 G;  4LCH A;  1HNZ E;  2UUB I;  4JI0 I;  2F4V E;  4DR6 E;  1XMO I;  4JI5 E;  2UUC E;  4JI6 I;  4BA1 A;  3GME A;  2HHH I;  4USM A;  4GKK I;  2UXB E;  1USV A;  4URL A;  1N0V C;  5DNL A;  3P06 A;  2PO2 B;  4LFA I;  4KHP E;  2ZM6 I;  4IS9 A;  5ELW A;  5K36 A;  5BR8 I;  1USU A;  4DUY E;  3M7N G;  5LMN E;  1N32 I;  1FI4 A;  4AQY E;  5JEA F;  5LMU E;  2VF3 A;  3HUL A;  3K85 A;  2C37 B;  4MYU A;  4DV3 I;  4JI7 I;  4IFD F;  3Q6M A;  2XEX A;  3M6A A;  3K1J A;  2Z5C A;  5IT9 C;  3WU3 A;  1WUU A;  4I3H A;  1B63 A;  1NHH A;  5L3J A;  5JEA A;  1FJG E;  1R6M A;  1N34 E;  4DPY A;  2C39 A;  4DUZ I;  2UUA E;  4FN5 A;  4LF5 I;  3WU6 A;  4B3S I;  4EMD A;  4MU1 A;  4FW5 A;  4X65 E;  4LCG A;  4IFD A;  4DV4 E;  2NN6 F;  4MDT A;  1EA6 A;  1UDQ A;  1B62 A;  4DV5 E;  4DPX A;  4NBQ A;  2PNZ A;  4OO1 A;  3ZZT A;  1BKN A;  4DV6 I;  3HKM A;  4Z7C A;  4OKG A;  4OO1 E;  4B3M I;  3PS3 A;  1UDN A;  5IWA E;  4LFB E;  3U1K A;  3GCM A;  1N36 I;  4OO1 C;  2PNM A;  4NXN E;  4B3T E;  4NXM I;  2LJP A;  3T1H I;  3LPS A;  4DR3 E;  4JI2 I;  4LF6 I;  4X64 E;  1Z59 A;  1Z0G A;  4MU0 A;  1IBL E;  1Y4S A;  4OZE A;  3J80 C;  2JEB B;  4JI8 I;  4JI4 I;  4FW4 A;  2BR2 A;  4IZK B;  1Z0B A;  2PO2 A;  2CVE A;  2O1W A;  5EL9 A;  1ZM4 A;  1Y6Z A;  1PIE A;  2PO0 B;  1VIS A;  3H4L A;  4LF4 I;  1J5E E;  2GQ0 A;  1OYS A;  3B4T A;  4LF8 I;  2F1D A;  2AE8 A;  4K0K E;  1I94 I;  1HNX E;  5FWK A;  4DR4 I;  3T1Y I;  1PVG A;  1HR0 E;  3ZKD A;  3OTO I;  4LFC E;  2E5L E;  3DD6 A;  5DRQ A;  4AM3 A;  3PYG A;  1K47 A;  4YY3 E;  1IBK I;  2AJ4 A;  4X66 I;  2EFG A;  5K36 F;  4U3D A;  1MG7 A;  4DV7 E;  4IZJ D;  1EI1 A;  1VI7 A;  1HNZ I;  2F4V I;  4DR6 I;  2C38 A;  2UXB I;  3CDJ A;  3M85 G;  2HFS A;  5C0X E;  1R6L A;  2BM1 A;  2DEJ A;  1Y60 A;  4AID A;  5C0X C;  3K17 A;  4HY1 A;  4DUY I;  1S16 A;  2VQE I;  1N33 E;  2JT2 A;  4AQY I;  3PRY A;  2V8P A;  4OX9 E;  3PS1 A;  2UUB E;  2GS8 A;  4LF7 I;  1ELO A;  4DXL A;  1A6F A;  4JI6 E;  4BA2 A;  3QT8 A;  2HHH E;  1FNM A;  2V34 A;  2Q2E B;  4DV2 E;  3Q6N A;  4DR1 E;  2IER A;  2WP8 A;  2ZM6 E;  2BM0 A;  1XNQ E;  3P3C A;  3GON A;  4OO1 F;  1FJG I;  1YHC A;  2GO3 A;  1N34 I;  4JI1 I;  2UUA I;  1N32 E;  1ZXN A;  4IZK A;  5C0X B;  2IOP A;  2CGE A;  2V2Q A;  1HNW I;  2PO0 A;  4IZJ B;  3L7Z B;  4DV4 I;  1Y4U A;  4MU4 A;  2WNR A;  2R3V A;  3JAM Q;  1Z5A A;  4JI7 E;  5JEA D;  2V2V A;  1QZR A;  5A2Q C;  4WUC A;  1D6T A;  1FKA E;  1OYP A;  4DPU A;  5IWA I;  2BA0 D;  4IFD D;  2V2Z A;  1Z0E A;  3PYE A;  1UDS A;  3ZKB A;  1H7U A;  3CDI A;  4Z7Y A;  4DR3 I;  3CWV A;  2JE6 B;  3B8H A;  4LF5 E;  3UHM A;  4X64 I;  4B3R I;  4HYM A;  3J7A M;  4XTJ A;  3J7A G;  3V2U C;  2UU9 E;  1MX0 A;  1IBL I;  1Z5B A;  4JV5 E;  2PNL A;  2HK2 A;  5IT9 Q;  4FW6 A;  1ZXM A;  4GQU A;  4LF9 E;  2BV3 A;  1NHJ A;  2J7K A;  4HAC B;  4M1K A;  2NN6 D;  4DV0 E;  1UDO A;  4DR7 I;  2PO1 B;  1H72 C;  4J3D A;  3J81 Q;  1FWK A;  3WU5 A;  3F0N A;  2X36 A;  2JEA B;  1RRE A;  4HXZ A;  1N36 E;  4K0K I;  3T1H E;  2BA1 D;  2ZIT A;  3WU4 A;  2UXD E;  1FWL A;  5C0X F;  1HR0 I;  2Z5C B;  4LF6 E;  2A2D A;  4JYA E;  3QT7 A;  3PYD A;  4LPF A;  4LFC I;  2E5L I;  4DR5 E;  1XNR I;  2C37 A;  4WUB A;  1OJ4 A;  1KTV A;  4FWG A;  1P42 A;  4DV1 I;  4JI4 E;  1H7S A;  2OI2 A;  4JI3 E;  2VQF E;  4DV7 I;  3ZM7 A; 
#chains in the Genus database with same CATH homology
 2O1U A;  1Z0W A;  4DR2 I;  4YHH E;  3B82 A;  4GKJ I;  2E1R A;  1IBM E;  4JI5 I;  2WW4 A;  2UUC I;  4LF8 E;  4R1F A;  1XMQ E;  4DR4 E;  1KKH A;  4KHP I;  2UXC E;  1N33 I;  5LMN I;  1ZM9 A;  5FLX Q;  2HKJ A;  4X66 E;  4X62 E;  4PRX A;  3D4J A;  5LMU I;  4JI0 E;  1XMO E;  5GMD A;  2Z5B B;  4DV2 I;  3JAM C;  4GKK E;  1N0U A;  3PYF A;  4DR1 I;  1XNQ I;  4P52 A;  4LFA E;  4FWH A;  2Z5E A;  5BR8 E;  2VQE E;  1DAR A;  1RR9 A;  4HAC A;  2A2C A;  2NPF A;  1NHI A;  1UEK A;  4WUD A;  4X65 I;  3ZZU A;  1MU5 A;  4LF7 E;  1HK7 A;  3ZZ0 A;  4DV5 I;  4DPW A;  4DV3 E;  1U2R A;  4FWD A;  1S4E A;  3HJC A;  3J81 C;  4LFB I;  4JI1 E;  2O1T A;  4NXN I;  4UT4 A;  4B3T I;  3Q1Q A;  1HNW E;  4DUZ E;  3LNU A;  2HK3 A;  2UU9 I;  4B3S E;  4DU7 A;  4JV5 I;  1ZM2 A;  1XHK A;  4LF9 I;  2CG9 A;  4P7A A;  4DV0 I;  3V5R A;  4PRV A;  4ED4 A;  2ZBK B;  4DV6 E;  1J5E I;  2O1V A;  4B3M E;  2DEI A;  4UTG A;  2R42 A;  2UXD I;  1H73 A;  2IOQ A;  4NXM E;  4B3R E;  4JYA I;  4PU9 A;  1HNX I;  1H74 A;  4JI2 E;  4DR5 I;  1Z0C A;  5A2Q Q;  4MYT A;  2Z5B A;  4JI3 I;  4RPF A;  2VQF I;  4YY3 I;  2CZ9 A;  4JI8 E;  2HFU A;  5FLX C;  1NZ0 A;  4YHH I;  4DR7 E;  1IBM I;  4JG4 A;  5LL6 R;  2X7I A;  4ZVI A;  4LF4 E;  4FW9 A;  4KQV A;  1PKP A;  4DPT A;  2HKE A;  5GME A;  1XMQ I;  4DU8 A;  1I94 E;  1KIJ A;  4IZJ A;  3T1Y E;  2UXC I;  3J80 Q;  1XNR E;  3LTO A;  3QT5 A;  1KVK A;  3B78 A;  3OTO E;  3QT6 A;  1Z5C A;  4DV1 E;  4X62 I;  1Z0V A;  1IBK E;  4OX9 I;  1ZM3 A;  4DR2 E;  4GKJ E;  1Z0T A;  4USK A;  4N3O A;  2UUB I;  1HNZ E;  2F4V E;  4JI0 I;  4DR6 E;  1XMO I;  4JI5 E;  2UUC E;  4JI6 I;  2HHH I;  4USM A;  4GKK I;  2UXB E;  1USV A;  4URL A;  1N0V C;  3P06 A;  4LFA I;  4KHP E;  2ZM6 I;  5BR8 I;  1USU A;  4DUY E;  5LMN E;  1N32 I;  1FI4 A;  4AQY E;  5LMU E;  2VF3 A;  3HUL A;  3K85 A;  4MYU A;  4DV3 I;  4JI7 I;  3Q6M A;  2XEX A;  3M6A A;  3K1J A;  2Z5C A;  5IT9 C;  3WU3 A;  1WUU A;  4I3H A;  1B63 A;  1NHH A;  5L3J A;  1FJG E;  1N34 E;  4DPY A;  4DUZ I;  2UUA E;  4FN5 A;  4LF5 I;  3WU6 A;  4B3S I;  4EMD A;  4X65 E;  4DV4 E;  1EA6 A;  1B62 A;  4DV5 E;  4DPX A;  3ZZT A;  1BKN A;  4DV6 I;  4Z7C A;  4B3M I;  5IWA E;  4LFB E;  1N36 I;  2PNM A;  4NXN E;  4B3T E;  4NXM I;  2LJP A;  3T1H I;  3LPS A;  4DR3 E;  4JI2 I;  4LF6 I;  4X64 E;  1Z59 A;  1Z0G A;  1IBL E;  1Y4S A;  3J80 C;  4JI4 I;  4JI8 I;  4IZK B;  1Z0B A;  2O1W A;  1ZM4 A;  1Y6Z A;  1PIE A;  1VIS A;  3H4L A;  4LF4 I;  1J5E E;  2GQ0 A;  4LF8 I;  4K0K E;  1I94 I;  1HNX E;  5FWK A;  4DR4 I;  3T1Y I;  1PVG A;  1HR0 E;  3ZKD A;  3OTO I;  4LFC E;  2E5L E;  3PYG A;  1K47 A;  4YY3 E;  1IBK I;  2AJ4 A;  4X66 I;  2EFG A;  1MG7 A;  4DV7 E;  4IZJ D;  1EI1 A;  1HNZ I;  2F4V I;  4DR6 I;  2UXB I;  2HFS A;  2BM1 A;  2DEJ A;  3K17 A;  4HY1 A;  4DUY I;  1S16 A;  2VQE I;  1N33 E;  4AQY I;  3PRY A;  2V8P A;  4OX9 E;  2UUB E;  2GS8 A;  4LF7 I;  1ELO A;  4DXL A;  1A6F A;  4JI6 E;  3QT8 A;  2HHH E;  1FNM A;  2V34 A;  2Q2E B;  4DV2 E;  3Q6N A;  4DR1 E;  2ZM6 E;  2BM0 A;  1XNQ E;  1FJG I;  3GON A;  1N34 I;  4JI1 I;  2UUA I;  1N32 E;  1ZXN A;  4IZK A;  2IOP A;  2CGE A;  2V2Q A;  1HNW I;  4IZJ B;  4DV4 I;  1Y4U A;  2R3V A;  3JAM Q;  1Z5A A;  4JI7 E;  2V2V A;  1QZR A;  5A2Q C;  4WUC A;  1D6T A;  1FKA E;  4DPU A;  5IWA I;  2V2Z A;  1Z0E A;  3PYE A;  3ZKB A;  1H7U A;  4Z7Y A;  4DR3 I;  3CWV A;  3B8H A;  4LF5 E;  4B3R I;  4X64 I;  4HYM A;  3J7A M;  4XTJ A;  3J7A G;  3V2U C;  2UU9 E;  1MX0 A;  1IBL I;  1Z5B A;  4JV5 E;  2PNL A;  2HK2 A;  5IT9 Q;  1ZXM A;  4LF9 E;  2BV3 A;  1NHJ A;  2J7K A;  4HAC B;  4M1K A;  4DV0 E;  4DR7 I;  1H72 C;  3J81 Q;  1FWK A;  3WU5 A;  3F0N A;  2X36 A;  1RRE A;  4HXZ A;  1N36 E;  4K0K I;  3T1H E;  2ZIT A;  3WU4 A;  2UXD E;  1FWL A;  1HR0 I;  2Z5C B;  4LF6 E;  2A2D A;  4JYA E;  3QT7 A;  3PYD A;  4LFC I;  2E5L I;  4DR5 E;  1XNR I;  4WUB A;  1OJ4 A;  1KTV A;  4FWG A;  4DV1 I;  4JI4 E;  1H7S A;  2OI2 A;  4JI3 E;  2VQF E;  4DV7 I;  3ZM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...