4X64I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x64I00
4LFBI 2F4VE 1Z5BA 1MG7A 3LPSA 4FW9A 1N34E 4OX9I 4DV3E 2UUAE 1U2RA 4DR3E 5BR8I 1KIJA 3WU4A 4LFAI 1D6TA 4HYMA 4JI5E 1NZ0A 4PU9A 2HKJA 3T1YI 1H7UA 4LFBE 1ZM3A 4LFCI 1XMOI 4NXME 1XMQI 4DPTA 2VF3A 5IT9C 1BKNA 4DR7I 4GKJE 3PYFA 4DPWA 5A2QC 4JI6E 1IBME 1N36E 1N0VC 4DV6E 1HNXE 4LFAE 4EMDA 1KVKA 3PYDA 4JG4A 4ZVIA 1ZXMA 1N33I 4B3SE 1ZM9A 1NHJA 2E1RA 2A2CA 3CWVA 4JV5I 2VQFE 1XMOE 3QT8A 4MYTA 1XNRI 2UXDI 4JI4E 3T1HE 4JI0I 2R3VA 1EI1A 2V2VA 1FWKA 1N32E 1PKPA 2BV3A 4KHPI 4P52A 4DR2I 4B3RI 1A6FA 4USMA 1HNWE 1Z0VA 4X62E 1Z0GA 1N33E 3ZZ0A 4AQYE 1FWLA 4YY3I 2EFGA 4JV5E 1Z5CA 1B62A 2HKEA 4YHHI 4DV0E 1H72C 3ZM7A 2UXDE 2UXBI 1HNZI 4DR4I 1MX0A 4HACA 4B3TI 1HR0I 4JYAI 2A2DA 1ELOA 4LF9I 3ZZUA 2UUCE 1MU5A 2V34A 1I94I 1VISA 4DR1I 2UU9I 2HK2A 1XNQE 2HFUA 2ZBKB 4LF6I 3Q1QA 4DUYI 4DV1E 4X64E 4JI3E 1Z59A 2E5LI 5FLXC 4USKA 4B3ME 5GMEA 1RREA 4DUZI 4X66I 4GKKE 1H73A 2HFSA 3OTOI 2UUBI 4LF7I 1I94E 4JI7E 2X7IA 3QT5A 4DR6E 3D4JA 4DV4E 2X36A 4DV2E 1NHIA 4JI1E 2UXCI 4XTJA 1N0UA 4Z7CA 4DUYE 5LMUI 3ZKBA 2OI2A 4OX9E 1Z5AA 5IWAI 5BR8E 3J7AG 4DU8A 4LF8I 3M6AA 3B78A 1S4EA 4WUCA 3F0NA 2UXCE 3T1YE 3J7AM 3J81Q 3LTOA 3ZZTA 2J7KA 4LFCE 1IBLI 3WU5A 1XMQE 4DV5I 1UEKA 4DR7E 4NXNI 3HULA 1H7SA 1KKHA 3WU6A 3V5RA 4K0KI 2GS8A 3H4LA 1KTVA 1FNMA 2BM0A 4HACB 1XNRE 1FJGI 1IBKI 1J5EI 4JI0E 4JI8I 3K1JA 4LF4I 3LNUA 4KQVA 4KHPE 4DR2E 2F4VI 4B3RE 3V2UC 2VQEI 4DV7I 1N34I 2WW4A 4DV3I 3J81C 2UUAI 4YY3E 4DR3I 1FKAE 5A2QQ 1Z0CA 4YHHE 2NPFA 1OJ4A 1FJGE 4DPYA 4LF5I 1J5EE 2UXBE 1HNZE 4JI5I 4DR4E 3B82A 4JI8E 4B3TE 1HR0E 4JYAE 1PVGA 4LF9E 5L3JA 4UT4A 2DEIA 4HXZA 4HY1A 1PIEA 4URLA 2BM1A 2DEJA 4DR1E 4NXMI 1XHKA 2VQEE 4DV7E 2UU9E 2CZ9A 3GONA 4LF6E 1ZM2A 3QT7A 4MYUA 4GKJI 4JI2I 4JI6I 1IBMI 3PYEA 4FN5A 2E5LE 4FWHA 1N36I 4DV6I 1HNXI 1S16A 1Z0BA 4LF5E 4DUZE 4X66E 2ZM6I 4FWDA 3OTOE 4WUDA 3K17A 4B3SI 3QT6A 2UUBE 4DU7A 4Z7YA 4LF7E 2XEXA 2VQFI 1QZRA 2Q2EB 3J80Q 1EA6A 4JI4I 1DARA 3T1HI 4DXLA 2V8PA 5LMUE 4JI2E 1N32I 4WUBA 5IWAE 2R42A 4P7AA 2ZM6E 1K47A 5LL6R 1Z0EA 1B63A 1HNWI 3JAMQ 4LF8E 1WUUA 4X62I 4AQYI 2V2QA 4DPUA 4DV0I 4R1FA 1ZXNA 5FLXQ 3B8HA 1ZM4A 3PYGA 4ED4A 3WU3A 4M1KA 5GMDA 2V2ZA 4FWGA 1Z0WA 1IBLE 1RR9A 2LJPA 5LMNI 2UUCI 4DV5E 4X65I 4DR5I 2HHHI 4NXNE 1XNQI 4PRXA 2ZITA 4K0KE 1Z0TA 4DV1I 4X64I 4DPXA 4JI3I 4UTGA 1H74A 4B3MI 3J80C 3ZKDA 5IT9Q 4RPFA 4GKKI 5LMNE 1IBKE 2HK3A 4X65E 4DR5E 4JI7I 2HHHE 1FI4A 4I3HA 4DR6I 4DV4I 1NHHA 4DV2I 4LF4E 3JAMC 4JI1I 2AJ4A 4PRVA
chains in the Genus database with same CATH superfamily
2NN6C 3GLLA 4LFBI 4QNKA 2F4VE 1Z5BA 1MG7A 2NN6D 3LPSA 4FW9A 1N34E 2AE8A 4OX9I 3U1YA 4DV3E 2UUAE 1U2RA 4DR3E 5BR8I 1KIJA 2C39B 2JE6B 4LPFA 3WU4A 4LFAI 1D6TA 4HYMA 2Z5BB 5JEAE 3CDIA 4JI5E 1NZ0A 4PU9A 1USVA 2HKJA 2C39A 2JEAB 3T1YI 5DNLA 2Z5BA 1H7UA 4IFDB 4LFBE 1HK7A 1ZM3A 4LFCI 1XMOI 4NXME 1XMQI 5K36A 2IOPA 3GMEA 4DPTA 2VF3A 5IT9C 1BKNA 4DR7I 2NN6E 4GKJE 3PYFA 4DPWA 5A2QC 4JI6E 1IBME 1N36E 4MQYA 1N0VC 4DV6E 2C37B 4MU4A 1HNXE 4LFAE 4AIDA 2O3ZA 5ELWA 2Z5CB 4EMDA 1KVKA 3PYDA 4JG4A 4ZVIA 1ZXMA 4GQUA 2C37A 1N33I 4B3SE 2Z5EA 4OO1E 1ZM9A 1NHJA 2E1RA 2A2CA 2JT2A 3CWVA 2VESA 4JV5I 2VQFE 1XMOE 3QT8A 4MYTA 2PO1B 1XNRI 5JEAA 2UXDI 4IZKB 4JI4E 3T1HE 2WNRA 4JI0I 2R3VA 1EI1A 2O1WA 2V2VA 1FWKA 1N32E 5C0XB 4IZJA 1PKPA 4IZKA 2BV3A 4KHPI 4P52A 4DR2I 4B3RI 1A6FA 4USMA 1HNWE 1Z0VA 4X62E 1Z0GA 1N33E 4LOMA 2PO0B 2NN6A 3ZZ0A 1FWLA 2BR2B 3GCMA 4YY3I 4AQYE 2EFGA 4JV5E 1Z5CA 1B62A 2HKEA 4YHHI 4LCGA 4DV0E 1H72C 3ZM7A 4OO1B 2UXDE 2BR2A 2UXBI 3H1CA 1HNZI 4DR4I 1MX0A 4HACA 4B3TI 1HR0I 4JYAI 2A2DA 2GO4A 1ELOA 4LF9I 3ZZUA 3U1KA 2UUCE 1MU5A 2PNZB 2V34A 1I94I 5K36E 2F1DA 1VISA 5EL9A 4DR1I 5EKWA 2UU9I 2GO3A 2HK2A 1XNQE 3NZKA 2HFUA 2ZBKB 4LF6I 3Q1QA 2PNZA 4U3DA 4DUYI 4DV1E 4X64E 3M7NG 1VI7A 1Z59A 4JI3E 3L7ZA 2O1UA 2E5LI 4BA1A 5FLXC 4USKA 4B3ME 5DRQA 5GMEA 1RREA 4DUZI 4X66I 4GKKE 1H73A 2HFSA 3OTOI 2UUBI 4LF7I 1OYRA 2PO2B 1I94E 4JI7E 2X7IA 3QT5A 1RHYA 4DR6E 3D4JA 4DV4E 2X36A 4DV2E 1NHIA 4JI1E 2UXCI 4XTJA 5K36B 4BA2A 1N0UA 4Z7CA 4DUYE 2PO2A 5LMUI 3ZKBA 2OI2A 4OX9E 1Z5AA 5IWAI 4NBQA 4ISAA 5BR8E 1YHCA 2BA1D 3J7AG 4DU8A 2O1TA 4LF8I 3M6AA 3B78A 5DNXA 3KRNA 1S4EA 4WUCA 3F0NA 4U3BA 3B4TA 2UXCE 5JEAB 3T1YE 3J7AM 3HKMA 4J3DA 3J81Q 3LTOA 3ZZTA 2WNRB 2J7KA 4LFCE 1IBLI 4IZJB 3WU5A 1XMQE 4MU3A 3UHMA 4DV5I 1UEKA 4N3OA 1UDOA 4DR7E 2J65A 4NXNI 3HULA 5DRRA 1H7SA 1KKHA 3P06A 2CVEA 3WU6A 3V5RA 2NN6B 3PS2A 4K0KI 2GS8A 3H4LA 1Y6ZA 1KTVA 1FNMA 2BM0A 4HACB 3M85D 1Y4SA 1XNRE 3M7ND 1FJGI 1IBKI 1J5EI 4JI0E 4JI8I 3K1JA 4LF4I 3LNUA 4FW4A 4KQVA 4KHPE 4DR2E 2F4VI 4B3RE 2BA0G 5C0XF 1YH8A 3L7ZB 2JEBB 4OZEA 3K85A 3V2UC 2VQEI 4BA1B 4DV7I 1N34I 2WW4A 3P3EA 2IOQA 2PNLA 1P42A 4DV3I 3J81C 2UUAI 4YY3E 4DR3I 1FKAE 5A2QQ 1Z0CA 4YHHE 2JEBA 2NPFA 1OJ4A 1FJGE 5DRPA 4DPYA 4LF5I 1J5EE 2CG9A 2UXBE 1HNZE 4JI5I 4DR4E 3B82A 3DD6A 1E3HA 1Y4UA 4JI8E 1HR0E 4B3TE 1PVGA 4JYAE 4OO1F 4LF9E 5C0XC 1UDNA 5L3JA 4UT4A 2DEIA 4BA2B 4HXZA 5C0XD 4HY1A 2C38A 4AM3A 1PIEA 4URLA 3Q6MA 2BM1A 2DEJA 3P3GA 4DR1E 3PRYA 4FW6A 4NXMI 1XHKA 2VQEE 4DV7E 2UU9E 1Y60A 2CZ9A 3GONA 4LF6E 1ZM2A 3QT7A 4MYUA 4GKJI 3PS3A 4JI2I 4JI6I 1IBMI 3PYEA 4FN5A 3P3CA 2E5LE 4FWHA 1N36I 4DV6I 1HNXI 1S16A 2IESA 4OO1C 1Z0BA 4LF5E 4IS9A 4DUZE 4OO1D 4X66E 2ZM6I 4FWDA 3OTOE 4WUDA 3K17A 2JE6A 1OYSA 4MU0A 4B3SI 3QT6A 3HJCA 2UUBE 4DU7A 4Z7YA 4LF7E 2XEXA 2VQFI 2GQ0A 1QZRA 2JEAA 2Q2EB 5C0XE 3J80Q 1EA6A 1UDQA 4JI4I 1DARA 4MU1A 3T1HI 4DXLA 4IFDA 2V8PA 3PS1A 5LMUE 1UDSA 4JI2E 1N32I 5K36F 4IFDF 4FW5A 4WUBA 5IWAE 2R42A 4P7AA 2ZM6E 1K47A 5LL6R 1R6MA 1Z0EA 4AIMA 1B63A 2WP8B 1HNWI 3JAMQ 4LF8E 1WUUA 4X62I 1E3PA 4AQYI 1OYPA 2Z5CA 4FW7A 2V2QA 4DPUA 4DV0I 4R1FA 1USUA 2WP8A 1ZXNA 4LCHA 5FLXQ 3B8HA 1ZM4A 2BA0D 3PYGA 2BA1G 4ED4A 3WU3A 5K36C 4M1KA 5GMDA 4IFDC 2CGEA 5K36D 5FWKA 2V2ZA 4FWGA 5JEAF 1Z0WA 1IBLE 1RR9A 2PO1A 2O1VA 4IFDD 2LJPA 3Q6NA 5LMNI 2PNMA 2UUCI 4DV5E 4X65I 4DR5I 2HHHI 4NXNE 5C0XA 1XNQI 4PRXA 2ZITA 1Y5YA 1Z0TA 4K0KE 4DV1I 4X64I 4QNJA 4DPXA 4JI3I 4UTGA 1H74A 4OKGA 2NN6F 1XXEA 4B3MI 5JEAC 3J80C 2PO0A 3ZKDA 1R6LA 5IT9Q 4MDTA 3P76A 4RPFA 5JEAD 4GKKI 2IERA 4FW3A 4OO1A 3CDJA 5LMNE 4LCFA 1IBKE 2HK3A 2C38B 5DROA 4X65E 4IZJD 4DR5E 4JI7I 2HHHE 4IFDE 1FI4A 4I3HA 4DR6I 4DV4I 1NHHA 4DV2I 4LF4E 3JAMC 4JI1I 2AJ4A 4PRVA 3M85G
chains in the Genus database with same CATH topology
4LFBI 2F4VE 1Z5BA 1MG7A 3LPSA 4FW9A 1N34E 4OX9I 4DV3E 2UUAE 1U2RA 4DR3E 5BR8I 1KIJA 3WU4A 4LFAI 1D6TA 4HYMA 2Z5BB 4JI5E 1NZ0A 4PU9A 1USVA 2HKJA 3T1YI 2Z5BA 1H7UA 4LFBE 1HK7A 1ZM3A 4LFCI 1XMOI 4NXME 1XMQI 2IOPA 4DPTA 2VF3A 5IT9C 1BKNA 4DR7I 4GKJE 3PYFA 4DPWA 5A2QC 4JI6E 1IBME 1N36E 1N0VC 4DV6E 1HNXE 4LFAE 4EMDA 2Z5CB 1KVKA 3PYDA 4JG4A 4ZVIA 1ZXMA 1N33I 4B3SE 2Z5EA 1ZM9A 1NHJA 2E1RA 2A2CA 3CWVA 4JV5I 2VQFE 1XMOE 3QT8A 4MYTA 1XNRI 2UXDI 4IZKB 4JI4E 3T1HE 4JI0I 2R3VA 1EI1A 2O1WA 2V2VA 1FWKA 1N32E 4IZJA 1PKPA 4IZKA 2BV3A 4KHPI 4P52A 4DR2I 4B3RI 1A6FA 4USMA 1HNWE 1Z0VA 4X62E 1Z0GA 1N33E 3ZZ0A 4AQYE 1FWLA 4YY3I 2EFGA 4JV5E 1Z5CA 1B62A 2HKEA 4YHHI 4DV0E 1H72C 3ZM7A 2UXDE 2UXBI 1HNZI 4DR4I 1MX0A 4HACA 4B3TI 1HR0I 4JYAI 2A2DA 1ELOA 4LF9I 3ZZUA 2UUCE 1MU5A 2V34A 1I94I 1VISA 4DR1I 2UU9I 2HK2A 1XNQE 2HFUA 2ZBKB 4LF6I 3Q1QA 4DUYI 4DV1E 4X64E 4JI3E 1Z59A 2O1UA 2E5LI 5FLXC 4USKA 4B3ME 5GMEA 1RREA 4DUZI 4X66I 4GKKE 1H73A 2HFSA 3OTOI 2UUBI 4LF7I 1I94E 4JI7E 2X7IA 3QT5A 4DR6E 3D4JA 4DV4E 2X36A 4DV2E 1NHIA 4JI1E 2UXCI 4XTJA 1N0UA 4Z7CA 4DUYE 5LMUI 3ZKBA 2OI2A 4OX9E 1Z5AA 5IWAI 5BR8E 3J7AG 4DU8A 2O1TA 4LF8I 3M6AA 3B78A 1S4EA 4WUCA 3F0NA 2UXCE 3T1YE 3J7AM 3J81Q 3LTOA 3ZZTA 2J7KA 4LFCE 1IBLI 4IZJB 3WU5A 1XMQE 4DV5I 1UEKA 4N3OA 4DR7E 4NXNI 3HULA 1H7SA 1KKHA 3P06A 3WU6A 3V5RA 4K0KI 2GS8A 3H4LA 1Y6ZA 1KTVA 1FNMA 2BM0A 4HACB 1Y4SA 1XNRE 1FJGI 1IBKI 1J5EI 4JI0E 4JI8I 3K1JA 4LF4I 3LNUA 4KQVA 4KHPE 4DR2E 2F4VI 4B3RE 3K85A 3V2UC 2VQEI 4DV7I 1N34I 2WW4A 2IOQA 2PNLA 4DV3I 3J81C 2UUAI 4YY3E 4DR3I 1FKAE 5A2QQ 1Z0CA 4YHHE 2NPFA 1OJ4A 1FJGE 4DPYA 4LF5I 1J5EE 2CG9A 2UXBE 1HNZE 4JI5I 4DR4E 3B82A 4JI8E 1Y4UA 4B3TE 1HR0E 4JYAE 1PVGA 4LF9E 5L3JA 4UT4A 2DEIA 4HXZA 4HY1A 1PIEA 4URLA 3Q6MA 2BM1A 2DEJA 4DR1E 3PRYA 4NXMI 1XHKA 2VQEE 4DV7E 2UU9E 2CZ9A 3GONA 4LF6E 1ZM2A 3QT7A 4MYUA 4GKJI 4JI2I 4JI6I 1IBMI 3PYEA 4FN5A 2E5LE 4FWHA 1N36I 4DV6I 1HNXI 1S16A 1Z0BA 4LF5E 4DUZE 4X66E 2ZM6I 4FWDA 3OTOE 4WUDA 3K17A 4B3SI 3QT6A 3HJCA 2UUBE 4DU7A 4Z7YA 4LF7E 2XEXA 2VQFI 2GQ0A 1QZRA 2Q2EB 3J80Q 1EA6A 4JI4I 1DARA 3T1HI 4DXLA 2V8PA 5LMUE 4JI2E 1N32I 4WUBA 5IWAE 2R42A 4P7AA 2ZM6E 1K47A 5LL6R 1Z0EA 1B63A 1HNWI 3JAMQ 4LF8E 1WUUA 4X62I 4AQYI 2Z5CA 2V2QA 4DPUA 4DV0I 4R1FA 1USUA 1ZXNA 5FLXQ 3B8HA 1ZM4A 3PYGA 4ED4A 3WU3A 4M1KA 5GMDA 2CGEA 5FWKA 2V2ZA 4FWGA 1Z0WA 1IBLE 1RR9A 2O1VA 2LJPA 3Q6NA 5LMNI 2PNMA 2UUCI 4DV5E 4X65I 4DR5I 2HHHI 4NXNE 1XNQI 4PRXA 2ZITA 4K0KE 1Z0TA 4DV1I 4X64I 4DPXA 4JI3I 4UTGA 1H74A 4B3MI 3J80C 3ZKDA 5IT9Q 4RPFA 4GKKI 5LMNE 1IBKE 2HK3A 4X65E 4DR5E 4IZJD 4JI7I 2HHHE 1FI4A 4I3HA 4DR6I 4DV4I 1NHHA 4DV2I 4LF4E 3JAMC 4JI1I 2AJ4A 4PRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB I;  2F4V E;  1Z5B A;  1MG7 A;  3LPS A;  4FW9 A;  1N34 E;  4OX9 I;  4DV3 E;  2UUA E;  1U2R A;  4DR3 E;  5BR8 I;  1KIJ A;  3WU4 A;  4LFA I;  1D6T A;  4HYM A;  4JI5 E;  1NZ0 A;  4PU9 A;  2HKJ A;  3T1Y I;  1H7U A;  4LFB E;  1ZM3 A;  4LFC I;  1XMO I;  4NXM E;  1XMQ I;  4DPT A;  2VF3 A;  5IT9 C;  1BKN A;  4DR7 I;  4GKJ E;  3PYF A;  4DPW A;  5A2Q C;  4JI6 E;  1IBM E;  1N36 E;  1N0V C;  4DV6 E;  1HNX E;  4LFA E;  4EMD A;  1KVK A;  3PYD A;  4JG4 A;  4ZVI A;  1ZXM A;  1N33 I;  4B3S E;  1ZM9 A;  1NHJ A;  2E1R A;  2A2C A;  3CWV A;  4JV5 I;  2VQF E;  1XMO E;  3QT8 A;  4MYT A;  1XNR I;  2UXD I;  4JI4 E;  3T1H E;  4JI0 I;  2R3V A;  1EI1 A;  2V2V A;  1FWK A;  1N32 E;  1PKP A;  2BV3 A;  4KHP I;  4P52 A;  4DR2 I;  4B3R I;  1A6F A;  4USM A;  1HNW E;  1Z0V A;  4X62 E;  1Z0G A;  1N33 E;  3ZZ0 A;  4AQY E;  1FWL A;  4YY3 I;  2EFG A;  4JV5 E;  1Z5C A;  1B62 A;  2HKE A;  4YHH I;  4DV0 E;  1H72 C;  3ZM7 A;  2UXD E;  2UXB I;  1HNZ I;  4DR4 I;  1MX0 A;  4HAC A;  4B3T I;  1HR0 I;  4JYA I;  2A2D A;  1ELO A;  4LF9 I;  3ZZU A;  2UUC E;  1MU5 A;  2V34 A;  1I94 I;  1VIS A;  4DR1 I;  2UU9 I;  2HK2 A;  1XNQ E;  2HFU A;  2ZBK B;  4LF6 I;  3Q1Q A;  4DUY I;  4DV1 E;  4X64 E;  4JI3 E;  1Z59 A;  2E5L I;  5FLX C;  4USK A;  4B3M E;  5GME A;  1RRE A;  4DUZ I;  4X66 I;  4GKK E;  1H73 A;  2HFS A;  3OTO I;  2UUB I;  4LF7 I;  1I94 E;  4JI7 E;  2X7I A;  3QT5 A;  4DR6 E;  3D4J A;  4DV4 E;  2X36 A;  4DV2 E;  1NHI A;  4JI1 E;  2UXC I;  4XTJ A;  1N0U A;  4Z7C A;  4DUY E;  5LMU I;  3ZKB A;  2OI2 A;  4OX9 E;  1Z5A A;  5IWA I;  5BR8 E;  3J7A G;  4DU8 A;  4LF8 I;  3M6A A;  3B78 A;  1S4E A;  4WUC A;  3F0N A;  2UXC E;  3T1Y E;  3J7A M;  3J81 Q;  3LTO A;  3ZZT A;  2J7K A;  4LFC E;  1IBL I;  3WU5 A;  1XMQ E;  4DV5 I;  1UEK A;  4DR7 E;  4NXN I;  3HUL A;  1H7S A;  1KKH A;  3WU6 A;  3V5R A;  4K0K I;  2GS8 A;  3H4L A;  1KTV A;  1FNM A;  2BM0 A;  4HAC B;  1XNR E;  1FJG I;  1IBK I;  1J5E I;  4JI0 E;  4JI8 I;  3K1J A;  4LF4 I;  3LNU A;  4KQV A;  4KHP E;  4DR2 E;  2F4V I;  4B3R E;  3V2U C;  2VQE I;  4DV7 I;  1N34 I;  2WW4 A;  4DV3 I;  3J81 C;  2UUA I;  4YY3 E;  4DR3 I;  1FKA E;  5A2Q Q;  1Z0C A;  4YHH E;  2NPF A;  1OJ4 A;  1FJG E;  4DPY A;  4LF5 I;  1J5E E;  2UXB E;  1HNZ E;  4JI5 I;  4DR4 E;  3B82 A;  4JI8 E;  4B3T E;  1HR0 E;  4JYA E;  1PVG A;  4LF9 E;  5L3J A;  4UT4 A;  2DEI A;  4HXZ A;  4HY1 A;  1PIE A;  4URL A;  2BM1 A;  2DEJ A;  4DR1 E;  4NXM I;  1XHK A;  2VQE E;  4DV7 E;  2UU9 E;  2CZ9 A;  3GON A;  4LF6 E;  1ZM2 A;  3QT7 A;  4MYU A;  4GKJ I;  4JI2 I;  4JI6 I;  1IBM I;  3PYE A;  4FN5 A;  2E5L E;  4FWH A;  1N36 I;  4DV6 I;  1HNX I;  1S16 A;  1Z0B A;  4LF5 E;  4DUZ E;  4X66 E;  2ZM6 I;  4FWD A;  3OTO E;  4WUD A;  3K17 A;  4B3S I;  3QT6 A;  2UUB E;  4DU7 A;  4Z7Y A;  4LF7 E;  2XEX A;  2VQF I;  1QZR A;  2Q2E B;  3J80 Q;  1EA6 A;  4JI4 I;  1DAR A;  3T1H I;  4DXL A;  2V8P A;  5LMU E;  4JI2 E;  1N32 I;  4WUB A;  5IWA E;  2R42 A;  4P7A A;  2ZM6 E;  1K47 A;  5LL6 R;  1Z0E A;  1B63 A;  1HNW I;  3JAM Q;  4LF8 E;  1WUU A;  4X62 I;  4AQY I;  2V2Q A;  4DPU A;  4DV0 I;  4R1F A;  1ZXN A;  5FLX Q;  3B8H A;  1ZM4 A;  3PYG A;  4ED4 A;  3WU3 A;  4M1K A;  5GMD A;  2V2Z A;  4FWG A;  1Z0W A;  1IBL E;  1RR9 A;  2LJP A;  5LMN I;  2UUC I;  4DV5 E;  4X65 I;  4DR5 I;  2HHH I;  4NXN E;  1XNQ I;  4PRX A;  2ZIT A;  4K0K E;  1Z0T A;  4DV1 I;  4X64 I;  4DPX A;  4JI3 I;  4UTG A;  1H74 A;  4B3M I;  3J80 C;  3ZKD A;  5IT9 Q;  4RPF A;  4GKK I;  5LMN E;  1IBK E;  2HK3 A;  4X65 E;  4DR5 E;  4JI7 I;  2HHH E;  1FI4 A;  4I3H A;  4DR6 I;  4DV4 I;  1NHH A;  4DV2 I;  4LF4 E;  3JAM C;  4JI1 I;  2AJ4 A;  4PRV A; 
#chains in the Genus database with same CATH topology
 2NN6 C;  3GLL A;  4LFB I;  4QNK A;  2F4V E;  1Z5B A;  1MG7 A;  2NN6 D;  3LPS A;  4FW9 A;  1N34 E;  2AE8 A;  4OX9 I;  3U1Y A;  4DV3 E;  2UUA E;  1U2R A;  4DR3 E;  5BR8 I;  1KIJ A;  2C39 B;  2JE6 B;  4LPF A;  3WU4 A;  4LFA I;  1D6T A;  4HYM A;  2Z5B B;  5JEA E;  3CDI A;  4JI5 E;  1NZ0 A;  4PU9 A;  1USV A;  2HKJ A;  2C39 A;  2JEA B;  3T1Y I;  5DNL A;  2Z5B A;  1H7U A;  4IFD B;  4LFB E;  1HK7 A;  1ZM3 A;  4LFC I;  1XMO I;  4NXM E;  1XMQ I;  5K36 A;  2IOP A;  3GME A;  4DPT A;  2VF3 A;  5IT9 C;  1BKN A;  4DR7 I;  2NN6 E;  4GKJ E;  3PYF A;  4DPW A;  5A2Q C;  4JI6 E;  1IBM E;  1N36 E;  4MQY A;  1N0V C;  4DV6 E;  2C37 B;  4MU4 A;  1HNX E;  4LFA E;  4AID A;  2O3Z A;  5ELW A;  2Z5C B;  4EMD A;  1KVK A;  3PYD A;  4JG4 A;  4ZVI A;  1ZXM A;  4GQU A;  2C37 A;  1N33 I;  4B3S E;  2Z5E A;  4OO1 E;  1ZM9 A;  1NHJ A;  2E1R A;  2A2C A;  2JT2 A;  3CWV A;  2VES A;  4JV5 I;  2VQF E;  1XMO E;  3QT8 A;  4MYT A;  2PO1 B;  1XNR I;  5JEA A;  2UXD I;  4IZK B;  4JI4 E;  3T1H E;  2WNR A;  4JI0 I;  2R3V A;  1EI1 A;  2O1W A;  2V2V A;  1FWK A;  1N32 E;  5C0X B;  4IZJ A;  1PKP A;  4IZK A;  2BV3 A;  4KHP I;  4P52 A;  4DR2 I;  4B3R I;  1A6F A;  4USM A;  1HNW E;  1Z0V A;  4X62 E;  1Z0G A;  1N33 E;  4LOM A;  2PO0 B;  2NN6 A;  3ZZ0 A;  1FWL A;  2BR2 B;  3GCM A;  4YY3 I;  4AQY E;  2EFG A;  4JV5 E;  1Z5C A;  1B62 A;  2HKE A;  4YHH I;  4LCG A;  4DV0 E;  1H72 C;  3ZM7 A;  4OO1 B;  2UXD E;  2BR2 A;  2UXB I;  3H1C A;  1HNZ I;  4DR4 I;  1MX0 A;  4HAC A;  4B3T I;  1HR0 I;  4JYA I;  2A2D A;  2GO4 A;  1ELO A;  4LF9 I;  3ZZU A;  3U1K A;  2UUC E;  1MU5 A;  2PNZ B;  2V34 A;  1I94 I;  5K36 E;  2F1D A;  1VIS A;  5EL9 A;  4DR1 I;  5EKW A;  2UU9 I;  2GO3 A;  2HK2 A;  1XNQ E;  3NZK A;  2HFU A;  2ZBK B;  4LF6 I;  3Q1Q A;  2PNZ A;  4U3D A;  4DUY I;  4DV1 E;  4X64 E;  3M7N G;  1VI7 A;  1Z59 A;  4JI3 E;  3L7Z A;  2O1U A;  2E5L I;  4BA1 A;  5FLX C;  4USK A;  4B3M E;  5DRQ A;  5GME A;  1RRE A;  4DUZ I;  4X66 I;  4GKK E;  1H73 A;  2HFS A;  3OTO I;  2UUB I;  4LF7 I;  1OYR A;  2PO2 B;  1I94 E;  4JI7 E;  2X7I A;  3QT5 A;  1RHY A;  4DR6 E;  3D4J A;  4DV4 E;  2X36 A;  4DV2 E;  1NHI A;  4JI1 E;  2UXC I;  4XTJ A;  5K36 B;  4BA2 A;  1N0U A;  4Z7C A;  4DUY E;  2PO2 A;  5LMU I;  3ZKB A;  2OI2 A;  4OX9 E;  1Z5A A;  5IWA I;  4NBQ A;  4ISA A;  5BR8 E;  1YHC A;  2BA1 D;  3J7A G;  4DU8 A;  2O1T A;  4LF8 I;  3M6A A;  3B78 A;  5DNX A;  3KRN A;  1S4E A;  4WUC A;  3F0N A;  4U3B A;  3B4T A;  2UXC E;  5JEA B;  3T1Y E;  3J7A M;  3HKM A;  4J3D A;  3J81 Q;  3LTO A;  3ZZT A;  2WNR B;  2J7K A;  4LFC E;  1IBL I;  4IZJ B;  3WU5 A;  1XMQ E;  4MU3 A;  3UHM A;  4DV5 I;  1UEK A;  4N3O A;  1UDO A;  4DR7 E;  2J65 A;  4NXN I;  3HUL A;  5DRR A;  1H7S A;  1KKH A;  3P06 A;  2CVE A;  3WU6 A;  3V5R A;  2NN6 B;  3PS2 A;  4K0K I;  2GS8 A;  3H4L A;  1Y6Z A;  1KTV A;  1FNM A;  2BM0 A;  4HAC B;  3M85 D;  1Y4S A;  1XNR E;  3M7N D;  1FJG I;  1IBK I;  1J5E I;  4JI0 E;  4JI8 I;  3K1J A;  4LF4 I;  3LNU A;  4FW4 A;  4KQV A;  4KHP E;  4DR2 E;  2F4V I;  4B3R E;  2BA0 G;  5C0X F;  1YH8 A;  3L7Z B;  2JEB B;  4OZE A;  3K85 A;  3V2U C;  2VQE I;  4BA1 B;  4DV7 I;  1N34 I;  2WW4 A;  3P3E A;  2IOQ A;  2PNL A;  1P42 A;  4DV3 I;  3J81 C;  2UUA I;  4YY3 E;  4DR3 I;  1FKA E;  5A2Q Q;  1Z0C A;  4YHH E;  2JEB A;  2NPF A;  1OJ4 A;  1FJG E;  5DRP A;  4DPY A;  4LF5 I;  1J5E E;  2CG9 A;  2UXB E;  1HNZ E;  4JI5 I;  4DR4 E;  3B82 A;  3DD6 A;  1E3H A;  1Y4U A;  4JI8 E;  1HR0 E;  4B3T E;  1PVG A;  4JYA E;  4OO1 F;  4LF9 E;  5C0X C;  1UDN A;  5L3J A;  4UT4 A;  2DEI A;  4BA2 B;  4HXZ A;  5C0X D;  4HY1 A;  2C38 A;  4AM3 A;  1PIE A;  4URL A;  3Q6M A;  2BM1 A;  2DEJ A;  3P3G A;  4DR1 E;  3PRY A;  4FW6 A;  4NXM I;  1XHK A;  2VQE E;  4DV7 E;  2UU9 E;  1Y60 A;  2CZ9 A;  3GON A;  4LF6 E;  1ZM2 A;  3QT7 A;  4MYU A;  4GKJ I;  3PS3 A;  4JI2 I;  4JI6 I;  1IBM I;  3PYE A;  4FN5 A;  3P3C A;  2E5L E;  4FWH A;  1N36 I;  4DV6 I;  1HNX I;  1S16 A;  2IES A;  4OO1 C;  1Z0B A;  4LF5 E;  4IS9 A;  4DUZ E;  4OO1 D;  4X66 E;  2ZM6 I;  4FWD A;  3OTO E;  4WUD A;  3K17 A;  2JE6 A;  1OYS A;  4MU0 A;  4B3S I;  3QT6 A;  3HJC A;  2UUB E;  4DU7 A;  4Z7Y A;  4LF7 E;  2XEX A;  2VQF I;  2GQ0 A;  1QZR A;  2JEA A;  2Q2E B;  5C0X E;  3J80 Q;  1EA6 A;  1UDQ A;  4JI4 I;  1DAR A;  4MU1 A;  3T1H I;  4DXL A;  4IFD A;  2V8P A;  3PS1 A;  5LMU E;  1UDS A;  4JI2 E;  1N32 I;  5K36 F;  4IFD F;  4FW5 A;  4WUB A;  5IWA E;  2R42 A;  4P7A A;  2ZM6 E;  1K47 A;  5LL6 R;  1R6M A;  1Z0E A;  4AIM A;  1B63 A;  2WP8 B;  1HNW I;  3JAM Q;  4LF8 E;  1WUU A;  4X62 I;  1E3P A;  4AQY I;  1OYP A;  2Z5C A;  4FW7 A;  2V2Q A;  4DPU A;  4DV0 I;  4R1F A;  1USU A;  2WP8 A;  1ZXN A;  4LCH A;  5FLX Q;  3B8H A;  1ZM4 A;  2BA0 D;  3PYG A;  2BA1 G;  4ED4 A;  3WU3 A;  5K36 C;  4M1K A;  5GMD A;  4IFD C;  2CGE A;  5K36 D;  5FWK A;  2V2Z A;  4FWG A;  5JEA F;  1Z0W A;  1IBL E;  1RR9 A;  2PO1 A;  2O1V A;  4IFD D;  2LJP A;  3Q6N A;  5LMN I;  2PNM A;  2UUC I;  4DV5 E;  4X65 I;  4DR5 I;  2HHH I;  4NXN E;  5C0X A;  1XNQ I;  4PRX A;  2ZIT A;  1Y5Y A;  1Z0T A;  4K0K E;  4DV1 I;  4X64 I;  4QNJ A;  4DPX A;  4JI3 I;  4UTG A;  1H74 A;  4OKG A;  2NN6 F;  1XXE A;  4B3M I;  5JEA C;  3J80 C;  2PO0 A;  3ZKD A;  1R6L A;  5IT9 Q;  4MDT A;  3P76 A;  4RPF A;  5JEA D;  4GKK I;  2IER A;  4FW3 A;  4OO1 A;  3CDJ A;  5LMN E;  4LCF A;  1IBK E;  2HK3 A;  2C38 B;  5DRO A;  4X65 E;  4IZJ D;  4DR5 E;  4JI7 I;  2HHH E;  4IFD E;  1FI4 A;  4I3H A;  4DR6 I;  4DV4 I;  1NHH A;  4DV2 I;  4LF4 E;  3JAM C;  4JI1 I;  2AJ4 A;  4PRV A;  3M85 G; 
#chains in the Genus database with same CATH homology
 4LFB I;  2F4V E;  1Z5B A;  1MG7 A;  3LPS A;  4FW9 A;  1N34 E;  4OX9 I;  4DV3 E;  2UUA E;  1U2R A;  4DR3 E;  5BR8 I;  1KIJ A;  3WU4 A;  4LFA I;  1D6T A;  4HYM A;  2Z5B B;  4JI5 E;  1NZ0 A;  4PU9 A;  1USV A;  2HKJ A;  3T1Y I;  2Z5B A;  1H7U A;  4LFB E;  1HK7 A;  1ZM3 A;  4LFC I;  1XMO I;  4NXM E;  1XMQ I;  2IOP A;  4DPT A;  2VF3 A;  5IT9 C;  1BKN A;  4DR7 I;  4GKJ E;  3PYF A;  4DPW A;  5A2Q C;  4JI6 E;  1IBM E;  1N36 E;  1N0V C;  4DV6 E;  1HNX E;  4LFA E;  4EMD A;  2Z5C B;  1KVK A;  3PYD A;  4JG4 A;  4ZVI A;  1ZXM A;  1N33 I;  4B3S E;  2Z5E A;  1ZM9 A;  1NHJ A;  2E1R A;  2A2C A;  3CWV A;  4JV5 I;  2VQF E;  1XMO E;  3QT8 A;  4MYT A;  1XNR I;  2UXD I;  4IZK B;  4JI4 E;  3T1H E;  4JI0 I;  2R3V A;  1EI1 A;  2O1W A;  2V2V A;  1FWK A;  1N32 E;  4IZJ A;  1PKP A;  4IZK A;  2BV3 A;  4KHP I;  4P52 A;  4DR2 I;  4B3R I;  1A6F A;  4USM A;  1HNW E;  1Z0V A;  4X62 E;  1Z0G A;  1N33 E;  3ZZ0 A;  4AQY E;  1FWL A;  4YY3 I;  2EFG A;  4JV5 E;  1Z5C A;  1B62 A;  2HKE A;  4YHH I;  4DV0 E;  1H72 C;  3ZM7 A;  2UXD E;  2UXB I;  1HNZ I;  4DR4 I;  1MX0 A;  4HAC A;  4B3T I;  1HR0 I;  4JYA I;  2A2D A;  1ELO A;  4LF9 I;  3ZZU A;  2UUC E;  1MU5 A;  2V34 A;  1I94 I;  1VIS A;  4DR1 I;  2UU9 I;  2HK2 A;  1XNQ E;  2HFU A;  2ZBK B;  4LF6 I;  3Q1Q A;  4DUY I;  4DV1 E;  4X64 E;  4JI3 E;  1Z59 A;  2O1U A;  2E5L I;  5FLX C;  4USK A;  4B3M E;  5GME A;  1RRE A;  4DUZ I;  4X66 I;  4GKK E;  1H73 A;  2HFS A;  3OTO I;  2UUB I;  4LF7 I;  1I94 E;  4JI7 E;  2X7I A;  3QT5 A;  4DR6 E;  3D4J A;  4DV4 E;  2X36 A;  4DV2 E;  1NHI A;  4JI1 E;  2UXC I;  4XTJ A;  1N0U A;  4Z7C A;  4DUY E;  5LMU I;  3ZKB A;  2OI2 A;  4OX9 E;  1Z5A A;  5IWA I;  5BR8 E;  3J7A G;  4DU8 A;  2O1T A;  4LF8 I;  3M6A A;  3B78 A;  1S4E A;  4WUC A;  3F0N A;  2UXC E;  3T1Y E;  3J7A M;  3J81 Q;  3LTO A;  3ZZT A;  2J7K A;  4LFC E;  1IBL I;  4IZJ B;  3WU5 A;  1XMQ E;  4DV5 I;  1UEK A;  4N3O A;  4DR7 E;  4NXN I;  3HUL A;  1H7S A;  1KKH A;  3P06 A;  3WU6 A;  3V5R A;  4K0K I;  2GS8 A;  3H4L A;  1Y6Z A;  1KTV A;  1FNM A;  2BM0 A;  4HAC B;  1Y4S A;  1XNR E;  1FJG I;  1IBK I;  1J5E I;  4JI0 E;  4JI8 I;  3K1J A;  4LF4 I;  3LNU A;  4KQV A;  4KHP E;  4DR2 E;  2F4V I;  4B3R E;  3K85 A;  3V2U C;  2VQE I;  4DV7 I;  1N34 I;  2WW4 A;  2IOQ A;  2PNL A;  4DV3 I;  3J81 C;  2UUA I;  4YY3 E;  4DR3 I;  1FKA E;  5A2Q Q;  1Z0C A;  4YHH E;  2NPF A;  1OJ4 A;  1FJG E;  4DPY A;  4LF5 I;  1J5E E;  2CG9 A;  2UXB E;  1HNZ E;  4JI5 I;  4DR4 E;  3B82 A;  4JI8 E;  1Y4U A;  4B3T E;  1HR0 E;  4JYA E;  1PVG A;  4LF9 E;  5L3J A;  4UT4 A;  2DEI A;  4HXZ A;  4HY1 A;  1PIE A;  4URL A;  3Q6M A;  2BM1 A;  2DEJ A;  4DR1 E;  3PRY A;  4NXM I;  1XHK A;  2VQE E;  4DV7 E;  2UU9 E;  2CZ9 A;  3GON A;  4LF6 E;  1ZM2 A;  3QT7 A;  4MYU A;  4GKJ I;  4JI2 I;  4JI6 I;  1IBM I;  3PYE A;  4FN5 A;  2E5L E;  4FWH A;  1N36 I;  4DV6 I;  1HNX I;  1S16 A;  1Z0B A;  4LF5 E;  4DUZ E;  4X66 E;  2ZM6 I;  4FWD A;  3OTO E;  4WUD A;  3K17 A;  4B3S I;  3QT6 A;  3HJC A;  2UUB E;  4DU7 A;  4Z7Y A;  4LF7 E;  2XEX A;  2VQF I;  2GQ0 A;  1QZR A;  2Q2E B;  3J80 Q;  1EA6 A;  4JI4 I;  1DAR A;  3T1H I;  4DXL A;  2V8P A;  5LMU E;  4JI2 E;  1N32 I;  4WUB A;  5IWA E;  2R42 A;  4P7A A;  2ZM6 E;  1K47 A;  5LL6 R;  1Z0E A;  1B63 A;  1HNW I;  3JAM Q;  4LF8 E;  1WUU A;  4X62 I;  4AQY I;  2Z5C A;  2V2Q A;  4DPU A;  4DV0 I;  4R1F A;  1USU A;  1ZXN A;  5FLX Q;  3B8H A;  1ZM4 A;  3PYG A;  4ED4 A;  3WU3 A;  4M1K A;  5GMD A;  2CGE A;  5FWK A;  2V2Z A;  4FWG A;  1Z0W A;  1IBL E;  1RR9 A;  2O1V A;  2LJP A;  3Q6N A;  5LMN I;  2PNM A;  2UUC I;  4DV5 E;  4X65 I;  4DR5 I;  2HHH I;  4NXN E;  1XNQ I;  4PRX A;  2ZIT A;  4K0K E;  1Z0T A;  4DV1 I;  4X64 I;  4DPX A;  4JI3 I;  4UTG A;  1H74 A;  4B3M I;  3J80 C;  3ZKD A;  5IT9 Q;  4RPF A;  4GKK I;  5LMN E;  1IBK E;  2HK3 A;  4X65 E;  4DR5 E;  4IZJ D;  4JI7 I;  2HHH E;  1FI4 A;  4I3H A;  4DR6 I;  4DV4 I;  1NHH A;  4DV2 I;  4LF4 E;  3JAM C;  4JI1 I;  2AJ4 A;  4PRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...