4X64I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 25
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x64I00
4LFCI 5IT9Q 4DR4E 1FJGE 4URLA 4DV0I 4DUYI 4JI1E 3PYGA 4DPUA 1Z59A 3V2UC 4DR3I 2Q2EB 3ZKBA 4JI6E 4LF7E 4Z7CA 1N32E 3F0NA 3PYFA 1XHKA 1DARA 2UXCE 1S4EA 4DR1E 1ZM4A 2UXDE 4YY3E 1FWLA 4AQYE 1HNWE 3JAMC 2E5LI 3ZKDA 4XTJA 3T1YE 4DV7E 1FWKA 4X65I 2E5LE 4HACA 5BR8I 4Z7YA 4K0KI 2UUCE 2HK3A 1ZM9A 4LFBI 5A2QQ 2A2DA 4JI0I 1Z0CA 4DV1I 4PRVA 3Q1QA 2VF3A 1RREA 4DR7I 1FNMA 1NHIA 4NXME 4LFBE 4LF6I 1XMQI 1HNZE 2VQFE 1N34I 4K0KE 5LMNE 2LJPA 4LF9E 4JI5I 3ZM7A 1N0VC 1H7UA 5LL6R 1IBLE 4DUZI 3ZZUA 4B3SE 2DEJA 1B63A 4DR2I 4B3RI 2V2ZA 4LF4I 4DR6E 2VQEI 1MU5A 2UUAE 1Z0VA 4B3TI 3OTOI 4JI4I 2HHHI 4DR6I 2BV3A 4USMA 5IWAI 2HFUA 4B3MI 4KQVA 4DV2I 4LFAI 4EMDA 4DUZE 1PIEA 1XNQI 5FLXC 4JI5E 4RPFA 4DR4I 1K47A 5LMNI 4DPTA 4MYUA 1U2RA 3GONA 4X65E 1NHHA 4FN5A 5IT9C 4FWHA 4DV5I 1HR0I 1XNRE 4LF8I 2HK2A 1I94E 1N34E 5LMUI 4LF5I 4FW9A 1MG7A 3WU4A 2ZM6I 1EA6A 1RR9A 3B8HA 3QT8A 4DUYE 4X62E 3JAMQ 4DU8A 2V2QA 2UXDI 5L3JA 1J5EE 2V2VA 4GKKE 4OX9E 4FWDA 1B62A 1Z5CA 4X64I 4JI2E 4DXLA 2E1RA 1NZ0A 2ZM6E 4HXZA 5A2QC 1IBKI 4B3TE 1N0UA 2V34A 1KTVA 2F4VE 2WW4A 1FJGI 3LPSA 1H73A 4M1KA 4JI2I 2UXBE 1HNWI 2V8PA 4LF9I 4I3HA 4JG4A 1H72C 4GKKI 1J5EI 4DR5I 4DPYA 1ZM3A 1H7SA 2X36A 3T1HI 4MYTA 1XNQE 4DV6I 2HKJA 2UUAI 1UEKA 2VQEE 4DV1E 4DPWA 4X64E 4YHHI 4HACB 1KIJA 4LF5E 3K17A 4DR2E 5GMDA 3J80C 2R42A 2EFGA 1XMOE 4YY3I 1EI1A 2ZITA 3QT7A 4DR1I 4JI8I 1BKNA 4HY1A 4LF6E 4X62I 2VQFI 1N33E 4LF7I 1IBKE 2CZ9A 4JV5E 3PYDA 4DR7E 4KHPI 4LF8E 1S16A 1A6FA 4P52A 4DPXA 2AJ4A 1Z5BA 1KKHA 4JI8E 3M6AA 2X7IA 3WU3A 1D6TA 3J7AM 1FKAE 4PRXA 3T1YI 2XEXA 4B3ME 4DV4I 3ZZ0A 2NPFA 4JI4E 1KVKA 4NXMI 4YHHE 5LMUE 1PVGA 2ZBKB 2A2CA 4JI6I 3PYEA 3WU5A 4JI1I 1HR0E 4GKJI 3B82A 3OTOE 3QT6A 1Z0TA 2BM0A 2UUCI 4LFCE 3J81C 2UXBI 4LFAE 3LTOA 2J7KA 4X66I 3WU6A 4HYMA 2UUBI 4USKA 4WUDA 5IWAE 4JI3I 1XMQE 1HNZI 1Z5AA 4NXNI 4FWGA 2F4VI 4ZVIA 4R1FA 1ELOA 5GMEA 5BR8E 4DV4E 3LNUA 1IBME 4B3SI 1Z0BA 4X66E 1WUUA 4DV7I 1HNXI 4DV0E 1N36I 3J80Q 3ZZTA 4OX9I 1VISA 2DEIA 2BM1A 1HNXE 1QZRA 3B78A 4GKJE 1N32I 3D4JA 4JI7I 1ZM2A 4JI0E 2HHHE 2UXCI 1OJ4A 1PKPA 1ZXNA 1N33I 4UTGA 4NXNE 1Z0EA 4JI7E 3QT5A 2HFSA 1Z0WA 4KHPE 1XNRI 2UUBE 4DV5E 4JYAI 4DV6E 3J7AG 1IBLI 3H4LA 4WUCA 4AQYI 4DU7A 3T1HE 1N36E 4DR5E 2HKEA 1NHJA 2OI2A 4UT4A 1Z0GA 4DV2E 1H74A 1IBMI 4ED4A 4DV3E 1MX0A 2GS8A 4JYAE 4DR3E 4JV5I 1FI4A 2R3VA 4PU9A 4P7AA 4DV3I 4LF4E 4B3RE 4JI3E 1ZXMA 3HULA 3V5RA 1I94I 1XMOI 5FLXQ 2UU9E 4WUBA 3J81Q 3CWVA 3K1JA 2UU9I
chains in the Genus database with same CATH superfamily
4LFCI 5IT9Q 5K36A 4BA2B 4DR4E 5JEAF 1FJGE 4URLA 2VESA 4DV0I 2CVEA 4DUYI 4JI1E 3PYGA 2O1VA 4DPUA 1Z59A 3V2UC 4DR3I 4U3BA 2Q2EB 3ZKBA 4JI6E 4LF7E 4Z7CA 1N32E 3F0NA 3PYFA 3DD6A 1XHKA 2NN6E 1DARA 2BR2A 4LOMA 1R6LA 2UXCE 1S4EA 4DR1E 2JEAB 1ZM4A 3UHMA 2UXDE 4YY3E 3P06A 5EKWA 1FWLA 4AQYE 1HNWE 3JAMC 2E5LI 3ZKDA 4XTJA 3T1YE 4DV7E 1FWKA 2PO1B 4X65I 1YH8A 2E5LE 4HACA 3P3CA 5BR8I 5K36C 2GO3A 4Z7YA 4K0KI 4FW4A 2UUCE 2HK3A 1Y4SA 1ZM9A 4LFBI 5A2QQ 3PRYA 4JI0I 2A2DA 2JEBB 1Z0CA 4DV1I 2BR2B 4PRVA 3Q1QA 2VF3A 1RREA 4DR7I 1FNMA 4BA2A 3M85D 1NHIA 4NXME 4LFBE 4LF6I 4AIMA 4IFDC 1XMQI 1HNZE 2VQFE 1N34I 4K0KE 5LMNE 4OKGA 2LJPA 4LF9E 5C0XA 4IZJD 4LCGA 4JI5I 4MU1A 3ZM7A 1N0VC 1H7UA 5LL6R 1IBLE 4DUZI 3ZZUA 4B3SE 2DEJA 5C0XC 1Y6ZA 1B63A 4OO1E 4DR2I 4B3RI 2V2ZA 4LF4I 4DR6E 2VQEI 1MU5A 3P3EA 2UUAE 1Z0VA 4B3TI 3OTOI 2IOPA 2HHHI 4JI4I 4DR6I 2BA0D 4IFDD 4NBQA 4FW5A 2BV3A 4USMA 5IWAI 2HFUA 4B3MI 4KQVA 4DV2I 4LPFA 4EMDA 4LFAI 4DUZE 3HKMA 1PIEA 1XNQI 5FLXC 4JI5E 2JE6A 4RPFA 4DR4I 1K47A 2PO2A 5LMNI 3KRNA 4DPTA 4BA1B 4MYUA 1U2RA 1RHYA 3GONA 4X65E 1NHHA 4FN5A 5IT9C 4FWHA 4DV5I 1HR0I 1Y4UA 2PNLA 3P76A 1XNRE 2JEBA 4OO1F 4LF8I 2HK2A 1I94E 1N34E 5LMUI 4LF5I 3M7NG 2WP8A 5C0XE 3PS3A 4FW9A 1OYSA 1MG7A 2O3ZA 3CDJA 3WU4A 2ZM6I 1EA6A 1RR9A 3B8HA 3QT8A 4QNJA 3Q6NA 4DUYE 2JEAA 4X62E 3JAMQ 2C37B 4DU8A 2V2QA 2Z5BB 2UXDI 3L7ZA 1UDSA 1HK7A 5L3JA 4OO1D 1J5EE 1UDNA 1UDOA 2V2VA 4OX9E 4GKKE 4FWDA 1B62A 1Z5CA 4X64I 2F1DA 3P3GA 4JI2E 1OYPA 4DXLA 2E1RA 1NZ0A 2ZM6E 4HXZA 5A2QC 1IBKI 4B3TE 4IFDF 1N0UA 2V34A 1KTVA 1P42A 2F4VE 2WW4A 5FWKA 1FJGI 3LPSA 1H73A 1E3PA 4M1KA 2WP8B 2NN6A 4JI2I 2UXBE 1HNWI 2IERA 3NZKA 5C0XF 2V8PA 4LF9I 4I3HA 3CDIA 4JG4A 1H72C 4GKKI 2C39B 1J5EI 4ISAA 4DR5I 4DPYA 1ZM3A 5K36D 1H7SA 2X36A 3T1HI 4MYTA 1XNQE 4OZEA 1UDQA 1OYRA 5JEAB 4DV6I 5JEAA 2NN6B 2PO0A 4IFDE 2HKJA 2UUAI 1UEKA 4J3DA 4MU4A 2VQEE 4DV1E 4DPWA 4X64E 2NN6D 4HACB 4YHHI 1KIJA 4OO1A 2CGEA 4LF5E 3K17A 4DR2E 2BA1D 5DRRA 5GMDA 3J80C 1Y60A 2R42A 5K36F 5JEAC 2EFGA 1XMOE 4YY3I 1EI1A 1Y5YA 2ZITA 3QT7A 4DR1I 4JI8I 1BKNA 4HY1A 3M7ND 4LF6E 4X62I 4QNKA 2VQFI 2IOQA 1USVA 2C37A 1N33E 4U3DA 4LF7I 4FW3A 3HJCA 1IBKE 2CZ9A 4JV5E 3PYDA 4DR7E 4KHPI 4LF8E 1S16A 1A6FA 4P52A 4DPXA 2AE8A 4IZJA 2AJ4A 3L7ZB 1Z5BA 1KKHA 4JI8E 3M6AA 5EL9A 3U1YA 2X7IA 3WU3A 1D6TA 5C0XD 5K36E 1XXEA 2C38A 3J7AM 1USUA 1FKAE 4PRXA 3M85G 3T1YI 2XEXA 4B3ME 4DV4I 3PS1A 5DROA 5DNLA 5DNXA 3ZZ0A 2NPFA 4JI4E 2PO2B 4LCFA 2JE6B 5DRQA 3K85A 1KVKA 4NXMI 4YHHE 5LMUE 1PVGA 2ZBKB 2A2CA 4JI6I 2NN6C 3PYEA 5DRPA 3WU5A 2PNZB 4JI1I 1HR0E 4GKJI 3B82A 3OTOE 3QT6A 1Z0TA 2BM0A 2UUCI 2WNRA 2Z5CB 4LFCE 3J81C 3PS2A 2WNRB 2Z5CA 2BA1G 4OO1C 2UXBI 4LFAE 3LTOA 2J7KA 4X66I 3WU6A 4HYMA 2UUBI 4USKA 4WUDA 5IWAE 4JI3I 4MU0A 4FW6A 2C38B 4AM3A 3GLLA 3B4TA 1XMQE 1HNZI 2O1TA 1Z5AA 4NXNI 2GQ0A 4FWGA 2F4VI 4ZVIA 4R1FA 1ELOA 4IZJB 5GMEA 5BR8E 4DV4E 3LNUA 4FW7A 1IBME 4B3SI 1Z0BA 4X66E 1WUUA 2Z5BA 4DV7I 2IESA 4N3OA 1HNXI 3GCMA 4DV0E 1N36I 3J80Q 3ZZTA 4OX9I 1VISA 2DEIA 2BM1A 1HNXE 1QZRA 3B78A 4GKJE 1N32I 3D4JA 5JEAD 4JI7I 4LCHA 3U1KA 1ZM2A 4IS9A 4JI0E 2HHHE 2UXCI 1OJ4A 1PKPA 1ZXNA 4MQYA 1N33I 4UTGA 4NXNE 4IFDB 1Z0EA 5ELWA 4JI7E 3QT5A 4IFDA 1Z0WA 2HFSA 2PO1A 4MU3A 1XNRI 4KHPE 5JEAE 2UUBE 4MDTA 2BA0G 4DV5E 4JYAI 4DV6E 4BA1A 3J7AG 1IBLI 3H4LA 4WUCA 4AQYI 4DU7A 3T1HE 2O1WA 1N36E 4DR5E 4OO1B 2HKEA 1NHJA 2OI2A 4UT4A 1R6MA 2O1UA 2PNZA 5K36B 1Z0GA 2C39A 4DV2E 1H74A 1IBMI 2PO0B 4GQUA 4ED4A 4DV3E 2GO4A 1MX0A 2GS8A 4JYAE 4DR3E 4JV5I 1FI4A 2Z5EA 2R3VA 4PU9A 2J65A 4AIDA 4P7AA 4DV3I 4LF4E 4B3RE 1YHCA 2NN6F 1ZXMA 4JI3E 2JT2A 3HULA 3V5RA 2CG9A 1I94I 1XMOI 4IZKA 1E3HA 1VI7A 3Q6MA 5FLXQ 5C0XB 4WUBA 2PNMA 4IZKB 3J81Q 2UU9E 3CWVA 3K1JA 3GMEA 3H1CA 2UU9I
chains in the Genus database with same CATH topology
4LFCI 5IT9Q 4DR4E 1FJGE 4URLA 4DV0I 4DUYI 4JI1E 3PYGA 2O1VA 4DPUA 1Z59A 3V2UC 4DR3I 2Q2EB 3ZKBA 4JI6E 4LF7E 4Z7CA 1N32E 3F0NA 3PYFA 1XHKA 1DARA 2UXCE 1S4EA 4DR1E 1ZM4A 2UXDE 4YY3E 3P06A 1FWLA 4AQYE 1HNWE 3JAMC 2E5LI 3ZKDA 4XTJA 3T1YE 4DV7E 1FWKA 4X65I 2E5LE 4HACA 5BR8I 4Z7YA 4K0KI 2UUCE 2HK3A 1Y4SA 1ZM9A 4LFBI 5A2QQ 3PRYA 2A2DA 4JI0I 1Z0CA 4DV1I 4PRVA 3Q1QA 2VF3A 1RREA 4DR7I 1FNMA 1NHIA 4NXME 4LFBE 4LF6I 1XMQI 1HNZE 2VQFE 1N34I 4K0KE 5LMNE 2LJPA 4LF9E 4IZJD 4JI5I 3ZM7A 1N0VC 1H7UA 5LL6R 1IBLE 4DUZI 3ZZUA 4B3SE 2DEJA 1Y6ZA 1B63A 4DR2I 4B3RI 2V2ZA 4LF4I 4DR6E 2VQEI 1MU5A 2UUAE 1Z0VA 4B3TI 3OTOI 2IOPA 2HHHI 4JI4I 4DR6I 2BV3A 4USMA 5IWAI 2HFUA 4B3MI 4KQVA 4DV2I 4LFAI 4EMDA 4DUZE 1PIEA 1XNQI 5FLXC 4JI5E 4RPFA 4DR4I 1K47A 5LMNI 4DPTA 4MYUA 1U2RA 3GONA 4X65E 1NHHA 4FN5A 5IT9C 4FWHA 4DV5I 1HR0I 1Y4UA 2PNLA 1XNRE 4LF8I 2HK2A 1I94E 1N34E 5LMUI 4LF5I 4FW9A 1MG7A 3WU4A 2ZM6I 1EA6A 1RR9A 3B8HA 3QT8A 3Q6NA 4DUYE 4X62E 3JAMQ 4DU8A 2V2QA 2Z5BB 2UXDI 1HK7A 5L3JA 1J5EE 2V2VA 4GKKE 4OX9E 4FWDA 1B62A 1Z5CA 4X64I 4JI2E 4DXLA 2E1RA 1NZ0A 2ZM6E 4HXZA 5A2QC 1IBKI 4B3TE 1N0UA 2V34A 1KTVA 2F4VE 2WW4A 5FWKA 1FJGI 3LPSA 1H73A 4M1KA 4JI2I 2UXBE 1HNWI 2V8PA 4LF9I 4I3HA 4JG4A 1H72C 4GKKI 1J5EI 4DR5I 4DPYA 1ZM3A 1H7SA 2X36A 3T1HI 4MYTA 1XNQE 4DV6I 2HKJA 2UUAI 1UEKA 2VQEE 4DV1E 4DPWA 4X64E 4YHHI 4HACB 1KIJA 2CGEA 4LF5E 3K17A 4DR2E 5GMDA 3J80C 2R42A 2EFGA 1XMOE 4YY3I 1EI1A 2ZITA 3QT7A 4DR1I 4JI8I 1BKNA 4HY1A 4LF6E 4X62I 2VQFI 2IOQA 1USVA 1N33E 4LF7I 3HJCA 1IBKE 2CZ9A 4JV5E 3PYDA 4DR7E 4KHPI 4LF8E 1S16A 1A6FA 4P52A 4DPXA 4IZJA 2AJ4A 1Z5BA 1KKHA 4JI8E 3M6AA 2X7IA 3WU3A 1D6TA 3J7AM 1USUA 1FKAE 4PRXA 3T1YI 2XEXA 4B3ME 4DV4I 3ZZ0A 2NPFA 4JI4E 3K85A 1KVKA 4NXMI 4YHHE 5LMUE 1PVGA 2ZBKB 2A2CA 4JI6I 3PYEA 3WU5A 4JI1I 1HR0E 4GKJI 3B82A 3OTOE 3QT6A 1Z0TA 2BM0A 2UUCI 2Z5CB 4LFCE 3J81C 2Z5CA 2UXBI 4LFAE 3LTOA 2J7KA 4X66I 3WU6A 4HYMA 2UUBI 4USKA 4WUDA 5IWAE 4JI3I 1XMQE 1HNZI 2O1TA 1Z5AA 4NXNI 2GQ0A 4FWGA 2F4VI 4ZVIA 4R1FA 1ELOA 4IZJB 5GMEA 5BR8E 4DV4E 3LNUA 1IBME 4B3SI 1Z0BA 4X66E 1WUUA 2Z5BA 4DV7I 4N3OA 1HNXI 4DV0E 1N36I 3J80Q 3ZZTA 4OX9I 1VISA 2DEIA 2BM1A 1HNXE 1QZRA 3B78A 4GKJE 1N32I 3D4JA 4JI7I 1ZM2A 4JI0E 2HHHE 2UXCI 1OJ4A 1PKPA 1ZXNA 1N33I 4UTGA 4NXNE 1Z0EA 4JI7E 3QT5A 2HFSA 1Z0WA 4KHPE 1XNRI 2UUBE 4DV5E 4JYAI 4DV6E 3J7AG 1IBLI 3H4LA 4WUCA 4AQYI 4DU7A 3T1HE 2O1WA 1N36E 4DR5E 2HKEA 1NHJA 2OI2A 4UT4A 2O1UA 1Z0GA 4DV2E 1H74A 1IBMI 4ED4A 4DV3E 1MX0A 2GS8A 4JYAE 4DR3E 4JV5I 1FI4A 2Z5EA 2R3VA 4PU9A 4P7AA 4DV3I 4LF4E 4B3RE 4JI3E 1ZXMA 3HULA 3V5RA 2CG9A 1I94I 1XMOI 4IZKA 5FLXQ 3Q6MA 2UU9E 4WUBA 2PNMA 4IZKB 3J81Q 3CWVA 3K1JA 2UU9I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC I;  5IT9 Q;  4DR4 E;  1FJG E;  4URL A;  4DV0 I;  4DUY I;  4JI1 E;  3PYG A;  4DPU A;  1Z59 A;  3V2U C;  4DR3 I;  2Q2E B;  3ZKB A;  4JI6 E;  4LF7 E;  4Z7C A;  1N32 E;  3F0N A;  3PYF A;  1XHK A;  1DAR A;  2UXC E;  1S4E A;  4DR1 E;  1ZM4 A;  2UXD E;  4YY3 E;  1FWL A;  4AQY E;  1HNW E;  3JAM C;  2E5L I;  3ZKD A;  4XTJ A;  3T1Y E;  4DV7 E;  1FWK A;  4X65 I;  2E5L E;  4HAC A;  5BR8 I;  4Z7Y A;  4K0K I;  2UUC E;  2HK3 A;  1ZM9 A;  4LFB I;  5A2Q Q;  2A2D A;  4JI0 I;  1Z0C A;  4DV1 I;  4PRV A;  3Q1Q A;  2VF3 A;  1RRE A;  4DR7 I;  1FNM A;  1NHI A;  4NXM E;  4LFB E;  4LF6 I;  1XMQ I;  1HNZ E;  2VQF E;  1N34 I;  4K0K E;  5LMN E;  2LJP A;  4LF9 E;  4JI5 I;  3ZM7 A;  1N0V C;  1H7U A;  5LL6 R;  1IBL E;  4DUZ I;  3ZZU A;  4B3S E;  2DEJ A;  1B63 A;  4DR2 I;  4B3R I;  2V2Z A;  4LF4 I;  4DR6 E;  2VQE I;  1MU5 A;  2UUA E;  1Z0V A;  4B3T I;  3OTO I;  4JI4 I;  2HHH I;  4DR6 I;  2BV3 A;  4USM A;  5IWA I;  2HFU A;  4B3M I;  4KQV A;  4DV2 I;  4LFA I;  4EMD A;  4DUZ E;  1PIE A;  1XNQ I;  5FLX C;  4JI5 E;  4RPF A;  4DR4 I;  1K47 A;  5LMN I;  4DPT A;  4MYU A;  1U2R A;  3GON A;  4X65 E;  1NHH A;  4FN5 A;  5IT9 C;  4FWH A;  4DV5 I;  1HR0 I;  1XNR E;  4LF8 I;  2HK2 A;  1I94 E;  1N34 E;  5LMU I;  4LF5 I;  4FW9 A;  1MG7 A;  3WU4 A;  2ZM6 I;  1EA6 A;  1RR9 A;  3B8H A;  3QT8 A;  4DUY E;  4X62 E;  3JAM Q;  4DU8 A;  2V2Q A;  2UXD I;  5L3J A;  1J5E E;  2V2V A;  4GKK E;  4OX9 E;  4FWD A;  1B62 A;  1Z5C A;  4X64 I;  4JI2 E;  4DXL A;  2E1R A;  1NZ0 A;  2ZM6 E;  4HXZ A;  5A2Q C;  1IBK I;  4B3T E;  1N0U A;  2V34 A;  1KTV A;  2F4V E;  2WW4 A;  1FJG I;  3LPS A;  1H73 A;  4M1K A;  4JI2 I;  2UXB E;  1HNW I;  2V8P A;  4LF9 I;  4I3H A;  4JG4 A;  1H72 C;  4GKK I;  1J5E I;  4DR5 I;  4DPY A;  1ZM3 A;  1H7S A;  2X36 A;  3T1H I;  4MYT A;  1XNQ E;  4DV6 I;  2HKJ A;  2UUA I;  1UEK A;  2VQE E;  4DV1 E;  4DPW A;  4X64 E;  4YHH I;  4HAC B;  1KIJ A;  4LF5 E;  3K17 A;  4DR2 E;  5GMD A;  3J80 C;  2R42 A;  2EFG A;  1XMO E;  4YY3 I;  1EI1 A;  2ZIT A;  3QT7 A;  4DR1 I;  4JI8 I;  1BKN A;  4HY1 A;  4LF6 E;  4X62 I;  2VQF I;  1N33 E;  4LF7 I;  1IBK E;  2CZ9 A;  4JV5 E;  3PYD A;  4DR7 E;  4KHP I;  4LF8 E;  1S16 A;  1A6F A;  4P52 A;  4DPX A;  2AJ4 A;  1Z5B A;  1KKH A;  4JI8 E;  3M6A A;  2X7I A;  3WU3 A;  1D6T A;  3J7A M;  1FKA E;  4PRX A;  3T1Y I;  2XEX A;  4B3M E;  4DV4 I;  3ZZ0 A;  2NPF A;  4JI4 E;  1KVK A;  4NXM I;  4YHH E;  5LMU E;  1PVG A;  2ZBK B;  2A2C A;  4JI6 I;  3PYE A;  3WU5 A;  4JI1 I;  1HR0 E;  4GKJ I;  3B82 A;  3OTO E;  3QT6 A;  1Z0T A;  2BM0 A;  2UUC I;  4LFC E;  3J81 C;  2UXB I;  4LFA E;  3LTO A;  2J7K A;  4X66 I;  3WU6 A;  4HYM A;  2UUB I;  4USK A;  4WUD A;  5IWA E;  4JI3 I;  1XMQ E;  1HNZ I;  1Z5A A;  4NXN I;  4FWG A;  2F4V I;  4ZVI A;  4R1F A;  1ELO A;  5GME A;  5BR8 E;  4DV4 E;  3LNU A;  1IBM E;  4B3S I;  1Z0B A;  4X66 E;  1WUU A;  4DV7 I;  1HNX I;  4DV0 E;  1N36 I;  3J80 Q;  3ZZT A;  4OX9 I;  1VIS A;  2DEI A;  2BM1 A;  1HNX E;  1QZR A;  3B78 A;  4GKJ E;  1N32 I;  3D4J A;  4JI7 I;  1ZM2 A;  4JI0 E;  2HHH E;  2UXC I;  1OJ4 A;  1PKP A;  1ZXN A;  1N33 I;  4UTG A;  4NXN E;  1Z0E A;  4JI7 E;  3QT5 A;  2HFS A;  1Z0W A;  4KHP E;  1XNR I;  2UUB E;  4DV5 E;  4JYA I;  4DV6 E;  3J7A G;  1IBL I;  3H4L A;  4WUC A;  4AQY I;  4DU7 A;  3T1H E;  1N36 E;  4DR5 E;  2HKE A;  1NHJ A;  2OI2 A;  4UT4 A;  1Z0G A;  4DV2 E;  1H74 A;  1IBM I;  4ED4 A;  4DV3 E;  1MX0 A;  2GS8 A;  4JYA E;  4DR3 E;  4JV5 I;  1FI4 A;  2R3V A;  4PU9 A;  4P7A A;  4DV3 I;  4LF4 E;  4B3R E;  4JI3 E;  1ZXM A;  3HUL A;  3V5R A;  1I94 I;  1XMO I;  5FLX Q;  2UU9 E;  4WUB A;  3J81 Q;  3CWV A;  3K1J A;  2UU9 I; 
#chains in the Genus database with same CATH topology
 4LFC I;  5IT9 Q;  5K36 A;  4BA2 B;  4DR4 E;  5JEA F;  1FJG E;  4URL A;  2VES A;  4DV0 I;  2CVE A;  4DUY I;  4JI1 E;  3PYG A;  2O1V A;  4DPU A;  1Z59 A;  3V2U C;  4DR3 I;  4U3B A;  2Q2E B;  3ZKB A;  4JI6 E;  4LF7 E;  4Z7C A;  1N32 E;  3F0N A;  3PYF A;  3DD6 A;  1XHK A;  2NN6 E;  1DAR A;  2BR2 A;  4LOM A;  1R6L A;  2UXC E;  1S4E A;  4DR1 E;  2JEA B;  1ZM4 A;  3UHM A;  2UXD E;  4YY3 E;  3P06 A;  5EKW A;  1FWL A;  4AQY E;  1HNW E;  3JAM C;  2E5L I;  3ZKD A;  4XTJ A;  3T1Y E;  4DV7 E;  1FWK A;  2PO1 B;  4X65 I;  1YH8 A;  2E5L E;  4HAC A;  3P3C A;  5BR8 I;  5K36 C;  2GO3 A;  4Z7Y A;  4K0K I;  4FW4 A;  2UUC E;  2HK3 A;  1Y4S A;  1ZM9 A;  4LFB I;  5A2Q Q;  3PRY A;  4JI0 I;  2A2D A;  2JEB B;  1Z0C A;  4DV1 I;  2BR2 B;  4PRV A;  3Q1Q A;  2VF3 A;  1RRE A;  4DR7 I;  1FNM A;  4BA2 A;  3M85 D;  1NHI A;  4NXM E;  4LFB E;  4LF6 I;  4AIM A;  4IFD C;  1XMQ I;  1HNZ E;  2VQF E;  1N34 I;  4K0K E;  5LMN E;  4OKG A;  2LJP A;  4LF9 E;  5C0X A;  4IZJ D;  4LCG A;  4JI5 I;  4MU1 A;  3ZM7 A;  1N0V C;  1H7U A;  5LL6 R;  1IBL E;  4DUZ I;  3ZZU A;  4B3S E;  2DEJ A;  5C0X C;  1Y6Z A;  1B63 A;  4OO1 E;  4DR2 I;  4B3R I;  2V2Z A;  4LF4 I;  4DR6 E;  2VQE I;  1MU5 A;  3P3E A;  2UUA E;  1Z0V A;  4B3T I;  3OTO I;  2IOP A;  2HHH I;  4JI4 I;  4DR6 I;  2BA0 D;  4IFD D;  4NBQ A;  4FW5 A;  2BV3 A;  4USM A;  5IWA I;  2HFU A;  4B3M I;  4KQV A;  4DV2 I;  4LPF A;  4EMD A;  4LFA I;  4DUZ E;  3HKM A;  1PIE A;  1XNQ I;  5FLX C;  4JI5 E;  2JE6 A;  4RPF A;  4DR4 I;  1K47 A;  2PO2 A;  5LMN I;  3KRN A;  4DPT A;  4BA1 B;  4MYU A;  1U2R A;  1RHY A;  3GON A;  4X65 E;  1NHH A;  4FN5 A;  5IT9 C;  4FWH A;  4DV5 I;  1HR0 I;  1Y4U A;  2PNL A;  3P76 A;  1XNR E;  2JEB A;  4OO1 F;  4LF8 I;  2HK2 A;  1I94 E;  1N34 E;  5LMU I;  4LF5 I;  3M7N G;  2WP8 A;  5C0X E;  3PS3 A;  4FW9 A;  1OYS A;  1MG7 A;  2O3Z A;  3CDJ A;  3WU4 A;  2ZM6 I;  1EA6 A;  1RR9 A;  3B8H A;  3QT8 A;  4QNJ A;  3Q6N A;  4DUY E;  2JEA A;  4X62 E;  3JAM Q;  2C37 B;  4DU8 A;  2V2Q A;  2Z5B B;  2UXD I;  3L7Z A;  1UDS A;  1HK7 A;  5L3J A;  4OO1 D;  1J5E E;  1UDN A;  1UDO A;  2V2V A;  4OX9 E;  4GKK E;  4FWD A;  1B62 A;  1Z5C A;  4X64 I;  2F1D A;  3P3G A;  4JI2 E;  1OYP A;  4DXL A;  2E1R A;  1NZ0 A;  2ZM6 E;  4HXZ A;  5A2Q C;  1IBK I;  4B3T E;  4IFD F;  1N0U A;  2V34 A;  1KTV A;  1P42 A;  2F4V E;  2WW4 A;  5FWK A;  1FJG I;  3LPS A;  1H73 A;  1E3P A;  4M1K A;  2WP8 B;  2NN6 A;  4JI2 I;  2UXB E;  1HNW I;  2IER A;  3NZK A;  5C0X F;  2V8P A;  4LF9 I;  4I3H A;  3CDI A;  4JG4 A;  1H72 C;  4GKK I;  2C39 B;  1J5E I;  4ISA A;  4DR5 I;  4DPY A;  1ZM3 A;  5K36 D;  1H7S A;  2X36 A;  3T1H I;  4MYT A;  1XNQ E;  4OZE A;  1UDQ A;  1OYR A;  5JEA B;  4DV6 I;  5JEA A;  2NN6 B;  2PO0 A;  4IFD E;  2HKJ A;  2UUA I;  1UEK A;  4J3D A;  4MU4 A;  2VQE E;  4DV1 E;  4DPW A;  4X64 E;  2NN6 D;  4HAC B;  4YHH I;  1KIJ A;  4OO1 A;  2CGE A;  4LF5 E;  3K17 A;  4DR2 E;  2BA1 D;  5DRR A;  5GMD A;  3J80 C;  1Y60 A;  2R42 A;  5K36 F;  5JEA C;  2EFG A;  1XMO E;  4YY3 I;  1EI1 A;  1Y5Y A;  2ZIT A;  3QT7 A;  4DR1 I;  4JI8 I;  1BKN A;  4HY1 A;  3M7N D;  4LF6 E;  4X62 I;  4QNK A;  2VQF I;  2IOQ A;  1USV A;  2C37 A;  1N33 E;  4U3D A;  4LF7 I;  4FW3 A;  3HJC A;  1IBK E;  2CZ9 A;  4JV5 E;  3PYD A;  4DR7 E;  4KHP I;  4LF8 E;  1S16 A;  1A6F A;  4P52 A;  4DPX A;  2AE8 A;  4IZJ A;  2AJ4 A;  3L7Z B;  1Z5B A;  1KKH A;  4JI8 E;  3M6A A;  5EL9 A;  3U1Y A;  2X7I A;  3WU3 A;  1D6T A;  5C0X D;  5K36 E;  1XXE A;  2C38 A;  3J7A M;  1USU A;  1FKA E;  4PRX A;  3M85 G;  3T1Y I;  2XEX A;  4B3M E;  4DV4 I;  3PS1 A;  5DRO A;  5DNL A;  5DNX A;  3ZZ0 A;  2NPF A;  4JI4 E;  2PO2 B;  4LCF A;  2JE6 B;  5DRQ A;  3K85 A;  1KVK A;  4NXM I;  4YHH E;  5LMU E;  1PVG A;  2ZBK B;  2A2C A;  4JI6 I;  2NN6 C;  3PYE A;  5DRP A;  3WU5 A;  2PNZ B;  4JI1 I;  1HR0 E;  4GKJ I;  3B82 A;  3OTO E;  3QT6 A;  1Z0T A;  2BM0 A;  2UUC I;  2WNR A;  2Z5C B;  4LFC E;  3J81 C;  3PS2 A;  2WNR B;  2Z5C A;  2BA1 G;  4OO1 C;  2UXB I;  4LFA E;  3LTO A;  2J7K A;  4X66 I;  3WU6 A;  4HYM A;  2UUB I;  4USK A;  4WUD A;  5IWA E;  4JI3 I;  4MU0 A;  4FW6 A;  2C38 B;  4AM3 A;  3GLL A;  3B4T A;  1XMQ E;  1HNZ I;  2O1T A;  1Z5A A;  4NXN I;  2GQ0 A;  4FWG A;  2F4V I;  4ZVI A;  4R1F A;  1ELO A;  4IZJ B;  5GME A;  5BR8 E;  4DV4 E;  3LNU A;  4FW7 A;  1IBM E;  4B3S I;  1Z0B A;  4X66 E;  1WUU A;  2Z5B A;  4DV7 I;  2IES A;  4N3O A;  1HNX I;  3GCM A;  4DV0 E;  1N36 I;  3J80 Q;  3ZZT A;  4OX9 I;  1VIS A;  2DEI A;  2BM1 A;  1HNX E;  1QZR A;  3B78 A;  4GKJ E;  1N32 I;  3D4J A;  5JEA D;  4JI7 I;  4LCH A;  3U1K A;  1ZM2 A;  4IS9 A;  4JI0 E;  2HHH E;  2UXC I;  1OJ4 A;  1PKP A;  1ZXN A;  4MQY A;  1N33 I;  4UTG A;  4NXN E;  4IFD B;  1Z0E A;  5ELW A;  4JI7 E;  3QT5 A;  4IFD A;  1Z0W A;  2HFS A;  2PO1 A;  4MU3 A;  1XNR I;  4KHP E;  5JEA E;  2UUB E;  4MDT A;  2BA0 G;  4DV5 E;  4JYA I;  4DV6 E;  4BA1 A;  3J7A G;  1IBL I;  3H4L A;  4WUC A;  4AQY I;  4DU7 A;  3T1H E;  2O1W A;  1N36 E;  4DR5 E;  4OO1 B;  2HKE A;  1NHJ A;  2OI2 A;  4UT4 A;  1R6M A;  2O1U A;  2PNZ A;  5K36 B;  1Z0G A;  2C39 A;  4DV2 E;  1H74 A;  1IBM I;  2PO0 B;  4GQU A;  4ED4 A;  4DV3 E;  2GO4 A;  1MX0 A;  2GS8 A;  4JYA E;  4DR3 E;  4JV5 I;  1FI4 A;  2Z5E A;  2R3V A;  4PU9 A;  2J65 A;  4AID A;  4P7A A;  4DV3 I;  4LF4 E;  4B3R E;  1YHC A;  2NN6 F;  1ZXM A;  4JI3 E;  2JT2 A;  3HUL A;  3V5R A;  2CG9 A;  1I94 I;  1XMO I;  4IZK A;  1E3H A;  1VI7 A;  3Q6M A;  5FLX Q;  5C0X B;  4WUB A;  2PNM A;  4IZK B;  3J81 Q;  2UU9 E;  3CWV A;  3K1J A;  3GME A;  3H1C A;  2UU9 I; 
#chains in the Genus database with same CATH homology
 4LFC I;  5IT9 Q;  4DR4 E;  1FJG E;  4URL A;  4DV0 I;  4DUY I;  4JI1 E;  3PYG A;  2O1V A;  4DPU A;  1Z59 A;  3V2U C;  4DR3 I;  2Q2E B;  3ZKB A;  4JI6 E;  4LF7 E;  4Z7C A;  1N32 E;  3F0N A;  3PYF A;  1XHK A;  1DAR A;  2UXC E;  1S4E A;  4DR1 E;  1ZM4 A;  2UXD E;  4YY3 E;  3P06 A;  1FWL A;  4AQY E;  1HNW E;  3JAM C;  2E5L I;  3ZKD A;  4XTJ A;  3T1Y E;  4DV7 E;  1FWK A;  4X65 I;  2E5L E;  4HAC A;  5BR8 I;  4Z7Y A;  4K0K I;  2UUC E;  2HK3 A;  1Y4S A;  1ZM9 A;  4LFB I;  5A2Q Q;  3PRY A;  2A2D A;  4JI0 I;  1Z0C A;  4DV1 I;  4PRV A;  3Q1Q A;  2VF3 A;  1RRE A;  4DR7 I;  1FNM A;  1NHI A;  4NXM E;  4LFB E;  4LF6 I;  1XMQ I;  1HNZ E;  2VQF E;  1N34 I;  4K0K E;  5LMN E;  2LJP A;  4LF9 E;  4IZJ D;  4JI5 I;  3ZM7 A;  1N0V C;  1H7U A;  5LL6 R;  1IBL E;  4DUZ I;  3ZZU A;  4B3S E;  2DEJ A;  1Y6Z A;  1B63 A;  4DR2 I;  4B3R I;  2V2Z A;  4LF4 I;  4DR6 E;  2VQE I;  1MU5 A;  2UUA E;  1Z0V A;  4B3T I;  3OTO I;  2IOP A;  2HHH I;  4JI4 I;  4DR6 I;  2BV3 A;  4USM A;  5IWA I;  2HFU A;  4B3M I;  4KQV A;  4DV2 I;  4LFA I;  4EMD A;  4DUZ E;  1PIE A;  1XNQ I;  5FLX C;  4JI5 E;  4RPF A;  4DR4 I;  1K47 A;  5LMN I;  4DPT A;  4MYU A;  1U2R A;  3GON A;  4X65 E;  1NHH A;  4FN5 A;  5IT9 C;  4FWH A;  4DV5 I;  1HR0 I;  1Y4U A;  2PNL A;  1XNR E;  4LF8 I;  2HK2 A;  1I94 E;  1N34 E;  5LMU I;  4LF5 I;  4FW9 A;  1MG7 A;  3WU4 A;  2ZM6 I;  1EA6 A;  1RR9 A;  3B8H A;  3QT8 A;  3Q6N A;  4DUY E;  4X62 E;  3JAM Q;  4DU8 A;  2V2Q A;  2Z5B B;  2UXD I;  1HK7 A;  5L3J A;  1J5E E;  2V2V A;  4GKK E;  4OX9 E;  4FWD A;  1B62 A;  1Z5C A;  4X64 I;  4JI2 E;  4DXL A;  2E1R A;  1NZ0 A;  2ZM6 E;  4HXZ A;  5A2Q C;  1IBK I;  4B3T E;  1N0U A;  2V34 A;  1KTV A;  2F4V E;  2WW4 A;  5FWK A;  1FJG I;  3LPS A;  1H73 A;  4M1K A;  4JI2 I;  2UXB E;  1HNW I;  2V8P A;  4LF9 I;  4I3H A;  4JG4 A;  1H72 C;  4GKK I;  1J5E I;  4DR5 I;  4DPY A;  1ZM3 A;  1H7S A;  2X36 A;  3T1H I;  4MYT A;  1XNQ E;  4DV6 I;  2HKJ A;  2UUA I;  1UEK A;  2VQE E;  4DV1 E;  4DPW A;  4X64 E;  4YHH I;  4HAC B;  1KIJ A;  2CGE A;  4LF5 E;  3K17 A;  4DR2 E;  5GMD A;  3J80 C;  2R42 A;  2EFG A;  1XMO E;  4YY3 I;  1EI1 A;  2ZIT A;  3QT7 A;  4DR1 I;  4JI8 I;  1BKN A;  4HY1 A;  4LF6 E;  4X62 I;  2VQF I;  2IOQ A;  1USV A;  1N33 E;  4LF7 I;  3HJC A;  1IBK E;  2CZ9 A;  4JV5 E;  3PYD A;  4DR7 E;  4KHP I;  4LF8 E;  1S16 A;  1A6F A;  4P52 A;  4DPX A;  4IZJ A;  2AJ4 A;  1Z5B A;  1KKH A;  4JI8 E;  3M6A A;  2X7I A;  3WU3 A;  1D6T A;  3J7A M;  1USU A;  1FKA E;  4PRX A;  3T1Y I;  2XEX A;  4B3M E;  4DV4 I;  3ZZ0 A;  2NPF A;  4JI4 E;  3K85 A;  1KVK A;  4NXM I;  4YHH E;  5LMU E;  1PVG A;  2ZBK B;  2A2C A;  4JI6 I;  3PYE A;  3WU5 A;  4JI1 I;  1HR0 E;  4GKJ I;  3B82 A;  3OTO E;  3QT6 A;  1Z0T A;  2BM0 A;  2UUC I;  2Z5C B;  4LFC E;  3J81 C;  2Z5C A;  2UXB I;  4LFA E;  3LTO A;  2J7K A;  4X66 I;  3WU6 A;  4HYM A;  2UUB I;  4USK A;  4WUD A;  5IWA E;  4JI3 I;  1XMQ E;  1HNZ I;  2O1T A;  1Z5A A;  4NXN I;  2GQ0 A;  4FWG A;  2F4V I;  4ZVI A;  4R1F A;  1ELO A;  4IZJ B;  5GME A;  5BR8 E;  4DV4 E;  3LNU A;  1IBM E;  4B3S I;  1Z0B A;  4X66 E;  1WUU A;  2Z5B A;  4DV7 I;  4N3O A;  1HNX I;  4DV0 E;  1N36 I;  3J80 Q;  3ZZT A;  4OX9 I;  1VIS A;  2DEI A;  2BM1 A;  1HNX E;  1QZR A;  3B78 A;  4GKJ E;  1N32 I;  3D4J A;  4JI7 I;  1ZM2 A;  4JI0 E;  2HHH E;  2UXC I;  1OJ4 A;  1PKP A;  1ZXN A;  1N33 I;  4UTG A;  4NXN E;  1Z0E A;  4JI7 E;  3QT5 A;  2HFS A;  1Z0W A;  4KHP E;  1XNR I;  2UUB E;  4DV5 E;  4JYA I;  4DV6 E;  3J7A G;  1IBL I;  3H4L A;  4WUC A;  4AQY I;  4DU7 A;  3T1H E;  2O1W A;  1N36 E;  4DR5 E;  2HKE A;  1NHJ A;  2OI2 A;  4UT4 A;  2O1U A;  1Z0G A;  4DV2 E;  1H74 A;  1IBM I;  4ED4 A;  4DV3 E;  1MX0 A;  2GS8 A;  4JYA E;  4DR3 E;  4JV5 I;  1FI4 A;  2Z5E A;  2R3V A;  4PU9 A;  4P7A A;  4DV3 I;  4LF4 E;  4B3R E;  4JI3 E;  1ZXM A;  3HUL A;  3V5R A;  2CG9 A;  1I94 I;  1XMO I;  4IZK A;  5FLX Q;  3Q6M A;  2UU9 E;  4WUB A;  2PNM A;  4IZK B;  3J81 Q;  3CWV A;  3K1J A;  2UU9 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...