4X64M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x64M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x64M02
3U6OA 1PJIA 4LF9M 2UXBM 1HNWM 3GQ5A 4X62M 3A42A 5LMUM 1R2ZA 1IBMM 4DR1M 1K82A 2E5LM 1L2DA 1K3XA 3SAWA 5FLXS 3VK8A 4B3MM 3J80S 3C58A 5ITXA 2F5SA 4NRVA 3JAMS 2VQFM 1PM5A 4ITQA 1N33M 3T1YM 1PJJA 5IWAM 4G4QA 4B3RM 1HNZM 1IBKM 4PDGA 2OPFA 1L2BA 1L1ZA 4OX9M 1Q3CA 5ITXE 1TDHA 3SAVA 2UUCM 3SATA 1XNRM 4PCZA 1XMOM 2UU9M 2HKJA 4JI1M 4K0KM 4DR2M 3SARA 3GPXA 1TDZA 2UUAM 4JI0M 1Q39A 4LF6M 3J7AS 5BR8M 4G4NA 2F5OA 4JV5M 1HNXM 4PD2A 1FJGM 5A2QS 1J5EM 1Q3BA 4JI7M 3A46A 3GPYA 4LF7M 3GO8A 1N36M 1Z5AA 4YY3M 3U6LA 1N34M 5ITRA 4DV5M 4DV7M 1XNQM 2VQEM 1XC8A 3VK7A 4JI5M 4G4OA 2XZUA 1EE8A 2ZM6M 4GKJM 1I94M 3TWMA 1L1TA 1MU5A 4DV1M 5LMNM 3SAUA 3T1HM 3U6DA 1N32M 3GQ4A 4DR4M 4JI2M 2F4VM 2UXDM 4MB7A 4NRWA 3U6QA 4YHHM 3JR4A 1L2CA 2UXCM 4LFCM 4LF5M 4B3SM 5ITUA 4GKKM 3U6CA 4X64M 4DUYM 2HHHM 4DR3M 4DV4M 4PDIA 4G4RA 2ZBKB 2XZFA 4DR6M 3GPPA 1R2YA 1IBLM 2OQ4A 3U6MA 4AQYM 4CISA 1NNJA 3W0FA 4DV2M 4LF4M 1XMQM 4LF8M 2F5NA 3JR5A 2F5PA 3SBJA 4X66M 1MX0A 4DV3M 4JI6M 2F5QA 1KFVA 4NXNM 4JYAM 1Z5CA 1K3WA 5ITQA 4DUZM 3GPUA 3GQ3A 2UUBM 4JI4M 4JI8M 5ITTA 4DR7M 4LFBM 4LFAM 4DV6M 4DV0M 4KHPM 3A45A 3U6EA 4JI3M 3U6SA 3TWKA 4B3TM 5ITYA 5IT9S 3TWLA 4X65M 1Z59A 4NXMM 3J81S 3SASA 2Q2EB 3DOAA 4DR5M 3GP1A 1Z5BA 3OTOM 3U6PA 2EA0A 1HR0M
chains in the Genus database with same CATH superfamily
4LF9M 2CWBA 5KPRA 1N78A 1XWIA 8CATA 5KQDA 4QHTA 2BJVA 1GLNA 2ZAOA 4DR1M 2DAEA 3R9XB 1L2DA 2OO9A 2XSZD 1PJSA 4AI6A 4MGYE 3M6AA 5ITXA 1N33M 1PJJA 1IN8A 3HJ8A 5IWAM 3HWSA 2OOBA 2YQZA 1G71A 2Y20A 1NY5A 1P3QQ 2KHHA 3FUXA 2LWXA 1JB0F 1ZMUA 2EUCA 5E26A 5ITXE 2JA2A 1QQWA 2C98A 3KS4A 1XNRM 2DZNB 4PCZA 1HT1E 2LBCA 2BWBA 3TPZA 3SARA 2DENA 4BBAA 4FCWA 4L15A 3UK6A 3VDUA 1TH4A 2DZOB 2EJSA 1Q39A 1V34A 2XFSA 3Q8XA 5KO3A 4LF6M 4UN2B 2NQ8C 4IBIA 4ANRA 5DYIA 1HNXM 4QNRA 3FD9A 4GIPA 4GC9A 4P17A 5A2QS 3BXWA 1EFUB 1SXJE 4II7A 1Z5AA 2JY5A 1HQCA 3LQRA 1N75A 1ORYB 4YY3M 4MGZE 5H37D 4DV5M 1XNQM 4MH0E 2EKKA 1TR8A 4G4OA 4TUWA 4AKHA 2XZUA 1PJQA 1EE8A 1DO2A 2CHQA 3UGJA 3WHLA 1MU5A 7CATA 4IBJA 4REZA 4BLCA 1N32M 3GQ4A 4DR4M 4JI2M 3QAUA 4LCBA 4NRWA 4LJ5A 2DAMA 2K47A 1G59A 3FUUA 4LF5M 1Y8GA 5ITUA 3FYCA 2JXNA 2KNZA 4KO8A 3AL0C 4L16A 4KODA 3GLFE 1D0MA 5FTNA 3ZC7B 1YUBA 5EXSA 1H6UA 3GRYA 4PT5A 3AOEA 4WURA 2CHGA 3GPPA 1R2YA 3IECA 3NBIA 1NNJA 3W0FA 4Z8XA 4B7HA 3T15A 3HHWA 1VG5A 1XMQM 2CV0A 4MGHA 4NOOB 3K92A 4LF8M 4FCTA 3ZH9B 1Q02A 1GVNA 2KZUA 1N77A 3C3EA 1S3SA 2I7NA 4G6ZA 3HZJA 3L2AA 5L8RF 2JWSA 1KFVA 2RGHA 4NXNM 3VLFB 4W5WA 3HHYA 3MHVC 2JY7A 3R8FA 4DUZM 4F2LA 3CGWA 3GPUA 3I51A 3FE3A 3E4RA 3U5ZA 4JI4M 1NO1A 1HQYE 4ZPXA 2VF7A 1NNUC 2D7GA 4KHPM 4JXJA 2VF8A 3AFHA 3A45A 3U6EA 1IN7A 1QDRA 4XK8F 3TWKA 5ITYA 5IT9S 1OAOC 5DNYA 2DAGA 2KXEA 2J7NA 1R4GA 1GL6A 3I01M 1LTMA 4IBFA 3LVVA 5KPTA 3E46A 2JZ1A 2CRUA 2DAIA 3DOAA 5DYGA 3B7ZA 3T6PA 4DR5M 1C7YA 2MROB 2R46A 3H4MA 2OOAA 4R3DA 2EA0A 3SATA 3U6OA 1PJIA 2UXBM 1LV7A 1G3IA 3GQ5A 4L78A 3A42A 4QHSA 1R2ZA 1WHCA 4LJAA 3L27A 1E9SA 5EXPA 3I4YA 3K2LA 3FTFA 2XGNA 3L25A 3HGIA 3VK8A 5FLXS 1AUAA 1NV8A 4WW0A 2DZLA 3JAMS 1IY0A 1TH3A 5EP2A 1SXJB 2JP7A 2KNVA 1OKSA 1HNZM 2JY8A 4LZJA 4FCVA 2OPFA 1L2BA 3VKHA 1NHGC 4FW9A 3KP0E 2CV2A 2O5RA 3FYDA 4OVZA 4IBKA 3FUWA 2UU9M 4LY6A 3FTDA 1GJSA 3NWLA 4K0KM 4DR2M 2QNJA 3D8BA 4IJEA 5FTJA 3B7NA 2DWNA 2FFJA 5IREB 4JI0M 2F5OA 2R4EA 3SC3A 3ILKA 3UJNA 3Q8GA 5IZ7D 2DI0A 1WGLA 3DA1A 1AIPC 2LTUA 1SG9A 2QPAA 2V1UA 3HU1A 3CF2A 2CP8A 2H5XA 3GO8A 4LF7M 1ZV1A 2ZTDA 1V33A 5ITRA 2LH0A 3EIHA 4DV7M 4D80A 1QUSA 2VQEM 4EIWA 2O25A 3M0EA 2APLA 1I94M 4R7GA 3TWMA 2RGOA 3L26A 2MJ5B 3M7GA 2C9OA 3HKPA 4FWHA 4I5SA 3U6DA 1Z6TA 4FVMA 4B7FA 4L6V6 3EIEA 2C96A 2F4VM 2UXDM 4MB7A 5EQTA 4YHHM 3JR4A 3AV0A 2UXCM 4RNAA 4HL4A 3GLHA 2DHRA 4XGIA 3VFDA 1JR3D 3W0LB 4QOSA 3AKZA 3W67A 4X64M 2WSEF 4DR3M 2M5ZA 2ZBKB 3L29A 5KQ8A 3FUTA 1V92A 2KEBA 3U6MA 4M9SA 2JZ0A 4OVZB 4LGYA 4DV2M 3PXGA 1HJPA 3LMMA 2YR0A 5JI3E 3KOZE 4IIWA 4OU7A 1GABA 3T38A 1XXHA 2J7OA 3MJ5A 2DHYA 1T3TA 5ITQA 4FD2A 3KSXA 1R5LA 1UM8A 1OAIA 4NL4H 1YE9A 3KOYE 3A98B 4MGIE 4JI8M 5C1BA 1I4WA 4DR7M 3RE8A 4P16A 2K6BA 1NV9A 3HY5A 1NVMA 1CUKA 1QZMA 1VDDA 2MH8A 2QBYB 4GHLA 3SHGB 3SMSA 4DV0M 3SYKA 2DXIA 4LJ7A 1OQYA 1F4IA 1OFIA 1XB2B 2QSFX 3QYBA 3TWLA 1PGYA 2FH0A 1R6BX 1PJTA 1TTEA 2L7IA 1Z59A 1GJTA 2LVNC 3E21A 4NXMM 4AKIA 4S12A 4IBEA 2Q2EB 3J27B 3OTOM 3U6PA 2F5SA 2F5QA 2XLJA 2W82A 1JR3E 3MK6A 1J09A 4LG2A 2A5YB 1HNWM 2DWZB 2Y21A 2DKLA 4X62M 3K8ZA 3FRHA 1IBMM 3IG8A 2R6FA 2Z4RA 1ZQ9A 4LRSA 1ZMVA 1XXHE 3SAWA 4B3MM 2L09A 1E9RA 2EKFA 3C58A 4CIZA 1X37A 2Z8YM 2X4AA 1WJ7A 5KPZA 1JQJC 4ITQA 3KFUG 4JN6A 2MGWA 1DV0A 2KRKA 1SXJD 2K9DA 4B3RM 4I8OA 1IBKM 2QP9X 3LW5F 3VDPA 1NSFA 2KRUA 5C18A 3C9PA 3SMPA 1L1ZA 4OX9M 1TDHA 3KW6A 5EP3A 3SAVA 2HL7A 1ZAEA 1XMOM 4LJ9A 2HKJA 2ZTCA 1G8PA 2L6OA 4JI1M 1OIPA 3CF0A 3B7QA 4KLNA 3GLHE 3ZCBB 1TDZA 5FTMA 4AG6A 3SHFA 4M9XA 2UUAM 1IY1A 3K9OA 2C9CA 5BR8M 3J7AS 2YNMD 1JR3A 2G5GX 2WSCF 2BJWA 4WP2A 4LJ4A 3HHZA 4JV5M 2X49A 2DWLA 1IFYA 4PD2A 2Y0QA 1OJLA 3RGSA 4CHTB 2K0BX 2L2DA 3BBZA 3U61B 2LNHC 4JI7M 2HAKA 1QZEA 3GPYA 1WIVA 1QVRA 2ZANA 1N36M 3KSJA 4RF1A 3U6LA 3GLIB 2XEPA 1KSFX 1N34M 3J2PB 3U61A 2AHMA 3KS8A 3GRVA 2GQFA 1FNNA 1RU3A 4MM3B 1L8QA 2ZM6M 4AG5A 5EP1A 5GKNA 4GKJM 4IJFA 5JI2E 3HX3A 4DV1M 1VEKA 3T1HM 2R44A 2WSFF 4LGMA 2JY6B 2FE8A 3U6QA 3SFZA 3PNVA 1HT2E 5E6JA 3IG5A 1YSYA 1VEGA 2LXEA 3SYLA 3IHPA 3LVWA 4M9ZA 3TQSA 3QYEA 4CJ6A 3U6CA 3HU3A 4DUYM 4LJ6A 5FSWA 1D0KA 2L4FA 2KW0A 3K9PA 2ZAMA 4PDIA 4DV4M 1NJGA 4G4RA 2XZFA 5EXXA 1IBLM 2OQ4A 2G3QA 3RFWA 2N35A 1TF0B 2KDLA 2VDBB 2L7HA 3PNYA 1IXSB 1QANA 4D82A 1IY2A 1J7KA 3CTWB 1SXJC 2F5NA 2O01F 3KVWA 4HLQA 4M0DA 5BPVA 3JR5A 3SBJA 2F5PA 4GITA 4X66M 2HCBA 3GLGB 4DV3M 4JI6M 3I4VA 1IXRC 3KXEC 1DGFA 1VQ1A 1IN4A 3THGA 3FTEA 2QQ8A 3DFZA 1Z5CA 2Z4SA 1K3WA 1IM2A 2DWMA 1W5SA 1OTRA 2DVWB 1TGUA 3FRIA 3RGPA 3GQ3A 3W68A 4A3VB 2Z3XA 1GL7A 1XXHB 2WZJA 5ITTA 4F1IA 3C3DA 3AJIB 4LFBM 4DV6M 3TL4X 4JI3M 2X8AA 3V76A 3U60B 4X65M 3J7BA 3GLFA 3HJQA 4DBGB 2D7EA 1SXJA 1NJFA 2XF3A 5FTLA 3GLIA 1EIJA 2LVAA 2Y0TA 2KZSA 3DZDA 2VIIA 4Z6YA 4GH9A 4B7GA 3GLHB 4FWGA 5LMUM 1DGGA 3D8LA 3FUVA 1XHBA 1IXZA 4LZZA 1K82A 2E5LM 1K3XA 3GRRA 2CEAA 4I4LA 3J80S 4NSRA 4RKUF 3L28A 1D2NA 3NBXX 3TE6A 2EO2A 2JNHA 2L4EA 4NRVA 1WGNA 2M60A 4CGYB 2VQFM 4LRTA 1PM5A 3T1YM 4IBCA 2B3TA 2V1CA 2FS1A 4G4QA 2R18A 4OW0A 3AOEC 3GLIE 4PDGA 3MMPA 3E9SA 2DNAA 2FNAA 1DO0A 1Q3CA 3KP1E 2CV1A 1A5TA 4GC5A 4BB9A 2UUCM 3F92A 3H4JA 4RF0A 2C99A 1NHWC 1QYRA 2G8LA 1T43A 3GPXA 1MJGM 4QOZC 1E94E 1VEJA 2V6ZM 3GLGA 4HEOA 4QNMA 1PRBA 3WHKA 1BVSA 1QAMA 4MGKE 4G4NA 2GNOA 1WR1B 3AOGA 1W5TA 3UMMA 1FJGM 2QENA 1J5EM 1Q3BA 3VKGA 3U60A 4XBOA 3A46A 1TH2A 2BWEA 2ERCA 3ZQJA 2C5RA 1YLAA 3CF6E 4GHAA 5EP4A 1DGHA 1C1KA 4M0WA 1XC8A 4GEWA 2MR9A 3VK7A 4JI5M 3LCUA 1R7RA 4NC6A 2R0IA 1GKIA 1WXQA 2XFTA 3PFIA 4GMQA 2KNAA 3GLGE 1L1TA 1G4AE 1NY6A 5LMNM 3SAUA 4D81A 4I81A 2R65A 3HJSA 3KDSE 1VDLA 1L2CA 2DAKA 2H1RA 4Y28F 4LFCM 2J5YA 1QUTA 4AKGA 4B3SM 4GKKM 2D7HA 2LHGA 4R71A 2HHHM 4L8RC 4GRIA 4DR6M 1G41A 2LVQD 2XSZA 1T6OA 2QCUA 2YFQA 3B9PA 4AQYM 4CISA 2RKOA 5F3WA 1QAQA 3FTCA 1ZMWA 2QHOB 2R4JA 2CFOA 2I7PA 2RRUA 4LF4M 1IN5A 2JUJA 4Q7JA 2KA6B 2LHCA 1MX0A 3LCVB 4KT0F 3B89A 3U5ZB 2BNKA 3HHXA 5FTKA 1OFHA 3GRUA 4IBBA 4NSOB 4JYAM 1D0LA 1UFZA 3BOSA 4L4UA 4LJ8A 3KOWE 3FKEA 2QZ4A 3KOXE 2CE7A 4AZFA 4IBDA 2UUBM 5EJCA 5DFLA 1IN6A 1DGHB 2HWJA 1QDTA 1IXSA 5EXTA 3GLFB 4LFAM 1E32A 2P5TA 2R62A 3HU2A 4AW4A 4B08A 3PVSA 4IBGA 3QWLA 3U6SA 1GO5A 2Z7JA 2R45A 1DGBA 4B3TM 2XH9A 1MN3A 2QBYA 4FWDA 2FOIC 2CUZA 1IQPA 3B74A 2LVPC 3LQQA 4G3OA 3J81S 3SASA 1KYIA 2CHVA 3I04M 3K1JA 1Z5BA 3GP1A 3UZUA 1OIZA 1QAOA 2LVOC 1HR0M
chains in the Genus database with same CATH topology
4LF9M 5KPRA 1N78A 1XWIA 8CATA 5KQDA 4QHTA 2BJVA 1GLNA 2ZAOA 4DR1M 3R9XB 1L2DA 2XSZD 4AI6A 4MGYE 3M6AA 5ITXA 1N33M 1PJJA 1IN8A 3HJ8A 5IWAM 3HWSA 2YQZA 2Y20A 1NY5A 3FUXA 2LWXA 2EUCA 5ITXE 5E26A 2JA2A 1QQWA 2C98A 3KS4A 1XNRM 2DZNB 4PCZA 1HT1E 3TPZA 3SARA 4BBAA 4FCWA 4L15A 3UK6A 3VDUA 1TH4A 2DZOB 2XFSA 1Q39A 4LF6M 3Q8XA 5KO3A 2NQ8C 4IBIA 5DYIA 1HNXM 4QNRA 3FD9A 4GIPA 4GC9A 5A2QS 1SXJE 4II7A 1Z5AA 3LQRA 1HQCA 1N75A 1ORYB 4YY3M 4MGZE 5H37D 4DV5M 1XNQM 4MH0E 4G4OA 4TUWA 4AKHA 2XZUA 1EE8A 1DO2A 2CHQA 3UGJA 3WHLA 1MU5A 7CATA 4IBJA 4REZA 4BLCA 1N32M 3GQ4A 4DR4M 4JI2M 3QAUA 4LCBA 4NRWA 4LJ5A 2K47A 1G59A 3FUUA 4LF5M 5ITUA 3FYCA 4KO8A 3AL0C 4L16A 4KODA 5FTNA 3ZC7B 1YUBA 5EXSA 1H6UA 3GRYA 4PT5A 3AOEA 4WURA 2CHGA 3GPPA 1R2YA 3NBIA 1NNJA 3W0FA 4Z8XA 4B7HA 3T15A 3HHWA 1XMQM 2CV0A 4MGHA 4NOOB 3K92A 4LF8M 4FCTA 3ZH9B 2KZUA 1GVNA 1N77A 1S3SA 2I7NA 4G6ZA 3L2AA 1KFVA 2RGHA 4NXNM 3VLFB 4W5WA 3HHYA 3MHVC 3R8FA 4DUZM 3GPUA 3I51A 3E4RA 3U5ZA 4JI4M 1HQYE 4ZPXA 1NNUC 2D7GA 4KHPM 4JXJA 3AFHA 3A45A 3U6EA 1IN7A 3TWKA 5ITYA 5IT9S 5DNYA 2KXEA 2J7NA 1GL6A 4IBFA 3LVVA 5KPTA 5DYGA 3DOAA 4DR5M 4R3DA 3H4MA 2R46A 2EA0A 3SATA 3U6OA 1PJIA 2UXBM 1LV7A 1G3IA 3GQ5A 4L78A 3A42A 4QHSA 1R2ZA 4LJAA 3L27A 1E9SA 5EXPA 3I4YA 3K2LA 3FTFA 2XGNA 3L25A 3HGIA 3VK8A 5FLXS 4WW0A 3JAMS 1IY0A 1TH3A 5EP2A 1SXJB 1HNZM 4LZJA 4FCVA 2OPFA 1L2BA 3VKHA 1NHGC 4FW9A 3KP0E 2CV2A 2O5RA 3FYDA 4OVZA 4IBKA 3FUWA 2UU9M 4LY6A 3FTDA 3NWLA 4K0KM 4DR2M 3D8BA 5FTJA 4IJEA 2DWNA 2FFJA 5IREB 4JI0M 2F5OA 2R4EA 3SC3A 3ILKA 3UJNA 5IZ7D 3DA1A 2QPAA 2V1UA 3HU1A 3CF2A 4LF7M 3GO8A 5ITRA 2LH0A 3EIHA 4DV7M 4D80A 2VQEM 4EIWA 3M0EA 1I94M 4R7GA 3TWMA 2RGOA 3L26A 3M7GA 2C9OA 3HKPA 4FWHA 4I5SA 3U6DA 1Z6TA 4FVMA 4B7FA 3EIEA 2C96A 2F4VM 2UXDM 4MB7A 5EQTA 4YHHM 3JR4A 3AV0A 2UXCM 4RNAA 4HL4A 3GLHA 2DHRA 4XGIA 3VFDA 1JR3D 3W0LB 4QOSA 3AKZA 4X64M 4DR3M 2M5ZA 2ZBKB 3L29A 5KQ8A 3FUTA 2KEBA 3U6MA 4M9SA 4OVZB 4LGYA 4DV2M 3PXGA 3LMMA 2YR0A 5JI3E 3KOZE 4IIWA 4OU7A 3T38A 1XXHA 2J7OA 3MJ5A 1T3TA 5ITQA 4FD2A 3KSXA 1UM8A 4NL4H 1YE9A 3KOYE 3A98B 4MGIE 4JI8M 5C1BA 1I4WA 4DR7M 3RE8A 4P16A 1NVMA 1VDDA 1QZMA 2QBYB 4GHLA 3SHGB 3SMSA 4DV0M 3SYKA 2DXIA 4LJ7A 1OFIA 3TWLA 1R6BX 1Z59A 2L7IA 4AKIA 4NXMM 4S12A 4IBEA 2Q2EB 3J27B 3OTOM 3U6PA 2F5SA 2F5QA 2XLJA 2W82A 3MK6A 1J09A 4LG2A 2A5YB 1HNWM 2DWZB 2Y21A 4X62M 3K8ZA 1IBMM 3IG8A 2Z4RA 1ZQ9A 4LRSA 3SAWA 4B3MM 2L09A 1E9RA 3C58A 1X37A 2X4AA 3KFUG 5KPZA 1JQJC 4ITQA 4JN6A 2KRKA 1SXJD 4B3RM 4I8OA 1IBKM 2QP9X 3VDPA 1NSFA 2KRUA 5C18A 3SMPA 1L1ZA 4OX9M 1TDHA 3KW6A 5EP3A 3SAVA 2HL7A 1ZAEA 1XMOM 4LJ9A 2HKJA 1G8PA 2L6OA 4JI1M 3CF0A 4KLNA 3ZCBB 1TDZA 5FTMA 4AG6A 3SHFA 4M9XA 2UUAM 1IY1A 3J7AS 2C9CA 5BR8M 2YNMD 1JR3A 2G5GX 2BJWA 4LJ4A 3HHZA 4JV5M 2X49A 2DWLA 4PD2A 2Y0QA 1OJLA 3RGSA 4CHTB 3U61B 4JI7M 2LNHC 3GPYA 1QVRA 2ZANA 1N36M 3KSJA 4RF1A 3U6LA 3GLIB 2XEPA 1KSFX 1N34M 3J2PB 3U61A 2AHMA 3KS8A 3GRVA 1FNNA 4MM3B 1L8QA 2ZM6M 4AG5A 5EP1A 5GKNA 4GKJM 4IJFA 5JI2E 4DV1M 3T1HM 4LGMA 2FE8A 3U6QA 3SFZA 3PNVA 1HT2E 5E6JA 3IG5A 1YSYA 2LXEA 3SYLA 3LVWA 4M9ZA 3U6CA 3TQSA 3HU3A 4DUYM 4LJ6A 5FSWA 2KW0A 2ZAMA 4PDIA 4DV4M 1NJGA 4G4RA 2XZFA 5EXXA 1IBLM 2OQ4A 3RFWA 3PNYA 2L7HA 1IXSB 1QANA 4D82A 1IY2A 1J7KA 3CTWB 1SXJC 2F5NA 5BPVA 3KVWA 4HLQA 4M0DA 3JR5A 3SBJA 2F5PA 4GITA 4X66M 2HCBA 3GLGB 4DV3M 4JI6M 3I4VA 1IXRC 3KXEC 1DGFA 1IN4A 3THGA 3FTEA 3DFZA 1Z5CA 2Z4SA 1K3WA 1IM2A 2DWMA 1W5SA 2DVWB 1TGUA 3RGPA 3GQ3A 4A3VB 2Z3XA 1GL7A 1XXHB 5ITTA 4LFBM 3AJIB 4DV6M 3TL4X 4JI3M 2X8AA 3U60B 4X65M 3J7BA 3GLFA 3HJQA 3GLIA 2D7EA 1SXJA 1NJFA 2XF3A 5FTLA 2Y0TA 2KZSA 3DZDA 2VIIA 4Z6YA 4GH9A 4B7GA 3GLHB 4FWGA 5LMUM 1DGGA 3D8LA 3FUVA 1XHBA 1IXZA 4LZZA 1K82A 2E5LM 1K3XA 3GRRA 2CEAA 4I4LA 3J80S 4NSRA 3TE6A 3L28A 1D2NA 4CGYB 2EO2A 4NRVA 2M60A 2VQFM 1PM5A 4LRTA 3T1YM 4IBCA 2V1CA 4G4QA 2R18A 4OW0A 3AOEC 4PDGA 3E9SA 2FNAA 1Q3CA 1DO0A 3KP1E 2CV1A 4GC5A 4BB9A 2UUCM 4RF0A 2C99A 1QYRA 1NHWC 2G8LA 3GPXA 4QOZC 1E94E 2V6ZM 3GLGA 4QNMA 3WHKA 1QAMA 4MGKE 4G4NA 3AOGA 1W5TA 3UMMA 1FJGM 2QENA 1J5EM 1Q3BA 3VKGA 3U60A 4XBOA 3A46A 1TH2A 2ERCA 2C5RA 3CF6E 4GHAA 5EP4A 1DGHA 1C1KA 4M0WA 1XC8A 3VK7A 4JI5M 1R7RA 1GKIA 1WXQA 2XFTA 3PFIA 4GMQA 1L1TA 1G4AE 1NY6A 5LMNM 3SAUA 4D81A 4I81A 2R65A 3HJSA 3KDSE 1L2CA 2H1RA 4LFCM 4AKGA 4B3SM 4GKKM 2D7HA 2HHHM 4L8RC 4GRIA 4DR6M 1G41A 2XSZA 2QCUA 2YFQA 3B9PA 4AQYM 4CISA 2RKOA 5F3WA 1QAQA 3FTCA 2CFOA 2R4JA 4LF4M 2I7PA 1IN5A 2KA6B 1MX0A 3U5ZB 2BNKA 3HHXA 5FTKA 1OFHA 3GRUA 4IBBA 4NSOB 4JYAM 3BOSA 4L4UA 4LJ8A 3KOWE 3FKEA 2QZ4A 3KOXE 2CE7A 4AZFA 4IBDA 2UUBM 5EJCA 1IN6A 1DGHB 5EXTA 3GLFB 4LFAM 1E32A 2P5TA 2R62A 3HU2A 4AW4A 4B08A 3PVSA 4IBGA 3QWLA 3U6SA 2Z7JA 2R45A 1DGBA 4B3TM 2XH9A 2QBYA 4FWDA 2FOIC 2CUZA 1IQPA 3LQQA 3J81S 3SASA 1KYIA 2CHVA 3K1JA 3GP1A 1Z5BA 3UZUA 1QAOA 1HR0M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6O A;  1PJI A;  4LF9 M;  2UXB M;  1HNW M;  3GQ5 A;  4X62 M;  3A42 A;  5LMU M;  1R2Z A;  1IBM M;  4DR1 M;  1K82 A;  2E5L M;  1L2D A;  1K3X A;  3SAW A;  5FLX S;  3VK8 A;  4B3M M;  3J80 S;  3C58 A;  5ITX A;  2F5S A;  4NRV A;  3JAM S;  2VQF M;  1PM5 A;  4ITQ A;  1N33 M;  3T1Y M;  1PJJ A;  5IWA M;  4G4Q A;  4B3R M;  1HNZ M;  1IBK M;  4PDG A;  2OPF A;  1L2B A;  1L1Z A;  4OX9 M;  1Q3C A;  5ITX E;  1TDH A;  3SAV A;  2UUC M;  3SAT A;  1XNR M;  4PCZ A;  1XMO M;  2UU9 M;  2HKJ A;  4JI1 M;  4K0K M;  4DR2 M;  3SAR A;  3GPX A;  1TDZ A;  2UUA M;  4JI0 M;  1Q39 A;  4LF6 M;  3J7A S;  5BR8 M;  4G4N A;  2F5O A;  4JV5 M;  1HNX M;  4PD2 A;  1FJG M;  5A2Q S;  1J5E M;  1Q3B A;  4JI7 M;  3A46 A;  3GPY A;  4LF7 M;  3GO8 A;  1N36 M;  1Z5A A;  4YY3 M;  3U6L A;  1N34 M;  5ITR A;  4DV5 M;  4DV7 M;  1XNQ M;  2VQE M;  1XC8 A;  3VK7 A;  4JI5 M;  4G4O A;  2XZU A;  1EE8 A;  2ZM6 M;  4GKJ M;  1I94 M;  3TWM A;  1L1T A;  1MU5 A;  4DV1 M;  5LMN M;  3SAU A;  3T1H M;  3U6D A;  1N32 M;  3GQ4 A;  4DR4 M;  4JI2 M;  2F4V M;  2UXD M;  4MB7 A;  4NRW A;  3U6Q A;  4YHH M;  3JR4 A;  1L2C A;  2UXC M;  4LFC M;  4LF5 M;  4B3S M;  5ITU A;  4GKK M;  3U6C A;  4X64 M;  4DUY M;  2HHH M;  4DR3 M;  4DV4 M;  4PDI A;  4G4R A;  2ZBK B;  2XZF A;  4DR6 M;  3GPP A;  1R2Y A;  1IBL M;  2OQ4 A;  3U6M A;  4AQY M;  4CIS A;  1NNJ A;  3W0F A;  4DV2 M;  4LF4 M;  1XMQ M;  4LF8 M;  2F5N A;  3JR5 A;  2F5P A;  3SBJ A;  4X66 M;  1MX0 A;  4DV3 M;  4JI6 M;  2F5Q A;  1KFV A;  4NXN M;  4JYA M;  1Z5C A;  1K3W A;  5ITQ A;  4DUZ M;  3GPU A;  3GQ3 A;  2UUB M;  4JI4 M;  4JI8 M;  5ITT A;  4DR7 M;  4LFB M;  4LFA M;  4DV6 M;  4DV0 M;  4KHP M;  3A45 A;  3U6E A;  4JI3 M;  3U6S A;  3TWK A;  4B3T M;  5ITY A;  5IT9 S;  3TWL A;  4X65 M;  1Z59 A;  4NXM M;  3J81 S;  3SAS A;  2Q2E B;  3DOA A;  4DR5 M;  3GP1 A;  1Z5B A;  3OTO M;  3U6P A;  2EA0 A;  1HR0 M; 
#chains in the Genus database with same CATH topology
 4LF9 M;  2CWB A;  5KPR A;  1N78 A;  1XWI A;  8CAT A;  5KQD A;  4QHT A;  2BJV A;  1GLN A;  2ZAO A;  4DR1 M;  2DAE A;  3R9X B;  1L2D A;  2OO9 A;  2XSZ D;  1PJS A;  4AI6 A;  4MGY E;  3M6A A;  5ITX A;  1N33 M;  1PJJ A;  1IN8 A;  3HJ8 A;  5IWA M;  3HWS A;  2OOB A;  2YQZ A;  1G71 A;  2Y20 A;  1NY5 A;  1P3Q Q;  2KHH A;  3FUX A;  2LWX A;  1JB0 F;  1ZMU A;  2EUC A;  5E26 A;  5ITX E;  2JA2 A;  1QQW A;  2C98 A;  3KS4 A;  1XNR M;  2DZN B;  4PCZ A;  1HT1 E;  2LBC A;  2BWB A;  3TPZ A;  3SAR A;  2DEN A;  4BBA A;  4FCW A;  4L15 A;  3UK6 A;  3VDU A;  1TH4 A;  2DZO B;  2EJS A;  1Q39 A;  1V34 A;  2XFS A;  3Q8X A;  5KO3 A;  4LF6 M;  4UN2 B;  2NQ8 C;  4IBI A;  4ANR A;  5DYI A;  1HNX M;  4QNR A;  3FD9 A;  4GIP A;  4GC9 A;  4P17 A;  5A2Q S;  3BXW A;  1EFU B;  1SXJ E;  4II7 A;  1Z5A A;  2JY5 A;  1HQC A;  3LQR A;  1N75 A;  1ORY B;  4YY3 M;  4MGZ E;  5H37 D;  4DV5 M;  1XNQ M;  4MH0 E;  2EKK A;  1TR8 A;  4G4O A;  4TUW A;  4AKH A;  2XZU A;  1PJQ A;  1EE8 A;  1DO2 A;  2CHQ A;  3UGJ A;  3WHL A;  1MU5 A;  7CAT A;  4IBJ A;  4REZ A;  4BLC A;  1N32 M;  3GQ4 A;  4DR4 M;  4JI2 M;  3QAU A;  4LCB A;  4NRW A;  4LJ5 A;  2DAM A;  2K47 A;  1G59 A;  3FUU A;  4LF5 M;  1Y8G A;  5ITU A;  3FYC A;  2JXN A;  2KNZ A;  4KO8 A;  3AL0 C;  4L16 A;  4KOD A;  3GLF E;  1D0M A;  5FTN A;  3ZC7 B;  1YUB A;  5EXS A;  1H6U A;  3GRY A;  4PT5 A;  3AOE A;  4WUR A;  2CHG A;  3GPP A;  1R2Y A;  3IEC A;  3NBI A;  1NNJ A;  3W0F A;  4Z8X A;  4B7H A;  3T15 A;  3HHW A;  1VG5 A;  1XMQ M;  2CV0 A;  4MGH A;  4NOO B;  3K92 A;  4LF8 M;  4FCT A;  3ZH9 B;  1Q02 A;  1GVN A;  2KZU A;  1N77 A;  3C3E A;  1S3S A;  2I7N A;  4G6Z A;  3HZJ A;  3L2A A;  5L8R F;  2JWS A;  1KFV A;  2RGH A;  4NXN M;  3VLF B;  4W5W A;  3HHY A;  3MHV C;  2JY7 A;  3R8F A;  4DUZ M;  4F2L A;  3CGW A;  3GPU A;  3I51 A;  3FE3 A;  3E4R A;  3U5Z A;  4JI4 M;  1NO1 A;  1HQY E;  4ZPX A;  2VF7 A;  1NNU C;  2D7G A;  4KHP M;  4JXJ A;  2VF8 A;  3AFH A;  3A45 A;  3U6E A;  1IN7 A;  1QDR A;  4XK8 F;  3TWK A;  5ITY A;  5IT9 S;  1OAO C;  5DNY A;  2DAG A;  2KXE A;  2J7N A;  1R4G A;  1GL6 A;  3I01 M;  1LTM A;  4IBF A;  3LVV A;  5KPT A;  3E46 A;  2JZ1 A;  2CRU A;  2DAI A;  3DOA A;  5DYG A;  3B7Z A;  3T6P A;  4DR5 M;  1C7Y A;  2MRO B;  2R46 A;  3H4M A;  2OOA A;  4R3D A;  2EA0 A;  3SAT A;  3U6O A;  1PJI A;  2UXB M;  1LV7 A;  1G3I A;  3GQ5 A;  4L78 A;  3A42 A;  4QHS A;  1R2Z A;  1WHC A;  4LJA A;  3L27 A;  1E9S A;  5EXP A;  3I4Y A;  3K2L A;  3FTF A;  2XGN A;  3L25 A;  3HGI A;  3VK8 A;  5FLX S;  1AUA A;  1NV8 A;  4WW0 A;  2DZL A;  3JAM S;  1IY0 A;  1TH3 A;  5EP2 A;  1SXJ B;  2JP7 A;  2KNV A;  1OKS A;  1HNZ M;  2JY8 A;  4LZJ A;  4FCV A;  2OPF A;  1L2B A;  3VKH A;  1NHG C;  4FW9 A;  3KP0 E;  2CV2 A;  2O5R A;  3FYD A;  4OVZ A;  4IBK A;  3FUW A;  2UU9 M;  4LY6 A;  3FTD A;  1GJS A;  3NWL A;  4K0K M;  4DR2 M;  2QNJ A;  3D8B A;  4IJE A;  5FTJ A;  3B7N A;  2DWN A;  2FFJ A;  5IRE B;  4JI0 M;  2F5O A;  2R4E A;  3SC3 A;  3ILK A;  3UJN A;  3Q8G A;  5IZ7 D;  2DI0 A;  1WGL A;  3DA1 A;  1AIP C;  2LTU A;  1SG9 A;  2QPA A;  2V1U A;  3HU1 A;  3CF2 A;  2CP8 A;  2H5X A;  3GO8 A;  4LF7 M;  1ZV1 A;  2ZTD A;  1V33 A;  5ITR A;  2LH0 A;  3EIH A;  4DV7 M;  4D80 A;  1QUS A;  2VQE M;  4EIW A;  2O25 A;  3M0E A;  2APL A;  1I94 M;  4R7G A;  3TWM A;  2RGO A;  3L26 A;  2MJ5 B;  3M7G A;  2C9O A;  3HKP A;  4FWH A;  4I5S A;  3U6D A;  1Z6T A;  4FVM A;  4B7F A;  4L6V 6;  3EIE A;  2C96 A;  2F4V M;  2UXD M;  4MB7 A;  5EQT A;  4YHH M;  3JR4 A;  3AV0 A;  2UXC M;  4RNA A;  4HL4 A;  3GLH A;  2DHR A;  4XGI A;  3VFD A;  1JR3 D;  3W0L B;  4QOS A;  3AKZ A;  3W67 A;  4X64 M;  2WSE F;  4DR3 M;  2M5Z A;  2ZBK B;  3L29 A;  5KQ8 A;  3FUT A;  1V92 A;  2KEB A;  3U6M A;  4M9S A;  2JZ0 A;  4OVZ B;  4LGY A;  4DV2 M;  3PXG A;  1HJP A;  3LMM A;  2YR0 A;  5JI3 E;  3KOZ E;  4IIW A;  4OU7 A;  1GAB A;  3T38 A;  1XXH A;  2J7O A;  3MJ5 A;  2DHY A;  1T3T A;  5ITQ A;  4FD2 A;  3KSX A;  1R5L A;  1UM8 A;  1OAI A;  4NL4 H;  1YE9 A;  3KOY E;  3A98 B;  4MGI E;  4JI8 M;  5C1B A;  1I4W A;  4DR7 M;  3RE8 A;  4P16 A;  2K6B A;  1NV9 A;  3HY5 A;  1NVM A;  1CUK A;  1QZM A;  1VDD A;  2MH8 A;  2QBY B;  4GHL A;  3SHG B;  3SMS A;  4DV0 M;  3SYK A;  2DXI A;  4LJ7 A;  1OQY A;  1F4I A;  1OFI A;  1XB2 B;  2QSF X;  3QYB A;  3TWL A;  1PGY A;  2FH0 A;  1R6B X;  1PJT A;  1TTE A;  2L7I A;  1Z59 A;  1GJT A;  2LVN C;  3E21 A;  4NXM M;  4AKI A;  4S12 A;  4IBE A;  2Q2E B;  3J27 B;  3OTO M;  3U6P A;  2F5S A;  2F5Q A;  2XLJ A;  2W82 A;  1JR3 E;  3MK6 A;  1J09 A;  4LG2 A;  2A5Y B;  1HNW M;  2DWZ B;  2Y21 A;  2DKL A;  4X62 M;  3K8Z A;  3FRH A;  1IBM M;  3IG8 A;  2R6F A;  2Z4R A;  1ZQ9 A;  4LRS A;  1ZMV A;  1XXH E;  3SAW A;  4B3M M;  2L09 A;  1E9R A;  2EKF A;  3C58 A;  4CIZ A;  1X37 A;  2Z8Y M;  2X4A A;  1WJ7 A;  5KPZ A;  1JQJ C;  4ITQ A;  3KFU G;  4JN6 A;  2MGW A;  1DV0 A;  2KRK A;  1SXJ D;  2K9D A;  4B3R M;  4I8O A;  1IBK M;  2QP9 X;  3LW5 F;  3VDP A;  1NSF A;  2KRU A;  5C18 A;  3C9P A;  3SMP A;  1L1Z A;  4OX9 M;  1TDH A;  3KW6 A;  5EP3 A;  3SAV A;  2HL7 A;  1ZAE A;  1XMO M;  4LJ9 A;  2HKJ A;  2ZTC A;  1G8P A;  2L6O A;  4JI1 M;  1OIP A;  3CF0 A;  3B7Q A;  4KLN A;  3GLH E;  3ZCB B;  1TDZ A;  5FTM A;  4AG6 A;  3SHF A;  4M9X A;  2UUA M;  1IY1 A;  3K9O A;  2C9C A;  5BR8 M;  3J7A S;  2YNM D;  1JR3 A;  2G5G X;  2WSC F;  2BJW A;  4WP2 A;  4LJ4 A;  3HHZ A;  4JV5 M;  2X49 A;  2DWL A;  1IFY A;  4PD2 A;  2Y0Q A;  1OJL A;  3RGS A;  4CHT B;  2K0B X;  2L2D A;  3BBZ A;  3U61 B;  2LNH C;  4JI7 M;  2HAK A;  1QZE A;  3GPY A;  1WIV A;  1QVR A;  2ZAN A;  1N36 M;  3KSJ A;  4RF1 A;  3U6L A;  3GLI B;  2XEP A;  1KSF X;  1N34 M;  3J2P B;  3U61 A;  2AHM A;  3KS8 A;  3GRV A;  2GQF A;  1FNN A;  1RU3 A;  4MM3 B;  1L8Q A;  2ZM6 M;  4AG5 A;  5EP1 A;  5GKN A;  4GKJ M;  4IJF A;  5JI2 E;  3HX3 A;  4DV1 M;  1VEK A;  3T1H M;  2R44 A;  2WSF F;  4LGM A;  2JY6 B;  2FE8 A;  3U6Q A;  3SFZ A;  3PNV A;  1HT2 E;  5E6J A;  3IG5 A;  1YSY A;  1VEG A;  2LXE A;  3SYL A;  3IHP A;  3LVW A;  4M9Z A;  3TQS A;  3QYE A;  4CJ6 A;  3U6C A;  3HU3 A;  4DUY M;  4LJ6 A;  5FSW A;  1D0K A;  2L4F A;  2KW0 A;  3K9P A;  2ZAM A;  4PDI A;  4DV4 M;  1NJG A;  4G4R A;  2XZF A;  5EXX A;  1IBL M;  2OQ4 A;  2G3Q A;  3RFW A;  2N35 A;  1TF0 B;  2KDL A;  2VDB B;  2L7H A;  3PNY A;  1IXS B;  1QAN A;  4D82 A;  1IY2 A;  1J7K A;  3CTW B;  1SXJ C;  2F5N A;  2O01 F;  3KVW A;  4HLQ A;  4M0D A;  5BPV A;  3JR5 A;  3SBJ A;  2F5P A;  4GIT A;  4X66 M;  2HCB A;  3GLG B;  4DV3 M;  4JI6 M;  3I4V A;  1IXR C;  3KXE C;  1DGF A;  1VQ1 A;  1IN4 A;  3THG A;  3FTE A;  2QQ8 A;  3DFZ A;  1Z5C A;  2Z4S A;  1K3W A;  1IM2 A;  2DWM A;  1W5S A;  1OTR A;  2DVW B;  1TGU A;  3FRI A;  3RGP A;  3GQ3 A;  3W68 A;  4A3V B;  2Z3X A;  1GL7 A;  1XXH B;  2WZJ A;  5ITT A;  4F1I A;  3C3D A;  3AJI B;  4LFB M;  4DV6 M;  3TL4 X;  4JI3 M;  2X8A A;  3V76 A;  3U60 B;  4X65 M;  3J7B A;  3GLF A;  3HJQ A;  4DBG B;  2D7E A;  1SXJ A;  1NJF A;  2XF3 A;  5FTL A;  3GLI A;  1EIJ A;  2LVA A;  2Y0T A;  2KZS A;  3DZD A;  2VII A;  4Z6Y A;  4GH9 A;  4B7G A;  3GLH B;  4FWG A;  5LMU M;  1DGG A;  3D8L A;  3FUV A;  1XHB A;  1IXZ A;  4LZZ A;  1K82 A;  2E5L M;  1K3X A;  3GRR A;  2CEA A;  4I4L A;  3J80 S;  4NSR A;  4RKU F;  3L28 A;  1D2N A;  3NBX X;  3TE6 A;  2EO2 A;  2JNH A;  2L4E A;  4NRV A;  1WGN A;  2M60 A;  4CGY B;  2VQF M;  4LRT A;  1PM5 A;  3T1Y M;  4IBC A;  2B3T A;  2V1C A;  2FS1 A;  4G4Q A;  2R18 A;  4OW0 A;  3AOE C;  3GLI E;  4PDG A;  3MMP A;  3E9S A;  2DNA A;  2FNA A;  1DO0 A;  1Q3C A;  3KP1 E;  2CV1 A;  1A5T A;  4GC5 A;  4BB9 A;  2UUC M;  3F92 A;  3H4J A;  4RF0 A;  2C99 A;  1NHW C;  1QYR A;  2G8L A;  1T43 A;  3GPX A;  1MJG M;  4QOZ C;  1E94 E;  1VEJ A;  2V6Z M;  3GLG A;  4HEO A;  4QNM A;  1PRB A;  3WHK A;  1BVS A;  1QAM A;  4MGK E;  4G4N A;  2GNO A;  1WR1 B;  3AOG A;  1W5T A;  3UMM A;  1FJG M;  2QEN A;  1J5E M;  1Q3B A;  3VKG A;  3U60 A;  4XBO A;  3A46 A;  1TH2 A;  2BWE A;  2ERC A;  3ZQJ A;  2C5R A;  1YLA A;  3CF6 E;  4GHA A;  5EP4 A;  1DGH A;  1C1K A;  4M0W A;  1XC8 A;  4GEW A;  2MR9 A;  3VK7 A;  4JI5 M;  3LCU A;  1R7R A;  4NC6 A;  2R0I A;  1GKI A;  1WXQ A;  2XFT A;  3PFI A;  4GMQ A;  2KNA A;  3GLG E;  1L1T A;  1G4A E;  1NY6 A;  5LMN M;  3SAU A;  4D81 A;  4I81 A;  2R65 A;  3HJS A;  3KDS E;  1VDL A;  1L2C A;  2DAK A;  2H1R A;  4Y28 F;  4LFC M;  2J5Y A;  1QUT A;  4AKG A;  4B3S M;  4GKK M;  2D7H A;  2LHG A;  4R71 A;  2HHH M;  4L8R C;  4GRI A;  4DR6 M;  1G41 A;  2LVQ D;  2XSZ A;  1T6O A;  2QCU A;  2YFQ A;  3B9P A;  4AQY M;  4CIS A;  2RKO A;  5F3W A;  1QAQ A;  3FTC A;  1ZMW A;  2QHO B;  2R4J A;  2CFO A;  2I7P A;  2RRU A;  4LF4 M;  1IN5 A;  2JUJ A;  4Q7J A;  2KA6 B;  2LHC A;  1MX0 A;  3LCV B;  4KT0 F;  3B89 A;  3U5Z B;  2BNK A;  3HHX A;  5FTK A;  1OFH A;  3GRU A;  4IBB A;  4NSO B;  4JYA M;  1D0L A;  1UFZ A;  3BOS A;  4L4U A;  4LJ8 A;  3KOW E;  3FKE A;  2QZ4 A;  3KOX E;  2CE7 A;  4AZF A;  4IBD A;  2UUB M;  5EJC A;  5DFL A;  1IN6 A;  1DGH B;  2HWJ A;  1QDT A;  1IXS A;  5EXT A;  3GLF B;  4LFA M;  1E32 A;  2P5T A;  2R62 A;  3HU2 A;  4AW4 A;  4B08 A;  3PVS A;  4IBG A;  3QWL A;  3U6S A;  1GO5 A;  2Z7J A;  2R45 A;  1DGB A;  4B3T M;  2XH9 A;  1MN3 A;  2QBY A;  4FWD A;  2FOI C;  2CUZ A;  1IQP A;  3B74 A;  2LVP C;  3LQQ A;  4G3O A;  3J81 S;  3SAS A;  1KYI A;  2CHV A;  3I04 M;  3K1J A;  1Z5B A;  3GP1 A;  3UZU A;  1OIZ A;  1QAO A;  2LVO C;  1HR0 M; 
#chains in the Genus database with same CATH homology
 4LF9 M;  5KPR A;  1N78 A;  1XWI A;  8CAT A;  5KQD A;  4QHT A;  2BJV A;  1GLN A;  2ZAO A;  4DR1 M;  3R9X B;  1L2D A;  2XSZ D;  4AI6 A;  4MGY E;  3M6A A;  5ITX A;  1N33 M;  1PJJ A;  1IN8 A;  3HJ8 A;  5IWA M;  3HWS A;  2YQZ A;  2Y20 A;  1NY5 A;  3FUX A;  2LWX A;  2EUC A;  5ITX E;  5E26 A;  2JA2 A;  1QQW A;  2C98 A;  3KS4 A;  1XNR M;  2DZN B;  4PCZ A;  1HT1 E;  3TPZ A;  3SAR A;  4BBA A;  4FCW A;  4L15 A;  3UK6 A;  3VDU A;  1TH4 A;  2DZO B;  2XFS A;  1Q39 A;  4LF6 M;  3Q8X A;  5KO3 A;  2NQ8 C;  4IBI A;  5DYI A;  1HNX M;  4QNR A;  3FD9 A;  4GIP A;  4GC9 A;  5A2Q S;  1SXJ E;  4II7 A;  1Z5A A;  3LQR A;  1HQC A;  1N75 A;  1ORY B;  4YY3 M;  4MGZ E;  5H37 D;  4DV5 M;  1XNQ M;  4MH0 E;  4G4O A;  4TUW A;  4AKH A;  2XZU A;  1EE8 A;  1DO2 A;  2CHQ A;  3UGJ A;  3WHL A;  1MU5 A;  7CAT A;  4IBJ A;  4REZ A;  4BLC A;  1N32 M;  3GQ4 A;  4DR4 M;  4JI2 M;  3QAU A;  4LCB A;  4NRW A;  4LJ5 A;  2K47 A;  1G59 A;  3FUU A;  4LF5 M;  5ITU A;  3FYC A;  4KO8 A;  3AL0 C;  4L16 A;  4KOD A;  5FTN A;  3ZC7 B;  1YUB A;  5EXS A;  1H6U A;  3GRY A;  4PT5 A;  3AOE A;  4WUR A;  2CHG A;  3GPP A;  1R2Y A;  3NBI A;  1NNJ A;  3W0F A;  4Z8X A;  4B7H A;  3T15 A;  3HHW A;  1XMQ M;  2CV0 A;  4MGH A;  4NOO B;  3K92 A;  4LF8 M;  4FCT A;  3ZH9 B;  2KZU A;  1GVN A;  1N77 A;  1S3S A;  2I7N A;  4G6Z A;  3L2A A;  1KFV A;  2RGH A;  4NXN M;  3VLF B;  4W5W A;  3HHY A;  3MHV C;  3R8F A;  4DUZ M;  3GPU A;  3I51 A;  3E4R A;  3U5Z A;  4JI4 M;  1HQY E;  4ZPX A;  1NNU C;  2D7G A;  4KHP M;  4JXJ A;  3AFH A;  3A45 A;  3U6E A;  1IN7 A;  3TWK A;  5ITY A;  5IT9 S;  5DNY A;  2KXE A;  2J7N A;  1GL6 A;  4IBF A;  3LVV A;  5KPT A;  5DYG A;  3DOA A;  4DR5 M;  4R3D A;  3H4M A;  2R46 A;  2EA0 A;  3SAT A;  3U6O A;  1PJI A;  2UXB M;  1LV7 A;  1G3I A;  3GQ5 A;  4L78 A;  3A42 A;  4QHS A;  1R2Z A;  4LJA A;  3L27 A;  1E9S A;  5EXP A;  3I4Y A;  3K2L A;  3FTF A;  2XGN A;  3L25 A;  3HGI A;  3VK8 A;  5FLX S;  4WW0 A;  3JAM S;  1IY0 A;  1TH3 A;  5EP2 A;  1SXJ B;  1HNZ M;  4LZJ A;  4FCV A;  2OPF A;  1L2B A;  3VKH A;  1NHG C;  4FW9 A;  3KP0 E;  2CV2 A;  2O5R A;  3FYD A;  4OVZ A;  4IBK A;  3FUW A;  2UU9 M;  4LY6 A;  3FTD A;  3NWL A;  4K0K M;  4DR2 M;  3D8B A;  5FTJ A;  4IJE A;  2DWN A;  2FFJ A;  5IRE B;  4JI0 M;  2F5O A;  2R4E A;  3SC3 A;  3ILK A;  3UJN A;  5IZ7 D;  3DA1 A;  2QPA A;  2V1U A;  3HU1 A;  3CF2 A;  4LF7 M;  3GO8 A;  5ITR A;  2LH0 A;  3EIH A;  4DV7 M;  4D80 A;  2VQE M;  4EIW A;  3M0E A;  1I94 M;  4R7G A;  3TWM A;  2RGO A;  3L26 A;  3M7G A;  2C9O A;  3HKP A;  4FWH A;  4I5S A;  3U6D A;  1Z6T A;  4FVM A;  4B7F A;  3EIE A;  2C96 A;  2F4V M;  2UXD M;  4MB7 A;  5EQT A;  4YHH M;  3JR4 A;  3AV0 A;  2UXC M;  4RNA A;  4HL4 A;  3GLH A;  2DHR A;  4XGI A;  3VFD A;  1JR3 D;  3W0L B;  4QOS A;  3AKZ A;  4X64 M;  4DR3 M;  2M5Z A;  2ZBK B;  3L29 A;  5KQ8 A;  3FUT A;  2KEB A;  3U6M A;  4M9S A;  4OVZ B;  4LGY A;  4DV2 M;  3PXG A;  3LMM A;  2YR0 A;  5JI3 E;  3KOZ E;  4IIW A;  4OU7 A;  3T38 A;  1XXH A;  2J7O A;  3MJ5 A;  1T3T A;  5ITQ A;  4FD2 A;  3KSX A;  1UM8 A;  4NL4 H;  1YE9 A;  3KOY E;  3A98 B;  4MGI E;  4JI8 M;  5C1B A;  1I4W A;  4DR7 M;  3RE8 A;  4P16 A;  1NVM A;  1VDD A;  1QZM A;  2QBY B;  4GHL A;  3SHG B;  3SMS A;  4DV0 M;  3SYK A;  2DXI A;  4LJ7 A;  1OFI A;  3TWL A;  1R6B X;  1Z59 A;  2L7I A;  4AKI A;  4NXM M;  4S12 A;  4IBE A;  2Q2E B;  3J27 B;  3OTO M;  3U6P A;  2F5S A;  2F5Q A;  2XLJ A;  2W82 A;  3MK6 A;  1J09 A;  4LG2 A;  2A5Y B;  1HNW M;  2DWZ B;  2Y21 A;  4X62 M;  3K8Z A;  1IBM M;  3IG8 A;  2Z4R A;  1ZQ9 A;  4LRS A;  3SAW A;  4B3M M;  2L09 A;  1E9R A;  3C58 A;  1X37 A;  2X4A A;  3KFU G;  5KPZ A;  1JQJ C;  4ITQ A;  4JN6 A;  2KRK A;  1SXJ D;  4B3R M;  4I8O A;  1IBK M;  2QP9 X;  3VDP A;  1NSF A;  2KRU A;  5C18 A;  3SMP A;  1L1Z A;  4OX9 M;  1TDH A;  3KW6 A;  5EP3 A;  3SAV A;  2HL7 A;  1ZAE A;  1XMO M;  4LJ9 A;  2HKJ A;  1G8P A;  2L6O A;  4JI1 M;  3CF0 A;  4KLN A;  3ZCB B;  1TDZ A;  5FTM A;  4AG6 A;  3SHF A;  4M9X A;  2UUA M;  1IY1 A;  3J7A S;  2C9C A;  5BR8 M;  2YNM D;  1JR3 A;  2G5G X;  2BJW A;  4LJ4 A;  3HHZ A;  4JV5 M;  2X49 A;  2DWL A;  4PD2 A;  2Y0Q A;  1OJL A;  3RGS A;  4CHT B;  3U61 B;  4JI7 M;  2LNH C;  3GPY A;  1QVR A;  2ZAN A;  1N36 M;  3KSJ A;  4RF1 A;  3U6L A;  3GLI B;  2XEP A;  1KSF X;  1N34 M;  3J2P B;  3U61 A;  2AHM A;  3KS8 A;  3GRV A;  1FNN A;  4MM3 B;  1L8Q A;  2ZM6 M;  4AG5 A;  5EP1 A;  5GKN A;  4GKJ M;  4IJF A;  5JI2 E;  4DV1 M;  3T1H M;  4LGM A;  2FE8 A;  3U6Q A;  3SFZ A;  3PNV A;  1HT2 E;  5E6J A;  3IG5 A;  1YSY A;  2LXE A;  3SYL A;  3LVW A;  4M9Z A;  3U6C A;  3TQS A;  3HU3 A;  4DUY M;  4LJ6 A;  5FSW A;  2KW0 A;  2ZAM A;  4PDI A;  4DV4 M;  1NJG A;  4G4R A;  2XZF A;  5EXX A;  1IBL M;  2OQ4 A;  3RFW A;  3PNY A;  2L7H A;  1IXS B;  1QAN A;  4D82 A;  1IY2 A;  1J7K A;  3CTW B;  1SXJ C;  2F5N A;  5BPV A;  3KVW A;  4HLQ A;  4M0D A;  3JR5 A;  3SBJ A;  2F5P A;  4GIT A;  4X66 M;  2HCB A;  3GLG B;  4DV3 M;  4JI6 M;  3I4V A;  1IXR C;  3KXE C;  1DGF A;  1IN4 A;  3THG A;  3FTE A;  3DFZ A;  1Z5C A;  2Z4S A;  1K3W A;  1IM2 A;  2DWM A;  1W5S A;  2DVW B;  1TGU A;  3RGP A;  3GQ3 A;  4A3V B;  2Z3X A;  1GL7 A;  1XXH B;  5ITT A;  4LFB M;  3AJI B;  4DV6 M;  3TL4 X;  4JI3 M;  2X8A A;  3U60 B;  4X65 M;  3J7B A;  3GLF A;  3HJQ A;  3GLI A;  2D7E A;  1SXJ A;  1NJF A;  2XF3 A;  5FTL A;  2Y0T A;  2KZS A;  3DZD A;  2VII A;  4Z6Y A;  4GH9 A;  4B7G A;  3GLH B;  4FWG A;  5LMU M;  1DGG A;  3D8L A;  3FUV A;  1XHB A;  1IXZ A;  4LZZ A;  1K82 A;  2E5L M;  1K3X A;  3GRR A;  2CEA A;  4I4L A;  3J80 S;  4NSR A;  3TE6 A;  3L28 A;  1D2N A;  4CGY B;  2EO2 A;  4NRV A;  2M60 A;  2VQF M;  1PM5 A;  4LRT A;  3T1Y M;  4IBC A;  2V1C A;  4G4Q A;  2R18 A;  4OW0 A;  3AOE C;  4PDG A;  3E9S A;  2FNA A;  1Q3C A;  1DO0 A;  3KP1 E;  2CV1 A;  4GC5 A;  4BB9 A;  2UUC M;  4RF0 A;  2C99 A;  1QYR A;  1NHW C;  2G8L A;  3GPX A;  4QOZ C;  1E94 E;  2V6Z M;  3GLG A;  4QNM A;  3WHK A;  1QAM A;  4MGK E;  4G4N A;  3AOG A;  1W5T A;  3UMM A;  1FJG M;  2QEN A;  1J5E M;  1Q3B A;  3VKG A;  3U60 A;  4XBO A;  3A46 A;  1TH2 A;  2ERC A;  2C5R A;  3CF6 E;  4GHA A;  5EP4 A;  1DGH A;  1C1K A;  4M0W A;  1XC8 A;  3VK7 A;  4JI5 M;  1R7R A;  1GKI A;  1WXQ A;  2XFT A;  3PFI A;  4GMQ A;  1L1T A;  1G4A E;  1NY6 A;  5LMN M;  3SAU A;  4D81 A;  4I81 A;  2R65 A;  3HJS A;  3KDS E;  1L2C A;  2H1R A;  4LFC M;  4AKG A;  4B3S M;  4GKK M;  2D7H A;  2HHH M;  4L8R C;  4GRI A;  4DR6 M;  1G41 A;  2XSZ A;  2QCU A;  2YFQ A;  3B9P A;  4AQY M;  4CIS A;  2RKO A;  5F3W A;  1QAQ A;  3FTC A;  2CFO A;  2R4J A;  4LF4 M;  2I7P A;  1IN5 A;  2KA6 B;  1MX0 A;  3U5Z B;  2BNK A;  3HHX A;  5FTK A;  1OFH A;  3GRU A;  4IBB A;  4NSO B;  4JYA M;  3BOS A;  4L4U A;  4LJ8 A;  3KOW E;  3FKE A;  2QZ4 A;  3KOX E;  2CE7 A;  4AZF A;  4IBD A;  2UUB M;  5EJC A;  1IN6 A;  1DGH B;  5EXT A;  3GLF B;  4LFA M;  1E32 A;  2P5T A;  2R62 A;  3HU2 A;  4AW4 A;  4B08 A;  3PVS A;  4IBG A;  3QWL A;  3U6S A;  2Z7J A;  2R45 A;  1DGB A;  4B3T M;  2XH9 A;  2QBY A;  4FWD A;  2FOI C;  2CUZ A;  1IQP A;  3LQQ A;  3J81 S;  3SAS A;  1KYI A;  2CHV A;  3K1J A;  3GP1 A;  1Z5B A;  3UZU A;  1QAO A;  1HR0 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...