4X64M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x64M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x64M02
3A45A 4KHPM 2UUAM 2OPFA 3U6MA 3U6SA 2UXCM 3SAWA 4DV0M 3U6QA 4LF8M 3JR4A 3J80S 4JI5M 4JYAM 4X66M 5LMUM 3TWLA 4DR1M 4GKJM 1N36M 4DUZM 4DV2M 3J7AS 2HHHM 5IT9S 2HKJA 2VQFM 4NXNM 4JI0M 5ITYA 3W0FA 3T1HM 4K0KM 1Q3CA 2UUCM 3A46A 1L1ZA 1K82A 2F5SA 5A2QS 1PJJA 4YY3M 4X62M 4YHHM 1IBLM 1XNQM 4DR6M 3SARA 2F5OA 3U6DA 2UXBM 4B3TM 1IBMM 2Q2EB 2EA0A 4B3SM 1R2YA 4DV6M 4DR3M 5ITTA 1FJGM 3TWKA 4X65M 4MB7A 3VK7A 3GP1A 4JI7M 1EE8A 4JI6M 4JV5M 3VK8A 2ZBKB 4DV3M 1PM5A 5LMNM 3JR5A 4G4OA 2F5NA 2F4VM 2XZFA 4JI4M 1NNJA 4JI3M 4LF6M 3T1YM 3J81S 3GQ5A 3U6PA 1I94M 4G4QA 2UXDM 3DOAA 4DV7M 1N33M 4DUYM 5ITQA 1K3WA 4JI1M 3JAMS 3TWMA 4DR5M 4DV4M 2OQ4A 4LF4M 3GQ3A 2VQEM 3SASA 4ITQA 1R2ZA 3OTOM 1Z59A 5ITRA 1N34M 4AQYM 1XNRM 4LF7M 5ITXE 1L2CA 4B3RM 4PCZA 4PDGA 4PD2A 1PJIA 2E5LM 1HR0M 1TDHA 3GPUA 3GPYA 3GO8A 3SATA 4NRWA 5FLXS 1XMQM 1HNZM 4DR2M 3SAUA 1MU5A 1MX0A 3U6LA 1L1TA 1L2DA 2UU9M 1L2BA 2UUBM 5BR8M 3U6CA 5ITXA 4OX9M 1KFVA 2F5PA 3A42A 1IBKM 5ITUA 4DV1M 3SBJA 1Z5BA 1XC8A 2ZM6M 2F5QA 4LFCM 3U6OA 4JI8M 4DV5M 4CISA 1Q39A 4GKKM 3GPXA 3GQ4A 4JI2M 1HNWM 4NXMM 3U6EA 4G4NA 1XMOM 4DR4M 1Z5AA 4LFBM 1TDZA 4DR7M 4NRVA 1Q3BA 4LF5M 1HNXM 4LFAM 3GPPA 1K3XA 1J5EM 4PDIA 4G4RA 2XZUA 4X64M 3C58A 4LF9M 3SAVA 1Z5CA 4B3MM 1N32M 5IWAM
chains in the Genus database with same CATH superfamily
3HHWA 1PGYA 4KHPM 1OQYA 2N35A 2UUAM 2WSCF 3SAWA 4WP2A 2CRUA 1NY5A 3HX3A 3HU1A 3KOYE 2GQFA 2QZ4A 2M60A 4HEOA 3ZC7B 3AV0A 2XLJA 2JY7A 4LGYA 3MMPA 4IBJA 1NO1A 4B7FA 4DR1M 2CWBA 4EIWA 3GLHA 1C1KA 3W0LB 1TR8A 4LY6A 1KSFX 1A5TA 4BB9A 2DKLA 3U60A 2HHHM 5IT9S 3M6AA 2XF3A 4L78A 2JNHA 2LNHC 4IJFA 1ZMVA 1XWIA 2RKOA 4B7GA 3PFIA 1SXJE 4Z8XA 3SYKA 2JY6B 1IY0A 3TL4X 1PRBA 1WJ7A 1PJJA 4YY3M 1OFIA 1R5LA 3I04M 1XNQM 3SYLA 2BWBA 7CATA 1XB2B 2I7PA 3L27A 2XEPA 3IG5A 3LVVA 2UXBM 2L4EA 2VDBB 4B3TM 2C9OA 4IJEA 3I01M 3QWLA 1PJQA 1PJSA 2G8LA 4DV6M 2DXIA 5ITTA 2LH0A 1IN4A 1FJGM 1IXZA 3FTEA 2NQ8C 3TWKA 4X65M 2MGWA 2OO9A 1OJLA 3VKHA 3VK7A 2WZJA 1QAOA 3GP1A 1EE8A 4JI7M 1H6UA 1DV0A 4GH9A 2HAKA 2R46A 5LMNM 3QYEA 1N77A 4G4OA 2EJSA 3IECA 2F5NA 2QBYB 2F4VM 4GHAA 1GL7A 2K0BX 1RU3A 1ZMWA 4JI3M 3NWLA 4G6ZA 4KT0F 3T1YM 3KFUG 4IBEA 3GLFA 5E26A 3A98B 1I94M 3KP1E 2R18A 3FUWA 1NVMA 5EXXA 4II7A 4JXJA 4FVMA 2QENA 3KOXE 5KPZA 3TWMA 1IQPA 1J09A 4LJ6A 3MHVC 1NHWC 1IN5A 4DBGB 1GABA 1R7RA 3KSXA 1R2ZA 3OTOM 1LTMA 2CFOA 4FD2A 4GC9A 1LV7A 5ITXE 3D8LA 4B3RM 1XXHA 2L7IA 1IY1A 1YE9A 4I81A 2J7OA 2QP9X 2XGNA 1OAIA 3E9SA 5FTJA 1E9SA 1W5SA 3HHXA 3GO8A 3U5ZB 2DAIA 4AZFA 4DR2M 1L8QA 3SAUA 1MU5A 2ZTDA 5KQDA 4GITA 3PVSA 2LVNC 3GLIB 3HJSA 2CP8A 2W82A 1L2BA 2APLA 4LGMA 3SFZA 1DGHB 2BNKA 2X4AA 4QOZC 3U6CA 4AKHA 3M0EA 1IN8A 3NBXX 4MGHA 3RGSA 1KFVA 5EP1A 3A42A 4OX9M 2CHGA 5ITUA 4DV1M 5FTKA 3SBJA 4NOOB 5DYGA 4WURA 3U61A 3NBIA 4IBIA 3CGWA 4NSRA 4XK8F 5GKNA 4JI8M 1Q39A 4FWHA 2KHHA 4XBOA 3GPXA 3HU2A 1AIPC 2DAGA 3FRHA 3CF2A 3HGIA 3LCUA 4LRTA 2YFQA 1NHGC 1XMOM 4QHTA 2JY5A 2P5TA 1TDZA 3U60B 3E4RA 5IREB 2WSEF 3LQRA 2X8AA 1R4GA 4LF9M 3SAVA 4Q7JA 1JR3A 1DGBA 3CF0A 2C99A 2K9DA 3FTFA 4L8RC 3ZH9B 3UMMA 3H4MA 3U6MA 3HHYA 4IBFA 3U6SA 1OIZA 3U6QA 1ZV1A 3V76A 3HHZA 3KOWE 3J80S 1W5TA 2ZTCA 4JYAM 3ZQJA 8CATA 3R9XB 2HWJA 1TH3A 3HJQA 4RKUF 5C18A 1QQWA 2OOAA 3AFHA 1N36M 2LVOC 3KP0E 1T43A 5IZ7D 4AI6A 2VF8A 1IN6A 1QUTA 4NXNM 2L6OA 4JI0M 1Z6TA 3CF6E 3HU3A 4KODA 3T1HM 1JQJC 4K0KM 1IY2A 2QQ8A 1Y8GA 2F5SA 5KPTA 3GLFB 3KXEC 2DAEA 2EKKA 3K9OA 4X62M 3VKGA 2MR9A 4DR6M 3SC3A 4Y28F 4GEWA 1VDLA 2OOBA 4BBAA 3U6DA 1IXRC 1IBMM 5DYIA 3DFZA 2DZNB 2JY8A 5L8RF 1VEKA 2C96A 4DR3M 1OFHA 2DZLA 3AL0C 4QOSA 4IBBA 1SXJA 3B7ZA 4RF0A 3PXGA 3W68A 4JI6M 4JV5M 5KPRA 3T15A 2R4EA 3VK8A 2V1CA 4MH0E 1NSFA 1PM5A 1D0KA 2LBCA 3JR5A 2KNAA 2L09A 1ZQ9A 1DGFA 4GIPA 2XZFA 1NJFA 5FTLA 4FWDA 2KW0A 3Q8GA 4L4UA 2CE7A 2KNVA 3DOAA 4DV7M 1AUAA 5ITQA 1GJSA 2R45A 1K3WA 2KRKA 4DR5M 3U61B 2D7GA 2CUZA 5FTMA 4AKIA 1IN7A 2ZAMA 1Z59A 5ITRA 1JR3D 1G41A 1R6BX 3FYCA 1L2CA 3T38A 5FTNA 2R62A 1HR0M 5DNYA 1TGUA 3KOZE 4NRWA 3SATA 2R0IA 3D8BA 1V34A 5JI2E 4M0WA 3WHLA 4D82A 1MX0A 3LCVB 4Z6YA 2M5ZA 5FSWA 2KDLA 2KA6B 5H37D 2QHOB 4L16A 4ANRA 2DNAA 3AOEA 4F1IA 1HT2E 2RRUA 3GRUA 3MJ5A 4I5SA 2KZUA 1TH2A 4B7HA 1HQYE 4W5WA 2CV2A 2CV0A 4RF1A 5ITXA 3LW5F 1IM2A 2F5PA 1IBKM 2QPAA 2JWSA 2K47A 3FUXA 3E46A 2FNAA 2R4JA 1OKSA 4R7GA 2KRUA 2BJWA 4GKKM 1HNWM 5BPVA 4NXMM 3IHPA 3L26A 2G5GX 4LFBM 3PNVA 3E21A 4KLNA 1Q3BA 4LF5M 3T6PA 2KZSA 4LFAM 3GPPA 4AG5A 2LHCA 3GLGA 3C58A 3C3EA 5EP2A 3L25A 2C9CA 3CTWB 2J7NA 4QNRA 1OAOC 3THGA 4LZZA 4D81A 4M9ZA 4D80A 3KS8A 3A45A 3J7BA 4CJ6A 2DVWB 2UXCM 3GLGE 1IFYA 1BVSA 2DHYA 1TH4A 3JR4A 4TUWA 2R65A 2XSZA 2JZ1A 4X66M 1T6OA 4JN6A 4P17A 1ZMUA 2MH8A 3GRVA 1JB0F 1QAMA 1WGNA 2LVPC 3GRYA 5LMUM 3ILKA 3VFDA 4DUZM 2Z7JA 1TF0B 2CEAA 3GLHB 3UK6A 4DV2M 2Y21A 4OU7A 2G3QA 3FUTA 3J7AS 2DHRA 1IXSA 2JA2A 2X49A 3I4VA 3SMPA 1Q3CA 2UUCM 4M9SA 2A5YB 1MJGM 3B9PA 3DA1A 5KQ8A 1S3SA 3F92A 2Z3XA 1L1ZA 1K82A 2LVQD 1NV9A 2KNZA 5EP3A 4R71A 2JUJA 4YHHM 1V92A 4GHLA 5JI3E 2KXEA 2DWLA 4CIZA 1QANA 3SARA 1WXQA 1NNUC 3M7GA 2YR0A 1HJPA 2HL7A 3LMMA 4B3SM 1G4AE 2Q2EB 3K2LA 2JZ0A 1R2YA 4OVZA 3J27B 2FE8A 3AJIB 4LJ4A 2RGOA 2QNJA 1GJTA 2MROB 4R3DA 3QYBA 3I4YA 1OTRA 1PJTA 3TE6A 4OW0A 1QDRA 4JI4M 3KSJA 1NNJA 3AKZA 2H5XA 4LF6M 4LCBA 1ZAEA 2R44A 3GQ5A 2D7EA 3B89A 3U6PA 3FTCA 3IG8A 4G4QA 4MM3B 2ERCA 4DUYM 3FTDA 2Z4RA 3JAMS 4LF4M 1C7YA 3SASA 3FD9A 2RGHA 4AQYM 1XNRM 3FUUA 1QUSA 3SMSA 2I7NA 3L2AA 1XXHB 1Q02A 4PDGA 4LJ5A 2L4FA 1SG9A 4BLCA 5C1BA 1QVRA 1TDHA 3GPYA 4M0DA 4QHSA 3UGJA 3U5ZA 2EO2A 2Y0QA 3MK6A 1GO5A 2LWXA 4REZA 5EP4A 3FE3A 3TPZA 1D0LA 3K92A 4LRSA 1G59A 2VIIA 1DGHA 3H4JA 5BR8M 5F3WA 1WIVA 2DENA 2FOIC 3GLIE 1Z5BA 1D0MA 2ZM6M 2F5QA 2D7HA 1G8PA 3KS4A 4LFCM 3FUVA 2MJ5B 4CISA 3FKEA 2LVAA 2R6FA 4IBDA 5DFLA 3VLFB 4DR4M 3EIHA 4FWGA 1WHCA 1QDTA 1YLAA 4UN2B 1HNXM 2V1UA 4FCWA 1IXSB 1K3XA 1J7KA 2DZOB 1J5EM 4PDIA 2XZUA 4A3VB 1VDDA 4F2LA 2DI0A 1YSYA 4NC6A 1Z5CA 1WR1B 2ZAOA 4MGIE 2KEBA 4ZPXA 1OIPA 1XHBA 3GLHE 4IBCA 4LZJA 4B3MM 2DWMA 1EFUB 5E6JA 5IWAM 1N32M 1VG5A 3DZDA 2OPFA 1NJGA 4I4LA 1CUKA 4DV0M 1QYRA 1DO2A 3C9PA 2VF7A 3HY5A 4OVZB 4JI5M 4LF8M 2HCBA 1F4IA 3J2PB 3RFWA 4I8OA 2LTUA 2JXNA 3Q8XA 3WHKA 1P3QQ 3B7QA 4XGIA 3TWLA 4IIWA 4CGYB 1N75A 2Y20A 3K1JA 4GKJM 4FW9A 1GL6A 4HL4A 4FCTA 3GRRA 1T3TA 1E9RA 1GLNA 2HKJA 2VQFM 2O5RA 4L6V6 4G3OA 5ITYA 3W0FA 3A46A 4LJ7A 2BJVA 1E32A 3SHGB 5A2QS 4QNMA 4GRIA 1MN3A 1SXJC 3C3DA 3QAUA 1IBLM 1UM8A 1N78A 1SXJD 3B74A 3L29A 1VQ1A 2F5OA 1VEGA 3LQQA 4HLQA 2GNOA 3UJNA 1QZMA 2FH0A 2C5RA 2EA0A 3SHFA 2Y0TA 2DAKA 3GLFE 4MGZE 3HKPA 1V33A 2WSFF 2BWEA 1QAQA 2DWZB 2Z4SA 3RGPA 4L15A 2V6ZM 1SXJB 4MB7A 4AG6A 1YUBA 4P16A 4LJ8A 2FFJA 1G3IA 1I4WA 2EKFA 3BBZA 2EUCA 2ZBKB 3BOSA 1KYIA 4M9XA 4IBKA 4DV3M 5EXSA 1DO0A 3K9PA 1XXHE 1UFZA 5EQTA 3LVWA 1NV8A 4NSOB 2DWNA 1GVNA 3J81S 2O01F 4LJAA 1E94E 2UXDM 2JP7A 1G71A 1N33M 5EJCA 2AHMA 1DGGA 3PNYA 4LG2A 2K6BA 4JI1M 2CV1A 4DV4M 2OQ4A 2CHVA 3RE8A 3GQ3A 2VQEM 3UZUA 3KDSE 4ITQA 2QSFX 2XH9A 3AOEC 1N34M 3HZJA 3I51A 4WW0A 4LF7M 4PCZA 4PT5A 1ORYB 1WGLA 4PD2A 2J5YA 2XFSA 1PJIA 2E5LM 3GPUA 3VDPA 3K8ZA 5FLXS 1XMQM 4S12A 1HNZM 4IBGA 1VEJA 1EIJA 1D2NA 4B08A 3U6LA 4AKGA 2O25A 1L2DA 1L1TA 5KO3A 2UU9M 2QBYA 1FNNA 2Z8YM 3L28A 3FYDA 2DAMA 2UUBM 3BXWA 4MGKE 1X37A 4FCVA 3FRIA 2FS1A 3KVWA 4AW4A 1GKIA 1XC8A 2YQZA 1JR3E 3U6OA 3AOGA 1HT1E 3R8FA 2YNMD 3VDUA 2L7HA 4DV5M 2B3TA 3GQ4A 2L2DA 3TQSA 4JI2M 3W67A 4RNAA 3U6EA 4G4NA 1Z5AA 4LJ9A 4DR7M 1QZEA 2XFTA 4NRVA 4MGYE 3HJ8A 4GMQA 3EIEA 2ZANA 2C98A 2LXEA 3B7NA 3HWSA 3GLGB 4G4RA 4KO8A 4X64M 4CHTB 4GC5A 2QCUA 2XSZD 5EXPA 1NY6A 3GLIA 3KW6A 4NL4H 2H1RA 1HQCA 1TTEA 5EXTA 2LHGA 3ZCBB 2CHQA
chains in the Genus database with same CATH topology
3HHWA 4KHPM 2UUAM 3SAWA 1NY5A 3KOYE 3HU1A 2QZ4A 2M60A 3AV0A 2XLJA 4LGYA 4IBJA 4B7FA 4DR1M 4EIWA 3GLHA 1C1KA 3W0LB 4LY6A 1KSFX 4BB9A 3U60A 2HHHM 5IT9S 3M6AA 2XF3A 4L78A 2LNHC 4IJFA 2RKOA 1XWIA 4B7GA 3PFIA 1SXJE 4Z8XA 3SYKA 1IY0A 3TL4X 1PJJA 4YY3M 1OFIA 1XNQM 3SYLA 7CATA 2I7PA 3L27A 2XEPA 3IG5A 3LVVA 2UXBM 4B3TM 2C9OA 4IJEA 3QWLA 4DV6M 2G8LA 2DXIA 5ITTA 2LH0A 1IN4A 1FJGM 1IXZA 3FTEA 2NQ8C 3TWKA 4X65M 1OJLA 3VKHA 3VK7A 1QAOA 3GP1A 1EE8A 4JI7M 1H6UA 4GH9A 2R46A 5LMNM 1N77A 4G4OA 2F5NA 2QBYB 2F4VM 4GHAA 1GL7A 4JI3M 3KFUG 3NWLA 4G6ZA 3T1YM 4IBEA 3GLFA 5E26A 3A98B 1I94M 3KP1E 2R18A 3FUWA 1NVMA 5EXXA 4II7A 4JXJA 4FVMA 2QENA 3KOXE 5KPZA 3TWMA 1IQPA 1J09A 4LJ6A 3MHVC 1NHWC 1IN5A 1R7RA 3KSXA 1R2ZA 3OTOM 4FD2A 2CFOA 4GC9A 1LV7A 5ITXE 3D8LA 4B3RM 1XXHA 2L7IA 1IY1A 1YE9A 4I81A 2J7OA 2QP9X 2XGNA 3E9SA 5FTJA 1E9SA 1W5SA 3HHXA 3GO8A 3U5ZB 4AZFA 4DR2M 1L8QA 3SAUA 1MU5A 5KQDA 4GITA 3PVSA 3GLIB 3HJSA 2W82A 1L2BA 4LGMA 3SFZA 1DGHB 2BNKA 2X4AA 4QOZC 3U6CA 4AKHA 3M0EA 1IN8A 3RGSA 4MGHA 4OX9M 1KFVA 5EP1A 3A42A 2CHGA 5ITUA 4DV1M 5FTKA 3SBJA 4NOOB 5DYGA 4WURA 3U61A 3NBIA 4IBIA 4NSRA 4JI8M 5GKNA 1Q39A 4FWHA 4XBOA 3GPXA 3HU2A 3HGIA 3CF2A 4LRTA 2YFQA 1NHGC 1XMOM 4QHTA 2P5TA 1TDZA 3U60B 3E4RA 5IREB 3LQRA 2X8AA 4LF9M 3SAVA 1JR3A 1DGBA 3CF0A 2C99A 3FTFA 4L8RC 3ZH9B 3UMMA 3H4MA 3U6MA 3HHYA 4IBFA 3U6SA 3U6QA 3HHZA 3KOWE 3J80S 1W5TA 4JYAM 8CATA 3R9XB 1TH3A 3HJQA 5C18A 1QQWA 3AFHA 1N36M 3KP0E 5IZ7D 4AI6A 1IN6A 4NXNM 2L6OA 4JI0M 1Z6TA 3CF6E 3HU3A 4KODA 3T1HM 1JQJC 4K0KM 1IY2A 2F5SA 5KPTA 3GLFB 3KXEC 4X62M 3VKGA 4DR6M 3SC3A 4BBAA 3U6DA 1IXRC 1IBMM 5DYIA 3DFZA 2DZNB 2C96A 4DR3M 1OFHA 3AL0C 4QOSA 4IBBA 1SXJA 4RF0A 3PXGA 4JI6M 4JV5M 5KPRA 3T15A 2R4EA 3VK8A 2V1CA 4MH0E 1NSFA 1PM5A 3JR5A 2L09A 1ZQ9A 1DGFA 4GIPA 2XZFA 1NJFA 5FTLA 4FWDA 2KW0A 4L4UA 2CE7A 3DOAA 4DV7M 5ITQA 2R45A 1K3WA 2KRKA 4DR5M 3U61B 2D7GA 2CUZA 5FTMA 4AKIA 1IN7A 2ZAMA 1Z59A 5ITRA 1JR3D 1G41A 1R6BX 3FYCA 1L2CA 3T38A 5FTNA 2R62A 1HR0M 5DNYA 1TGUA 3KOZE 4NRWA 3SATA 3D8BA 5JI2E 4M0WA 3WHLA 4D82A 1MX0A 4Z6YA 2M5ZA 5FSWA 2KA6B 5H37D 4L16A 3AOEA 1HT2E 3GRUA 3MJ5A 4I5SA 2KZUA 1TH2A 4B7HA 1HQYE 4W5WA 2CV2A 2CV0A 4RF1A 5ITXA 1IM2A 2F5PA 1IBKM 2QPAA 3FUXA 2K47A 2FNAA 2R4JA 4R7GA 2KRUA 2BJWA 4GKKM 1HNWM 5BPVA 4NXMM 3L26A 2G5GX 4LFBM 3PNVA 4KLNA 1Q3BA 4LF5M 2KZSA 4LFAM 3GPPA 4AG5A 3GLGA 3C58A 5EP2A 3L25A 2C9CA 3CTWB 2J7NA 4QNRA 3THGA 4LZZA 4D81A 4M9ZA 4D80A 3KS8A 3A45A 3J7BA 2DVWB 2UXCM 1TH4A 3JR4A 4TUWA 2R65A 2XSZA 4X66M 4JN6A 3GRVA 5LMUM 1QAMA 3GRYA 3ILKA 3VFDA 4DUZM 2Z7JA 3GLHB 2CEAA 3UK6A 4DV2M 2Y21A 4OU7A 3J7AS 3FUTA 2DHRA 2JA2A 3I4VA 2X49A 3SMPA 1Q3CA 2UUCM 4M9SA 2A5YB 3DA1A 3B9PA 5KQ8A 2Z3XA 1S3SA 1L1ZA 1K82A 5EP3A 4YHHM 4GHLA 5JI3E 2KXEA 2DWLA 1QANA 3SARA 1WXQA 1NNUC 3M7GA 2YR0A 2HL7A 3LMMA 4B3SM 1G4AE 2Q2EB 3K2LA 1R2YA 4OVZA 3J27B 2FE8A 3AJIB 4LJ4A 2RGOA 4R3DA 3I4YA 3TE6A 4OW0A 4JI4M 3KSJA 1NNJA 3AKZA 4LF6M 4LCBA 1ZAEA 3GQ5A 2D7EA 3U6PA 3FTCA 3IG8A 4G4QA 4MM3B 2ERCA 4DUYM 3FTDA 2Z4RA 3JAMS 4LF4M 3SASA 3FD9A 2RGHA 4AQYM 1XNRM 3FUUA 3SMSA 2I7NA 3L2AA 1XXHB 4PDGA 4LJ5A 4BLCA 5C1BA 1QVRA 1TDHA 3GPYA 4M0DA 4QHSA 3UGJA 3U5ZA 2EO2A 2Y0QA 3MK6A 2LWXA 4REZA 5EP4A 3TPZA 3K92A 4LRSA 1G59A 2VIIA 1DGHA 5BR8M 5F3WA 2FOIC 1Z5BA 2F5QA 2ZM6M 4LFCM 2D7HA 1G8PA 3KS4A 3FUVA 4CISA 3FKEA 4IBDA 3VLFB 4DR4M 3EIHA 4FWGA 1HNXM 2V1UA 4FCWA 1IXSB 1K3XA 1J7KA 2DZOB 1J5EM 4PDIA 2XZUA 4A3VB 1VDDA 1YSYA 1Z5CA 4MGIE 2ZAOA 4ZPXA 2KEBA 1XHBA 4IBCA 4LZJA 4B3MM 2DWMA 5E6JA 1N32M 5IWAM 3DZDA 2OPFA 1NJGA 4I4LA 4DV0M 1QYRA 1DO2A 4OVZB 4LF8M 4JI5M 2HCBA 3J2PB 3RFWA 4I8OA 3Q8XA 3WHKA 4XGIA 3TWLA 4IIWA 4CGYB 1N75A 2Y20A 3K1JA 4GKJM 4FW9A 1GL6A 4HL4A 4FCTA 3GRRA 1T3TA 1E9RA 1GLNA 2HKJA 2VQFM 2O5RA 5ITYA 3W0FA 3A46A 4LJ7A 2BJVA 1E32A 3SHGB 5A2QS 4QNMA 4GRIA 1SXJC 3QAUA 1IBLM 1UM8A 1N78A 1SXJD 3L29A 2F5OA 3LQQA 4HLQA 3UJNA 2C5RA 1QZMA 2EA0A 3SHFA 2Y0TA 4MGZE 3HKPA 1QAQA 2DWZB 2Z4SA 3RGPA 4L15A 2V6ZM 1SXJB 4MB7A 4AG6A 1YUBA 4P16A 4LJ8A 2FFJA 1G3IA 1I4WA 2EUCA 2ZBKB 3BOSA 1KYIA 4M9XA 4IBKA 4DV3M 5EXSA 1DO0A 5EQTA 3LVWA 4NSOB 2DWNA 1GVNA 3J81S 4LJAA 1E94E 2UXDM 1N33M 5EJCA 2AHMA 1DGGA 3PNYA 4LG2A 4JI1M 2CV1A 4DV4M 2OQ4A 2CHVA 3RE8A 3GQ3A 2VQEM 3UZUA 3KDSE 4ITQA 1N34M 2XH9A 3AOEC 3I51A 4WW0A 4LF7M 4PCZA 4PT5A 1ORYB 4PD2A 1PJIA 2XFSA 2E5LM 3GPUA 3VDPA 3K8ZA 5FLXS 1XMQM 4S12A 1HNZM 4IBGA 1D2NA 4B08A 3U6LA 4AKGA 1L1TA 1L2DA 5KO3A 2UU9M 2QBYA 1FNNA 3L28A 3FYDA 2UUBM 4MGKE 1X37A 4FCVA 3KVWA 4AW4A 1GKIA 1XC8A 2YQZA 3U6OA 3AOGA 1HT1E 3R8FA 2YNMD 3VDUA 2L7HA 4DV5M 3GQ4A 4JI2M 3TQSA 4RNAA 3U6EA 4G4NA 1Z5AA 4LJ9A 4DR7M 2XFTA 4NRVA 4MGYE 3HJ8A 4GMQA 3EIEA 2ZANA 2C98A 2LXEA 3HWSA 4G4RA 3GLGB 4KO8A 4X64M 4CHTB 4GC5A 2QCUA 2XSZD 5EXPA 1NY6A 3GLIA 3KW6A 4NL4H 2H1RA 1HQCA 5EXTA 3ZC7B 3ZCBB 2CHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A45 A;  4KHP M;  2UUA M;  2OPF A;  3U6M A;  3U6S A;  2UXC M;  3SAW A;  4DV0 M;  3U6Q A;  4LF8 M;  3JR4 A;  3J80 S;  4JI5 M;  4JYA M;  4X66 M;  5LMU M;  3TWL A;  4DR1 M;  4GKJ M;  1N36 M;  4DUZ M;  4DV2 M;  3J7A S;  2HHH M;  5IT9 S;  2HKJ A;  2VQF M;  4NXN M;  4JI0 M;  5ITY A;  3W0F A;  3T1H M;  4K0K M;  1Q3C A;  2UUC M;  3A46 A;  1L1Z A;  1K82 A;  2F5S A;  5A2Q S;  1PJJ A;  4YY3 M;  4X62 M;  4YHH M;  1IBL M;  1XNQ M;  4DR6 M;  3SAR A;  2F5O A;  3U6D A;  2UXB M;  4B3T M;  1IBM M;  2Q2E B;  2EA0 A;  4B3S M;  1R2Y A;  4DV6 M;  4DR3 M;  5ITT A;  1FJG M;  3TWK A;  4X65 M;  4MB7 A;  3VK7 A;  3GP1 A;  4JI7 M;  1EE8 A;  4JI6 M;  4JV5 M;  3VK8 A;  2ZBK B;  4DV3 M;  1PM5 A;  5LMN M;  3JR5 A;  4G4O A;  2F5N A;  2F4V M;  2XZF A;  4JI4 M;  1NNJ A;  4JI3 M;  4LF6 M;  3T1Y M;  3J81 S;  3GQ5 A;  3U6P A;  1I94 M;  4G4Q A;  2UXD M;  3DOA A;  4DV7 M;  1N33 M;  4DUY M;  5ITQ A;  1K3W A;  4JI1 M;  3JAM S;  3TWM A;  4DR5 M;  4DV4 M;  2OQ4 A;  4LF4 M;  3GQ3 A;  2VQE M;  3SAS A;  4ITQ A;  1R2Z A;  3OTO M;  1Z59 A;  5ITR A;  1N34 M;  4AQY M;  1XNR M;  4LF7 M;  5ITX E;  1L2C A;  4B3R M;  4PCZ A;  4PDG A;  4PD2 A;  1PJI A;  2E5L M;  1HR0 M;  1TDH A;  3GPU A;  3GPY A;  3GO8 A;  3SAT A;  4NRW A;  5FLX S;  1XMQ M;  1HNZ M;  4DR2 M;  3SAU A;  1MU5 A;  1MX0 A;  3U6L A;  1L1T A;  1L2D A;  2UU9 M;  1L2B A;  2UUB M;  5BR8 M;  3U6C A;  5ITX A;  4OX9 M;  1KFV A;  2F5P A;  3A42 A;  1IBK M;  5ITU A;  4DV1 M;  3SBJ A;  1Z5B A;  1XC8 A;  2ZM6 M;  2F5Q A;  4LFC M;  3U6O A;  4JI8 M;  4DV5 M;  4CIS A;  1Q39 A;  4GKK M;  3GPX A;  3GQ4 A;  4JI2 M;  1HNW M;  4NXM M;  3U6E A;  4G4N A;  1XMO M;  4DR4 M;  1Z5A A;  4LFB M;  1TDZ A;  4DR7 M;  4NRV A;  1Q3B A;  4LF5 M;  1HNX M;  4LFA M;  3GPP A;  1K3X A;  1J5E M;  4PDI A;  4G4R A;  2XZU A;  4X64 M;  3C58 A;  4LF9 M;  3SAV A;  1Z5C A;  4B3M M;  1N32 M;  5IWA M; 
#chains in the Genus database with same CATH topology
 3HHW A;  1PGY A;  4KHP M;  1OQY A;  2N35 A;  2UUA M;  2WSC F;  3SAW A;  4WP2 A;  2CRU A;  1NY5 A;  3HX3 A;  3HU1 A;  3KOY E;  2GQF A;  2QZ4 A;  2M60 A;  4HEO A;  3ZC7 B;  3AV0 A;  2XLJ A;  2JY7 A;  4LGY A;  3MMP A;  4IBJ A;  1NO1 A;  4B7F A;  4DR1 M;  2CWB A;  4EIW A;  3GLH A;  1C1K A;  3W0L B;  1TR8 A;  4LY6 A;  1KSF X;  1A5T A;  4BB9 A;  2DKL A;  3U60 A;  2HHH M;  5IT9 S;  3M6A A;  2XF3 A;  4L78 A;  2JNH A;  2LNH C;  4IJF A;  1ZMV A;  1XWI A;  2RKO A;  4B7G A;  3PFI A;  1SXJ E;  4Z8X A;  3SYK A;  2JY6 B;  1IY0 A;  3TL4 X;  1PRB A;  1WJ7 A;  1PJJ A;  4YY3 M;  1OFI A;  1R5L A;  3I04 M;  1XNQ M;  3SYL A;  2BWB A;  7CAT A;  1XB2 B;  2I7P A;  3L27 A;  2XEP A;  3IG5 A;  3LVV A;  2UXB M;  2L4E A;  2VDB B;  4B3T M;  2C9O A;  4IJE A;  3I01 M;  3QWL A;  1PJQ A;  1PJS A;  2G8L A;  4DV6 M;  2DXI A;  5ITT A;  2LH0 A;  1IN4 A;  1FJG M;  1IXZ A;  3FTE A;  2NQ8 C;  3TWK A;  4X65 M;  2MGW A;  2OO9 A;  1OJL A;  3VKH A;  3VK7 A;  2WZJ A;  1QAO A;  3GP1 A;  1EE8 A;  4JI7 M;  1H6U A;  1DV0 A;  4GH9 A;  2HAK A;  2R46 A;  5LMN M;  3QYE A;  1N77 A;  4G4O A;  2EJS A;  3IEC A;  2F5N A;  2QBY B;  2F4V M;  4GHA A;  1GL7 A;  2K0B X;  1RU3 A;  1ZMW A;  4JI3 M;  3NWL A;  4G6Z A;  4KT0 F;  3T1Y M;  3KFU G;  4IBE A;  3GLF A;  5E26 A;  3A98 B;  1I94 M;  3KP1 E;  2R18 A;  3FUW A;  1NVM A;  5EXX A;  4II7 A;  4JXJ A;  4FVM A;  2QEN A;  3KOX E;  5KPZ A;  3TWM A;  1IQP A;  1J09 A;  4LJ6 A;  3MHV C;  1NHW C;  1IN5 A;  4DBG B;  1GAB A;  1R7R A;  3KSX A;  1R2Z A;  3OTO M;  1LTM A;  2CFO A;  4FD2 A;  4GC9 A;  1LV7 A;  5ITX E;  3D8L A;  4B3R M;  1XXH A;  2L7I A;  1IY1 A;  1YE9 A;  4I81 A;  2J7O A;  2QP9 X;  2XGN A;  1OAI A;  3E9S A;  5FTJ A;  1E9S A;  1W5S A;  3HHX A;  3GO8 A;  3U5Z B;  2DAI A;  4AZF A;  4DR2 M;  1L8Q A;  3SAU A;  1MU5 A;  2ZTD A;  5KQD A;  4GIT A;  3PVS A;  2LVN C;  3GLI B;  3HJS A;  2CP8 A;  2W82 A;  1L2B A;  2APL A;  4LGM A;  3SFZ A;  1DGH B;  2BNK A;  2X4A A;  4QOZ C;  3U6C A;  4AKH A;  3M0E A;  1IN8 A;  3NBX X;  4MGH A;  3RGS A;  1KFV A;  5EP1 A;  3A42 A;  4OX9 M;  2CHG A;  5ITU A;  4DV1 M;  5FTK A;  3SBJ A;  4NOO B;  5DYG A;  4WUR A;  3U61 A;  3NBI A;  4IBI A;  3CGW A;  4NSR A;  4XK8 F;  5GKN A;  4JI8 M;  1Q39 A;  4FWH A;  2KHH A;  4XBO A;  3GPX A;  3HU2 A;  1AIP C;  2DAG A;  3FRH A;  3CF2 A;  3HGI A;  3LCU A;  4LRT A;  2YFQ A;  1NHG C;  1XMO M;  4QHT A;  2JY5 A;  2P5T A;  1TDZ A;  3U60 B;  3E4R A;  5IRE B;  2WSE F;  3LQR A;  2X8A A;  1R4G A;  4LF9 M;  3SAV A;  4Q7J A;  1JR3 A;  1DGB A;  3CF0 A;  2C99 A;  2K9D A;  3FTF A;  4L8R C;  3ZH9 B;  3UMM A;  3H4M A;  3U6M A;  3HHY A;  4IBF A;  3U6S A;  1OIZ A;  3U6Q A;  1ZV1 A;  3V76 A;  3HHZ A;  3KOW E;  3J80 S;  1W5T A;  2ZTC A;  4JYA M;  3ZQJ A;  8CAT A;  3R9X B;  2HWJ A;  1TH3 A;  3HJQ A;  4RKU F;  5C18 A;  1QQW A;  2OOA A;  3AFH A;  1N36 M;  2LVO C;  3KP0 E;  1T43 A;  5IZ7 D;  4AI6 A;  2VF8 A;  1IN6 A;  1QUT A;  4NXN M;  2L6O A;  4JI0 M;  1Z6T A;  3CF6 E;  3HU3 A;  4KOD A;  3T1H M;  1JQJ C;  4K0K M;  1IY2 A;  2QQ8 A;  1Y8G A;  2F5S A;  5KPT A;  3GLF B;  3KXE C;  2DAE A;  2EKK A;  3K9O A;  4X62 M;  3VKG A;  2MR9 A;  4DR6 M;  3SC3 A;  4Y28 F;  4GEW A;  1VDL A;  2OOB A;  4BBA A;  3U6D A;  1IXR C;  1IBM M;  5DYI A;  3DFZ A;  2DZN B;  2JY8 A;  5L8R F;  1VEK A;  2C96 A;  4DR3 M;  1OFH A;  2DZL A;  3AL0 C;  4QOS A;  4IBB A;  1SXJ A;  3B7Z A;  4RF0 A;  3PXG A;  3W68 A;  4JI6 M;  4JV5 M;  5KPR A;  3T15 A;  2R4E A;  3VK8 A;  2V1C A;  4MH0 E;  1NSF A;  1PM5 A;  1D0K A;  2LBC A;  3JR5 A;  2KNA A;  2L09 A;  1ZQ9 A;  1DGF A;  4GIP A;  2XZF A;  1NJF A;  5FTL A;  4FWD A;  2KW0 A;  3Q8G A;  4L4U A;  2CE7 A;  2KNV A;  3DOA A;  4DV7 M;  1AUA A;  5ITQ A;  1GJS A;  2R45 A;  1K3W A;  2KRK A;  4DR5 M;  3U61 B;  2D7G A;  2CUZ A;  5FTM A;  4AKI A;  1IN7 A;  2ZAM A;  1Z59 A;  5ITR A;  1JR3 D;  1G41 A;  1R6B X;  3FYC A;  1L2C A;  3T38 A;  5FTN A;  2R62 A;  1HR0 M;  5DNY A;  1TGU A;  3KOZ E;  4NRW A;  3SAT A;  2R0I A;  3D8B A;  1V34 A;  5JI2 E;  4M0W A;  3WHL A;  4D82 A;  1MX0 A;  3LCV B;  4Z6Y A;  2M5Z A;  5FSW A;  2KDL A;  2KA6 B;  5H37 D;  2QHO B;  4L16 A;  4ANR A;  2DNA A;  3AOE A;  4F1I A;  1HT2 E;  2RRU A;  3GRU A;  3MJ5 A;  4I5S A;  2KZU A;  1TH2 A;  4B7H A;  1HQY E;  4W5W A;  2CV2 A;  2CV0 A;  4RF1 A;  5ITX A;  3LW5 F;  1IM2 A;  2F5P A;  1IBK M;  2QPA A;  2JWS A;  2K47 A;  3FUX A;  3E46 A;  2FNA A;  2R4J A;  1OKS A;  4R7G A;  2KRU A;  2BJW A;  4GKK M;  1HNW M;  5BPV A;  4NXM M;  3IHP A;  3L26 A;  2G5G X;  4LFB M;  3PNV A;  3E21 A;  4KLN A;  1Q3B A;  4LF5 M;  3T6P A;  2KZS A;  4LFA M;  3GPP A;  4AG5 A;  2LHC A;  3GLG A;  3C58 A;  3C3E A;  5EP2 A;  3L25 A;  2C9C A;  3CTW B;  2J7N A;  4QNR A;  1OAO C;  3THG A;  4LZZ A;  4D81 A;  4M9Z A;  4D80 A;  3KS8 A;  3A45 A;  3J7B A;  4CJ6 A;  2DVW B;  2UXC M;  3GLG E;  1IFY A;  1BVS A;  2DHY A;  1TH4 A;  3JR4 A;  4TUW A;  2R65 A;  2XSZ A;  2JZ1 A;  4X66 M;  1T6O A;  4JN6 A;  4P17 A;  1ZMU A;  2MH8 A;  3GRV A;  1JB0 F;  1QAM A;  1WGN A;  2LVP C;  3GRY A;  5LMU M;  3ILK A;  3VFD A;  4DUZ M;  2Z7J A;  1TF0 B;  2CEA A;  3GLH B;  3UK6 A;  4DV2 M;  2Y21 A;  4OU7 A;  2G3Q A;  3FUT A;  3J7A S;  2DHR A;  1IXS A;  2JA2 A;  2X49 A;  3I4V A;  3SMP A;  1Q3C A;  2UUC M;  4M9S A;  2A5Y B;  1MJG M;  3B9P A;  3DA1 A;  5KQ8 A;  1S3S A;  3F92 A;  2Z3X A;  1L1Z A;  1K82 A;  2LVQ D;  1NV9 A;  2KNZ A;  5EP3 A;  4R71 A;  2JUJ A;  4YHH M;  1V92 A;  4GHL A;  5JI3 E;  2KXE A;  2DWL A;  4CIZ A;  1QAN A;  3SAR A;  1WXQ A;  1NNU C;  3M7G A;  2YR0 A;  1HJP A;  2HL7 A;  3LMM A;  4B3S M;  1G4A E;  2Q2E B;  3K2L A;  2JZ0 A;  1R2Y A;  4OVZ A;  3J27 B;  2FE8 A;  3AJI B;  4LJ4 A;  2RGO A;  2QNJ A;  1GJT A;  2MRO B;  4R3D A;  3QYB A;  3I4Y A;  1OTR A;  1PJT A;  3TE6 A;  4OW0 A;  1QDR A;  4JI4 M;  3KSJ A;  1NNJ A;  3AKZ A;  2H5X A;  4LF6 M;  4LCB A;  1ZAE A;  2R44 A;  3GQ5 A;  2D7E A;  3B89 A;  3U6P A;  3FTC A;  3IG8 A;  4G4Q A;  4MM3 B;  2ERC A;  4DUY M;  3FTD A;  2Z4R A;  3JAM S;  4LF4 M;  1C7Y A;  3SAS A;  3FD9 A;  2RGH A;  4AQY M;  1XNR M;  3FUU A;  1QUS A;  3SMS A;  2I7N A;  3L2A A;  1XXH B;  1Q02 A;  4PDG A;  4LJ5 A;  2L4F A;  1SG9 A;  4BLC A;  5C1B A;  1QVR A;  1TDH A;  3GPY A;  4M0D A;  4QHS A;  3UGJ A;  3U5Z A;  2EO2 A;  2Y0Q A;  3MK6 A;  1GO5 A;  2LWX A;  4REZ A;  5EP4 A;  3FE3 A;  3TPZ A;  1D0L A;  3K92 A;  4LRS A;  1G59 A;  2VII A;  1DGH A;  3H4J A;  5BR8 M;  5F3W A;  1WIV A;  2DEN A;  2FOI C;  3GLI E;  1Z5B A;  1D0M A;  2ZM6 M;  2F5Q A;  2D7H A;  1G8P A;  3KS4 A;  4LFC M;  3FUV A;  2MJ5 B;  4CIS A;  3FKE A;  2LVA A;  2R6F A;  4IBD A;  5DFL A;  3VLF B;  4DR4 M;  3EIH A;  4FWG A;  1WHC A;  1QDT A;  1YLA A;  4UN2 B;  1HNX M;  2V1U A;  4FCW A;  1IXS B;  1K3X A;  1J7K A;  2DZO B;  1J5E M;  4PDI A;  2XZU A;  4A3V B;  1VDD A;  4F2L A;  2DI0 A;  1YSY A;  4NC6 A;  1Z5C A;  1WR1 B;  2ZAO A;  4MGI E;  2KEB A;  4ZPX A;  1OIP A;  1XHB A;  3GLH E;  4IBC A;  4LZJ A;  4B3M M;  2DWM A;  1EFU B;  5E6J A;  5IWA M;  1N32 M;  1VG5 A;  3DZD A;  2OPF A;  1NJG A;  4I4L A;  1CUK A;  4DV0 M;  1QYR A;  1DO2 A;  3C9P A;  2VF7 A;  3HY5 A;  4OVZ B;  4JI5 M;  4LF8 M;  2HCB A;  1F4I A;  3J2P B;  3RFW A;  4I8O A;  2LTU A;  2JXN A;  3Q8X A;  3WHK A;  1P3Q Q;  3B7Q A;  4XGI A;  3TWL A;  4IIW A;  4CGY B;  1N75 A;  2Y20 A;  3K1J A;  4GKJ M;  4FW9 A;  1GL6 A;  4HL4 A;  4FCT A;  3GRR A;  1T3T A;  1E9R A;  1GLN A;  2HKJ A;  2VQF M;  2O5R A;  4L6V 6;  4G3O A;  5ITY A;  3W0F A;  3A46 A;  4LJ7 A;  2BJV A;  1E32 A;  3SHG B;  5A2Q S;  4QNM A;  4GRI A;  1MN3 A;  1SXJ C;  3C3D A;  3QAU A;  1IBL M;  1UM8 A;  1N78 A;  1SXJ D;  3B74 A;  3L29 A;  1VQ1 A;  2F5O A;  1VEG A;  3LQQ A;  4HLQ A;  2GNO A;  3UJN A;  1QZM A;  2FH0 A;  2C5R A;  2EA0 A;  3SHF A;  2Y0T A;  2DAK A;  3GLF E;  4MGZ E;  3HKP A;  1V33 A;  2WSF F;  2BWE A;  1QAQ A;  2DWZ B;  2Z4S A;  3RGP A;  4L15 A;  2V6Z M;  1SXJ B;  4MB7 A;  4AG6 A;  1YUB A;  4P16 A;  4LJ8 A;  2FFJ A;  1G3I A;  1I4W A;  2EKF A;  3BBZ A;  2EUC A;  2ZBK B;  3BOS A;  1KYI A;  4M9X A;  4IBK A;  4DV3 M;  5EXS A;  1DO0 A;  3K9P A;  1XXH E;  1UFZ A;  5EQT A;  3LVW A;  1NV8 A;  4NSO B;  2DWN A;  1GVN A;  3J81 S;  2O01 F;  4LJA A;  1E94 E;  2UXD M;  2JP7 A;  1G71 A;  1N33 M;  5EJC A;  2AHM A;  1DGG A;  3PNY A;  4LG2 A;  2K6B A;  4JI1 M;  2CV1 A;  4DV4 M;  2OQ4 A;  2CHV A;  3RE8 A;  3GQ3 A;  2VQE M;  3UZU A;  3KDS E;  4ITQ A;  2QSF X;  2XH9 A;  3AOE C;  1N34 M;  3HZJ A;  3I51 A;  4WW0 A;  4LF7 M;  4PCZ A;  4PT5 A;  1ORY B;  1WGL A;  4PD2 A;  2J5Y A;  2XFS A;  1PJI A;  2E5L M;  3GPU A;  3VDP A;  3K8Z A;  5FLX S;  1XMQ M;  4S12 A;  1HNZ M;  4IBG A;  1VEJ A;  1EIJ A;  1D2N A;  4B08 A;  3U6L A;  4AKG A;  2O25 A;  1L2D A;  1L1T A;  5KO3 A;  2UU9 M;  2QBY A;  1FNN A;  2Z8Y M;  3L28 A;  3FYD A;  2DAM A;  2UUB M;  3BXW A;  4MGK E;  1X37 A;  4FCV A;  3FRI A;  2FS1 A;  3KVW A;  4AW4 A;  1GKI A;  1XC8 A;  2YQZ A;  1JR3 E;  3U6O A;  3AOG A;  1HT1 E;  3R8F A;  2YNM D;  3VDU A;  2L7H A;  4DV5 M;  2B3T A;  3GQ4 A;  2L2D A;  3TQS A;  4JI2 M;  3W67 A;  4RNA A;  3U6E A;  4G4N A;  1Z5A A;  4LJ9 A;  4DR7 M;  1QZE A;  2XFT A;  4NRV A;  4MGY E;  3HJ8 A;  4GMQ A;  3EIE A;  2ZAN A;  2C98 A;  2LXE A;  3B7N A;  3HWS A;  3GLG B;  4G4R A;  4KO8 A;  4X64 M;  4CHT B;  4GC5 A;  2QCU A;  2XSZ D;  5EXP A;  1NY6 A;  3GLI A;  3KW6 A;  4NL4 H;  2H1R A;  1HQC A;  1TTE A;  5EXT A;  2LHG A;  3ZCB B;  2CHQ A; 
#chains in the Genus database with same CATH homology
 3HHW A;  4KHP M;  2UUA M;  3SAW A;  1NY5 A;  3KOY E;  3HU1 A;  2QZ4 A;  2M60 A;  3AV0 A;  2XLJ A;  4LGY A;  4IBJ A;  4B7F A;  4DR1 M;  4EIW A;  3GLH A;  1C1K A;  3W0L B;  4LY6 A;  1KSF X;  4BB9 A;  3U60 A;  2HHH M;  5IT9 S;  3M6A A;  2XF3 A;  4L78 A;  2LNH C;  4IJF A;  2RKO A;  1XWI A;  4B7G A;  3PFI A;  1SXJ E;  4Z8X A;  3SYK A;  1IY0 A;  3TL4 X;  1PJJ A;  4YY3 M;  1OFI A;  1XNQ M;  3SYL A;  7CAT A;  2I7P A;  3L27 A;  2XEP A;  3IG5 A;  3LVV A;  2UXB M;  4B3T M;  2C9O A;  4IJE A;  3QWL A;  4DV6 M;  2G8L A;  2DXI A;  5ITT A;  2LH0 A;  1IN4 A;  1FJG M;  1IXZ A;  3FTE A;  2NQ8 C;  3TWK A;  4X65 M;  1OJL A;  3VKH A;  3VK7 A;  1QAO A;  3GP1 A;  1EE8 A;  4JI7 M;  1H6U A;  4GH9 A;  2R46 A;  5LMN M;  1N77 A;  4G4O A;  2F5N A;  2QBY B;  2F4V M;  4GHA A;  1GL7 A;  4JI3 M;  3KFU G;  3NWL A;  4G6Z A;  3T1Y M;  4IBE A;  3GLF A;  5E26 A;  3A98 B;  1I94 M;  3KP1 E;  2R18 A;  3FUW A;  1NVM A;  5EXX A;  4II7 A;  4JXJ A;  4FVM A;  2QEN A;  3KOX E;  5KPZ A;  3TWM A;  1IQP A;  1J09 A;  4LJ6 A;  3MHV C;  1NHW C;  1IN5 A;  1R7R A;  3KSX A;  1R2Z A;  3OTO M;  4FD2 A;  2CFO A;  4GC9 A;  1LV7 A;  5ITX E;  3D8L A;  4B3R M;  1XXH A;  2L7I A;  1IY1 A;  1YE9 A;  4I81 A;  2J7O A;  2QP9 X;  2XGN A;  3E9S A;  5FTJ A;  1E9S A;  1W5S A;  3HHX A;  3GO8 A;  3U5Z B;  4AZF A;  4DR2 M;  1L8Q A;  3SAU A;  1MU5 A;  5KQD A;  4GIT A;  3PVS A;  3GLI B;  3HJS A;  2W82 A;  1L2B A;  4LGM A;  3SFZ A;  1DGH B;  2BNK A;  2X4A A;  4QOZ C;  3U6C A;  4AKH A;  3M0E A;  1IN8 A;  3RGS A;  4MGH A;  4OX9 M;  1KFV A;  5EP1 A;  3A42 A;  2CHG A;  5ITU A;  4DV1 M;  5FTK A;  3SBJ A;  4NOO B;  5DYG A;  4WUR A;  3U61 A;  3NBI A;  4IBI A;  4NSR A;  4JI8 M;  5GKN A;  1Q39 A;  4FWH A;  4XBO A;  3GPX A;  3HU2 A;  3HGI A;  3CF2 A;  4LRT A;  2YFQ A;  1NHG C;  1XMO M;  4QHT A;  2P5T A;  1TDZ A;  3U60 B;  3E4R A;  5IRE B;  3LQR A;  2X8A A;  4LF9 M;  3SAV A;  1JR3 A;  1DGB A;  3CF0 A;  2C99 A;  3FTF A;  4L8R C;  3ZH9 B;  3UMM A;  3H4M A;  3U6M A;  3HHY A;  4IBF A;  3U6S A;  3U6Q A;  3HHZ A;  3KOW E;  3J80 S;  1W5T A;  4JYA M;  8CAT A;  3R9X B;  1TH3 A;  3HJQ A;  5C18 A;  1QQW A;  3AFH A;  1N36 M;  3KP0 E;  5IZ7 D;  4AI6 A;  1IN6 A;  4NXN M;  2L6O A;  4JI0 M;  1Z6T A;  3CF6 E;  3HU3 A;  4KOD A;  3T1H M;  1JQJ C;  4K0K M;  1IY2 A;  2F5S A;  5KPT A;  3GLF B;  3KXE C;  4X62 M;  3VKG A;  4DR6 M;  3SC3 A;  4BBA A;  3U6D A;  1IXR C;  1IBM M;  5DYI A;  3DFZ A;  2DZN B;  2C96 A;  4DR3 M;  1OFH A;  3AL0 C;  4QOS A;  4IBB A;  1SXJ A;  4RF0 A;  3PXG A;  4JI6 M;  4JV5 M;  5KPR A;  3T15 A;  2R4E A;  3VK8 A;  2V1C A;  4MH0 E;  1NSF A;  1PM5 A;  3JR5 A;  2L09 A;  1ZQ9 A;  1DGF A;  4GIP A;  2XZF A;  1NJF A;  5FTL A;  4FWD A;  2KW0 A;  4L4U A;  2CE7 A;  3DOA A;  4DV7 M;  5ITQ A;  2R45 A;  1K3W A;  2KRK A;  4DR5 M;  3U61 B;  2D7G A;  2CUZ A;  5FTM A;  4AKI A;  1IN7 A;  2ZAM A;  1Z59 A;  5ITR A;  1JR3 D;  1G41 A;  1R6B X;  3FYC A;  1L2C A;  3T38 A;  5FTN A;  2R62 A;  1HR0 M;  5DNY A;  1TGU A;  3KOZ E;  4NRW A;  3SAT A;  3D8B A;  5JI2 E;  4M0W A;  3WHL A;  4D82 A;  1MX0 A;  4Z6Y A;  2M5Z A;  5FSW A;  2KA6 B;  5H37 D;  4L16 A;  3AOE A;  1HT2 E;  3GRU A;  3MJ5 A;  4I5S A;  2KZU A;  1TH2 A;  4B7H A;  1HQY E;  4W5W A;  2CV2 A;  2CV0 A;  4RF1 A;  5ITX A;  1IM2 A;  2F5P A;  1IBK M;  2QPA A;  3FUX A;  2K47 A;  2FNA A;  2R4J A;  4R7G A;  2KRU A;  2BJW A;  4GKK M;  1HNW M;  5BPV A;  4NXM M;  3L26 A;  2G5G X;  4LFB M;  3PNV A;  4KLN A;  1Q3B A;  4LF5 M;  2KZS A;  4LFA M;  3GPP A;  4AG5 A;  3GLG A;  3C58 A;  5EP2 A;  3L25 A;  2C9C A;  3CTW B;  2J7N A;  4QNR A;  3THG A;  4LZZ A;  4D81 A;  4M9Z A;  4D80 A;  3KS8 A;  3A45 A;  3J7B A;  2DVW B;  2UXC M;  1TH4 A;  3JR4 A;  4TUW A;  2R65 A;  2XSZ A;  4X66 M;  4JN6 A;  3GRV A;  5LMU M;  1QAM A;  3GRY A;  3ILK A;  3VFD A;  4DUZ M;  2Z7J A;  3GLH B;  2CEA A;  3UK6 A;  4DV2 M;  2Y21 A;  4OU7 A;  3J7A S;  3FUT A;  2DHR A;  2JA2 A;  3I4V A;  2X49 A;  3SMP A;  1Q3C A;  2UUC M;  4M9S A;  2A5Y B;  3DA1 A;  3B9P A;  5KQ8 A;  2Z3X A;  1S3S A;  1L1Z A;  1K82 A;  5EP3 A;  4YHH M;  4GHL A;  5JI3 E;  2KXE A;  2DWL A;  1QAN A;  3SAR A;  1WXQ A;  1NNU C;  3M7G A;  2YR0 A;  2HL7 A;  3LMM A;  4B3S M;  1G4A E;  2Q2E B;  3K2L A;  1R2Y A;  4OVZ A;  3J27 B;  2FE8 A;  3AJI B;  4LJ4 A;  2RGO A;  4R3D A;  3I4Y A;  3TE6 A;  4OW0 A;  4JI4 M;  3KSJ A;  1NNJ A;  3AKZ A;  4LF6 M;  4LCB A;  1ZAE A;  3GQ5 A;  2D7E A;  3U6P A;  3FTC A;  3IG8 A;  4G4Q A;  4MM3 B;  2ERC A;  4DUY M;  3FTD A;  2Z4R A;  3JAM S;  4LF4 M;  3SAS A;  3FD9 A;  2RGH A;  4AQY M;  1XNR M;  3FUU A;  3SMS A;  2I7N A;  3L2A A;  1XXH B;  4PDG A;  4LJ5 A;  4BLC A;  5C1B A;  1QVR A;  1TDH A;  3GPY A;  4M0D A;  4QHS A;  3UGJ A;  3U5Z A;  2EO2 A;  2Y0Q A;  3MK6 A;  2LWX A;  4REZ A;  5EP4 A;  3TPZ A;  3K92 A;  4LRS A;  1G59 A;  2VII A;  1DGH A;  5BR8 M;  5F3W A;  2FOI C;  1Z5B A;  2F5Q A;  2ZM6 M;  4LFC M;  2D7H A;  1G8P A;  3KS4 A;  3FUV A;  4CIS A;  3FKE A;  4IBD A;  3VLF B;  4DR4 M;  3EIH A;  4FWG A;  1HNX M;  2V1U A;  4FCW A;  1IXS B;  1K3X A;  1J7K A;  2DZO B;  1J5E M;  4PDI A;  2XZU A;  4A3V B;  1VDD A;  1YSY A;  1Z5C A;  4MGI E;  2ZAO A;  4ZPX A;  2KEB A;  1XHB A;  4IBC A;  4LZJ A;  4B3M M;  2DWM A;  5E6J A;  1N32 M;  5IWA M;  3DZD A;  2OPF A;  1NJG A;  4I4L A;  4DV0 M;  1QYR A;  1DO2 A;  4OVZ B;  4LF8 M;  4JI5 M;  2HCB A;  3J2P B;  3RFW A;  4I8O A;  3Q8X A;  3WHK A;  4XGI A;  3TWL A;  4IIW A;  4CGY B;  1N75 A;  2Y20 A;  3K1J A;  4GKJ M;  4FW9 A;  1GL6 A;  4HL4 A;  4FCT A;  3GRR A;  1T3T A;  1E9R A;  1GLN A;  2HKJ A;  2VQF M;  2O5R A;  5ITY A;  3W0F A;  3A46 A;  4LJ7 A;  2BJV A;  1E32 A;  3SHG B;  5A2Q S;  4QNM A;  4GRI A;  1SXJ C;  3QAU A;  1IBL M;  1UM8 A;  1N78 A;  1SXJ D;  3L29 A;  2F5O A;  3LQQ A;  4HLQ A;  3UJN A;  2C5R A;  1QZM A;  2EA0 A;  3SHF A;  2Y0T A;  4MGZ E;  3HKP A;  1QAQ A;  2DWZ B;  2Z4S A;  3RGP A;  4L15 A;  2V6Z M;  1SXJ B;  4MB7 A;  4AG6 A;  1YUB A;  4P16 A;  4LJ8 A;  2FFJ A;  1G3I A;  1I4W A;  2EUC A;  2ZBK B;  3BOS A;  1KYI A;  4M9X A;  4IBK A;  4DV3 M;  5EXS A;  1DO0 A;  5EQT A;  3LVW A;  4NSO B;  2DWN A;  1GVN A;  3J81 S;  4LJA A;  1E94 E;  2UXD M;  1N33 M;  5EJC A;  2AHM A;  1DGG A;  3PNY A;  4LG2 A;  4JI1 M;  2CV1 A;  4DV4 M;  2OQ4 A;  2CHV A;  3RE8 A;  3GQ3 A;  2VQE M;  3UZU A;  3KDS E;  4ITQ A;  1N34 M;  2XH9 A;  3AOE C;  3I51 A;  4WW0 A;  4LF7 M;  4PCZ A;  4PT5 A;  1ORY B;  4PD2 A;  1PJI A;  2XFS A;  2E5L M;  3GPU A;  3VDP A;  3K8Z A;  5FLX S;  1XMQ M;  4S12 A;  1HNZ M;  4IBG A;  1D2N A;  4B08 A;  3U6L A;  4AKG A;  1L1T A;  1L2D A;  5KO3 A;  2UU9 M;  2QBY A;  1FNN A;  3L28 A;  3FYD A;  2UUB M;  4MGK E;  1X37 A;  4FCV A;  3KVW A;  4AW4 A;  1GKI A;  1XC8 A;  2YQZ A;  3U6O A;  3AOG A;  1HT1 E;  3R8F A;  2YNM D;  3VDU A;  2L7H A;  4DV5 M;  3GQ4 A;  4JI2 M;  3TQS A;  4RNA A;  3U6E A;  4G4N A;  1Z5A A;  4LJ9 A;  4DR7 M;  2XFT A;  4NRV A;  4MGY E;  3HJ8 A;  4GMQ A;  3EIE A;  2ZAN A;  2C98 A;  2LXE A;  3HWS A;  4G4R A;  3GLG B;  4KO8 A;  4X64 M;  4CHT B;  4GC5 A;  2QCU A;  2XSZ D;  5EXP A;  1NY6 A;  3GLI A;  3KW6 A;  4NL4 H;  2H1R A;  1HQC A;  5EXT A;  3ZC7 B;  3ZCB B;  2CHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...