4X64M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x64M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x64M02
3SARA 4DV2M 3JAMS 4G4OA 1XMOM 4JI5M 4DR7M 3GPPA 1K82A 4JI3M 2HKJA 1TDHA 1XC8A 1R2ZA 4LF9M 1L1ZA 1MX0A 1PJIA 1HNWM 4DV7M 4KHPM 1I94M 1N32M 3GQ4A 2EA0A 3T1HM 3VK8A 1R2YA 1K3WA 1IBMM 2UXDM 4LFAM 1KFVA 4YHHM 3T1YM 4JI8M 1N36M 1FJGM 4JYAM 4DR1M 3GPYA 3U6SA 4B3MM 4JV5M 1HNZM 5ITRA 4DR5M 3TWKA 3GP1A 3W0FA 4DR2M 4LF7M 2Q2EB 1IBLM 3GQ3A 3SAWA 3VK7A 4PCZA 4B3SM 5ITQA 1L2BA 2F5QA 4DV1M 2UUBM 4PDIA 1Q3CA 1HR0M 1J5EM 4YY3M 4JI6M 1Z59A 4JI4M 4G4QA 5IT9S 4B3TM 5BR8M 4X66M 2E5LM 1MU5A 3TWMA 3SATA 3GPUA 4G4RA 2VQFM 3SAVA 2VQEM 4LF8M 3TWLA 2XZUA 1K3XA 1IBKM 4CISA 4NRVA 1HNXM 4X65M 3C58A 1XMQM 1PM5A 4AQYM 5IWAM 1N34M 3U6LA 2UXBM 4NXMM 3DOAA 2F5OA 3JR5A 3A45A 1L2CA 4X64M 4LF4M 1XNQM 4LF6M 4DV6M 4K0KM 5A2QS 2ZM6M 2OQ4A 5LMUM 4LFBM 5LMNM 4JI7M 4GKKM 1Z5CA 2OPFA 1Z5AA 3U6PA 5ITXE 4PDGA 3J81S 1Q39A 2F5NA 1N33M 3A42A 4NRWA 3U6OA 5ITTA 5ITUA 4JI1M 4X62M 4DR4M 4DR3M 3U6QA 3JR4A 3U6MA 3SAUA 2F5PA 4DR6M 4MB7A 2UXCM 2F4VM 2ZBKB 3U6DA 4G4NA 3GQ5A 4LFCM 4PD2A 2UUAM 4NXNM 2UU9M 4DV5M 3SASA 2F5SA 1TDZA 4OX9M 4DV4M 1Q3BA 4JI2M 3GPXA 1Z5BA 3GO8A 4LF5M 2XZFA 4DV0M 1PJJA 3J7AS 1L1TA 4DUYM 3SBJA 4DUZM 5ITXA 2UUCM 1L2DA 3U6CA 4GKJM 4JI0M 4B3RM 3J80S 1EE8A 5ITYA 3OTOM 3A46A 1NNJA 2HHHM 1XNRM 3U6EA 5FLXS 4DV3M 4ITQA
chains in the Genus database with same CATH superfamily
1J09A 4FWDA 3B89A 2R44A 4R7GA 4DV2M 2L2DA 4JI5M 3L29A 5JI3E 2R6FA 3C3DA 1K82A 4DR7M 4FCVA 2BNKA 4HL4A 2GQFA 2KA6B 3FUUA 1YLAA 3MMPA 1BVSA 2CUZA 2H5XA 1E94E 3QYEA 3L26A 1XB2B 2NQ8C 3FUXA 1QDTA 4PT5A 1WXQA 5KQ8A 3GQ4A 5KPRA 3I01M 3Q8GA 1IBMM 2DAMA 2CHGA 3B7QA 4L8RC 4YHHM 4JYAM 2MROB 1YSYA 2ZTDA 2KEBA 2L09A 3BXWA 3K2LA 1F4IA 3QWLA 4OVZA 2N35A 2BJVA 3J27B 4MGYE 3PXGA 4LJ7A 5IREB 4JV5M 1SXJD 2JY5A 4D82A 3TWKA 1J7KA 1R6BX 3W0FA 4OU7A 2Y20A 3KOXE 1IXZA 4QNRA 1IN4A 4NOOB 1IBLM 5ITQA 2UUBM 5EP3A 1NHGC 4DV1M 1GABA 2ZAOA 1R5LA 3TPZA 3B7NA 2YNMD 3KW6A 4M9SA 4LZZA 1PGYA 2X8AA 2KZUA 2QCUA 4JI6M 3D8BA 5IT9S 3MHVC 4JN6A 4LGMA 2V6ZM 2EKFA 2WSFF 3PNYA 4CJ6A 3UK6A 2Y21A 3FTCA 4AZFA 1S3SA 2RRUA 5EXXA 2KW0A 2VQFM 3CF0A 4GITA 2X4AA 1ZMVA 2M5ZA 2KDLA 3I4VA 3I04M 4I5SA 3TQSA 3TWLA 1NV9A 3NWLA 5FTKA 3K9PA 1HNXM 4FVMA 4I4LA 1JB0F 2HAKA 3FD9A 1D0KA 1FNNA 2KNZA 3TE6A 3U6LA 4NXMM 3DOAA 2APLA 1GLNA 2F5OA 2X49A 3JR5A 3A45A 3DFZA 1GO5A 2ERCA 2R4JA 3E46A 4GIPA 1IY1A 3FUTA 3J2PB 1T3TA 3HHZA 1WHCA 1NSFA 2OO9A 5LMNM 1XXHB 4GKKM 3J81S 1NY6A 2FOIC 2KRUA 4G3OA 2F5NA 3LQQA 3U6OA 4MGIE 4BLCA 2ZAMA 4X62M 3T6PA 1TF0B 3HKPA 4L4UA 4LZJA 3H4MA 5KPZA 3ZC7B 3A98B 2DAIA 3JR4A 4DR6M 8CATA 3RE8A 1WJ7A 3LVWA 1V92A 4WURA 4KO8A 1W5SA 3THGA 2R65A 2JP7A 4PD2A 1C7YA 4P16A 1OFIA 2OOBA 2B3TA 1GVNA 2LVOC 4DV5M 3GLFB 1IN5A 2JUJA 3SASA 2R62A 4OX9M 2KNAA 3KFUG 4GMQA 4LCBA 2JY7A 1NV8A 2C96A 3M0EA 4HLQA 1D2NA 2RGHA 5FTLA 5H37D 1QVRA 3CGWA 5EP2A 3SBJA 3U60B 4DV3M 4RF1A 5ITXA 3AFHA 1YE9A 4JI0M 1I4WA 5EP1A 2CV2A 4M0WA 2K47A 5ITYA 3AKZA 1ORYB 4LJ8A 2HHHM 2EJSA 1HT2E 2M60A 4Y28F 3KOZE 2DI0A 3GLHA 4TUWA 2YFQA 2CEAA 3KVWA 3SMSA 4G4OA 3K8ZA 1XMOM 4AG5A 1UFZA 1R4GA 2HKJA 1L8QA 1GL6A 1TDHA 2XFTA 2LXEA 3LVVA 4DV7M 1ZQ9A 5FSWA 1XHBA 2J7NA 2KNVA 2LVAA 2J7OA 3T1HM 2LH0A 3NBXX 1K3WA 2Y0QA 4LFAM 3GLGB 4G6ZA 4L6V6 3WHLA 1A5TA 3GPYA 2DWMA 1FJGM 2DWZB 2LVQD 1VEJA 3SHGB 2EKKA 4CGYB 4B3MM 1GKIA 1XNRM 2DAKA 3PVSA 2LTUA 4DR5M 4IBGA 4B08A 3H4JA 4F2LA 1MN3A 4KT0F 1TGUA 3U5ZB 3B9PA 4LJ9A 1G59A 1SXJC 4LRSA 4B3SM 1SXJB 3L2AA 3SHFA 1RU3A 5E26A 4AG6A 2BWEA 3SFZA 1KYIA 4QOSA 3KP0E 1NNUC 1OIZA 1DGBA 4JI4M 3QYBA 4IJEA 4B3TM 2H1RA 1HQCA 1MU5A 3I51A 1JQJC 2VDBB 1E32A 3TWMA 1G4AE 2DHRA 3GPUA 5KPTA 3AOEC 4AKHA 3HY5A 3GLHE 2XZUA 2HL7A 1GJTA 1K3XA 3U61B 1OKSA 1IBKM 1OFHA 3J7BA 1P3QQ 4GHAA 1IN6A 3KDSE 3C58A 1PM5A 4F1IA 2AHMA 3GLIB 1N34M 3B7ZA 2BWBA 4AKGA 4LG2A 2DNAA 4FWHA 3W0LB 2VF7A 2XEPA 3FRIA 3FUWA 3IG5A 1DGHA 2R18A 1XNQM 2L4FA 3W68A 2QBYA 2OQ4A 5LMUM 2L6OA 4LFBM 4KLNA 4IBDA 4UN2B 1E9SA 5EQTA 3U6PA 1Q39A 2I7NA 1NVMA 3VDUA 4M0DA 3A42A 4NRWA 2JZ0A 2DHYA 5ITTA 5EP4A 1N78A 4JI1M 2CHQA 4I81A 3C9PA 1IQPA 1X37A 3U6QA 2JZ1A 1DO0A 3ILKA 3SAUA 1HJPA 4MB7A 2UXCM 2F4VM 2DVWB 2ZBKB 2K0BX 1DGGA 3IG8A 1QAQA 4ZPXA 5FTJA 3RGSA 3M7GA 3KP1E 4LFCM 1D0LA 1IXSB 4W5WA 4NXNM 1NY5A 2LVNC 4A3VB 1WGNA 4XGIA 2QQ8A 2DZLA 1IY0A 1TTEA 1Q3BA 2K9DA 4IBEA 1PJSA 1Z5BA 4I8OA 1QQWA 3HHYA 3GPXA 3AJIB 4CIZA 5E6JA 3HHWA 2XFSA 4IBCA 4MGHA 4MM3B 4BBAA 1HT1E 1IN8A 2WZJA 3E21A 3R9XB 4KODA 2CV1A 2UUCM 3U6CA 3LCVB 2QZ4A 1EE8A 4NSRA 4GC9A 1GJSA 2XSZD 4R71A 1J5EM 4ITQA 4QHSA 2HCBA 4QOZC 1QAMA 3B74A 3EIEA 3HU3A 3JAMS 3GPPA 3BOSA 4LGYA 4JI3M 2LHGA 3HZJA 4LF9M 1MX0A 4WW0A 1PJIA 1EFUB 1ZAEA 1HNWM 3HWSA 3KSJA 4KHPM 1ZV1A 1I94M 1N32M 5EXPA 2D7EA 4IJFA 2EA0A 1IM2A 3PFIA 4RKUF 2FH0A 4IIWA 3VK8A 2UXDM 4AKIA 2LBCA 1IXRC 1N36M 3SMPA 2DXIA 4D81A 3U6SA 2G3QA 3TL4X 4GRIA 1OJLA 4RNAA 2XSZA 3FTDA 4S12A 1HNZM 2G8LA 3FYCA 4LJ6A 4DR2M 4FCWA 2Z7JA 1VG5A 2Q2EB 1G3IA 3KOWE 3GRVA 3L28A 4OVZB 2BJWA 2OOAA 2VIIA 2YR0A 3WHKA 3GQ3A 4OW0A 3SAWA 3VK7A 4GHLA 2F5QA 4DBGB 5FTMA 2EO2A 4PDIA 3KXEC 2XLJA 3ZCBB 4M9ZA 4IBBA 2DAGA 3MJ5A 5DYGA 2MH8A 4YY3M 2QPAA 1Z59A 2CHVA 4G4QA 1PRBA 5BR8M 2JNHA 3KS4A 2E5LM 2JY6B 3M6AA 1QUSA 2O25A 2ZANA 2C5RA 3SATA 3KS8A 4NSOB 3SAVA 5EXSA 5L8RF 3L25A 3LW5F 2C9CA 2R0IA 4CISA 2Z4RA 3DZDA 4L15A 2GNOA 4X65M 3LMMA 3HX3A 2CP8A 2KHHA 2L7IA 1EIJA 1XXHA 4GEWA 2XF3A 2CWBA 4X64M 1QZEA 4LY6A 4REZA 4K0KM 3FRHA 1DO2A 2JWSA 4EIWA 1TR8A 2HWJA 1QANA 1Z5AA 1VQ1A 4PDGA 5ITXE 3CF6E 3DA1A 1LV7A 1PJTA 2DZNB 5ITUA 3K1JA 4DR4M 1NHWC 1NJGA 4DR3M 4B7FA 4AI6A 1IN7A 3UGJA 1QAOA 3GLFA 1VEKA 4IBIA 2JY8A 2FNAA 3SC3A 1XWIA 2KRKA 4WP2A 3HU1A 4FW9A 3T38A 3VDPA 4GH9A 2FE8A 3FKEA 4Z8XA 3GQ5A 2QENA 1IY2A 1V34A 4GC5A 4L16A 3U60A 2UU9M 4IBFA 3I4YA 2F5SA 1HQYE 1TDZA 2Z3XA 2FFJA 4LRTA 4LF5M 3AOGA 4B7HA 4DV0M 5KO3A 3CTWB 3VLFB 1PJJA 2DWLA 3E9SA 3SYLA 2I7PA 1L1TA 2W82A 4DUYM 3AV0A 3GRYA 3VFDA 2LNHC 2JXNA 2VF8A 1L2DA 2O5RA 4QNMA 3Q8XA 4P17A 1DV0A 2MJ5B 4XBOA 3J80S 5GKNA 2DAEA 1ZMUA 3NBIA 2KXEA 1MJGM 1QZMA 5IZ7D 5FLXS 3OTOM 1GL7A 3U6EA 2V1UA 3E4RA 1N77A 3HU2A 3SARA 3HJ8A 4BB9A 2RKOA 3GRRA 3ZQJA 2A5YB 5DYIA 5KQDA 1XXHE 2D7GA 5EXTA 4XK8F 2CFOA 4IBKA 4AW4A 3GLGA 1R2ZA 3L27A 3V76A 5C18A 1XC8A 2QNJA 1L1ZA 1QUTA 3GLHB 4II7A 3IECA 4RF0A 1N75A 4NC6A 4D80A 1D0MA 2V1CA 1R2YA 1PJQA 1KFVA 3UJNA 1LTMA 3T1YM 4JI8M 4LJ4A 4DR1M 3U5ZA 2YQZA 2O01F 1CUKA 2XGNA 1R7RA 5FTNA 3HGIA 2Z8YM 2K6BA 3KOYE 1SXJA 1G8PA 1NO1A 5EJCA 1T43A 4IBJA 5ITRA 3GLFE 4M9XA 3VKHA 3GP1A 3U6DA 1T6OA 1JR3D 3CF2A 4MGKE 4LF7M 3T15A 1IFYA 2DZOB 7CATA 4LJAA 1OIPA 3LCUA 4CHTB 3KSXA 1DGFA 2R4EA 4R3DA 4PCZA 1L2BA 1Y8GA 2L4EA 3RFWA 3QAUA 2DWNA 1G71A 3UZUA 1Q3CA 1HR0M 1WGLA 3AOEA 3FYDA 3HJSA 2JA2A 1TH3A 2CRUA 4L78A 5F3WA 3K9OA 4X66M 3RGPA 3U61A 4ANRA 2XH9A 5BPVA 4G4RA 1UM8A 1VDDA 2LVPC 1G41A 3R8FA 1SG9A 2QP9X 2VQEM 3GLIA 4LF8M 2P5TA 3F92A 1TH4A 1VEGA 3MK6A 2CE7A 1TH2A 2KZSA 2MR9A 1JR3A 1Z6TA 2EUCA 4NRVA 2R45A 1AUAA 5JI2E 2WSCF 1OTRA 1AIPC 2LHCA 2ZTCA 1XMQM 2C99A 3GLGE 1NJFA 5IWAM 4AQYM 2FS1A 2UXBM 4FWGA 2MGWA 1L2CA 4NL4H 3C3EA 5DFLA 2CV0A 4LF4M 2G5GX 3K92A 4LF6M 4DV6M 1W5TA 5A2QS 2ZM6M 2DKLA 3PNVA 4JI7M 3UMMA 1Z5CA 2DENA 2OPFA 1YUBA 2D7HA 1OAIA 2J5YA 4JXJA 1SXJE 1DGHB 4QHTA 1N33M 1QDRA 4B7GA 2QBYB 1C1KA 3BBZA 1IXSA 1H6UA 3VKGA 4MH0E 1KSFX 5DNYA 2QSFX 3U6MA 2F5PA 2QHOB 3EIHA 4LJ5A 1Q02A 3FE3A 2Y0TA 3D8LA 4G4NA 1VDLA 4FCTA 3W67A 1E9RA 1WR1B 3LQRA 3SYKA 2UUAM 2C9OA 1WIVA 2L7HA 3FTFA 4DV4M 3HJQA 4JI2M 2WSEF 3GO8A 2R46A 3IHPA 2XZFA 3J7AS 2C98A 4HEOA 1ZMWA 4FD2A 3FTEA 4Q7JA 4DUZM 4MGZE 1OQYA 3FUVA 3GLIE 4GKJM 2LWXA 4B3RM 3GRUA 2RGOA 1OAOC 4Z6YA 3A46A 1NNJA 1JR3E 5C1BA 3ZH9B 2Z4SA 1V33A 3HHXA 1QYRA 3AL0C
chains in the Genus database with same CATH topology
1J09A 4FWDA 4R7GA 4DV2M 4JI5M 3L29A 5JI3E 4DR7M 1K82A 4FCVA 2BNKA 4HL4A 2KA6B 3FUUA 2CUZA 1E94E 3L26A 2NQ8C 3FUXA 5KQ8A 4PT5A 1WXQA 3GQ4A 5KPRA 1IBMM 2CHGA 4L8RC 4YHHM 4JYAM 1YSYA 2KEBA 2L09A 3K2LA 3QWLA 4OVZA 2BJVA 3J27B 4MGYE 3PXGA 4LJ7A 5IREB 4JV5M 1SXJD 4D82A 3TWKA 1J7KA 1R6BX 3W0FA 4OU7A 2Y20A 3KOXE 1IXZA 4QNRA 1IN4A 4NOOB 1IBLM 5ITQA 2UUBM 5EP3A 1NHGC 4DV1M 2ZAOA 3TPZA 2YNMD 3KW6A 4M9SA 4LZZA 2X8AA 2KZUA 2QCUA 4JI6M 3D8BA 5IT9S 3MHVC 4JN6A 4LGMA 2V6ZM 3PNYA 3UK6A 2Y21A 3FTCA 4AZFA 1S3SA 5EXXA 2KW0A 2VQFM 3CF0A 4GITA 2X4AA 3I4VA 2M5ZA 4I5SA 3TQSA 3TWLA 3NWLA 5FTKA 1HNXM 4FVMA 4I4LA 3FD9A 1FNNA 3TE6A 3U6LA 4NXMM 3DOAA 1GLNA 2F5OA 2X49A 3JR5A 3A45A 3DFZA 2ERCA 2R4JA 4GIPA 1IY1A 3FUTA 3J2PB 1T3TA 3HHZA 1NSFA 5LMNM 1XXHB 4GKKM 3J81S 1NY6A 2FOIC 2KRUA 2F5NA 3LQQA 3U6OA 4MGIE 4BLCA 2ZAMA 4X62M 3HKPA 4L4UA 4LZJA 3H4MA 5KPZA 3ZC7B 3A98B 3JR4A 4DR6M 8CATA 3RE8A 3LVWA 4WURA 4KO8A 1W5SA 3THGA 2R65A 4PD2A 4P16A 1OFIA 1GVNA 4DV5M 3GLFB 1IN5A 3SASA 2R62A 4OX9M 3KFUG 4GMQA 4LCBA 2C96A 3M0EA 4HLQA 1D2NA 2RGHA 5FTLA 5H37D 1QVRA 5EP2A 3SBJA 3U60B 4DV3M 4RF1A 5ITXA 3AFHA 1YE9A 4JI0M 1I4WA 5EP1A 2CV2A 4M0WA 2K47A 5ITYA 3AKZA 1ORYB 4LJ8A 2HHHM 1HT2E 2M60A 3KOZE 3GLHA 4TUWA 2YFQA 2CEAA 3KVWA 3SMSA 4G4OA 3K8ZA 1XMOM 4AG5A 2HKJA 1L8QA 1GL6A 1TDHA 2XFTA 2LXEA 3LVVA 4DV7M 1ZQ9A 5FSWA 1XHBA 2J7NA 2J7OA 3T1HM 2LH0A 1K3WA 2Y0QA 4LFAM 3GLGB 4G6ZA 2DWMA 3WHLA 1FJGM 3GPYA 2DWZB 3SHGB 4B3MM 4CGYB 1GKIA 3PVSA 4DR5M 4IBGA 4B08A 1TGUA 3U5ZB 3B9PA 4LJ9A 1G59A 1SXJC 4LRSA 4B3SM 1SXJB 3L2AA 3SHFA 5E26A 4AG6A 3SFZA 1KYIA 4QOSA 3KP0E 1NNUC 1DGBA 4JI4M 4IJEA 4B3TM 2H1RA 1HQCA 1MU5A 3I51A 1JQJC 1E32A 3TWMA 1G4AE 2DHRA 3GPUA 5KPTA 3AOEC 4AKHA 2XZUA 2HL7A 1K3XA 3U61B 1IBKM 1OFHA 3J7BA 4GHAA 1IN6A 3KDSE 3C58A 1PM5A 2AHMA 3GLIB 1N34M 4AKGA 4LG2A 4FWHA 3W0LB 2XEPA 3IG5A 3FUWA 1DGHA 2R18A 1XNQM 2QBYA 2OQ4A 5LMUM 2L6OA 4LFBM 4KLNA 4IBDA 5EQTA 1E9SA 3U6PA 1Q39A 2I7NA 1NVMA 3VDUA 4M0DA 3A42A 4NRWA 5ITTA 5EP4A 1N78A 4JI1M 2CHQA 4I81A 1IQPA 1X37A 3U6QA 1DO0A 3ILKA 3SAUA 4MB7A 2UXCM 2F4VM 2DVWB 2ZBKB 1DGGA 3IG8A 1QAQA 4ZPXA 5FTJA 3RGSA 3M7GA 3KP1E 4LFCM 1IXSB 4W5WA 4NXNM 1NY5A 4A3VB 4XGIA 1IY0A 3HHYA 1Q3BA 4IBEA 1Z5BA 3GPXA 4I8OA 1QQWA 3AJIB 5E6JA 3HHWA 2XFSA 4IBCA 4MGHA 4MM3B 4BBAA 1HT1E 1IN8A 3R9XB 4KODA 2CV1A 2UUCM 3U6CA 2QZ4A 1EE8A 4NSRA 4GC9A 2XSZD 1J5EM 4ITQA 4QHSA 2HCBA 4QOZC 1QAMA 3JAMS 3EIEA 3HU3A 3GPPA 3BOSA 4LGYA 4JI3M 4LF9M 1MX0A 4WW0A 1PJIA 1HNWM 1ZAEA 4KHPM 3HWSA 3KSJA 1I94M 1N32M 5EXPA 2D7EA 4IJFA 2EA0A 1IM2A 3PFIA 3VK8A 2UXDM 4IIWA 4AKIA 1IXRC 1N36M 3SMPA 2DXIA 4D81A 3U6SA 3TL4X 4GRIA 1OJLA 4RNAA 2XSZA 3FTDA 4S12A 1HNZM 2G8LA 3FYCA 4LJ6A 4DR2M 4FCWA 2Z7JA 2Q2EB 1G3IA 3KOWE 3GRVA 3L28A 4OVZB 2BJWA 2YR0A 2VIIA 3WHKA 3GQ3A 4OW0A 3SAWA 3VK7A 4GHLA 2F5QA 5FTMA 2EO2A 4PDIA 3KXEC 2XLJA 3ZCBB 4M9ZA 4IBBA 5DYGA 3MJ5A 4YY3M 2QPAA 1Z59A 2CHVA 4G4QA 5BR8M 3KS4A 2E5LM 3M6AA 2ZANA 2C5RA 3SATA 3KS8A 4NSOB 3SAVA 5EXSA 3L25A 2C9CA 4CISA 2Z4RA 3DZDA 4L15A 4X65M 3LMMA 2L7IA 1XXHA 2XF3A 4X64M 4LY6A 4REZA 4K0KM 1DO2A 4EIWA 1QANA 1Z5AA 5ITXE 4PDGA 3CF6E 3DA1A 1LV7A 2DZNB 5ITUA 3K1JA 4DR4M 1NHWC 1NJGA 4DR3M 4B7FA 4AI6A 1IN7A 3UGJA 1QAOA 3GLFA 4IBIA 3SC3A 2FNAA 1XWIA 2KRKA 3T38A 3HU1A 4FW9A 3U6DA 3VDPA 4GH9A 2FE8A 3FKEA 4Z8XA 3GQ5A 2QENA 1IY2A 4GC5A 4L16A 3U60A 2UU9M 4IBFA 3I4YA 2F5SA 1HQYE 1TDZA 2Z3XA 2FFJA 4LRTA 4LF5M 3AOGA 4B7HA 4DV0M 5KO3A 3CTWB 3VLFB 1PJJA 2DWLA 3E9SA 3SYLA 2I7PA 1L1TA 2W82A 4DUYM 3AV0A 3GRYA 3VFDA 2LNHC 1L2DA 2O5RA 4QNMA 3Q8XA 4XBOA 3J80S 5GKNA 5IZ7D 3OTOM 3NBIA 2KXEA 1XNRM 1QZMA 3U6EA 5FLXS 1GL7A 2V1UA 3E4RA 1N77A 3HU2A 3SARA 3HJ8A 4BB9A 2RKOA 3GRRA 2A5YB 5DYIA 5KQDA 2D7GA 5EXTA 2CFOA 4IBKA 4AW4A 3GLGA 1R2ZA 3L27A 5C18A 1XC8A 1L1ZA 3GLHB 4II7A 4RF0A 1N75A 4D80A 2V1CA 1R2YA 1KFVA 3UJNA 3T1YM 4JI8M 4LJ4A 4DR1M 3U5ZA 2YQZA 2XGNA 5FTNA 1R7RA 3HGIA 3KOYE 1SXJA 1G8PA 5EJCA 3VKHA 4IBJA 5ITRA 4M9XA 3GP1A 1JR3D 3CF2A 4MGKE 4LF7M 3T15A 2DZOB 7CATA 4LJAA 4CHTB 3KSXA 1DGFA 2R4EA 4R3DA 4PCZA 1L2BA 3RFWA 3QAUA 2DWNA 3UZUA 1Q3CA 1HR0M 3AOEA 3FYDA 3HJSA 2JA2A 1TH3A 4L78A 5F3WA 4X66M 3RGPA 3U61A 2XH9A 5BPVA 4G4RA 1UM8A 1VDDA 3R8FA 1G41A 2QP9X 2VQEM 3GLIA 4LF8M 2P5TA 1TH4A 3MK6A 2CE7A 1TH2A 2KZSA 1JR3A 1Z6TA 2EUCA 4NRVA 2R45A 5JI2E 1XMQM 2C99A 1NJFA 5IWAM 4AQYM 2UXBM 4FWGA 1L2CA 4NL4H 4LF4M 2CV0A 2G5GX 3K92A 4LF6M 4DV6M 1W5TA 5A2QS 2ZM6M 3PNVA 4JI7M 3UMMA 1Z5CA 2OPFA 1YUBA 2D7HA 4JXJA 1SXJE 1DGHB 4QHTA 1N33M 4B7GA 2QBYB 1C1KA 1H6UA 3VKGA 4MH0E 1KSFX 5DNYA 3U6MA 2F5PA 3EIHA 4LJ5A 2Y0TA 3D8LA 4G4NA 4FCTA 1E9RA 3LQRA 3SYKA 2UUAM 2C9OA 2L7HA 3FTFA 4DV4M 3HJQA 4JI2M 3GO8A 2R46A 2XZFA 3J7AS 2C98A 4FD2A 3FTEA 4DUZM 4MGZE 3FUVA 4GKJM 2LWXA 4B3RM 3GRUA 2RGOA 4Z6YA 3A46A 1NNJA 5C1BA 3ZH9B 2Z4SA 3HHXA 1QYRA 3AL0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SAR A;  4DV2 M;  3JAM S;  4G4O A;  1XMO M;  4JI5 M;  4DR7 M;  3GPP A;  1K82 A;  4JI3 M;  2HKJ A;  1TDH A;  1XC8 A;  1R2Z A;  4LF9 M;  1L1Z A;  1MX0 A;  1PJI A;  1HNW M;  4DV7 M;  4KHP M;  1I94 M;  1N32 M;  3GQ4 A;  2EA0 A;  3T1H M;  3VK8 A;  1R2Y A;  1K3W A;  1IBM M;  2UXD M;  4LFA M;  1KFV A;  4YHH M;  3T1Y M;  4JI8 M;  1N36 M;  1FJG M;  4JYA M;  4DR1 M;  3GPY A;  3U6S A;  4B3M M;  4JV5 M;  1HNZ M;  5ITR A;  4DR5 M;  3TWK A;  3GP1 A;  3W0F A;  4DR2 M;  4LF7 M;  2Q2E B;  1IBL M;  3GQ3 A;  3SAW A;  3VK7 A;  4PCZ A;  4B3S M;  5ITQ A;  1L2B A;  2F5Q A;  4DV1 M;  2UUB M;  4PDI A;  1Q3C A;  1HR0 M;  1J5E M;  4YY3 M;  4JI6 M;  1Z59 A;  4JI4 M;  4G4Q A;  5IT9 S;  4B3T M;  5BR8 M;  4X66 M;  2E5L M;  1MU5 A;  3TWM A;  3SAT A;  3GPU A;  4G4R A;  2VQF M;  3SAV A;  2VQE M;  4LF8 M;  3TWL A;  2XZU A;  1K3X A;  1IBK M;  4CIS A;  4NRV A;  1HNX M;  4X65 M;  3C58 A;  1XMQ M;  1PM5 A;  4AQY M;  5IWA M;  1N34 M;  3U6L A;  2UXB M;  4NXM M;  3DOA A;  2F5O A;  3JR5 A;  3A45 A;  1L2C A;  4X64 M;  4LF4 M;  1XNQ M;  4LF6 M;  4DV6 M;  4K0K M;  5A2Q S;  2ZM6 M;  2OQ4 A;  5LMU M;  4LFB M;  5LMN M;  4JI7 M;  4GKK M;  1Z5C A;  2OPF A;  1Z5A A;  3U6P A;  5ITX E;  4PDG A;  3J81 S;  1Q39 A;  2F5N A;  1N33 M;  3A42 A;  4NRW A;  3U6O A;  5ITT A;  5ITU A;  4JI1 M;  4X62 M;  4DR4 M;  4DR3 M;  3U6Q A;  3JR4 A;  3U6M A;  3SAU A;  2F5P A;  4DR6 M;  4MB7 A;  2UXC M;  2F4V M;  2ZBK B;  3U6D A;  4G4N A;  3GQ5 A;  4LFC M;  4PD2 A;  2UUA M;  4NXN M;  2UU9 M;  4DV5 M;  3SAS A;  2F5S A;  1TDZ A;  4OX9 M;  4DV4 M;  1Q3B A;  4JI2 M;  3GPX A;  1Z5B A;  3GO8 A;  4LF5 M;  2XZF A;  4DV0 M;  1PJJ A;  3J7A S;  1L1T A;  4DUY M;  3SBJ A;  4DUZ M;  5ITX A;  2UUC M;  1L2D A;  3U6C A;  4GKJ M;  4JI0 M;  4B3R M;  3J80 S;  1EE8 A;  5ITY A;  3OTO M;  3A46 A;  1NNJ A;  2HHH M;  1XNR M;  3U6E A;  5FLX S;  4DV3 M;  4ITQ A; 
#chains in the Genus database with same CATH topology
 1J09 A;  4FWD A;  3B89 A;  2R44 A;  4R7G A;  4DV2 M;  2L2D A;  4JI5 M;  3L29 A;  5JI3 E;  2R6F A;  3C3D A;  1K82 A;  4DR7 M;  4FCV A;  2BNK A;  4HL4 A;  2GQF A;  2KA6 B;  3FUU A;  1YLA A;  3MMP A;  1BVS A;  2CUZ A;  2H5X A;  1E94 E;  3QYE A;  3L26 A;  1XB2 B;  2NQ8 C;  3FUX A;  1QDT A;  4PT5 A;  1WXQ A;  5KQ8 A;  3GQ4 A;  5KPR A;  3I01 M;  3Q8G A;  1IBM M;  2DAM A;  2CHG A;  3B7Q A;  4L8R C;  4YHH M;  4JYA M;  2MRO B;  1YSY A;  2ZTD A;  2KEB A;  2L09 A;  3BXW A;  3K2L A;  1F4I A;  3QWL A;  4OVZ A;  2N35 A;  2BJV A;  3J27 B;  4MGY E;  3PXG A;  4LJ7 A;  5IRE B;  4JV5 M;  1SXJ D;  2JY5 A;  4D82 A;  3TWK A;  1J7K A;  1R6B X;  3W0F A;  4OU7 A;  2Y20 A;  3KOX E;  1IXZ A;  4QNR A;  1IN4 A;  4NOO B;  1IBL M;  5ITQ A;  2UUB M;  5EP3 A;  1NHG C;  4DV1 M;  1GAB A;  2ZAO A;  1R5L A;  3TPZ A;  3B7N A;  2YNM D;  3KW6 A;  4M9S A;  4LZZ A;  1PGY A;  2X8A A;  2KZU A;  2QCU A;  4JI6 M;  3D8B A;  5IT9 S;  3MHV C;  4JN6 A;  4LGM A;  2V6Z M;  2EKF A;  2WSF F;  3PNY A;  4CJ6 A;  3UK6 A;  2Y21 A;  3FTC A;  4AZF A;  1S3S A;  2RRU A;  5EXX A;  2KW0 A;  2VQF M;  3CF0 A;  4GIT A;  2X4A A;  1ZMV A;  2M5Z A;  2KDL A;  3I4V A;  3I04 M;  4I5S A;  3TQS A;  3TWL A;  1NV9 A;  3NWL A;  5FTK A;  3K9P A;  1HNX M;  4FVM A;  4I4L A;  1JB0 F;  2HAK A;  3FD9 A;  1D0K A;  1FNN A;  2KNZ A;  3TE6 A;  3U6L A;  4NXM M;  3DOA A;  2APL A;  1GLN A;  2F5O A;  2X49 A;  3JR5 A;  3A45 A;  3DFZ A;  1GO5 A;  2ERC A;  2R4J A;  3E46 A;  4GIP A;  1IY1 A;  3FUT A;  3J2P B;  1T3T A;  3HHZ A;  1WHC A;  1NSF A;  2OO9 A;  5LMN M;  1XXH B;  4GKK M;  3J81 S;  1NY6 A;  2FOI C;  2KRU A;  4G3O A;  2F5N A;  3LQQ A;  3U6O A;  4MGI E;  4BLC A;  2ZAM A;  4X62 M;  3T6P A;  1TF0 B;  3HKP A;  4L4U A;  4LZJ A;  3H4M A;  5KPZ A;  3ZC7 B;  3A98 B;  2DAI A;  3JR4 A;  4DR6 M;  8CAT A;  3RE8 A;  1WJ7 A;  3LVW A;  1V92 A;  4WUR A;  4KO8 A;  1W5S A;  3THG A;  2R65 A;  2JP7 A;  4PD2 A;  1C7Y A;  4P16 A;  1OFI A;  2OOB A;  2B3T A;  1GVN A;  2LVO C;  4DV5 M;  3GLF B;  1IN5 A;  2JUJ A;  3SAS A;  2R62 A;  4OX9 M;  2KNA A;  3KFU G;  4GMQ A;  4LCB A;  2JY7 A;  1NV8 A;  2C96 A;  3M0E A;  4HLQ A;  1D2N A;  2RGH A;  5FTL A;  5H37 D;  1QVR A;  3CGW A;  5EP2 A;  3SBJ A;  3U60 B;  4DV3 M;  4RF1 A;  5ITX A;  3AFH A;  1YE9 A;  4JI0 M;  1I4W A;  5EP1 A;  2CV2 A;  4M0W A;  2K47 A;  5ITY A;  3AKZ A;  1ORY B;  4LJ8 A;  2HHH M;  2EJS A;  1HT2 E;  2M60 A;  4Y28 F;  3KOZ E;  2DI0 A;  3GLH A;  4TUW A;  2YFQ A;  2CEA A;  3KVW A;  3SMS A;  4G4O A;  3K8Z A;  1XMO M;  4AG5 A;  1UFZ A;  1R4G A;  2HKJ A;  1L8Q A;  1GL6 A;  1TDH A;  2XFT A;  2LXE A;  3LVV A;  4DV7 M;  1ZQ9 A;  5FSW A;  1XHB A;  2J7N A;  2KNV A;  2LVA A;  2J7O A;  3T1H M;  2LH0 A;  3NBX X;  1K3W A;  2Y0Q A;  4LFA M;  3GLG B;  4G6Z A;  4L6V 6;  3WHL A;  1A5T A;  3GPY A;  2DWM A;  1FJG M;  2DWZ B;  2LVQ D;  1VEJ A;  3SHG B;  2EKK A;  4CGY B;  4B3M M;  1GKI A;  1XNR M;  2DAK A;  3PVS A;  2LTU A;  4DR5 M;  4IBG A;  4B08 A;  3H4J A;  4F2L A;  1MN3 A;  4KT0 F;  1TGU A;  3U5Z B;  3B9P A;  4LJ9 A;  1G59 A;  1SXJ C;  4LRS A;  4B3S M;  1SXJ B;  3L2A A;  3SHF A;  1RU3 A;  5E26 A;  4AG6 A;  2BWE A;  3SFZ A;  1KYI A;  4QOS A;  3KP0 E;  1NNU C;  1OIZ A;  1DGB A;  4JI4 M;  3QYB A;  4IJE A;  4B3T M;  2H1R A;  1HQC A;  1MU5 A;  3I51 A;  1JQJ C;  2VDB B;  1E32 A;  3TWM A;  1G4A E;  2DHR A;  3GPU A;  5KPT A;  3AOE C;  4AKH A;  3HY5 A;  3GLH E;  2XZU A;  2HL7 A;  1GJT A;  1K3X A;  3U61 B;  1OKS A;  1IBK M;  1OFH A;  3J7B A;  1P3Q Q;  4GHA A;  1IN6 A;  3KDS E;  3C58 A;  1PM5 A;  4F1I A;  2AHM A;  3GLI B;  1N34 M;  3B7Z A;  2BWB A;  4AKG A;  4LG2 A;  2DNA A;  4FWH A;  3W0L B;  2VF7 A;  2XEP A;  3FRI A;  3FUW A;  3IG5 A;  1DGH A;  2R18 A;  1XNQ M;  2L4F A;  3W68 A;  2QBY A;  2OQ4 A;  5LMU M;  2L6O A;  4LFB M;  4KLN A;  4IBD A;  4UN2 B;  1E9S A;  5EQT A;  3U6P A;  1Q39 A;  2I7N A;  1NVM A;  3VDU A;  4M0D A;  3A42 A;  4NRW A;  2JZ0 A;  2DHY A;  5ITT A;  5EP4 A;  1N78 A;  4JI1 M;  2CHQ A;  4I81 A;  3C9P A;  1IQP A;  1X37 A;  3U6Q A;  2JZ1 A;  1DO0 A;  3ILK A;  3SAU A;  1HJP A;  4MB7 A;  2UXC M;  2F4V M;  2DVW B;  2ZBK B;  2K0B X;  1DGG A;  3IG8 A;  1QAQ A;  4ZPX A;  5FTJ A;  3RGS A;  3M7G A;  3KP1 E;  4LFC M;  1D0L A;  1IXS B;  4W5W A;  4NXN M;  1NY5 A;  2LVN C;  4A3V B;  1WGN A;  4XGI A;  2QQ8 A;  2DZL A;  1IY0 A;  1TTE A;  1Q3B A;  2K9D A;  4IBE A;  1PJS A;  1Z5B A;  4I8O A;  1QQW A;  3HHY A;  3GPX A;  3AJI B;  4CIZ A;  5E6J A;  3HHW A;  2XFS A;  4IBC A;  4MGH A;  4MM3 B;  4BBA A;  1HT1 E;  1IN8 A;  2WZJ A;  3E21 A;  3R9X B;  4KOD A;  2CV1 A;  2UUC M;  3U6C A;  3LCV B;  2QZ4 A;  1EE8 A;  4NSR A;  4GC9 A;  1GJS A;  2XSZ D;  4R71 A;  1J5E M;  4ITQ A;  4QHS A;  2HCB A;  4QOZ C;  1QAM A;  3B74 A;  3EIE A;  3HU3 A;  3JAM S;  3GPP A;  3BOS A;  4LGY A;  4JI3 M;  2LHG A;  3HZJ A;  4LF9 M;  1MX0 A;  4WW0 A;  1PJI A;  1EFU B;  1ZAE A;  1HNW M;  3HWS A;  3KSJ A;  4KHP M;  1ZV1 A;  1I94 M;  1N32 M;  5EXP A;  2D7E A;  4IJF A;  2EA0 A;  1IM2 A;  3PFI A;  4RKU F;  2FH0 A;  4IIW A;  3VK8 A;  2UXD M;  4AKI A;  2LBC A;  1IXR C;  1N36 M;  3SMP A;  2DXI A;  4D81 A;  3U6S A;  2G3Q A;  3TL4 X;  4GRI A;  1OJL A;  4RNA A;  2XSZ A;  3FTD A;  4S12 A;  1HNZ M;  2G8L A;  3FYC A;  4LJ6 A;  4DR2 M;  4FCW A;  2Z7J A;  1VG5 A;  2Q2E B;  1G3I A;  3KOW E;  3GRV A;  3L28 A;  4OVZ B;  2BJW A;  2OOA A;  2VII A;  2YR0 A;  3WHK A;  3GQ3 A;  4OW0 A;  3SAW A;  3VK7 A;  4GHL A;  2F5Q A;  4DBG B;  5FTM A;  2EO2 A;  4PDI A;  3KXE C;  2XLJ A;  3ZCB B;  4M9Z A;  4IBB A;  2DAG A;  3MJ5 A;  5DYG A;  2MH8 A;  4YY3 M;  2QPA A;  1Z59 A;  2CHV A;  4G4Q A;  1PRB A;  5BR8 M;  2JNH A;  3KS4 A;  2E5L M;  2JY6 B;  3M6A A;  1QUS A;  2O25 A;  2ZAN A;  2C5R A;  3SAT A;  3KS8 A;  4NSO B;  3SAV A;  5EXS A;  5L8R F;  3L25 A;  3LW5 F;  2C9C A;  2R0I A;  4CIS A;  2Z4R A;  3DZD A;  4L15 A;  2GNO A;  4X65 M;  3LMM A;  3HX3 A;  2CP8 A;  2KHH A;  2L7I A;  1EIJ A;  1XXH A;  4GEW A;  2XF3 A;  2CWB A;  4X64 M;  1QZE A;  4LY6 A;  4REZ A;  4K0K M;  3FRH A;  1DO2 A;  2JWS A;  4EIW A;  1TR8 A;  2HWJ A;  1QAN A;  1Z5A A;  1VQ1 A;  4PDG A;  5ITX E;  3CF6 E;  3DA1 A;  1LV7 A;  1PJT A;  2DZN B;  5ITU A;  3K1J A;  4DR4 M;  1NHW C;  1NJG A;  4DR3 M;  4B7F A;  4AI6 A;  1IN7 A;  3UGJ A;  1QAO A;  3GLF A;  1VEK A;  4IBI A;  2JY8 A;  2FNA A;  3SC3 A;  1XWI A;  2KRK A;  4WP2 A;  3HU1 A;  4FW9 A;  3T38 A;  3VDP A;  4GH9 A;  2FE8 A;  3FKE A;  4Z8X A;  3GQ5 A;  2QEN A;  1IY2 A;  1V34 A;  4GC5 A;  4L16 A;  3U60 A;  2UU9 M;  4IBF A;  3I4Y A;  2F5S A;  1HQY E;  1TDZ A;  2Z3X A;  2FFJ A;  4LRT A;  4LF5 M;  3AOG A;  4B7H A;  4DV0 M;  5KO3 A;  3CTW B;  3VLF B;  1PJJ A;  2DWL A;  3E9S A;  3SYL A;  2I7P A;  1L1T A;  2W82 A;  4DUY M;  3AV0 A;  3GRY A;  3VFD A;  2LNH C;  2JXN A;  2VF8 A;  1L2D A;  2O5R A;  4QNM A;  3Q8X A;  4P17 A;  1DV0 A;  2MJ5 B;  4XBO A;  3J80 S;  5GKN A;  2DAE A;  1ZMU A;  3NBI A;  2KXE A;  1MJG M;  1QZM A;  5IZ7 D;  5FLX S;  3OTO M;  1GL7 A;  3U6E A;  2V1U A;  3E4R A;  1N77 A;  3HU2 A;  3SAR A;  3HJ8 A;  4BB9 A;  2RKO A;  3GRR A;  3ZQJ A;  2A5Y B;  5DYI A;  5KQD A;  1XXH E;  2D7G A;  5EXT A;  4XK8 F;  2CFO A;  4IBK A;  4AW4 A;  3GLG A;  1R2Z A;  3L27 A;  3V76 A;  5C18 A;  1XC8 A;  2QNJ A;  1L1Z A;  1QUT A;  3GLH B;  4II7 A;  3IEC A;  4RF0 A;  1N75 A;  4NC6 A;  4D80 A;  1D0M A;  2V1C A;  1R2Y A;  1PJQ A;  1KFV A;  3UJN A;  1LTM A;  3T1Y M;  4JI8 M;  4LJ4 A;  4DR1 M;  3U5Z A;  2YQZ A;  2O01 F;  1CUK A;  2XGN A;  1R7R A;  5FTN A;  3HGI A;  2Z8Y M;  2K6B A;  3KOY E;  1SXJ A;  1G8P A;  1NO1 A;  5EJC A;  1T43 A;  4IBJ A;  5ITR A;  3GLF E;  4M9X A;  3VKH A;  3GP1 A;  3U6D A;  1T6O A;  1JR3 D;  3CF2 A;  4MGK E;  4LF7 M;  3T15 A;  1IFY A;  2DZO B;  7CAT A;  4LJA A;  1OIP A;  3LCU A;  4CHT B;  3KSX A;  1DGF A;  2R4E A;  4R3D A;  4PCZ A;  1L2B A;  1Y8G A;  2L4E A;  3RFW A;  3QAU A;  2DWN A;  1G71 A;  3UZU A;  1Q3C A;  1HR0 M;  1WGL A;  3AOE A;  3FYD A;  3HJS A;  2JA2 A;  1TH3 A;  2CRU A;  4L78 A;  5F3W A;  3K9O A;  4X66 M;  3RGP A;  3U61 A;  4ANR A;  2XH9 A;  5BPV A;  4G4R A;  1UM8 A;  1VDD A;  2LVP C;  1G41 A;  3R8F A;  1SG9 A;  2QP9 X;  2VQE M;  3GLI A;  4LF8 M;  2P5T A;  3F92 A;  1TH4 A;  1VEG A;  3MK6 A;  2CE7 A;  1TH2 A;  2KZS A;  2MR9 A;  1JR3 A;  1Z6T A;  2EUC A;  4NRV A;  2R45 A;  1AUA A;  5JI2 E;  2WSC F;  1OTR A;  1AIP C;  2LHC A;  2ZTC A;  1XMQ M;  2C99 A;  3GLG E;  1NJF A;  5IWA M;  4AQY M;  2FS1 A;  2UXB M;  4FWG A;  2MGW A;  1L2C A;  4NL4 H;  3C3E A;  5DFL A;  2CV0 A;  4LF4 M;  2G5G X;  3K92 A;  4LF6 M;  4DV6 M;  1W5T A;  5A2Q S;  2ZM6 M;  2DKL A;  3PNV A;  4JI7 M;  3UMM A;  1Z5C A;  2DEN A;  2OPF A;  1YUB A;  2D7H A;  1OAI A;  2J5Y A;  4JXJ A;  1SXJ E;  1DGH B;  4QHT A;  1N33 M;  1QDR A;  4B7G A;  2QBY B;  1C1K A;  3BBZ A;  1IXS A;  1H6U A;  3VKG A;  4MH0 E;  1KSF X;  5DNY A;  2QSF X;  3U6M A;  2F5P A;  2QHO B;  3EIH A;  4LJ5 A;  1Q02 A;  3FE3 A;  2Y0T A;  3D8L A;  4G4N A;  1VDL A;  4FCT A;  3W67 A;  1E9R A;  1WR1 B;  3LQR A;  3SYK A;  2UUA M;  2C9O A;  1WIV A;  2L7H A;  3FTF A;  4DV4 M;  3HJQ A;  4JI2 M;  2WSE F;  3GO8 A;  2R46 A;  3IHP A;  2XZF A;  3J7A S;  2C98 A;  4HEO A;  1ZMW A;  4FD2 A;  3FTE A;  4Q7J A;  4DUZ M;  4MGZ E;  1OQY A;  3FUV A;  3GLI E;  4GKJ M;  2LWX A;  4B3R M;  3GRU A;  2RGO A;  1OAO C;  4Z6Y A;  3A46 A;  1NNJ A;  1JR3 E;  5C1B A;  3ZH9 B;  2Z4S A;  1V33 A;  3HHX A;  1QYR A;  3AL0 C; 
#chains in the Genus database with same CATH homology
 1J09 A;  4FWD A;  4R7G A;  4DV2 M;  4JI5 M;  3L29 A;  5JI3 E;  4DR7 M;  1K82 A;  4FCV A;  2BNK A;  4HL4 A;  2KA6 B;  3FUU A;  2CUZ A;  1E94 E;  3L26 A;  2NQ8 C;  3FUX A;  5KQ8 A;  4PT5 A;  1WXQ A;  3GQ4 A;  5KPR A;  1IBM M;  2CHG A;  4L8R C;  4YHH M;  4JYA M;  1YSY A;  2KEB A;  2L09 A;  3K2L A;  3QWL A;  4OVZ A;  2BJV A;  3J27 B;  4MGY E;  3PXG A;  4LJ7 A;  5IRE B;  4JV5 M;  1SXJ D;  4D82 A;  3TWK A;  1J7K A;  1R6B X;  3W0F A;  4OU7 A;  2Y20 A;  3KOX E;  1IXZ A;  4QNR A;  1IN4 A;  4NOO B;  1IBL M;  5ITQ A;  2UUB M;  5EP3 A;  1NHG C;  4DV1 M;  2ZAO A;  3TPZ A;  2YNM D;  3KW6 A;  4M9S A;  4LZZ A;  2X8A A;  2KZU A;  2QCU A;  4JI6 M;  3D8B A;  5IT9 S;  3MHV C;  4JN6 A;  4LGM A;  2V6Z M;  3PNY A;  3UK6 A;  2Y21 A;  3FTC A;  4AZF A;  1S3S A;  5EXX A;  2KW0 A;  2VQF M;  3CF0 A;  4GIT A;  2X4A A;  3I4V A;  2M5Z A;  4I5S A;  3TQS A;  3TWL A;  3NWL A;  5FTK A;  1HNX M;  4FVM A;  4I4L A;  3FD9 A;  1FNN A;  3TE6 A;  3U6L A;  4NXM M;  3DOA A;  1GLN A;  2F5O A;  2X49 A;  3JR5 A;  3A45 A;  3DFZ A;  2ERC A;  2R4J A;  4GIP A;  1IY1 A;  3FUT A;  3J2P B;  1T3T A;  3HHZ A;  1NSF A;  5LMN M;  1XXH B;  4GKK M;  3J81 S;  1NY6 A;  2FOI C;  2KRU A;  2F5N A;  3LQQ A;  3U6O A;  4MGI E;  4BLC A;  2ZAM A;  4X62 M;  3HKP A;  4L4U A;  4LZJ A;  3H4M A;  5KPZ A;  3ZC7 B;  3A98 B;  3JR4 A;  4DR6 M;  8CAT A;  3RE8 A;  3LVW A;  4WUR A;  4KO8 A;  1W5S A;  3THG A;  2R65 A;  4PD2 A;  4P16 A;  1OFI A;  1GVN A;  4DV5 M;  3GLF B;  1IN5 A;  3SAS A;  2R62 A;  4OX9 M;  3KFU G;  4GMQ A;  4LCB A;  2C96 A;  3M0E A;  4HLQ A;  1D2N A;  2RGH A;  5FTL A;  5H37 D;  1QVR A;  5EP2 A;  3SBJ A;  3U60 B;  4DV3 M;  4RF1 A;  5ITX A;  3AFH A;  1YE9 A;  4JI0 M;  1I4W A;  5EP1 A;  2CV2 A;  4M0W A;  2K47 A;  5ITY A;  3AKZ A;  1ORY B;  4LJ8 A;  2HHH M;  1HT2 E;  2M60 A;  3KOZ E;  3GLH A;  4TUW A;  2YFQ A;  2CEA A;  3KVW A;  3SMS A;  4G4O A;  3K8Z A;  1XMO M;  4AG5 A;  2HKJ A;  1L8Q A;  1GL6 A;  1TDH A;  2XFT A;  2LXE A;  3LVV A;  4DV7 M;  1ZQ9 A;  5FSW A;  1XHB A;  2J7N A;  2J7O A;  3T1H M;  2LH0 A;  1K3W A;  2Y0Q A;  4LFA M;  3GLG B;  4G6Z A;  2DWM A;  3WHL A;  1FJG M;  3GPY A;  2DWZ B;  3SHG B;  4B3M M;  4CGY B;  1GKI A;  3PVS A;  4DR5 M;  4IBG A;  4B08 A;  1TGU A;  3U5Z B;  3B9P A;  4LJ9 A;  1G59 A;  1SXJ C;  4LRS A;  4B3S M;  1SXJ B;  3L2A A;  3SHF A;  5E26 A;  4AG6 A;  3SFZ A;  1KYI A;  4QOS A;  3KP0 E;  1NNU C;  1DGB A;  4JI4 M;  4IJE A;  4B3T M;  2H1R A;  1HQC A;  1MU5 A;  3I51 A;  1JQJ C;  1E32 A;  3TWM A;  1G4A E;  2DHR A;  3GPU A;  5KPT A;  3AOE C;  4AKH A;  2XZU A;  2HL7 A;  1K3X A;  3U61 B;  1IBK M;  1OFH A;  3J7B A;  4GHA A;  1IN6 A;  3KDS E;  3C58 A;  1PM5 A;  2AHM A;  3GLI B;  1N34 M;  4AKG A;  4LG2 A;  4FWH A;  3W0L B;  2XEP A;  3IG5 A;  3FUW A;  1DGH A;  2R18 A;  1XNQ M;  2QBY A;  2OQ4 A;  5LMU M;  2L6O A;  4LFB M;  4KLN A;  4IBD A;  5EQT A;  1E9S A;  3U6P A;  1Q39 A;  2I7N A;  1NVM A;  3VDU A;  4M0D A;  3A42 A;  4NRW A;  5ITT A;  5EP4 A;  1N78 A;  4JI1 M;  2CHQ A;  4I81 A;  1IQP A;  1X37 A;  3U6Q A;  1DO0 A;  3ILK A;  3SAU A;  4MB7 A;  2UXC M;  2F4V M;  2DVW B;  2ZBK B;  1DGG A;  3IG8 A;  1QAQ A;  4ZPX A;  5FTJ A;  3RGS A;  3M7G A;  3KP1 E;  4LFC M;  1IXS B;  4W5W A;  4NXN M;  1NY5 A;  4A3V B;  4XGI A;  1IY0 A;  3HHY A;  1Q3B A;  4IBE A;  1Z5B A;  3GPX A;  4I8O A;  1QQW A;  3AJI B;  5E6J A;  3HHW A;  2XFS A;  4IBC A;  4MGH A;  4MM3 B;  4BBA A;  1HT1 E;  1IN8 A;  3R9X B;  4KOD A;  2CV1 A;  2UUC M;  3U6C A;  2QZ4 A;  1EE8 A;  4NSR A;  4GC9 A;  2XSZ D;  1J5E M;  4ITQ A;  4QHS A;  2HCB A;  4QOZ C;  1QAM A;  3JAM S;  3EIE A;  3HU3 A;  3GPP A;  3BOS A;  4LGY A;  4JI3 M;  4LF9 M;  1MX0 A;  4WW0 A;  1PJI A;  1HNW M;  1ZAE A;  4KHP M;  3HWS A;  3KSJ A;  1I94 M;  1N32 M;  5EXP A;  2D7E A;  4IJF A;  2EA0 A;  1IM2 A;  3PFI A;  3VK8 A;  2UXD M;  4IIW A;  4AKI A;  1IXR C;  1N36 M;  3SMP A;  2DXI A;  4D81 A;  3U6S A;  3TL4 X;  4GRI A;  1OJL A;  4RNA A;  2XSZ A;  3FTD A;  4S12 A;  1HNZ M;  2G8L A;  3FYC A;  4LJ6 A;  4DR2 M;  4FCW A;  2Z7J A;  2Q2E B;  1G3I A;  3KOW E;  3GRV A;  3L28 A;  4OVZ B;  2BJW A;  2YR0 A;  2VII A;  3WHK A;  3GQ3 A;  4OW0 A;  3SAW A;  3VK7 A;  4GHL A;  2F5Q A;  5FTM A;  2EO2 A;  4PDI A;  3KXE C;  2XLJ A;  3ZCB B;  4M9Z A;  4IBB A;  5DYG A;  3MJ5 A;  4YY3 M;  2QPA A;  1Z59 A;  2CHV A;  4G4Q A;  5BR8 M;  3KS4 A;  2E5L M;  3M6A A;  2ZAN A;  2C5R A;  3SAT A;  3KS8 A;  4NSO B;  3SAV A;  5EXS A;  3L25 A;  2C9C A;  4CIS A;  2Z4R A;  3DZD A;  4L15 A;  4X65 M;  3LMM A;  2L7I A;  1XXH A;  2XF3 A;  4X64 M;  4LY6 A;  4REZ A;  4K0K M;  1DO2 A;  4EIW A;  1QAN A;  1Z5A A;  5ITX E;  4PDG A;  3CF6 E;  3DA1 A;  1LV7 A;  2DZN B;  5ITU A;  3K1J A;  4DR4 M;  1NHW C;  1NJG A;  4DR3 M;  4B7F A;  4AI6 A;  1IN7 A;  3UGJ A;  1QAO A;  3GLF A;  4IBI A;  3SC3 A;  2FNA A;  1XWI A;  2KRK A;  3T38 A;  3HU1 A;  4FW9 A;  3U6D A;  3VDP A;  4GH9 A;  2FE8 A;  3FKE A;  4Z8X A;  3GQ5 A;  2QEN A;  1IY2 A;  4GC5 A;  4L16 A;  3U60 A;  2UU9 M;  4IBF A;  3I4Y A;  2F5S A;  1HQY E;  1TDZ A;  2Z3X A;  2FFJ A;  4LRT A;  4LF5 M;  3AOG A;  4B7H A;  4DV0 M;  5KO3 A;  3CTW B;  3VLF B;  1PJJ A;  2DWL A;  3E9S A;  3SYL A;  2I7P A;  1L1T A;  2W82 A;  4DUY M;  3AV0 A;  3GRY A;  3VFD A;  2LNH C;  1L2D A;  2O5R A;  4QNM A;  3Q8X A;  4XBO A;  3J80 S;  5GKN A;  5IZ7 D;  3OTO M;  3NBI A;  2KXE A;  1XNR M;  1QZM A;  3U6E A;  5FLX S;  1GL7 A;  2V1U A;  3E4R A;  1N77 A;  3HU2 A;  3SAR A;  3HJ8 A;  4BB9 A;  2RKO A;  3GRR A;  2A5Y B;  5DYI A;  5KQD A;  2D7G A;  5EXT A;  2CFO A;  4IBK A;  4AW4 A;  3GLG A;  1R2Z A;  3L27 A;  5C18 A;  1XC8 A;  1L1Z A;  3GLH B;  4II7 A;  4RF0 A;  1N75 A;  4D80 A;  2V1C A;  1R2Y A;  1KFV A;  3UJN A;  3T1Y M;  4JI8 M;  4LJ4 A;  4DR1 M;  3U5Z A;  2YQZ A;  2XGN A;  5FTN A;  1R7R A;  3HGI A;  3KOY E;  1SXJ A;  1G8P A;  5EJC A;  3VKH A;  4IBJ A;  5ITR A;  4M9X A;  3GP1 A;  1JR3 D;  3CF2 A;  4MGK E;  4LF7 M;  3T15 A;  2DZO B;  7CAT A;  4LJA A;  4CHT B;  3KSX A;  1DGF A;  2R4E A;  4R3D A;  4PCZ A;  1L2B A;  3RFW A;  3QAU A;  2DWN A;  3UZU A;  1Q3C A;  1HR0 M;  3AOE A;  3FYD A;  3HJS A;  2JA2 A;  1TH3 A;  4L78 A;  5F3W A;  4X66 M;  3RGP A;  3U61 A;  2XH9 A;  5BPV A;  4G4R A;  1UM8 A;  1VDD A;  3R8F A;  1G41 A;  2QP9 X;  2VQE M;  3GLI A;  4LF8 M;  2P5T A;  1TH4 A;  3MK6 A;  2CE7 A;  1TH2 A;  2KZS A;  1JR3 A;  1Z6T A;  2EUC A;  4NRV A;  2R45 A;  5JI2 E;  1XMQ M;  2C99 A;  1NJF A;  5IWA M;  4AQY M;  2UXB M;  4FWG A;  1L2C A;  4NL4 H;  4LF4 M;  2CV0 A;  2G5G X;  3K92 A;  4LF6 M;  4DV6 M;  1W5T A;  5A2Q S;  2ZM6 M;  3PNV A;  4JI7 M;  3UMM A;  1Z5C A;  2OPF A;  1YUB A;  2D7H A;  4JXJ A;  1SXJ E;  1DGH B;  4QHT A;  1N33 M;  4B7G A;  2QBY B;  1C1K A;  1H6U A;  3VKG A;  4MH0 E;  1KSF X;  5DNY A;  3U6M A;  2F5P A;  3EIH A;  4LJ5 A;  2Y0T A;  3D8L A;  4G4N A;  4FCT A;  1E9R A;  3LQR A;  3SYK A;  2UUA M;  2C9O A;  2L7H A;  3FTF A;  4DV4 M;  3HJQ A;  4JI2 M;  3GO8 A;  2R46 A;  2XZF A;  3J7A S;  2C98 A;  4FD2 A;  3FTE A;  4DUZ M;  4MGZ E;  3FUV A;  4GKJ M;  2LWX A;  4B3R M;  3GRU A;  2RGO A;  4Z6Y A;  3A46 A;  1NNJ A;  5C1B A;  3ZH9 B;  2Z4S A;  3HHX A;  1QYR A;  3AL0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...