4X64M

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
118
structure length
118
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4x64M01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 4x64M02
3GQ5A 2E5LM 5ITRA 2HHHM 4YHHM 4DR2M 3U6LA 3DOAA 1Q3CA 1J5EM 1L2DA 1IBLM 3TWMA 3JAMS 2F4VM 4DR7M 3VK7A 4LFBM 2HKJA 4PDIA 3GQ4A 1I94M 5ITUA 3U6PA 4DR1M 4LFCM 2F5OA 1L1TA 1N32M 4G4QA 4LF9M 4JI3M 1MU5A 3TWLA 4CISA 3JR4A 1K3XA 1XC8A 4DV2M 1L2BA 3U6OA 3VK8A 1Q3BA 4JI5M 3GPPA 1L1ZA 4LFAM 4LF4M 3SARA 4PD2A 2UUBM 4DV6M 1FJGM 4NRVA 4DV4M 3J80S 3U6MA 1XNQM 1IBKM 4DV7M 3OTOM 3J81S 3U6CA 2UUAM 4B3SM 2XZFA 4LF5M 4X62M 5LMNM 1XMQM 4JI0M 4G4OA 4DV3M 1N36M 3A45A 2F5SA 3SAUA 4G4RA 4B3RM 1R2ZA 2ZBKB 5LMUM 3C58A 3U6QA 1PM5A 1PJJA 3U6DA 5ITQA 4DUYM 2VQFM 1NNJA 5ITXE 1TDZA 4KHPM 3W0FA 1Z5AA 5ITYA 2UUCM 4DR4M 2OPFA 4B3TM 2UXCM 5IT9S 1TDHA 2F5NA 4NXNM 1XMOM 4DV1M 1L2CA 3SAWA 1R2YA 5ITXA 2F5PA 4AQYM 4PDGA 3GPYA 4X66M 3GPUA 2ZM6M 1HNZM 4NRWA 4GKKM 1N33M 4JI8M 3GO8A 1HNWM 4JI1M 4LF7M 2F5QA 5ITTA 1K3WA 1XNRM 2OQ4A 1Z5CA 3SAVA 4NXMM 5FLXS 2UXBM 4DR3M 3A46A 1KFVA 1PJIA 4JI6M 4X65M 2UXDM 5IWAM 3SATA 4X64M 2UU9M 4JYAM 3TWKA 4DUZM 1N34M 1K82A 5BR8M 2EA0A 4LF8M 2VQEM 1EE8A 1HNXM 4PCZA 4JV5M 1HR0M 4B3MM 1Z5BA 4JI7M 3JR5A 3GPXA 3T1HM 1MX0A 3GP1A 3A42A 4G4NA 4DR6M 4K0KM 3J7AS 4JI4M 2XZUA 3T1YM 1Z59A 1Q39A 1IBMM 4DR5M 3U6SA 4JI2M 4MB7A 4LF6M 5A2QS 3GQ3A 4ITQA 2Q2EB 3U6EA 3SASA 4DV0M 4OX9M 4GKJM 4DV5M 4YY3M 3SBJA
chains in the Genus database with same CATH superfamily
2LXEA 3QYBA 4P16A 2HHHM 1VDLA 2LVOC 2VF8A 4ANRA 2C99A 1I4WA 3LQRA 3U6LA 3VLFB 1D0LA 3PVSA 4LJ9A 2DVWB 3VK7A 4LFBM 1OIPA 1OKSA 4IBBA 3HJSA 5E6JA 3T6PA 2DXIA 2J7OA 1IXRC 5ITUA 3GLFA 4AKGA 3U6PA 4LFCM 2F5OA 1GL7A 3PFIA 1RU3A 2DZNB 2CV0A 3HJQA 3HHYA 3SMPA 3ZC7B 2JWSA 3JR4A 3CF2A 3GLFB 4QHSA 2LVPC 4B7FA 3E21A 3U6OA 5FTMA 3GPPA 1G8PA 2DWLA 3U61A 1J7KA 1H6UA 2Z8YM 1XB2B 3QYEA 1Z6TA 2L09A 2UUBM 1GJTA 1GLNA 4IJEA 1NO1A 3MJ5A 3U61B 1OTRA 3E4RA 3NBIA 3E9SA 3M7GA 1GVNA 2JZ0A 2KZUA 4LJ5A 4AZFA 2XZFA 2UUAM 5LMNM 2WSFF 2R46A 2A5YB 4LGYA 1N77A 1V92A 4QNMA 1N36M 2EO2A 3SAUA 3UGJA 5EXXA 5KQDA 5KO3A 1GJSA 1PJJA 2C98A 4P17A 4DUYM 3U6DA 2C96A 5E26A 4IBIA 5C18A 1NHGC 5F3WA 1TDZA 4Y28F 4D81A 4R7GA 3U60A 3CGWA 3I4VA 5DYIA 1WGLA 4GRIA 1VG5A 2OPFA 1NVMA 4B3TM 5IT9S 2DHRA 2L7HA 4GC5A 1DGHA 4IBGA 3AKZA 3CF6E 2BWEA 3HHXA 2CHVA 4AW4A 2MR9A 1R2YA 4G3OA 3BXWA 5ITXA 2LTUA 4TUWA 3GPYA 3UZUA 1C1KA 4GHAA 5KPRA 2D7GA 3TQSA 4NOOB 2JUJA 2LVQD 3IG5A 4JI1M 1WIVA 3RE8A 3V76A 3AJIB 3KOXE 2KA6B 3L28A 4RNAA 1PGYA 2OQ4A 3SAVA 2RGOA 1IN4A 1QUTA 1TF0B 2WZJA 1VQ1A 1SXJC 3R8FA 1QYRA 2CV2A 5IWAM 3KOWE 8CATA 2UU9M 2KEBA 2ZANA 2QZ4A 3H4MA 3GLHE 4HEOA 2EA0A 1EE8A 4GIPA 1G4AE 1XHBA 1WHCA 2KXEA 2BJVA 2KZSA 4LJAA 1JR3D 4JI7M 2VF7A 3KVWA 3GPXA 3J27B 1MX0A 3GP1A 1JR3E 3FRIA 4DR6M 1JQJC 3ZCBB 4JI4M 1QZMA 1Y8GA 2DAGA 2FE8A 4LCBA 2V1CA 4B7GA 4NSRA 3FD9A 2X49A 3MMPA 2EKFA 4QHTA 1TR8A 2APLA 2Q2EB 3A98B 2FH0A 2FOIC 3ZQJA 1MN3A 3GQ5A 5FSWA 1NV9A 2QCUA 2YFQA 1AIPC 4WURA 3HJ8A 2XH9A 4I81A 4MGHA 3ZH9B 1V33A 3GLFE 1LTMA 3BBZA 4L6V6 3KP1E 1HQYE 1OJLA 3DOAA 3AOEC 1J5EM 1YSYA 3KS4A 3JAMS 3TWMA 1FNNA 4MGIE 2F4VM 3UMMA 1DGFA 2FNAA 2G3QA 2HKJA 2Y20A 2KHHA 3GQ4A 2OOAA 2M5ZA 3C3DA 4L15A 3PNVA 1I94M 4EIWA 1KYIA 4LJ4A 1L1TA 2X4AA 1DGGA 1PJTA 4JI3M 1QAMA 3T15A 2CRUA 3SHGB 4CISA 3IG8A 4FCWA 1JR3A 2DZOB 4MM3B 5GKNA 4DBGB 1L2BA 1Q3BA 4JI5M 1L1ZA 1NY5A 1WGNA 2CHQA 1S3SA 2BWBA 3GLGB 4Q7JA 2X8AA 4PD2A 3NWLA 4B08A 3AOGA 3K9OA 2L2DA 2ERCA 3TPZA 1XNQM 1TH3A 4II7A 1IBKM 5DYGA 3U6CA 3B7QA 5FTNA 2QP9X 2R0IA 2MGWA 2LVNC 3I4YA 4QOZC 4FWDA 4AG5A 4G4OA 4CHTB 4G4RA 5EJCA 3RGSA 1R2ZA 1OFIA 1OFHA 1IN7A 4IJFA 4LY6A 3C58A 2G8LA 3GRRA 4LF6M 3FTFA 5ITQA 2C9CA 3B89A 4FWHA 5ITXE 4KHPM 4KODA 5EXSA 4CJ6A 2RGHA 2KRUA 1Z5AA 4GITA 7CATA 2UUCM 3KSXA 4DR4M 4R71A 1AUAA 4GH9A 2UXCM 1CUKA 4FCTA 2XSZA 3UJNA 4NXNM 1XMOM 4LZJA 5IREB 3T38A 3SAWA 1F4IA 1OAIA 4JXJA 3LW5F 1NJGA 2F5PA 4AQYM 3L2AA 2K0BX 4PDGA 2CV1A 1ZMVA 1ZMUA 2R44A 3HY5A 2QHOB 3HWSA 4JI8M 5L8RF 2L4EA 3L25A 3GO8A 2I7PA 2JY7A 2F5QA 1IXSB 4HLQA 1E9SA 2N35A 3HU1A 3LVWA 4XBOA 1YUBA 5FLXS 2UXBM 4DR3M 2L7IA 1T6OA 1G3IA 1PJIA 1T43A 2QQ8A 3SMSA 4X64M 3GLIB 5FTJA 3TWKA 1IY2A 1N34M 5BR8M 2VQEM 3AFHA 1LV7A 2DNAA 1G59A 1IN6A 2DAEA 2XGNA 1HR0M 3TL4X 4B3MM 1Z5BA 4LJ7A 5KPZA 3T1HM 4OW0A 3I04M 2D7HA 3K92A 2KW0A 4QNRA 2O25A 4AG6A 5EP2A 3J7AS 2J5YA 1DV0A 3C3EA 3KSJA 1Q39A 4I4LA 4L8RC 2VDBB 4DR5M 3U6SA 2KNZA 4REZA 2V1UA 2OO9A 4IBEA 2R6FA 2BNKA 3FKEA 5EXTA 4ITQA 4LG2A 4AKIA 2WSEF 3W68A 2CHGA 4LGMA 4B7HA 1N78A 3SC3A 3KDSE 3B7NA 4IBJA 3FTCA 2XF3A 3ILKA 3KOYE 4F1IA 5ITRA 2V6ZM 3C9PA 2P5TA 2Z3XA 3W67A 3HU3A 2JY6B 5EP4A 2DENA 4KT0F 3HHZA 3B7ZA 3H4JA 4DR7M 2L4FA 1IM2A 1Q02A 5FTLA 1XXHB 3CTWB 3U5ZB 1DGBA 4NSOB 3GRVA 2M60A 3HZJA 3LQQA 1YLAA 1XWIA 2LWXA 2KNVA 1GKIA 4FD2A 5C1BA 4DR1M 4JN6A 3FUWA 1N32M 3Q8GA 3KP0E 4G4QA 1VEGA 1IFYA 2DI0A 3J2PB 2JY8A 3D8LA 3M6AA 2JXNA 3FTDA 3VDPA 1XC8A 2DZLA 4DV2M 2GNOA 1C7YA 3MHVC 1HT1E 4LF4M 1X37A 1G41A 4LFAM 2HAKA 3K1JA 4KLNA 2Z4SA 3L26A 3VFDA 2ZTCA 3SARA 4Z8XA 3E46A 1FJGM 2CP8A 1R4GA 3J80S 4RF1A 3U6MA 1OAOC 1VEJA 2C5RA 5JI3E 3OTOM 4B3SM 1HT2E 2YR0A 4X62M 1XMQM 4JI0M 1P3QQ 1QDTA 2CE7A 3LVVA 2MROB 2XSZD 2O01F 1TGUA 4OVZB 3IECA 3KS8A 1VDDA 4B3RM 3LMMA 3K9PA 1NSFA 1NV8A 2XFSA 4D80A 3U6QA 1NNJA 4OX9M 3W0LB 2VQFM 3NBXX 3THGA 1T3TA 2QBYB 2DAKA 2KRKA 3UK6A 3GLGA 2CUZA 4AKHA 2D7EA 2LH0A 2OOBA 5DFLA 1DO2A 4Z6YA 5H37D 2Y0QA 1IY0A 2QNJA 3BOSA 3I01M 1D0KA 1L2CA 4GEWA 1GL6A 2DWNA 2J7NA 4M0DA 2I7NA 3QWLA 1R6BX 2H1RA 2R4EA 3Q8XA 3LCVB 3DA1A 3GPUA 3KW6A 1D2NA 4MGYE 1NJFA 4WP2A 3TE6A 4NRWA 1HNWM 3RFWA 5ITTA 2VIIA 1K3WA 1XNRM 2JP7A 1Z5CA 4NXMM 2HWJA 4FCVA 3A46A 1KFVA 4GMQA 4X65M 5BPVA 2UXDM 1EIJA 3CF0A 4HL4A 2DWZB 1D0MA 2EJSA 1J09A 2ZAOA 1K82A 4IBFA 4IBDA 2B3TA 1HNXM 1NNUC 2RRUA 3FE3A 2LHCA 3FUTA 1UFZA 3JR5A 4L78A 3HGIA 3A42A 1A5TA 5EXPA 2K6BA 4K0KM 1BVSA 1WR1B 1IXSA 1W5SA 3FUXA 3T1YM 1Z59A 1L8QA 1KSFX 2JNHA 2QSFX 1IBMM 2R4JA 1V34A 1XXHE 1ZAEA 2G5GX 2DAMA 5A2QS 2Z7JA 4XGIA 5DNYA 3U6EA 3SASA 3GLIA 4DV0M 4DV5M 4YY3M 2XZUA 4BLCA 2O5RA 3K8ZA 2E5LM 4YHHM 3B74A 4DR2M 2W82A 1SXJA 2LHGA 2ZAMA 4LJ6A 4ZPXA 3WHKA 1Q3CA 2DHYA 1L2DA 3L27A 1IBLM 1QAQA 3SHFA 2NQ8C 1SXJB 4L4UA 1ZQ9A 4PDIA 2EKKA 4WW0A 5FTKA 2EUCA 1DO0A 2KNAA 2Y21A 2HL7A 3VDUA 1PRBA 5EP1A 1VEKA 1QUSA 4AI6A 1GABA 3KOZE 1QZEA 5JI2E 1IXZA 4OU7A 1IN8A 4LJ8A 5EQTA 1IY1A 2LNHC 4LF9M 2JA2A 3EIHA 3IHPA 1JB0F 2R65A 1MU5A 2RKOA 3QAUA 1ZV1A 1E9RA 4QOSA 4UN2B 4W5WA 3TWLA 1K3XA 2CWBA 4G6ZA 2WSCF 1EFUB 4M9ZA 3FUUA 2DAIA 4MH0E 5IZ7D 4NC6A 2XLJA 3VK8A 2H5XA 3AV0A 4I8OA 5EP3A 4FW9A 1W5TA 4IBCA 1SG9A 2LBCA 2GQFA 2R45A 3FYDA 1R7RA 4DV6M 3U60B 1XXHA 3U5ZA 2MH8A 4NRVA 4DV4M 2YNMD 1NY6A 2K9DA 3DZDA 3FYCA 1DGHB 3HX3A 2R62A 3HHWA 4DV7M 2JY5A 2HCBA 3J81S 4LF5M 1TH4A 3AL0C 4LRTA 2CEAA 3GLGE 4D82A 3AOEA 4LZZA 2LVAA 3D8BA 4DV3M 2R18A 3A45A 1HQCA 5KPTA 2F5SA 1HJPA 4M0WA 2ZBKB 5LMUM 1PM5A 2Z4RA 1TH2A 3J7BA 1NHWC 1N75A 3I51A 3W0FA 3R9XB 2JZ1A 4LRSA 5ITYA 3M0EA 4MGZE 4BB9A 1TDHA 2F5NA 1GO5A 1QAOA 1ZMWA 2XFTA 3KXEC 4L16A 3FUVA 4DV1M 1OQYA 1PJQA 1G71A 1QANA 1UM8A 1WXQA 1YE9A 2MJ5B 3VKGA 4X66M 4FWGA 3SYKA 4OVZA 4RKUF 2ZM6M 1HNZM 1QDRA 4GKKM 1N33M 3K2LA 4I5SA 2BJWA 4LF7M 2FS1A 1IN5A 4XK8F 2FFJA 3GRYA 2QPAA 4CGYB 2QBYA 2ZTDA 1OIZA 2CFOA 3DFZA 1QQWA 4JI6M 1PJSA 4GHLA 4FVMA 1E32A 2DKLA 2Y0TA 3SATA 2AHMA 4M9XA 4DUZM 4JYAM 3GRUA 4R3DA 3MK6A 1IQPA 1ORYB 1QVRA 3RGPA 4LF8M 4IIWA 4M9SA 4PCZA 4JV5M 4PT5A 3VKHA 1R5LA 3PNYA 5KQ8A 2XEPA 3WHLA 1TTEA 3KFUG 3SBJA 3GLIE 4RF0A 2K47A 2YQZA 3FRHA 3HU2A 4G4NA 1MJGM 4A3VB 3GLHA 3FTEA 4NL4H 1WJ7A 4S12A 2QENA 4F2LA 3EIEA 3F92A 1SXJD 2KDLA 1E94E 3HKPA 2DWMA 3L29A 3SYLA 4JI2M 4MB7A 1SXJE 3GLHB 3B9PA 4IBKA 3GQ3A 3PXGA 3LCUA 4KO8A 2L6OA 4GC9A 4MGKE 4GKJM 4CIZA 4BBAA 2C9OA 3SFZA
chains in the Genus database with same CATH topology
2LXEA 4P16A 2HHHM 2C99A 1I4WA 3LQRA 3U6LA 3VLFB 3PVSA 4LJ9A 2DVWB 3VK7A 4LFBM 4IBBA 3HJSA 5E6JA 2DXIA 2J7OA 1IXRC 5ITUA 3GLFA 4AKGA 3U6PA 4LFCM 2F5OA 1GL7A 3PFIA 2DZNB 2CV0A 3HJQA 3HHYA 3SMPA 3ZC7B 3JR4A 3GLFB 3CF2A 4QHSA 4B7FA 3U6OA 5FTMA 3GPPA 1G8PA 2DWLA 3U61A 1J7KA 1H6UA 1Z6TA 2L09A 2UUBM 1GLNA 4IJEA 3MJ5A 3U61B 3E4RA 3NBIA 3E9SA 3M7GA 1GVNA 2KZUA 4LJ5A 4AZFA 2XZFA 2UUAM 5LMNM 2R46A 2A5YB 4LGYA 1N77A 1N36M 4QNMA 2EO2A 3SAUA 3UGJA 5EXXA 5KQDA 5KO3A 1PJJA 2C98A 3U6DA 4DUYM 2C96A 5E26A 4IBIA 5C18A 1NHGC 5F3WA 1TDZA 4D81A 4R7GA 3U60A 3I4VA 5DYIA 4GRIA 2OPFA 1NVMA 4B3TM 5IT9S 2DHRA 2L7HA 4GC5A 1DGHA 4IBGA 3AKZA 3CF6E 3HHXA 2CHVA 4AW4A 1R2YA 5ITXA 4TUWA 3GPYA 3UZUA 1C1KA 4GHAA 5KPRA 2D7GA 3TQSA 4NOOB 3IG5A 4JI1M 3RE8A 3AJIB 3KOXE 2KA6B 3L28A 4RNAA 2OQ4A 3SAVA 2RGOA 1IN4A 1SXJC 3R8FA 1QYRA 2CV2A 5IWAM 3KOWE 8CATA 2UU9M 2KEBA 2ZANA 2QZ4A 3H4MA 2EA0A 1EE8A 4GIPA 1G4AE 1XHBA 2KXEA 2BJVA 2KZSA 4LJAA 1JR3D 4JI7M 3KVWA 3GPXA 3J27B 1MX0A 3GP1A 4DR6M 1JQJC 3ZCBB 4JI4M 1QZMA 2FE8A 4LCBA 2V1CA 4B7GA 4NSRA 3FD9A 2X49A 4QHTA 2Q2EB 3A98B 2FOIC 3GQ5A 5FSWA 2YFQA 2QCUA 4WURA 3HJ8A 2XH9A 4I81A 4MGHA 3ZH9B 3KP1E 1HQYE 1OJLA 3DOAA 3AOEC 1J5EM 1YSYA 3KS4A 3JAMS 3TWMA 1FNNA 4MGIE 2F4VM 3UMMA 1DGFA 2FNAA 2HKJA 2Y20A 3GQ4A 2M5ZA 4L15A 3PNVA 1I94M 4EIWA 1KYIA 4LJ4A 1L1TA 2X4AA 1DGGA 4JI3M 1QAMA 3T15A 3SHGB 4CISA 3IG8A 4FCWA 1JR3A 2DZOB 4MM3B 5GKNA 1L2BA 1Q3BA 4JI5M 1L1ZA 1NY5A 2CHQA 1S3SA 3GLGB 2X8AA 4PD2A 3NWLA 4B08A 3AOGA 2ERCA 3TPZA 1XNQM 1TH3A 4II7A 1IBKM 5DYGA 3U6CA 5FTNA 2QP9X 4QOZC 3I4YA 4FWDA 4AG5A 4G4OA 4CHTB 4G4RA 5EJCA 3RGSA 1R2ZA 1OFIA 1OFHA 1IN7A 4IJFA 4LY6A 3C58A 2G8LA 3GRRA 4LF6M 3FTFA 5ITQA 2C9CA 4FWHA 5ITXE 4KHPM 4KODA 5EXSA 2RGHA 2KRUA 1Z5AA 4GITA 7CATA 2UUCM 3KSXA 4DR4M 4GH9A 2UXCM 4FCTA 2XSZA 3UJNA 4NXNM 1XMOM 4LZJA 5IREB 3T38A 3SAWA 4JXJA 1NJGA 2F5PA 4AQYM 3L2AA 2CV1A 4PDGA 3HWSA 4JI8M 3L25A 3GO8A 2I7PA 2F5QA 1IXSB 4HLQA 1E9SA 3HU1A 3LVWA 4XBOA 1YUBA 5FLXS 2UXBM 4DR3M 2L7IA 1G3IA 1PJIA 3SMSA 4X64M 3GLIB 5FTJA 3TWKA 1IY2A 1N34M 5BR8M 2VQEM 3AFHA 1LV7A 1G59A 1IN6A 2XGNA 1HR0M 3TL4X 4B3MM 1Z5BA 4LJ7A 5KPZA 3T1HM 4OW0A 2D7HA 3K92A 2KW0A 4QNRA 4AG6A 3J7AS 5EP2A 3KSJA 1Q39A 4I4LA 4L8RC 4DR5M 3U6SA 4REZA 2V1UA 4IBEA 4AKIA 2BNKA 3FKEA 5EXTA 4ITQA 4LG2A 2CHGA 4LGMA 4B7HA 1N78A 3SC3A 3KDSE 4IBJA 3FTCA 2XF3A 3ILKA 3KOYE 5ITRA 2V6ZM 2P5TA 2Z3XA 3HU3A 5EP4A 3HHZA 4DR7M 1IM2A 5FTLA 1XXHB 3CTWB 3U5ZB 1DGBA 4NSOB 3GRVA 2M60A 3LQQA 1XWIA 2LWXA 1GKIA 4FD2A 5C1BA 4DR1M 4JN6A 3FUWA 1N32M 3KP0E 4G4QA 3J2PB 3D8LA 3M6AA 3VDPA 3FTDA 1XC8A 4DV2M 3MHVC 1HT1E 4LF4M 1X37A 1G41A 4LFAM 3K1JA 3L26A 4KLNA 2Z4SA 3VFDA 3SARA 4Z8XA 1FJGM 3J80S 4RF1A 3U6MA 2C5RA 5JI3E 3OTOM 4B3SM 1HT2E 2YR0A 4X62M 1XMQM 4JI0M 2CE7A 3LVVA 2XSZD 1TGUA 4OVZB 3KS8A 1VDDA 4B3RM 3LMMA 3U6QA 1NSFA 4OX9M 2XFSA 4D80A 1NNJA 3W0LB 2VQFM 2QBYB 1T3TA 2KRKA 3UK6A 3GLGA 2CUZA 4AKHA 2D7EA 2LH0A 1DO2A 4Z6YA 5H37D 2Y0QA 1IY0A 3BOSA 1L2CA 1GL6A 2DWNA 2J7NA 4M0DA 2I7NA 3QWLA 1R6BX 2H1RA 2R4EA 3Q8XA 3DA1A 3GPUA 3KW6A 1D2NA 4MGYE 1NJFA 3TE6A 4NRWA 1HNWM 3RFWA 5ITTA 2VIIA 1K3WA 1XNRM 1Z5CA 4NXMM 1KFVA 4FCVA 3A46A 4GMQA 4X65M 5BPVA 2UXDM 3CF0A 4HL4A 2DWZB 1J09A 2ZAOA 1K82A 4IBFA 4IBDA 1HNXM 1NNUC 3FUTA 3JR5A 4L78A 3HGIA 3A42A 5EXPA 4K0KM 1W5SA 3FUXA 3T1YM 1Z59A 1L8QA 1KSFX 1IBMM 2R4JA 1ZAEA 2G5GX 5A2QS 2Z7JA 4XGIA 5DNYA 3U6EA 3SASA 3GLIA 4DV0M 4DV5M 4YY3M 2XZUA 4BLCA 2O5RA 3K8ZA 2E5LM 4YHHM 4DR2M 2W82A 1SXJA 2ZAMA 4LJ6A 4ZPXA 3WHKA 1Q3CA 1L2DA 3L27A 1IBLM 1QAQA 3SHFA 2NQ8C 1SXJB 4L4UA 1ZQ9A 4PDIA 4WW0A 5FTKA 2EUCA 1DO0A 2Y21A 3VDUA 2HL7A 5EP1A 4AI6A 3KOZE 4OU7A 5JI2E 1IXZA 1IN8A 4LJ8A 5EQTA 1IY1A 2LNHC 4LF9M 2JA2A 3EIHA 3QAUA 2R65A 3THGA 1MU5A 2RKOA 3TWLA 4W5WA 1E9RA 4QOSA 1K3XA 4G6ZA 2XLJA 4M9ZA 3FUUA 4MH0E 5IZ7D 3VK8A 3AV0A 4I8OA 5EP3A 4FW9A 1W5TA 4IBCA 2R45A 3FYDA 3U60B 1R7RA 4DV6M 1XXHA 3U5ZA 4NRVA 4DV4M 2YNMD 1NY6A 3DZDA 3FYCA 1DGHB 2R62A 3HHWA 4DV7M 3AL0C 2HCBA 3J81S 4LF5M 1TH4A 4LRTA 2CEAA 4D82A 3AOEA 4LZZA 3D8BA 4DV3M 2R18A 3A45A 1HQCA 5KPTA 2F5SA 4M0WA 2ZBKB 5LMUM 1PM5A 2Z4RA 1TH2A 3J7BA 1NHWC 1N75A 3I51A 3W0FA 3R9XB 4LRSA 5ITYA 3M0EA 4MGZE 4BB9A 1TDHA 2F5NA 1QAOA 4L16A 2XFTA 3KXEC 3FUVA 4DV1M 1QANA 1UM8A 1WXQA 1YE9A 3VKGA 4X66M 4FWGA 3SYKA 4OVZA 2ZM6M 1HNZM 4GKKM 1N33M 3K2LA 4I5SA 2BJWA 4LF7M 1IN5A 2FFJA 3GRYA 2QPAA 4CGYB 2QBYA 2CFOA 3DFZA 1QQWA 4JI6M 4GHLA 4FVMA 1E32A 2Y0TA 3SATA 2AHMA 4M9XA 4DUZM 4JYAM 3GRUA 4R3DA 3MK6A 1IQPA 1ORYB 1QVRA 3RGPA 4LF8M 4IIWA 4M9SA 4PCZA 4JV5M 4PT5A 3VKHA 3PNYA 5KQ8A 2XEPA 3WHLA 3KFUG 3SBJA 4RF0A 2K47A 2YQZA 3HU2A 4G4NA 4A3VB 3GLHA 3FTEA 4NL4H 4S12A 2QENA 3EIEA 1SXJD 1E94E 3HKPA 2DWMA 3L29A 3SYLA 4JI2M 4MB7A 1SXJE 3GLHB 3B9PA 4IBKA 3GQ3A 3PXGA 4KO8A 2L6OA 4GC9A 4MGKE 4GKJM 4BBAA 2C9OA 3SFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQ5 A;  2E5L M;  5ITR A;  2HHH M;  4YHH M;  4DR2 M;  3U6L A;  3DOA A;  1Q3C A;  1J5E M;  1L2D A;  1IBL M;  3TWM A;  3JAM S;  2F4V M;  4DR7 M;  3VK7 A;  4LFB M;  2HKJ A;  4PDI A;  3GQ4 A;  1I94 M;  5ITU A;  3U6P A;  4DR1 M;  4LFC M;  2F5O A;  1L1T A;  1N32 M;  4G4Q A;  4LF9 M;  4JI3 M;  1MU5 A;  3TWL A;  4CIS A;  3JR4 A;  1K3X A;  1XC8 A;  4DV2 M;  1L2B A;  3U6O A;  3VK8 A;  1Q3B A;  4JI5 M;  3GPP A;  1L1Z A;  4LFA M;  4LF4 M;  3SAR A;  4PD2 A;  2UUB M;  4DV6 M;  1FJG M;  4NRV A;  4DV4 M;  3J80 S;  3U6M A;  1XNQ M;  1IBK M;  4DV7 M;  3OTO M;  3J81 S;  3U6C A;  2UUA M;  4B3S M;  2XZF A;  4LF5 M;  4X62 M;  5LMN M;  1XMQ M;  4JI0 M;  4G4O A;  4DV3 M;  1N36 M;  3A45 A;  2F5S A;  3SAU A;  4G4R A;  4B3R M;  1R2Z A;  2ZBK B;  5LMU M;  3C58 A;  3U6Q A;  1PM5 A;  1PJJ A;  3U6D A;  5ITQ A;  4DUY M;  2VQF M;  1NNJ A;  5ITX E;  1TDZ A;  4KHP M;  3W0F A;  1Z5A A;  5ITY A;  2UUC M;  4DR4 M;  2OPF A;  4B3T M;  2UXC M;  5IT9 S;  1TDH A;  2F5N A;  4NXN M;  1XMO M;  4DV1 M;  1L2C A;  3SAW A;  1R2Y A;  5ITX A;  2F5P A;  4AQY M;  4PDG A;  3GPY A;  4X66 M;  3GPU A;  2ZM6 M;  1HNZ M;  4NRW A;  4GKK M;  1N33 M;  4JI8 M;  3GO8 A;  1HNW M;  4JI1 M;  4LF7 M;  2F5Q A;  5ITT A;  1K3W A;  1XNR M;  2OQ4 A;  1Z5C A;  3SAV A;  4NXM M;  5FLX S;  2UXB M;  4DR3 M;  3A46 A;  1KFV A;  1PJI A;  4JI6 M;  4X65 M;  2UXD M;  5IWA M;  3SAT A;  4X64 M;  2UU9 M;  4JYA M;  3TWK A;  4DUZ M;  1N34 M;  1K82 A;  5BR8 M;  2EA0 A;  4LF8 M;  2VQE M;  1EE8 A;  1HNX M;  4PCZ A;  4JV5 M;  1HR0 M;  4B3M M;  1Z5B A;  4JI7 M;  3JR5 A;  3GPX A;  3T1H M;  1MX0 A;  3GP1 A;  3A42 A;  4G4N A;  4DR6 M;  4K0K M;  3J7A S;  4JI4 M;  2XZU A;  3T1Y M;  1Z59 A;  1Q39 A;  1IBM M;  4DR5 M;  3U6S A;  4JI2 M;  4MB7 A;  4LF6 M;  5A2Q S;  3GQ3 A;  4ITQ A;  2Q2E B;  3U6E A;  3SAS A;  4DV0 M;  4OX9 M;  4GKJ M;  4DV5 M;  4YY3 M;  3SBJ A; 
#chains in the Genus database with same CATH topology
 2LXE A;  3QYB A;  4P16 A;  2HHH M;  1VDL A;  2LVO C;  2VF8 A;  4ANR A;  2C99 A;  1I4W A;  3LQR A;  3U6L A;  3VLF B;  1D0L A;  3PVS A;  4LJ9 A;  2DVW B;  3VK7 A;  4LFB M;  1OIP A;  1OKS A;  4IBB A;  3HJS A;  5E6J A;  3T6P A;  2DXI A;  2J7O A;  1IXR C;  5ITU A;  3GLF A;  4AKG A;  3U6P A;  4LFC M;  2F5O A;  1GL7 A;  3PFI A;  1RU3 A;  2DZN B;  2CV0 A;  3HJQ A;  3HHY A;  3SMP A;  3ZC7 B;  2JWS A;  3JR4 A;  3CF2 A;  3GLF B;  4QHS A;  2LVP C;  4B7F A;  3E21 A;  3U6O A;  5FTM A;  3GPP A;  1G8P A;  2DWL A;  3U61 A;  1J7K A;  1H6U A;  2Z8Y M;  1XB2 B;  3QYE A;  1Z6T A;  2L09 A;  2UUB M;  1GJT A;  1GLN A;  4IJE A;  1NO1 A;  3MJ5 A;  3U61 B;  1OTR A;  3E4R A;  3NBI A;  3E9S A;  3M7G A;  1GVN A;  2JZ0 A;  2KZU A;  4LJ5 A;  4AZF A;  2XZF A;  2UUA M;  5LMN M;  2WSF F;  2R46 A;  2A5Y B;  4LGY A;  1N77 A;  1V92 A;  4QNM A;  1N36 M;  2EO2 A;  3SAU A;  3UGJ A;  5EXX A;  5KQD A;  5KO3 A;  1GJS A;  1PJJ A;  2C98 A;  4P17 A;  4DUY M;  3U6D A;  2C96 A;  5E26 A;  4IBI A;  5C18 A;  1NHG C;  5F3W A;  1TDZ A;  4Y28 F;  4D81 A;  4R7G A;  3U60 A;  3CGW A;  3I4V A;  5DYI A;  1WGL A;  4GRI A;  1VG5 A;  2OPF A;  1NVM A;  4B3T M;  5IT9 S;  2DHR A;  2L7H A;  4GC5 A;  1DGH A;  4IBG A;  3AKZ A;  3CF6 E;  2BWE A;  3HHX A;  2CHV A;  4AW4 A;  2MR9 A;  1R2Y A;  4G3O A;  3BXW A;  5ITX A;  2LTU A;  4TUW A;  3GPY A;  3UZU A;  1C1K A;  4GHA A;  5KPR A;  2D7G A;  3TQS A;  4NOO B;  2JUJ A;  2LVQ D;  3IG5 A;  4JI1 M;  1WIV A;  3RE8 A;  3V76 A;  3AJI B;  3KOX E;  2KA6 B;  3L28 A;  4RNA A;  1PGY A;  2OQ4 A;  3SAV A;  2RGO A;  1IN4 A;  1QUT A;  1TF0 B;  2WZJ A;  1VQ1 A;  1SXJ C;  3R8F A;  1QYR A;  2CV2 A;  5IWA M;  3KOW E;  8CAT A;  2UU9 M;  2KEB A;  2ZAN A;  2QZ4 A;  3H4M A;  3GLH E;  4HEO A;  2EA0 A;  1EE8 A;  4GIP A;  1G4A E;  1XHB A;  1WHC A;  2KXE A;  2BJV A;  2KZS A;  4LJA A;  1JR3 D;  4JI7 M;  2VF7 A;  3KVW A;  3GPX A;  3J27 B;  1MX0 A;  3GP1 A;  1JR3 E;  3FRI A;  4DR6 M;  1JQJ C;  3ZCB B;  4JI4 M;  1QZM A;  1Y8G A;  2DAG A;  2FE8 A;  4LCB A;  2V1C A;  4B7G A;  4NSR A;  3FD9 A;  2X49 A;  3MMP A;  2EKF A;  4QHT A;  1TR8 A;  2APL A;  2Q2E B;  3A98 B;  2FH0 A;  2FOI C;  3ZQJ A;  1MN3 A;  3GQ5 A;  5FSW A;  1NV9 A;  2QCU A;  2YFQ A;  1AIP C;  4WUR A;  3HJ8 A;  2XH9 A;  4I81 A;  4MGH A;  3ZH9 B;  1V33 A;  3GLF E;  1LTM A;  3BBZ A;  4L6V 6;  3KP1 E;  1HQY E;  1OJL A;  3DOA A;  3AOE C;  1J5E M;  1YSY A;  3KS4 A;  3JAM S;  3TWM A;  1FNN A;  4MGI E;  2F4V M;  3UMM A;  1DGF A;  2FNA A;  2G3Q A;  2HKJ A;  2Y20 A;  2KHH A;  3GQ4 A;  2OOA A;  2M5Z A;  3C3D A;  4L15 A;  3PNV A;  1I94 M;  4EIW A;  1KYI A;  4LJ4 A;  1L1T A;  2X4A A;  1DGG A;  1PJT A;  4JI3 M;  1QAM A;  3T15 A;  2CRU A;  3SHG B;  4CIS A;  3IG8 A;  4FCW A;  1JR3 A;  2DZO B;  4MM3 B;  5GKN A;  4DBG B;  1L2B A;  1Q3B A;  4JI5 M;  1L1Z A;  1NY5 A;  1WGN A;  2CHQ A;  1S3S A;  2BWB A;  3GLG B;  4Q7J A;  2X8A A;  4PD2 A;  3NWL A;  4B08 A;  3AOG A;  3K9O A;  2L2D A;  2ERC A;  3TPZ A;  1XNQ M;  1TH3 A;  4II7 A;  1IBK M;  5DYG A;  3U6C A;  3B7Q A;  5FTN A;  2QP9 X;  2R0I A;  2MGW A;  2LVN C;  3I4Y A;  4QOZ C;  4FWD A;  4AG5 A;  4G4O A;  4CHT B;  4G4R A;  5EJC A;  3RGS A;  1R2Z A;  1OFI A;  1OFH A;  1IN7 A;  4IJF A;  4LY6 A;  3C58 A;  2G8L A;  3GRR A;  4LF6 M;  3FTF A;  5ITQ A;  2C9C A;  3B89 A;  4FWH A;  5ITX E;  4KHP M;  4KOD A;  5EXS A;  4CJ6 A;  2RGH A;  2KRU A;  1Z5A A;  4GIT A;  7CAT A;  2UUC M;  3KSX A;  4DR4 M;  4R71 A;  1AUA A;  4GH9 A;  2UXC M;  1CUK A;  4FCT A;  2XSZ A;  3UJN A;  4NXN M;  1XMO M;  4LZJ A;  5IRE B;  3T38 A;  3SAW A;  1F4I A;  1OAI A;  4JXJ A;  3LW5 F;  1NJG A;  2F5P A;  4AQY M;  3L2A A;  2K0B X;  4PDG A;  2CV1 A;  1ZMV A;  1ZMU A;  2R44 A;  3HY5 A;  2QHO B;  3HWS A;  4JI8 M;  5L8R F;  2L4E A;  3L25 A;  3GO8 A;  2I7P A;  2JY7 A;  2F5Q A;  1IXS B;  4HLQ A;  1E9S A;  2N35 A;  3HU1 A;  3LVW A;  4XBO A;  1YUB A;  5FLX S;  2UXB M;  4DR3 M;  2L7I A;  1T6O A;  1G3I A;  1PJI A;  1T43 A;  2QQ8 A;  3SMS A;  4X64 M;  3GLI B;  5FTJ A;  3TWK A;  1IY2 A;  1N34 M;  5BR8 M;  2VQE M;  3AFH A;  1LV7 A;  2DNA A;  1G59 A;  1IN6 A;  2DAE A;  2XGN A;  1HR0 M;  3TL4 X;  4B3M M;  1Z5B A;  4LJ7 A;  5KPZ A;  3T1H M;  4OW0 A;  3I04 M;  2D7H A;  3K92 A;  2KW0 A;  4QNR A;  2O25 A;  4AG6 A;  5EP2 A;  3J7A S;  2J5Y A;  1DV0 A;  3C3E A;  3KSJ A;  1Q39 A;  4I4L A;  4L8R C;  2VDB B;  4DR5 M;  3U6S A;  2KNZ A;  4REZ A;  2V1U A;  2OO9 A;  4IBE A;  2R6F A;  2BNK A;  3FKE A;  5EXT A;  4ITQ A;  4LG2 A;  4AKI A;  2WSE F;  3W68 A;  2CHG A;  4LGM A;  4B7H A;  1N78 A;  3SC3 A;  3KDS E;  3B7N A;  4IBJ A;  3FTC A;  2XF3 A;  3ILK A;  3KOY E;  4F1I A;  5ITR A;  2V6Z M;  3C9P A;  2P5T A;  2Z3X A;  3W67 A;  3HU3 A;  2JY6 B;  5EP4 A;  2DEN A;  4KT0 F;  3HHZ A;  3B7Z A;  3H4J A;  4DR7 M;  2L4F A;  1IM2 A;  1Q02 A;  5FTL A;  1XXH B;  3CTW B;  3U5Z B;  1DGB A;  4NSO B;  3GRV A;  2M60 A;  3HZJ A;  3LQQ A;  1YLA A;  1XWI A;  2LWX A;  2KNV A;  1GKI A;  4FD2 A;  5C1B A;  4DR1 M;  4JN6 A;  3FUW A;  1N32 M;  3Q8G A;  3KP0 E;  4G4Q A;  1VEG A;  1IFY A;  2DI0 A;  3J2P B;  2JY8 A;  3D8L A;  3M6A A;  2JXN A;  3FTD A;  3VDP A;  1XC8 A;  2DZL A;  4DV2 M;  2GNO A;  1C7Y A;  3MHV C;  1HT1 E;  4LF4 M;  1X37 A;  1G41 A;  4LFA M;  2HAK A;  3K1J A;  4KLN A;  2Z4S A;  3L26 A;  3VFD A;  2ZTC A;  3SAR A;  4Z8X A;  3E46 A;  1FJG M;  2CP8 A;  1R4G A;  3J80 S;  4RF1 A;  3U6M A;  1OAO C;  1VEJ A;  2C5R A;  5JI3 E;  3OTO M;  4B3S M;  1HT2 E;  2YR0 A;  4X62 M;  1XMQ M;  4JI0 M;  1P3Q Q;  1QDT A;  2CE7 A;  3LVV A;  2MRO B;  2XSZ D;  2O01 F;  1TGU A;  4OVZ B;  3IEC A;  3KS8 A;  1VDD A;  4B3R M;  3LMM A;  3K9P A;  1NSF A;  1NV8 A;  2XFS A;  4D80 A;  3U6Q A;  1NNJ A;  4OX9 M;  3W0L B;  2VQF M;  3NBX X;  3THG A;  1T3T A;  2QBY B;  2DAK A;  2KRK A;  3UK6 A;  3GLG A;  2CUZ A;  4AKH A;  2D7E A;  2LH0 A;  2OOB A;  5DFL A;  1DO2 A;  4Z6Y A;  5H37 D;  2Y0Q A;  1IY0 A;  2QNJ A;  3BOS A;  3I01 M;  1D0K A;  1L2C A;  4GEW A;  1GL6 A;  2DWN A;  2J7N A;  4M0D A;  2I7N A;  3QWL A;  1R6B X;  2H1R A;  2R4E A;  3Q8X A;  3LCV B;  3DA1 A;  3GPU A;  3KW6 A;  1D2N A;  4MGY E;  1NJF A;  4WP2 A;  3TE6 A;  4NRW A;  1HNW M;  3RFW A;  5ITT A;  2VII A;  1K3W A;  1XNR M;  2JP7 A;  1Z5C A;  4NXM M;  2HWJ A;  4FCV A;  3A46 A;  1KFV A;  4GMQ A;  4X65 M;  5BPV A;  2UXD M;  1EIJ A;  3CF0 A;  4HL4 A;  2DWZ B;  1D0M A;  2EJS A;  1J09 A;  2ZAO A;  1K82 A;  4IBF A;  4IBD A;  2B3T A;  1HNX M;  1NNU C;  2RRU A;  3FE3 A;  2LHC A;  3FUT A;  1UFZ A;  3JR5 A;  4L78 A;  3HGI A;  3A42 A;  1A5T A;  5EXP A;  2K6B A;  4K0K M;  1BVS A;  1WR1 B;  1IXS A;  1W5S A;  3FUX A;  3T1Y M;  1Z59 A;  1L8Q A;  1KSF X;  2JNH A;  2QSF X;  1IBM M;  2R4J A;  1V34 A;  1XXH E;  1ZAE A;  2G5G X;  2DAM A;  5A2Q S;  2Z7J A;  4XGI A;  5DNY A;  3U6E A;  3SAS A;  3GLI A;  4DV0 M;  4DV5 M;  4YY3 M;  2XZU A;  4BLC A;  2O5R A;  3K8Z A;  2E5L M;  4YHH M;  3B74 A;  4DR2 M;  2W82 A;  1SXJ A;  2LHG A;  2ZAM A;  4LJ6 A;  4ZPX A;  3WHK A;  1Q3C A;  2DHY A;  1L2D A;  3L27 A;  1IBL M;  1QAQ A;  3SHF A;  2NQ8 C;  1SXJ B;  4L4U A;  1ZQ9 A;  4PDI A;  2EKK A;  4WW0 A;  5FTK A;  2EUC A;  1DO0 A;  2KNA A;  2Y21 A;  2HL7 A;  3VDU A;  1PRB A;  5EP1 A;  1VEK A;  1QUS A;  4AI6 A;  1GAB A;  3KOZ E;  1QZE A;  5JI2 E;  1IXZ A;  4OU7 A;  1IN8 A;  4LJ8 A;  5EQT A;  1IY1 A;  2LNH C;  4LF9 M;  2JA2 A;  3EIH A;  3IHP A;  1JB0 F;  2R65 A;  1MU5 A;  2RKO A;  3QAU A;  1ZV1 A;  1E9R A;  4QOS A;  4UN2 B;  4W5W A;  3TWL A;  1K3X A;  2CWB A;  4G6Z A;  2WSC F;  1EFU B;  4M9Z A;  3FUU A;  2DAI A;  4MH0 E;  5IZ7 D;  4NC6 A;  2XLJ A;  3VK8 A;  2H5X A;  3AV0 A;  4I8O A;  5EP3 A;  4FW9 A;  1W5T A;  4IBC A;  1SG9 A;  2LBC A;  2GQF A;  2R45 A;  3FYD A;  1R7R A;  4DV6 M;  3U60 B;  1XXH A;  3U5Z A;  2MH8 A;  4NRV A;  4DV4 M;  2YNM D;  1NY6 A;  2K9D A;  3DZD A;  3FYC A;  1DGH B;  3HX3 A;  2R62 A;  3HHW A;  4DV7 M;  2JY5 A;  2HCB A;  3J81 S;  4LF5 M;  1TH4 A;  3AL0 C;  4LRT A;  2CEA A;  3GLG E;  4D82 A;  3AOE A;  4LZZ A;  2LVA A;  3D8B A;  4DV3 M;  2R18 A;  3A45 A;  1HQC A;  5KPT A;  2F5S A;  1HJP A;  4M0W A;  2ZBK B;  5LMU M;  1PM5 A;  2Z4R A;  1TH2 A;  3J7B A;  1NHW C;  1N75 A;  3I51 A;  3W0F A;  3R9X B;  2JZ1 A;  4LRS A;  5ITY A;  3M0E A;  4MGZ E;  4BB9 A;  1TDH A;  2F5N A;  1GO5 A;  1QAO A;  1ZMW A;  2XFT A;  3KXE C;  4L16 A;  3FUV A;  4DV1 M;  1OQY A;  1PJQ A;  1G71 A;  1QAN A;  1UM8 A;  1WXQ A;  1YE9 A;  2MJ5 B;  3VKG A;  4X66 M;  4FWG A;  3SYK A;  4OVZ A;  4RKU F;  2ZM6 M;  1HNZ M;  1QDR A;  4GKK M;  1N33 M;  3K2L A;  4I5S A;  2BJW A;  4LF7 M;  2FS1 A;  1IN5 A;  4XK8 F;  2FFJ A;  3GRY A;  2QPA A;  4CGY B;  2QBY A;  2ZTD A;  1OIZ A;  2CFO A;  3DFZ A;  1QQW A;  4JI6 M;  1PJS A;  4GHL A;  4FVM A;  1E32 A;  2DKL A;  2Y0T A;  3SAT A;  2AHM A;  4M9X A;  4DUZ M;  4JYA M;  3GRU A;  4R3D A;  3MK6 A;  1IQP A;  1ORY B;  1QVR A;  3RGP A;  4LF8 M;  4IIW A;  4M9S A;  4PCZ A;  4JV5 M;  4PT5 A;  3VKH A;  1R5L A;  3PNY A;  5KQ8 A;  2XEP A;  3WHL A;  1TTE A;  3KFU G;  3SBJ A;  3GLI E;  4RF0 A;  2K47 A;  2YQZ A;  3FRH A;  3HU2 A;  4G4N A;  1MJG M;  4A3V B;  3GLH A;  3FTE A;  4NL4 H;  1WJ7 A;  4S12 A;  2QEN A;  4F2L A;  3EIE A;  3F92 A;  1SXJ D;  2KDL A;  1E94 E;  3HKP A;  2DWM A;  3L29 A;  3SYL A;  4JI2 M;  4MB7 A;  1SXJ E;  3GLH B;  3B9P A;  4IBK A;  3GQ3 A;  3PXG A;  3LCU A;  4KO8 A;  2L6O A;  4GC9 A;  4MGK E;  4GKJ M;  4CIZ A;  4BBA A;  2C9O A;  3SFZ A; 
#chains in the Genus database with same CATH homology
 2LXE A;  4P16 A;  2HHH M;  2C99 A;  1I4W A;  3LQR A;  3U6L A;  3VLF B;  3PVS A;  4LJ9 A;  2DVW B;  3VK7 A;  4LFB M;  4IBB A;  3HJS A;  5E6J A;  2DXI A;  2J7O A;  1IXR C;  5ITU A;  3GLF A;  4AKG A;  3U6P A;  4LFC M;  2F5O A;  1GL7 A;  3PFI A;  2DZN B;  2CV0 A;  3HJQ A;  3HHY A;  3SMP A;  3ZC7 B;  3JR4 A;  3GLF B;  3CF2 A;  4QHS A;  4B7F A;  3U6O A;  5FTM A;  3GPP A;  1G8P A;  2DWL A;  3U61 A;  1J7K A;  1H6U A;  1Z6T A;  2L09 A;  2UUB M;  1GLN A;  4IJE A;  3MJ5 A;  3U61 B;  3E4R A;  3NBI A;  3E9S A;  3M7G A;  1GVN A;  2KZU A;  4LJ5 A;  4AZF A;  2XZF A;  2UUA M;  5LMN M;  2R46 A;  2A5Y B;  4LGY A;  1N77 A;  1N36 M;  4QNM A;  2EO2 A;  3SAU A;  3UGJ A;  5EXX A;  5KQD A;  5KO3 A;  1PJJ A;  2C98 A;  3U6D A;  4DUY M;  2C96 A;  5E26 A;  4IBI A;  5C18 A;  1NHG C;  5F3W A;  1TDZ A;  4D81 A;  4R7G A;  3U60 A;  3I4V A;  5DYI A;  4GRI A;  2OPF A;  1NVM A;  4B3T M;  5IT9 S;  2DHR A;  2L7H A;  4GC5 A;  1DGH A;  4IBG A;  3AKZ A;  3CF6 E;  3HHX A;  2CHV A;  4AW4 A;  1R2Y A;  5ITX A;  4TUW A;  3GPY A;  3UZU A;  1C1K A;  4GHA A;  5KPR A;  2D7G A;  3TQS A;  4NOO B;  3IG5 A;  4JI1 M;  3RE8 A;  3AJI B;  3KOX E;  2KA6 B;  3L28 A;  4RNA A;  2OQ4 A;  3SAV A;  2RGO A;  1IN4 A;  1SXJ C;  3R8F A;  1QYR A;  2CV2 A;  5IWA M;  3KOW E;  8CAT A;  2UU9 M;  2KEB A;  2ZAN A;  2QZ4 A;  3H4M A;  2EA0 A;  1EE8 A;  4GIP A;  1G4A E;  1XHB A;  2KXE A;  2BJV A;  2KZS A;  4LJA A;  1JR3 D;  4JI7 M;  3KVW A;  3GPX A;  3J27 B;  1MX0 A;  3GP1 A;  4DR6 M;  1JQJ C;  3ZCB B;  4JI4 M;  1QZM A;  2FE8 A;  4LCB A;  2V1C A;  4B7G A;  4NSR A;  3FD9 A;  2X49 A;  4QHT A;  2Q2E B;  3A98 B;  2FOI C;  3GQ5 A;  5FSW A;  2YFQ A;  2QCU A;  4WUR A;  3HJ8 A;  2XH9 A;  4I81 A;  4MGH A;  3ZH9 B;  3KP1 E;  1HQY E;  1OJL A;  3DOA A;  3AOE C;  1J5E M;  1YSY A;  3KS4 A;  3JAM S;  3TWM A;  1FNN A;  4MGI E;  2F4V M;  3UMM A;  1DGF A;  2FNA A;  2HKJ A;  2Y20 A;  3GQ4 A;  2M5Z A;  4L15 A;  3PNV A;  1I94 M;  4EIW A;  1KYI A;  4LJ4 A;  1L1T A;  2X4A A;  1DGG A;  4JI3 M;  1QAM A;  3T15 A;  3SHG B;  4CIS A;  3IG8 A;  4FCW A;  1JR3 A;  2DZO B;  4MM3 B;  5GKN A;  1L2B A;  1Q3B A;  4JI5 M;  1L1Z A;  1NY5 A;  2CHQ A;  1S3S A;  3GLG B;  2X8A A;  4PD2 A;  3NWL A;  4B08 A;  3AOG A;  2ERC A;  3TPZ A;  1XNQ M;  1TH3 A;  4II7 A;  1IBK M;  5DYG A;  3U6C A;  5FTN A;  2QP9 X;  4QOZ C;  3I4Y A;  4FWD A;  4AG5 A;  4G4O A;  4CHT B;  4G4R A;  5EJC A;  3RGS A;  1R2Z A;  1OFI A;  1OFH A;  1IN7 A;  4IJF A;  4LY6 A;  3C58 A;  2G8L A;  3GRR A;  4LF6 M;  3FTF A;  5ITQ A;  2C9C A;  4FWH A;  5ITX E;  4KHP M;  4KOD A;  5EXS A;  2RGH A;  2KRU A;  1Z5A A;  4GIT A;  7CAT A;  2UUC M;  3KSX A;  4DR4 M;  4GH9 A;  2UXC M;  4FCT A;  2XSZ A;  3UJN A;  4NXN M;  1XMO M;  4LZJ A;  5IRE B;  3T38 A;  3SAW A;  4JXJ A;  1NJG A;  2F5P A;  4AQY M;  3L2A A;  2CV1 A;  4PDG A;  3HWS A;  4JI8 M;  3L25 A;  3GO8 A;  2I7P A;  2F5Q A;  1IXS B;  4HLQ A;  1E9S A;  3HU1 A;  3LVW A;  4XBO A;  1YUB A;  5FLX S;  2UXB M;  4DR3 M;  2L7I A;  1G3I A;  1PJI A;  3SMS A;  4X64 M;  3GLI B;  5FTJ A;  3TWK A;  1IY2 A;  1N34 M;  5BR8 M;  2VQE M;  3AFH A;  1LV7 A;  1G59 A;  1IN6 A;  2XGN A;  1HR0 M;  3TL4 X;  4B3M M;  1Z5B A;  4LJ7 A;  5KPZ A;  3T1H M;  4OW0 A;  2D7H A;  3K92 A;  2KW0 A;  4QNR A;  4AG6 A;  3J7A S;  5EP2 A;  3KSJ A;  1Q39 A;  4I4L A;  4L8R C;  4DR5 M;  3U6S A;  4REZ A;  2V1U A;  4IBE A;  4AKI A;  2BNK A;  3FKE A;  5EXT A;  4ITQ A;  4LG2 A;  2CHG A;  4LGM A;  4B7H A;  1N78 A;  3SC3 A;  3KDS E;  4IBJ A;  3FTC A;  2XF3 A;  3ILK A;  3KOY E;  5ITR A;  2V6Z M;  2P5T A;  2Z3X A;  3HU3 A;  5EP4 A;  3HHZ A;  4DR7 M;  1IM2 A;  5FTL A;  1XXH B;  3CTW B;  3U5Z B;  1DGB A;  4NSO B;  3GRV A;  2M60 A;  3LQQ A;  1XWI A;  2LWX A;  1GKI A;  4FD2 A;  5C1B A;  4DR1 M;  4JN6 A;  3FUW A;  1N32 M;  3KP0 E;  4G4Q A;  3J2P B;  3D8L A;  3M6A A;  3VDP A;  3FTD A;  1XC8 A;  4DV2 M;  3MHV C;  1HT1 E;  4LF4 M;  1X37 A;  1G41 A;  4LFA M;  3K1J A;  3L26 A;  4KLN A;  2Z4S A;  3VFD A;  3SAR A;  4Z8X A;  1FJG M;  3J80 S;  4RF1 A;  3U6M A;  2C5R A;  5JI3 E;  3OTO M;  4B3S M;  1HT2 E;  2YR0 A;  4X62 M;  1XMQ M;  4JI0 M;  2CE7 A;  3LVV A;  2XSZ D;  1TGU A;  4OVZ B;  3KS8 A;  1VDD A;  4B3R M;  3LMM A;  3U6Q A;  1NSF A;  4OX9 M;  2XFS A;  4D80 A;  1NNJ A;  3W0L B;  2VQF M;  2QBY B;  1T3T A;  2KRK A;  3UK6 A;  3GLG A;  2CUZ A;  4AKH A;  2D7E A;  2LH0 A;  1DO2 A;  4Z6Y A;  5H37 D;  2Y0Q A;  1IY0 A;  3BOS A;  1L2C A;  1GL6 A;  2DWN A;  2J7N A;  4M0D A;  2I7N A;  3QWL A;  1R6B X;  2H1R A;  2R4E A;  3Q8X A;  3DA1 A;  3GPU A;  3KW6 A;  1D2N A;  4MGY E;  1NJF A;  3TE6 A;  4NRW A;  1HNW M;  3RFW A;  5ITT A;  2VII A;  1K3W A;  1XNR M;  1Z5C A;  4NXM M;  1KFV A;  4FCV A;  3A46 A;  4GMQ A;  4X65 M;  5BPV A;  2UXD M;  3CF0 A;  4HL4 A;  2DWZ B;  1J09 A;  2ZAO A;  1K82 A;  4IBF A;  4IBD A;  1HNX M;  1NNU C;  3FUT A;  3JR5 A;  4L78 A;  3HGI A;  3A42 A;  5EXP A;  4K0K M;  1W5S A;  3FUX A;  3T1Y M;  1Z59 A;  1L8Q A;  1KSF X;  1IBM M;  2R4J A;  1ZAE A;  2G5G X;  5A2Q S;  2Z7J A;  4XGI A;  5DNY A;  3U6E A;  3SAS A;  3GLI A;  4DV0 M;  4DV5 M;  4YY3 M;  2XZU A;  4BLC A;  2O5R A;  3K8Z A;  2E5L M;  4YHH M;  4DR2 M;  2W82 A;  1SXJ A;  2ZAM A;  4LJ6 A;  4ZPX A;  3WHK A;  1Q3C A;  1L2D A;  3L27 A;  1IBL M;  1QAQ A;  3SHF A;  2NQ8 C;  1SXJ B;  4L4U A;  1ZQ9 A;  4PDI A;  4WW0 A;  5FTK A;  2EUC A;  1DO0 A;  2Y21 A;  3VDU A;  2HL7 A;  5EP1 A;  4AI6 A;  3KOZ E;  4OU7 A;  5JI2 E;  1IXZ A;  1IN8 A;  4LJ8 A;  5EQT A;  1IY1 A;  2LNH C;  4LF9 M;  2JA2 A;  3EIH A;  3QAU A;  2R65 A;  3THG A;  1MU5 A;  2RKO A;  3TWL A;  4W5W A;  1E9R A;  4QOS A;  1K3X A;  4G6Z A;  2XLJ A;  4M9Z A;  3FUU A;  4MH0 E;  5IZ7 D;  3VK8 A;  3AV0 A;  4I8O A;  5EP3 A;  4FW9 A;  1W5T A;  4IBC A;  2R45 A;  3FYD A;  3U60 B;  1R7R A;  4DV6 M;  1XXH A;  3U5Z A;  4NRV A;  4DV4 M;  2YNM D;  1NY6 A;  3DZD A;  3FYC A;  1DGH B;  2R62 A;  3HHW A;  4DV7 M;  3AL0 C;  2HCB A;  3J81 S;  4LF5 M;  1TH4 A;  4LRT A;  2CEA A;  4D82 A;  3AOE A;  4LZZ A;  3D8B A;  4DV3 M;  2R18 A;  3A45 A;  1HQC A;  5KPT A;  2F5S A;  4M0W A;  2ZBK B;  5LMU M;  1PM5 A;  2Z4R A;  1TH2 A;  3J7B A;  1NHW C;  1N75 A;  3I51 A;  3W0F A;  3R9X B;  4LRS A;  5ITY A;  3M0E A;  4MGZ E;  4BB9 A;  1TDH A;  2F5N A;  1QAO A;  4L16 A;  2XFT A;  3KXE C;  3FUV A;  4DV1 M;  1QAN A;  1UM8 A;  1WXQ A;  1YE9 A;  3VKG A;  4X66 M;  4FWG A;  3SYK A;  4OVZ A;  2ZM6 M;  1HNZ M;  4GKK M;  1N33 M;  3K2L A;  4I5S A;  2BJW A;  4LF7 M;  1IN5 A;  2FFJ A;  3GRY A;  2QPA A;  4CGY B;  2QBY A;  2CFO A;  3DFZ A;  1QQW A;  4JI6 M;  4GHL A;  4FVM A;  1E32 A;  2Y0T A;  3SAT A;  2AHM A;  4M9X A;  4DUZ M;  4JYA M;  3GRU A;  4R3D A;  3MK6 A;  1IQP A;  1ORY B;  1QVR A;  3RGP A;  4LF8 M;  4IIW A;  4M9S A;  4PCZ A;  4JV5 M;  4PT5 A;  3VKH A;  3PNY A;  5KQ8 A;  2XEP A;  3WHL A;  3KFU G;  3SBJ A;  4RF0 A;  2K47 A;  2YQZ A;  3HU2 A;  4G4N A;  4A3V B;  3GLH A;  3FTE A;  4NL4 H;  4S12 A;  2QEN A;  3EIE A;  1SXJ D;  1E94 E;  3HKP A;  2DWM A;  3L29 A;  3SYL A;  4JI2 M;  4MB7 A;  1SXJ E;  3GLH B;  3B9P A;  4IBK A;  3GQ3 A;  3PXG A;  4KO8 A;  2L6O A;  4GC9 A;  4MGK E;  4GKJ M;  4BBA A;  2C9O A;  3SFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...