4X64T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4x64T00
1HNZT 4DV2T 4K0KT 1IBLT 1IBKT 2UUAT 2F4VT 4DR3T 4DR1T 1HNXT 1I94T 4DR5T 4NXMT 4JI8T 3OTOT 1FJGT 1N34T 2UXBT 4JI4T 4JI7T 2UUBT 4LF6T 4JI0T 4DUZT 4X62T 4DV1T 3T1HT 1HR0T 4JI3T 2UXCT 4JYAT 4X66T 4DR6T 1N33T 4DV4T 4B3ST 4B3TT 4DR4T 2E5LT 1N36T 4YY3T 3T1YT 2VQET 2ZM6T 4B3MT 4JI6T 1HNWT 4LFAT 4LFBT 4JI1T 4LF4T 1IBMT 4LF9T 2UU9T 4DV0T 4KHPT 4GKJT 5IWAT 5BR8T 2UUCT 4NXNT 4GKKT 4LF7T 4B3RT 4OX9T 4DV3T 4X65T 4JV5T 4DV5T 4JI5T 4LF8T 4YHHT 4DUYT 4DR7T 2VQFT 2HHHT 4JI2T 4DV7T 5LMUT 1N32T 4AQYT 4DR2T 4LF5T 4DV6T 1XNRT 5LMNT 1XNQT 1J5ET 2UXDT 4LFCT 1XMQT 4X64T 1XMOT
chains in the Genus database with same CATH superfamily
3UT5E 1U5PA 4WBOA 3ZN0B 4DVDA 4PJNA 4TZ4C 2KWHA 1IBLT 3CX7B 1IBKT 4EB6E 2KT9A 2LKHA 4U2YA 3QC9A 2XQ3A 3LJCA 1S35A 4L0RA 3QK6A 4DUZT 4E7ZA 3CQCB 2RP4A 3C50A 4HFEA 4PNIA 4A98A 1D0ZA 4L9IA 4ILAA 4O8SA 4IL4A 3AEBA 3PUZF 1MIYA 4LFBT 5FMNA 5LJNA 3J9X1 2WMNA 4DV3T 2YU1A 3H3MA 2XAGB 3GWHA 3EABA 2VK9A 2LJLA 4JEUB 5LHGB 4EXTA 2AE9A 2FJEA 5KDMC 1ZEEA 2XTLA 3ZC1A 3UU4A 4ZS3A 2X66A 3RF1A 5F8PA 3ZCIA 2JMHA 3MK7C 4EYYR 3EUHA 1D0XA 3Q5DA 4HFHA 5HEJA 2CEAA 5J2UE 3RIUA 3RYFE 2WMOA 3B57A 4LFCT 3GN5B 4X64T 5LBQB 3KBUA 1MMAA 2BS4A 1HX8A 2YU2A 2N1GA 3PJAJ 3PURA 4YXDA 4ZOLE 4A5XA 3ZYLA 1JNZA 5AQOB 2X9YA 2XQ7A 4COFA 2OA5A 5KMGP 2OLTA 5AQJB 1QUUA 3ZJ1A 3P4RA 4HGAA 4PK6A 1WYCA 1KNZA 5L3GB 3H37A 2IUBA 4PFOA 2JQQA 2L9QA 2W4XA 4YJ2E 5LP6E 4U3CA 3PUVF 2QVAA 2ZM6T 3CK6A 5J1GA 3ZT6A 3CKDA 5F3JA 4NUUA 2KZ7B 2AXDS 1WLXA 4WNKA 2UUCT 4OX9T 4U31A 3ZCJA 1D1AA 3L39A 5JR9C 3K3NA 2DNXA 3RC3A 3U78A 1BR4A 2LSIA 5JDFA 4I0UA 2HHHT 3ETVA 3ZJ2A 1NENA 2Q9QD 2KNDA 5LA6E 1HS7A 2V1DB 4ZZBA 2VWAA 2C5KT 1ZP0A 4ILCA 3UUBA 2VKHA 3D0TA 4AKRB 2WY2A 4UXNB 3ZEFB 3ONXA 4QX8B 4LF5T 4Q25A 3ZSTA 2K48A 4YHJA 2C0SA 1BR1A 3ZT5A 4QKNA 4HFIA 1WRDA 2YDSA 5FXWA 5L4HA 2XHEB 2XM1A 2X0HA 3WAKA 4DR5T 3BQIA 3IA3A 2E9XA 3VRBA 2EHOB 3T1HT 4HTEA 3VR9A 3ZSSA 2CRBA 3TLSA 2CLYB 2JIWA 3FBLA 1V9DA 3KV5A 1US7B 4QH1A 4JBWF 4B3TT 2E5LT 3MZKB 5AQLB 3F57A 4ISTA 2DL1A 3IF8B 1Y01A 4JI1T 1IBMT 4PK5A 4ADZA 2YINA 2UU9T 2FJAA 5EK4A 3UUXB 4A97A 2V7KA 5FY0A 5KX5E 4ILUA 3B13A 3PUYF 3RRCA 2Y8DA 2CXFA 2LOPA 5LHHB 1HTJF 2YN6A 5FL1A 4DV7T 5JTGA 4H9NC 3KFWX 4OHFA 4AKHA 4AQFC 2V5CA 3OPCA 3Q5WA 3OYXA 2CXLA 1YKEB 2JQ9A 2BG9A 4DV2T 5ABEA 4MALA 4BA9A 4H9SE 3HKCE 5LHIB 4TX5A 2ZMAA 3QB5A 2MAWA 2F4VT 5IUXA 3L8RA 2V6XA 4JI8T 3MA9A 1SE7A 1CHUA 4JEHB 4CXYA 1D0YA 4V1Av 2LOSA 1OEDC 3V5SA 4CXWA 2XAHB 3AEFA 3TLUA 3C4XA 1N36T 5FXZA 5DQVA 4H63H 3SFEA 4B3MT 2N2NA 5JRCA 3BQLA 2CPTA 3ESLA 3S4UA 3UU5A 2R6GF 4LF7T 2J62A 2XAJB 1ZOYA 2V6YA 3QOFA 4ZI2C 2V7IA 2BKPA 4P1NA 2W0GA 2X51A 1UURA 4U72A 3C64A 1R8IA 3CX8B 4QH5A 3I9WA 3RQUA 4IDQA 3AA6B 3FZKB 4FI5A 4HWDA 4IDNA 2NOXA 2J1DG 1NAFA 1X9BA 2W2UA 4TWFA 1OXZA 1G8XA 3OBVE 2BVLA 3N9MA 2BKNA 4OYJA 4ASKA 5KXJA 4C91A 4XBFB 4HWCA 5FVKA 2J47A 2RPAA 3N9OA 2WQYA 5ABFB 2DWGA 4YLHA 3MKDA 3AE1A 2XQ6A 2W67A 3PUXF 2P9BA 3AE5A 2HPJA 1MNEA 2YDQA 2B1EA 4I4TE 2IAKA 3NZPA 4I55E 4U74A 5JR9B 5HEOA 1N33T 4ZS2A 4DR4T 4DMWA 3T1YT 2BZBA 3BK9A 3CWZB 4LFAT 4YTMA 4LF4T 2FJDA 2RA1A 4DV0T 2LM2A 4B3RT 3O1IA 3AA7B 2DWKA 1IAPA 5HXSA 2WM9A 4ILBA 2Q9QB 4Z90A 4YFSA 5L4EA 4EZHA 2VKDA 2W63A 1W0BA 4WZXA 4CXXA 2LSKA 3ANWB 3UUMA 1UK5A 2XQYA 4OFZA 4ISSA 1W09A 1Y64B 2XSBA 4X1KE 5M4YA 4PJJA 2ZM0A 2KWIB 2X9WA 3KDSE 2CBJA 4LMKA 2XZEA 3P8CD 3AE3A 3NZQA 2Y48B 3NRYA 4CN4A 1FMVA 4EEBA 3AXJB 4KMCA 4IE7A 4AKIA 1OEDA 4YTNA 4UF0B 4EZ4A 1E2AA 2CCQA 1XZYA 2IDOB 5JDHA 4P09A 5CGMA 5LCYA 3PUGA 4DBRA 4X1IE 3I0OA 3NRXA 3Q5XA 5DQWA 4JI6T 2YEVC 1HNWT 2PG8A 3OKQA 2E9XC 4JI5T 5F5WA 4AISA 2CMRA 5FY1A 4GIWA 3UU3A 4QXCB 4DIDB 3AEAA 2B76A 1WR0A 3O9XA 2VKOA 4JUYA 2VVNA 5AQTB 1IJ6A 2D0TA 2KMFA 4N78D 5FVLA 4QWNB 3M65A 5C3JA 2H89A 2LRKA 4U7IA 1XMQT 4PK4A 3UTKA 3Q9DA 4IGUA 4YSZA 2OV9A 5AQQB 3RLFF 1HCIA 3MJXA 2A72A 3N2OA 3LBXA 4X1YE 4P0AA 3TKLB 2IIUA 5JDQA 3IEEA 3HL6A 2IC6A 2UXBT 1VCSA 1MIVA 1UX5A 4C90A 4DNDA 2ZLYA 4OYKA 5AQNB 1HR0T 2BS3A 2WSSV 2A3DA 3AE2A 3CQGB 3IBPA 1T8BA 4GK0E 4O2AE 2ACZA 4ANJA 1J1JA 2BG9C 4HWIB 5LNKA 2X68A 3RPUA 5L3DB 3ZC0A 4IREA 1OEDE 3L09A 4YHHT 3ZN1B 2DI4A 2GK9A 4O4JE 2C5IT 5AQRB 3RYCE 2D9DA 4J2CA 3E22E 2WS3A 2CWYA 2IMLA 3RKOA 3FZLB 4HFDA 5HEUA 3ZMUB 4YTPA 4M1PA 3I0QA 4H9PC 1N32T 4QXBB 3AA0B 2CE7A 2EHOA 1L0VA 2WDRA 3E08A 3U3IA 3J7Yq 2KSRA 1HF8A 4NIQA 4WBNE 4ZI3C 2WDVA 3KV4A 3LK2B 1FIOA 2SPCA 2BKOA 4KHZF 2JMKA 3AB3B 3AVRA 3AAIA 2DLRA 2VL0A 3A5XA 2DHRA 5LBMA 3RQWA 2BVMA 4KUMB 2XQAA 1XDOA 5HEHA 5L2LA 5AQSB 1KK7A 1Z8UA 5H6QB 4DV4T 3QUJA 3SS1A 4OK0A 4TV9E 3P4PA 4TNVA 2JQKA 3KV6A 3WAJA 1DU2A 4X20E 2CA5A 5IWAT 4IE0A 2XUEA 5E0OA 1E7PA 2V7MA 2XASB 4G2AA 2XQ9A 4DV5T 5AQMB 1ZHCA 1HX1B 5ETWA 4ZZCA 2ODVA 1MIWA 4XAXB 2A9UA 4CZZB 3SOLA 1YQ3A 4MLKA 5JDMA 2X0YA 4GK5E 4F6RC 5AQGB 1KNPA 4GOUA 3E0ZA 1HFAA 4IIJE 2YDRA 3AE7A 1WFDA 4ZHQE 3UQ7A 4HN9A 1G73A 4H9QC 2G0UA 3DJBA 3A7MA 2BS2A 2NTYA 4DO0A 3LG7A 2KLQA 2UUAT 2YK0A 2ODUA 2CM0A 3LK3B 2W62A 1W9RA 4U2ZA 1I94T 2Z6EA 3O4XE 3M3ZB 1N34T 2UUBT 3FXEB 5BMVE 4X62T 3JC6C 3HKEE 2PJQA 2UXCT 5L3BB 1I6ZA 2E9XB 5HXHA 3VKHA 3CPZA 5LGUB 1M7KA 2M6BA 2PBIA 1YKHB 2C5JA 3BQKA 2WZIA 2WDQA 3FZFB 3N2KE 3AEEA 1YQ4A 2XAFB 3I1AA 2K5BB 4BJMA 4JLEA 4ZI2D 3DP7A 4JI2T 4FJOA 2JPFA 3PTRB 3PU3A 3KBTA 3VRAA 2LT3A 4H9OC 2D0UA 4F8HA 2J4GA 5ABGA 2XM2A 3MXZA 4HFVA 3RI5A 5HEGA 3FBZA 5HYAA 3G06A 1NEKA 4TN7B 4EGWA 3PU8A 2I0MA 2ACXA 4TUYE 1MNDA 2BG9B 3ZMTB 2K24A 1UX4A 4AKGA 2Q9QA 2XSAA 4IL9A 4IE4A 3NKZA 2YOEA 1JNRA 5AQIB 4X66T 3N2GE 2VB6A 5HWYA 4DR6T 2LRLA 2XQ4A 2IHR1 3O1HA 4NPPA 5EK2A 4QXHB 3ZPOA 2XPKA 4BAYB 5AQUB 1UUSA 4LF9T 4KHPT 5AQPB 4DBQA 2LE8A 4JV5T 5AQFB 3AE8A 3F2EA 4QH4A 5JRCB 2MTQA 3PV0F 3AAEB 4WW0A 2QRXA 2HN2A 2JQHA 2V7LA 4UIGA 2BG9E 3A8YC 4CI2B 5LYJE 2XQ8A 4DR7T 2V6YB 4PW8A 1QSDA 5H6RB 2I6HA 3AXJA 1VRBA 4HWFA 3P50A 5HWXA 1XDPA 3KVBA 2V5DA 1WYBA 2H88A 4O2BE 4EV6A 3FZHB 3UU8A 2M6IA 1QLBA 3ZKRA 2XJ7A 4JYAT 4A56A 1KF6A 1FMWA 5L3CB 1MMDA 5JDGA 4K0KT 4EYUA 2FJBA 2DCFA 1LRZA 4DR3T 3QB5K 3R6NA 3OTOT 4PJMA 2EHOC 2KXPB 2CHNA 3AE4A 3KINB 3RIFA 2CLYC 5HAXA 3LSVA 2LKGA 3ZYKA 3JCFA 3ONLC 3OJAA 2VQET 3NVOA 3PJAA 4CQIA 5JQGE 4CI1B 5HXRA 2YKSA 1BR0A 4CI3B 2D2SA 2MBGA 1U4QA 5L3EB 3KV9A 4K0UA 1HG5A 2V26A 3P4QA 4L5GA 5IHYA 2L8KA 5LB7B 3W15B 3AEGA 2E9XD 5ABHA 5FY7A 2H3RA 4YSXA 2NR4A 3F31A 3C98B 2X9XA 3C4WA 3RKGA 5CFBA 3ZMSB 4TWHA 3GN5A 3R84B 3UUNA 4DR2T 5ADXL 4XZCA 3AEDA 3K3OA 2UXDT 2QYWA 3ZYMA 5JDLA 1EZ3A 1XMOT 2WB5A 1T72A 3RYHE 3NBXX 3ZMZB 4DMVA 2WU5A 3AA1B 3FB2A 4UV9B 5FNVE 1GQEA 2NWBA 1IJ5A 3P4SA 5HCMA 2ZM8A 3FXDB 3B5MA 3RYIE 1YD8G 2V8SV 4LF6T 4H9RC 1LVFA 3L3PA 1IZNB 4IHJE 1OEDB 5GONE 5EK3A 4ZEYA 3UQ4A 4ERRA 5DJQC 2W61A 3P7IA 4KX6A 4Z91A 3RGLA 4YY3T 3ABVA 4HWHA 2WZHA 1FEWA 2XAQB 4GKJT 4GKKT 2WCAA 3MACA 3ETUA 1UGOA 4UVAB 4IE6A 2E2AA 3H3AA 4YSYA 4BJNA 3CMLA 4QHOA 1VOMA 3AE9A 2D5UA 3VHLA 5LG4A 2VL8A 3TLTA 4IE5A 2UXNB 4HEAA 4DV6T 5JREA 2E8IA 4O4LE 3CX6B 2VURA 4HKAA 2CHOA 3UULA 4UEMA 4TNWA 3RIAA 4ZI3D 1D1BA 2L3LA 3N9PA 3N5LA 3EAMA 3RH3A 1HNXT 4JI7T 3FHNA 4LMJA 1YXRA 3LBXB 2ZM2A 2H7VC 4JI3T 3HR0A 3OVUA 2X0LB 1Z0PA 4KBMB 4TWDA 5BR8T 3HKBE 2JJ9A 2JRKA 4CN6A 2LHNA 3JAEA 4U7YA 2Q9QC 2LLYA 3N9QA 4DUYT 4IDPA 2FBWA 3RRWA 2NP9A 1W0AA 2WU2A 3VKGA 5CA0E 2KINB 3SWHA 5FL0A 4I50E 2HN1A 5LMUT 4WYVA 1O3XA 3P4WA 1D1CA 2PFVA 2CBIA 3CIRA 3SFDA 4IDZA 5JDNA 1XNRT 1XNQT 2XY8B 3PUAA 1ZV4X 2BDEA 4CN1A 3PDYA 2K9AA 3VR8A 4QX7B 2IC9A 3JAFA 4PJLA 4UV8B 2K3WA 5A1LA 4PFPA 4DR1T 3OYZA 3AECA 2E5VA 4MHCA 4DV1T 3RHWA 3HA4A 4KI0F 4O4IE 5J0ZA 1OWAA 2CWOA 5TAOA 3JC6D 1MMNA 5HXCA 3GMIA 4UVBB 4ZXLA 1YW0A 2BBHA 5FKYA 4MBQA 2MYSA 3AAAB 4EEDA 1X79A 4X65T 4GYRA 3K1SA 3ZLIA 3LDQB 1CUNA 2WWUA 4MFRA 1AJ3A 3GA8A 3N9NA 3VU7H 2NW7A 3UU6A 3LFMA 2VKJA 4ZI7E 2QGSA 3O1JA 4IT4A 5JVDE 3N9LA 3NWIA 2LEHA 5HXEA 2N9DA 1E1HB 1J5WA 2HPLA 5LMNT 2W00A 1NWMX 2UXXB 1UCUA 3AVSA 2LM9A 2WBLA 5ABFA 5CA1E 1VCTA 1H7CA 4HFBA 3PUQA 4UR9A 1HNZT 4TV8E 2WP9A 2LSYA 3Q5EA 3EHZA 2M67A 4YT0A 2BBJA 3IHRA 5LJMA 2WWVA 3Q2MA 4AKLA 1FJGT 3V5UA 4GYSA 1XWMA 1MMGA 2Y6XA 5JR9A 4JI4T 3JADA 3WI3A 4UVCB 5L3FB 5HCJA 2FUPA 5LXTE 4B3ST 1LVKA 4I43B 2W66A 2NW8A 3FZMB 2NTXA 3PE0A 1S94A 5CB4E 5LGTB 5FYMA 5JH7E 4AI6A 4NXNT 4PAGA 2LHRA 4LF8T 3I9YA 3KVAA 4YJ3E 5AQKB 3EDUA 2HH7A 4H63V 4P0BA 3ANWA 3T8OA 2VQFT 4KP3C 3LK42 4E7SA 2VASA 4UELA 2XQ5A 3QNUA 3ZMVB 4EOZB 4AQYT 1ZKEA 1T7SA 4LMLA 2H7OA 3EDVA 3UFGA 4AXPA 5AFUL 3EI0A 3C51A 2QA7A 4HE8A 4B6XA 5CJ5A 3HKDE 1J5ET 1KEYA 3UFEA 3PUSA 2PTFA 2V7JA 3X1DA 1HG2A 2X67A 3RIUC 2NW9A 4O4HE 3EVYA 1KFYA 3RX6A 3K3QC 4UF0A 4AQGA 4NUVA 4X5TA 5LG3A 2LSGA 1KNRA 3TLWA 3SRZA 4NXMT 5LGNB 4G63A 5FXVA 1B7TA 2IW5B 4JI0T 3HI2A 2ES0A 5DABA 2MOZA 5EZYE 2MPKA 3PUWF 2EHOD 5FXXA 3DTOA 2A2FX 5C2TA 1SHZC 3ONJA 5LOVE 4AQFA 3K8PC 4EAHA 3C4ZA 3CVRA 1SA0E 5AQVB 4AIUA 4EIWA 1BR2A 5IYZE 1SUMB 2CXDA 5FP3A 3TLVA 5AQHB 5C8YE 2X9HA 4HFCA 1LKXA 1T98A 2WAUA 1WR6A 2LSJA 3ZT7A 4U33A 5J2TE 4IDOA 3RC8A 1M62A 3CQXC 2VVSA 1WCRA 4Z8XA 5L47A 2I59A 3AE6A
chains in the Genus database with same CATH topology
1HNZT 4DV2T 4K0KT 1IBLT 1IBKT 2UUAT 2F4VT 4DR3T 4DR1T 1HNXT 1I94T 4DR5T 4NXMT 4JI8T 3OTOT 1FJGT 1N34T 2UXBT 4JI4T 4JI7T 2UUBT 4LF6T 4JI0T 4DUZT 4X62T 4DV1T 3T1HT 1HR0T 4JI3T 2UXCT 4JYAT 4X66T 4DR6T 1N33T 4DV4T 4B3ST 4B3TT 4DR4T 2E5LT 1N36T 4YY3T 3T1YT 2VQET 2ZM6T 4B3MT 4JI6T 1HNWT 4LFAT 4LFBT 4JI1T 4LF4T 1IBMT 4LF9T 2UU9T 4DV0T 4KHPT 4GKJT 5IWAT 5BR8T 2UUCT 4NXNT 4GKKT 4LF7T 4B3RT 4OX9T 4DV3T 4X65T 4JV5T 4DV5T 4JI5T 4LF8T 4YHHT 4DUYT 4DR7T 2VQFT 2HHHT 4JI2T 4DV7T 5LMUT 1N32T 4AQYT 4DR2T 4LF5T 4DV6T 1XNRT 5LMNT 1XNQT 1J5ET 2UXDT 4LFCT 1XMQT 4X64T 1XMOT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ T;  4DV2 T;  4K0K T;  1IBL T;  1IBK T;  2UUA T;  2F4V T;  4DR3 T;  4DR1 T;  1HNX T;  1I94 T;  4DR5 T;  4NXM T;  4JI8 T;  3OTO T;  1FJG T;  1N34 T;  2UXB T;  4JI4 T;  4JI7 T;  2UUB T;  4LF6 T;  4JI0 T;  4DUZ T;  4X62 T;  4DV1 T;  3T1H T;  1HR0 T;  4JI3 T;  2UXC T;  4JYA T;  4X66 T;  4DR6 T;  1N33 T;  4DV4 T;  4B3S T;  4B3T T;  4DR4 T;  2E5L T;  1N36 T;  4YY3 T;  3T1Y T;  2VQE T;  2ZM6 T;  4B3M T;  4JI6 T;  1HNW T;  4LFA T;  4LFB T;  4JI1 T;  4LF4 T;  1IBM T;  4LF9 T;  2UU9 T;  4DV0 T;  4KHP T;  4GKJ T;  5IWA T;  5BR8 T;  2UUC T;  4NXN T;  4GKK T;  4LF7 T;  4B3R T;  4OX9 T;  4DV3 T;  4X65 T;  4JV5 T;  4DV5 T;  4JI5 T;  4LF8 T;  4YHH T;  4DUY T;  4DR7 T;  2VQF T;  2HHH T;  4JI2 T;  4DV7 T;  5LMU T;  1N32 T;  4AQY T;  4DR2 T;  4LF5 T;  4DV6 T;  1XNR T;  5LMN T;  1XNQ T;  1J5E T;  2UXD T;  4LFC T;  1XMQ T;  4X64 T;  1XMO T; 
#chains in the Genus database with same CATH topology
 3UT5 E;  1U5P A;  4WBO A;  3ZN0 B;  4DVD A;  4PJN A;  4TZ4 C;  2KWH A;  1IBL T;  3CX7 B;  1IBK T;  4EB6 E;  2KT9 A;  2LKH A;  4U2Y A;  3QC9 A;  2XQ3 A;  3LJC A;  1S35 A;  4L0R A;  3QK6 A;  4DUZ T;  4E7Z A;  3CQC B;  2RP4 A;  3C50 A;  4HFE A;  4PNI A;  4A98 A;  1D0Z A;  4L9I A;  4ILA A;  4O8S A;  4IL4 A;  3AEB A;  3PUZ F;  1MIY A;  4LFB T;  5FMN A;  5LJN A;  3J9X 1;  2WMN A;  4DV3 T;  2YU1 A;  3H3M A;  2XAG B;  3GWH A;  3EAB A;  2VK9 A;  2LJL A;  4JEU B;  5LHG B;  4EXT A;  2AE9 A;  2FJE A;  5KDM C;  1ZEE A;  2XTL A;  3ZC1 A;  3UU4 A;  4ZS3 A;  2X66 A;  3RF1 A;  5F8P A;  3ZCI A;  2JMH A;  3MK7 C;  4EYY R;  3EUH A;  1D0X A;  3Q5D A;  4HFH A;  5HEJ A;  2CEA A;  5J2U E;  3RIU A;  3RYF E;  2WMO A;  3B57 A;  4LFC T;  3GN5 B;  4X64 T;  5LBQ B;  3KBU A;  1MMA A;  2BS4 A;  1HX8 A;  2YU2 A;  2N1G A;  3PJA J;  3PUR A;  4YXD A;  4ZOL E;  4A5X A;  3ZYL A;  1JNZ A;  5AQO B;  2X9Y A;  2XQ7 A;  4COF A;  2OA5 A;  5KMG P;  2OLT A;  5AQJ B;  1QUU A;  3ZJ1 A;  3P4R A;  4HGA A;  4PK6 A;  1WYC A;  1KNZ A;  5L3G B;  3H37 A;  2IUB A;  4PFO A;  2JQQ A;  2L9Q A;  2W4X A;  4YJ2 E;  5LP6 E;  4U3C A;  3PUV F;  2QVA A;  2ZM6 T;  3CK6 A;  5J1G A;  3ZT6 A;  3CKD A;  5F3J A;  4NUU A;  2KZ7 B;  2AXD S;  1WLX A;  4WNK A;  2UUC T;  4OX9 T;  4U31 A;  3ZCJ A;  1D1A A;  3L39 A;  5JR9 C;  3K3N A;  2DNX A;  3RC3 A;  3U78 A;  1BR4 A;  2LSI A;  5JDF A;  4I0U A;  2HHH T;  3ETV A;  3ZJ2 A;  1NEN A;  2Q9Q D;  2KND A;  5LA6 E;  1HS7 A;  2V1D B;  4ZZB A;  2VWA A;  2C5K T;  1ZP0 A;  4ILC A;  3UUB A;  2VKH A;  3D0T A;  4AKR B;  2WY2 A;  4UXN B;  3ZEF B;  3ONX A;  4QX8 B;  4LF5 T;  4Q25 A;  3ZST A;  2K48 A;  4YHJ A;  2C0S A;  1BR1 A;  3ZT5 A;  4QKN A;  4HFI A;  1WRD A;  2YDS A;  5FXW A;  5L4H A;  2XHE B;  2XM1 A;  2X0H A;  3WAK A;  4DR5 T;  3BQI A;  3IA3 A;  2E9X A;  3VRB A;  2EHO B;  3T1H T;  4HTE A;  3VR9 A;  3ZSS A;  2CRB A;  3TLS A;  2CLY B;  2JIW A;  3FBL A;  1V9D A;  3KV5 A;  1US7 B;  4QH1 A;  4JBW F;  4B3T T;  2E5L T;  3MZK B;  5AQL B;  3F57 A;  4IST A;  2DL1 A;  3IF8 B;  1Y01 A;  4JI1 T;  1IBM T;  4PK5 A;  4ADZ A;  2YIN A;  2UU9 T;  2FJA A;  5EK4 A;  3UUX B;  4A97 A;  2V7K A;  5FY0 A;  5KX5 E;  4ILU A;  3B13 A;  3PUY F;  3RRC A;  2Y8D A;  2CXF A;  2LOP A;  5LHH B;  1HTJ F;  2YN6 A;  5FL1 A;  4DV7 T;  5JTG A;  4H9N C;  3KFW X;  4OHF A;  4AKH A;  4AQF C;  2V5C A;  3OPC A;  3Q5W A;  3OYX A;  2CXL A;  1YKE B;  2JQ9 A;  2BG9 A;  4DV2 T;  5ABE A;  4MAL A;  4BA9 A;  4H9S E;  3HKC E;  5LHI B;  4TX5 A;  2ZMA A;  3QB5 A;  2MAW A;  2F4V T;  5IUX A;  3L8R A;  2V6X A;  4JI8 T;  3MA9 A;  1SE7 A;  1CHU A;  4JEH B;  4CXY A;  1D0Y A;  4V1A v;  2LOS A;  1OED C;  3V5S A;  4CXW A;  2XAH B;  3AEF A;  3TLU A;  3C4X A;  1N36 T;  5FXZ A;  5DQV A;  4H63 H;  3SFE A;  4B3M T;  2N2N A;  5JRC A;  3BQL A;  2CPT A;  3ESL A;  3S4U A;  3UU5 A;  2R6G F;  4LF7 T;  2J62 A;  2XAJ B;  1ZOY A;  2V6Y A;  3QOF A;  4ZI2 C;  2V7I A;  2BKP A;  4P1N A;  2W0G A;  2X51 A;  1UUR A;  4U72 A;  3C64 A;  1R8I A;  3CX8 B;  4QH5 A;  3I9W A;  3RQU A;  4IDQ A;  3AA6 B;  3FZK B;  4FI5 A;  4HWD A;  4IDN A;  2NOX A;  2J1D G;  1NAF A;  1X9B A;  2W2U A;  4TWF A;  1OXZ A;  1G8X A;  3OBV E;  2BVL A;  3N9M A;  2BKN A;  4OYJ A;  4ASK A;  5KXJ A;  4C91 A;  4XBF B;  4HWC A;  5FVK A;  2J47 A;  2RPA A;  3N9O A;  2WQY A;  5ABF B;  2DWG A;  4YLH A;  3MKD A;  3AE1 A;  2XQ6 A;  2W67 A;  3PUX F;  2P9B A;  3AE5 A;  2HPJ A;  1MNE A;  2YDQ A;  2B1E A;  4I4T E;  2IAK A;  3NZP A;  4I55 E;  4U74 A;  5JR9 B;  5HEO A;  1N33 T;  4ZS2 A;  4DR4 T;  4DMW A;  3T1Y T;  2BZB A;  3BK9 A;  3CWZ B;  4LFA T;  4YTM A;  4LF4 T;  2FJD A;  2RA1 A;  4DV0 T;  2LM2 A;  4B3R T;  3O1I A;  3AA7 B;  2DWK A;  1IAP A;  5HXS A;  2WM9 A;  4ILB A;  2Q9Q B;  4Z90 A;  4YFS A;  5L4E A;  4EZH A;  2VKD A;  2W63 A;  1W0B A;  4WZX A;  4CXX A;  2LSK A;  3ANW B;  3UUM A;  1UK5 A;  2XQY A;  4OFZ A;  4ISS A;  1W09 A;  1Y64 B;  2XSB A;  4X1K E;  5M4Y A;  4PJJ A;  2ZM0 A;  2KWI B;  2X9W A;  3KDS E;  2CBJ A;  4LMK A;  2XZE A;  3P8C D;  3AE3 A;  3NZQ A;  2Y48 B;  3NRY A;  4CN4 A;  1FMV A;  4EEB A;  3AXJ B;  4KMC A;  4IE7 A;  4AKI A;  1OED A;  4YTN A;  4UF0 B;  4EZ4 A;  1E2A A;  2CCQ A;  1XZY A;  2IDO B;  5JDH A;  4P09 A;  5CGM A;  5LCY A;  3PUG A;  4DBR A;  4X1I E;  3I0O A;  3NRX A;  3Q5X A;  5DQW A;  4JI6 T;  2YEV C;  1HNW T;  2PG8 A;  3OKQ A;  2E9X C;  4JI5 T;  5F5W A;  4AIS A;  2CMR A;  5FY1 A;  4GIW A;  3UU3 A;  4QXC B;  4DID B;  3AEA A;  2B76 A;  1WR0 A;  3O9X A;  2VKO A;  4JUY A;  2VVN A;  5AQT B;  1IJ6 A;  2D0T A;  2KMF A;  4N78 D;  5FVL A;  4QWN B;  3M65 A;  5C3J A;  2H89 A;  2LRK A;  4U7I A;  1XMQ T;  4PK4 A;  3UTK A;  3Q9D A;  4IGU A;  4YSZ A;  2OV9 A;  5AQQ B;  3RLF F;  1HCI A;  3MJX A;  2A72 A;  3N2O A;  3LBX A;  4X1Y E;  4P0A A;  3TKL B;  2IIU A;  5JDQ A;  3IEE A;  3HL6 A;  2IC6 A;  2UXB T;  1VCS A;  1MIV A;  1UX5 A;  4C90 A;  4DND A;  2ZLY A;  4OYK A;  5AQN B;  1HR0 T;  2BS3 A;  2WSS V;  2A3D A;  3AE2 A;  3CQG B;  3IBP A;  1T8B A;  4GK0 E;  4O2A E;  2ACZ A;  4ANJ A;  1J1J A;  2BG9 C;  4HWI B;  5LNK A;  2X68 A;  3RPU A;  5L3D B;  3ZC0 A;  4IRE A;  1OED E;  3L09 A;  4YHH T;  3ZN1 B;  2DI4 A;  2GK9 A;  4O4J E;  2C5I T;  5AQR B;  3RYC E;  2D9D A;  4J2C A;  3E22 E;  2WS3 A;  2CWY A;  2IML A;  3RKO A;  3FZL B;  4HFD A;  5HEU A;  3ZMU B;  4YTP A;  4M1P A;  3I0Q A;  4H9P C;  1N32 T;  4QXB B;  3AA0 B;  2CE7 A;  2EHO A;  1L0V A;  2WDR A;  3E08 A;  3U3I A;  3J7Y q;  2KSR A;  1HF8 A;  4NIQ A;  4WBN E;  4ZI3 C;  2WDV A;  3KV4 A;  3LK2 B;  1FIO A;  2SPC A;  2BKO A;  4KHZ F;  2JMK A;  3AB3 B;  3AVR A;  3AAI A;  2DLR A;  2VL0 A;  3A5X A;  2DHR A;  5LBM A;  3RQW A;  2BVM A;  4KUM B;  2XQA A;  1XDO A;  5HEH A;  5L2L A;  5AQS B;  1KK7 A;  1Z8U A;  5H6Q B;  4DV4 T;  3QUJ A;  3SS1 A;  4OK0 A;  4TV9 E;  3P4P A;  4TNV A;  2JQK A;  3KV6 A;  3WAJ A;  1DU2 A;  4X20 E;  2CA5 A;  5IWA T;  4IE0 A;  2XUE A;  5E0O A;  1E7P A;  2V7M A;  2XAS B;  4G2A A;  2XQ9 A;  4DV5 T;  5AQM B;  1ZHC A;  1HX1 B;  5ETW A;  4ZZC A;  2ODV A;  1MIW A;  4XAX B;  2A9U A;  4CZZ B;  3SOL A;  1YQ3 A;  4MLK A;  5JDM A;  2X0Y A;  4GK5 E;  4F6R C;  5AQG B;  1KNP A;  4GOU A;  3E0Z A;  1HFA A;  4IIJ E;  2YDR A;  3AE7 A;  1WFD A;  4ZHQ E;  3UQ7 A;  4HN9 A;  1G73 A;  4H9Q C;  2G0U A;  3DJB A;  3A7M A;  2BS2 A;  2NTY A;  4DO0 A;  3LG7 A;  2KLQ A;  2UUA T;  2YK0 A;  2ODU A;  2CM0 A;  3LK3 B;  2W62 A;  1W9R A;  4U2Z A;  1I94 T;  2Z6E A;  3O4X E;  3M3Z B;  1N34 T;  2UUB T;  3FXE B;  5BMV E;  4X62 T;  3JC6 C;  3HKE E;  2PJQ A;  2UXC T;  5L3B B;  1I6Z A;  2E9X B;  5HXH A;  3VKH A;  3CPZ A;  5LGU B;  1M7K A;  2M6B A;  2PBI A;  1YKH B;  2C5J A;  3BQK A;  2WZI A;  2WDQ A;  3FZF B;  3N2K E;  3AEE A;  1YQ4 A;  2XAF B;  3I1A A;  2K5B B;  4BJM A;  4JLE A;  4ZI2 D;  3DP7 A;  4JI2 T;  4FJO A;  2JPF A;  3PTR B;  3PU3 A;  3KBT A;  3VRA A;  2LT3 A;  4H9O C;  2D0U A;  4F8H A;  2J4G A;  5ABG A;  2XM2 A;  3MXZ A;  4HFV A;  3RI5 A;  5HEG A;  3FBZ A;  5HYA A;  3G06 A;  1NEK A;  4TN7 B;  4EGW A;  3PU8 A;  2I0M A;  2ACX A;  4TUY E;  1MND A;  2BG9 B;  3ZMT B;  2K24 A;  1UX4 A;  4AKG A;  2Q9Q A;  2XSA A;  4IL9 A;  4IE4 A;  3NKZ A;  2YOE A;  1JNR A;  5AQI B;  4X66 T;  3N2G E;  2VB6 A;  5HWY A;  4DR6 T;  2LRL A;  2XQ4 A;  2IHR 1;  3O1H A;  4NPP A;  5EK2 A;  4QXH B;  3ZPO A;  2XPK A;  4BAY B;  5AQU B;  1UUS A;  4LF9 T;  4KHP T;  5AQP B;  4DBQ A;  2LE8 A;  4JV5 T;  5AQF B;  3AE8 A;  3F2E A;  4QH4 A;  5JRC B;  2MTQ A;  3PV0 F;  3AAE B;  4WW0 A;  2QRX A;  2HN2 A;  2JQH A;  2V7L A;  4UIG A;  2BG9 E;  3A8Y C;  4CI2 B;  5LYJ E;  2XQ8 A;  4DR7 T;  2V6Y B;  4PW8 A;  1QSD A;  5H6R B;  2I6H A;  3AXJ A;  1VRB A;  4HWF A;  3P50 A;  5HWX A;  1XDP A;  3KVB A;  2V5D A;  1WYB A;  2H88 A;  4O2B E;  4EV6 A;  3FZH B;  3UU8 A;  2M6I A;  1QLB A;  3ZKR A;  2XJ7 A;  4JYA T;  4A56 A;  1KF6 A;  1FMW A;  5L3C B;  1MMD A;  5JDG A;  4K0K T;  4EYU A;  2FJB A;  2DCF A;  1LRZ A;  4DR3 T;  3QB5 K;  3R6N A;  3OTO T;  4PJM A;  2EHO C;  2KXP B;  2CHN A;  3AE4 A;  3KIN B;  3RIF A;  2CLY C;  5HAX A;  3LSV A;  2LKG A;  3ZYK A;  3JCF A;  3ONL C;  3OJA A;  2VQE T;  3NVO A;  3PJA A;  4CQI A;  5JQG E;  4CI1 B;  5HXR A;  2YKS A;  1BR0 A;  4CI3 B;  2D2S A;  2MBG A;  1U4Q A;  5L3E B;  3KV9 A;  4K0U A;  1HG5 A;  2V26 A;  3P4Q A;  4L5G A;  5IHY A;  2L8K A;  5LB7 B;  3W15 B;  3AEG A;  2E9X D;  5ABH A;  5FY7 A;  2H3R A;  4YSX A;  2NR4 A;  3F31 A;  3C98 B;  2X9X A;  3C4W A;  3RKG A;  5CFB A;  3ZMS B;  4TWH A;  3GN5 A;  3R84 B;  3UUN A;  4DR2 T;  5ADX L;  4XZC A;  3AED A;  3K3O A;  2UXD T;  2QYW A;  3ZYM A;  5JDL A;  1EZ3 A;  1XMO T;  2WB5 A;  1T72 A;  3RYH E;  3NBX X;  3ZMZ B;  4DMV A;  2WU5 A;  3AA1 B;  3FB2 A;  4UV9 B;  5FNV E;  1GQE A;  2NWB A;  1IJ5 A;  3P4S A;  5HCM A;  2ZM8 A;  3FXD B;  3B5M A;  3RYI E;  1YD8 G;  2V8S V;  4LF6 T;  4H9R C;  1LVF A;  3L3P A;  1IZN B;  4IHJ E;  1OED B;  5GON E;  5EK3 A;  4ZEY A;  3UQ4 A;  4ERR A;  5DJQ C;  2W61 A;  3P7I A;  4KX6 A;  4Z91 A;  3RGL A;  4YY3 T;  3ABV A;  4HWH A;  2WZH A;  1FEW A;  2XAQ B;  4GKJ T;  4GKK T;  2WCA A;  3MAC A;  3ETU A;  1UGO A;  4UVA B;  4IE6 A;  2E2A A;  3H3A A;  4YSY A;  4BJN A;  3CML A;  4QHO A;  1VOM A;  3AE9 A;  2D5U A;  3VHL A;  5LG4 A;  2VL8 A;  3TLT A;  4IE5 A;  2UXN B;  4HEA A;  4DV6 T;  5JRE A;  2E8I A;  4O4L E;  3CX6 B;  2VUR A;  4HKA A;  2CHO A;  3UUL A;  4UEM A;  4TNW A;  3RIA A;  4ZI3 D;  1D1B A;  2L3L A;  3N9P A;  3N5L A;  3EAM A;  3RH3 A;  1HNX T;  4JI7 T;  3FHN A;  4LMJ A;  1YXR A;  3LBX B;  2ZM2 A;  2H7V C;  4JI3 T;  3HR0 A;  3OVU A;  2X0L B;  1Z0P A;  4KBM B;  4TWD A;  5BR8 T;  3HKB E;  2JJ9 A;  2JRK A;  4CN6 A;  2LHN A;  3JAE A;  4U7Y A;  2Q9Q C;  2LLY A;  3N9Q A;  4DUY T;  4IDP A;  2FBW A;  3RRW A;  2NP9 A;  1W0A A;  2WU2 A;  3VKG A;  5CA0 E;  2KIN B;  3SWH A;  5FL0 A;  4I50 E;  2HN1 A;  5LMU T;  4WYV A;  1O3X A;  3P4W A;  1D1C A;  2PFV A;  2CBI A;  3CIR A;  3SFD A;  4IDZ A;  5JDN A;  1XNR T;  1XNQ T;  2XY8 B;  3PUA A;  1ZV4 X;  2BDE A;  4CN1 A;  3PDY A;  2K9A A;  3VR8 A;  4QX7 B;  2IC9 A;  3JAF A;  4PJL A;  4UV8 B;  2K3W A;  5A1L A;  4PFP A;  4DR1 T;  3OYZ A;  3AEC A;  2E5V A;  4MHC A;  4DV1 T;  3RHW A;  3HA4 A;  4KI0 F;  4O4I E;  5J0Z A;  1OWA A;  2CWO A;  5TAO A;  3JC6 D;  1MMN A;  5HXC A;  3GMI A;  4UVB B;  4ZXL A;  1YW0 A;  2BBH A;  5FKY A;  4MBQ A;  2MYS A;  3AAA B;  4EED A;  1X79 A;  4X65 T;  4GYR A;  3K1S A;  3ZLI A;  3LDQ B;  1CUN A;  2WWU A;  4MFR A;  1AJ3 A;  3GA8 A;  3N9N A;  3VU7 H;  2NW7 A;  3UU6 A;  3LFM A;  2VKJ A;  4ZI7 E;  2QGS A;  3O1J A;  4IT4 A;  5JVD E;  3N9L A;  3NWI A;  2LEH A;  5HXE A;  2N9D A;  1E1H B;  1J5W A;  2HPL A;  5LMN T;  2W00 A;  1NWM X;  2UXX B;  1UCU A;  3AVS A;  2LM9 A;  2WBL A;  5ABF A;  5CA1 E;  1VCT A;  1H7C A;  4HFB A;  3PUQ A;  4UR9 A;  1HNZ T;  4TV8 E;  2WP9 A;  2LSY A;  3Q5E A;  3EHZ A;  2M67 A;  4YT0 A;  2BBJ A;  3IHR A;  5LJM A;  2WWV A;  3Q2M A;  4AKL A;  1FJG T;  3V5U A;  4GYS A;  1XWM A;  1MMG A;  2Y6X A;  5JR9 A;  4JI4 T;  3JAD A;  3WI3 A;  4UVC B;  5L3F B;  5HCJ A;  2FUP A;  5LXT E;  4B3S T;  1LVK A;  4I43 B;  2W66 A;  2NW8 A;  3FZM B;  2NTX A;  3PE0 A;  1S94 A;  5CB4 E;  5LGT B;  5FYM A;  5JH7 E;  4AI6 A;  4NXN T;  4PAG A;  2LHR A;  4LF8 T;  3I9Y A;  3KVA A;  4YJ3 E;  5AQK B;  3EDU A;  2HH7 A;  4H63 V;  4P0B A;  3ANW A;  3T8O A;  2VQF T;  4KP3 C;  3LK4 2;  4E7S A;  2VAS A;  4UEL A;  2XQ5 A;  3QNU A;  3ZMV B;  4EOZ B;  4AQY T;  1ZKE A;  1T7S A;  4LML A;  2H7O A;  3EDV A;  3UFG A;  4AXP A;  5AFU L;  3EI0 A;  3C51 A;  2QA7 A;  4HE8 A;  4B6X A;  5CJ5 A;  3HKD E;  1J5E T;  1KEY A;  3UFE A;  3PUS A;  2PTF A;  2V7J A;  3X1D A;  1HG2 A;  2X67 A;  3RIU C;  2NW9 A;  4O4H E;  3EVY A;  1KFY A;  3RX6 A;  3K3Q C;  4UF0 A;  4AQG A;  4NUV A;  4X5T A;  5LG3 A;  2LSG A;  1KNR A;  3TLW A;  3SRZ A;  4NXM T;  5LGN B;  4G63 A;  5FXV A;  1B7T A;  2IW5 B;  4JI0 T;  3HI2 A;  2ES0 A;  5DAB A;  2MOZ A;  5EZY E;  2MPK A;  3PUW F;  2EHO D;  5FXX A;  3DTO A;  2A2F X;  5C2T A;  1SHZ C;  3ONJ A;  5LOV E;  4AQF A;  3K8P C;  4EAH A;  3C4Z A;  3CVR A;  1SA0 E;  5AQV B;  4AIU A;  4EIW A;  1BR2 A;  5IYZ E;  1SUM B;  2CXD A;  5FP3 A;  3TLV A;  5AQH B;  5C8Y E;  2X9H A;  4HFC A;  1LKX A;  1T98 A;  2WAU A;  1WR6 A;  2LSJ A;  3ZT7 A;  4U33 A;  5J2T E;  4IDO A;  3RC8 A;  1M62 A;  3CQX C;  2VVS A;  1WCR A;  4Z8X A;  5L47 A;  2I59 A;  3AE6 A; 
#chains in the Genus database with same CATH homology
 1HNZ T;  4DV2 T;  4K0K T;  1IBL T;  1IBK T;  2UUA T;  2F4V T;  4DR3 T;  4DR1 T;  1HNX T;  1I94 T;  4DR5 T;  4NXM T;  4JI8 T;  3OTO T;  1FJG T;  1N34 T;  2UXB T;  4JI4 T;  4JI7 T;  2UUB T;  4LF6 T;  4JI0 T;  4DUZ T;  4X62 T;  4DV1 T;  3T1H T;  1HR0 T;  4JI3 T;  2UXC T;  4JYA T;  4X66 T;  4DR6 T;  1N33 T;  4DV4 T;  4B3S T;  4B3T T;  4DR4 T;  2E5L T;  1N36 T;  4YY3 T;  3T1Y T;  2VQE T;  2ZM6 T;  4B3M T;  4JI6 T;  1HNW T;  4LFA T;  4LFB T;  4JI1 T;  4LF4 T;  1IBM T;  4LF9 T;  2UU9 T;  4DV0 T;  4KHP T;  4GKJ T;  5IWA T;  5BR8 T;  2UUC T;  4NXN T;  4GKK T;  4LF7 T;  4B3R T;  4OX9 T;  4DV3 T;  4X65 T;  4JV5 T;  4DV5 T;  4JI5 T;  4LF8 T;  4YHH T;  4DUY T;  4DR7 T;  2VQF T;  2HHH T;  4JI2 T;  4DV7 T;  5LMU T;  1N32 T;  4AQY T;  4DR2 T;  4LF5 T;  4DV6 T;  1XNR T;  5LMN T;  1XNQ T;  1J5E T;  2UXD T;  4LFC T;  1XMQ T;  4X64 T;  1XMO T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...