4X64T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4x64T00
4JI2T 2HHHT 5BR8T 4JI4T 4DV0T 4JI8T 1HNZT 2E5LT 4DV7T 4DR4T 4DV5T 1XNRT 4DV4T 3OTOT 4LF8T 4GKJT 1IBKT 4X64T 1N33T 4LF4T 4JI0T 4OX9T 2UXDT 2UU9T 4JI6T 4JI1T 4B3MT 4X62T 1N36T 4DR5T 2VQET 4DR7T 2UXBT 1HR0T 2ZM6T 1HNWT 4DUZT 4JYAT 1XMQT 4GKKT 4DV3T 2UXCT 3T1YT 1I94T 2UUAT 5LMNT 4DV6T 4X65T 1J5ET 4DV1T 1FJGT 2UUBT 4DR6T 4JV5T 4B3ST 4AQYT 3T1HT 4LF5T 4JI5T 4DV2T 4KHPT 1N32T 4LFAT 4B3RT 4LF9T 4JI7T 2UUCT 1XNQT 4JI3T 2F4VT 1IBLT 1IBMT 4LF7T 5IWAT 4LF6T 4DR3T 5LMUT 4B3TT 4DR1T 4YY3T 4NXMT 4X66T 4K0KT 4YHHT 4LFBT 1N34T 1XMOT 4DUYT 2VQFT 4NXNT 4LFCT 4DR2T 1HNXT
chains in the Genus database with same CATH superfamily
3LK42 4TWDA 5FY0A 3NVOA 1D0YA 3CIRA 4EYYR 1ZKEA 3KV4A 4QX8B 4MHCA 4YT0A 2E9XC 4B6XA 2Y6XA 4EOZB 2KMFA 4I4TE 2X51A 4QWNB 4TUYE 5L3DB 4TZ4C 4KBMB 3QUJA 2XY8B 4QH5A 2WS3A 2JPFA 2LSIA 4QXHB 4IIJE 3P8CD 1WYCA 2WBLA 4QX7B 3KVAA 3AB3B 5AQTB 2LM9A 2LT3A 3I0QA 2HH7A 3TLTA 1FJGT 4QH4A 3CMLA 3JC6C 3HL6A 1BR0A 4Z8XA 2A3DA 2PBIA 4CZZB 1V9DA 4TNVA 2NR4A 2IHR1 1I6ZA 3UU5A 5FNVE 2R6GF 5JR9B 4WBOA 4MBQA 5DABA 2E9XA 3LBXA 5FXXA 2LOSA 3UU6A 4WW0A 5LJNA 4PK5A 3GN5A 1UGOA 5LGUB 4U2ZA 5FVLA 4G2AA 3SFDA 2GK9A 1KNRA 3X1DA 4EGWA 5HXCA 4ZI7E 5DQWA 1HNZT 4EXTA 2ZM2A 3VU7H 5JDFA 2W62A 3PU3A 2DI4A 3CWZB 4AI6A 5LGTB 3QB5K 4OHFA 2N2NA 4UVBB 2EHOD 2K5BB 2LSGA 3ZPOA 2A9UA 4ANJA 3JADA 4HEAA 5LG4A 2XAJB 4ISTA 3O9XA 2J62A 4ZZCA 3PU8A 2VVSA 3CQCB 2XTLA 3PV0F 2V5CA 4O4LE 4LF5T 4PK4A 4G63A 2V6YB 3E0ZA 3PUZF 4QH1A 2BVMA 2NW7A 2JMKA 3UT5E 3EAMA 1YQ3A 1T7SA 3IA3A 2BKNA 3R84B 2LSYA 4EIWA 2E8IA 4JUYA 2LSKA 5HAXA 4KX6A 4OFZA 2Q9QB 1WYBA 4ZHQE 3C64A 1MMNA 4PJMA 4U31A 5DJQC 5ETWA 2QA7A 4IE5A 5LP6E 3RQWA 2K24A 4HFDA 4PAGA 4OYKA 4YTMA 3PUWF 4DV4T 2KLQA 3SOLA 4X64T 3NRYA 5A1LA 3DP7A 3ZKRA 1XWMA 3K8PC 3BQKA 2YU2A 2W63A 4IDQA 4MLKA 1GQEA 2A72A 1WR6A 1OWAA 5JDNA 2UXBT 3N9MA 1HR0T 1D1BA 1X9BA 3IHRA 3GA8A 1UX5A 4O4HE 4DV3T 5AQGB 3O4XE 2OV9A 5AQIB 2VL8A 2DLRA 5LBMA 3CX8B 3FZFB 4IL4A 2X9WA 4X65T 1LKXA 5AFUL 5HXHA 3EUHA 2JRKA 4EAHA 5BMVE 3RGLA 2VKHA 3RRCA 3HI2A 4P1NA 2ODVA 3O1HA 1XNQT 2BS3A 2WWVA 4EB6E 4UEMA 4IDOA 1JNZA 4DBRA 1SUMB 5JTGA 3FBZA 2JMHA 3NKZA 4CN6A 3AAEB 4A56A 3AEEA 3KVBA 3K3OA 3PUVF 3ZMZB 4YSXA 1IJ6A 5KDMC 4DBQA 3B5MA 4OK0A 4GKJT 2YU1A 5AQOB 5LYJE 2FJBA 3ANWA 4E7ZA 2FJDA 3HKDE 4X62T 4IREA 2YDRA 1HTJF 4DR7T 3Q5XA 3ZMVB 3ETVA 3AE6A 2EHOC 3RI5A 2BZBA 2I59A 5JDMA 5L3EB 4F8HA 3AVSA 3L3PA 3N2GE 5FVKA 4F6RC 3ZJ2A 5L4HA 3ZYMA 4XZCA 3RH3A 2J1DG 5AQFB 4ZI3C 2W2UA 4H9SE 2FJEA 2WQYA 3AE1A 4X5TA 5M4YA 5IHYA 5C2TA 2YOEA 5FMNA 1WLXA 2F4VT 2NW9A 3AE8A 4IHJE 2BKOA 1BR2A 4YY3T 3RYHE 3C4ZA 4CI3B 2X0HA 4LFBT 1J5WA 4HTEA 2M6IA 2WWUA 2B76A 1HX8A 4LMJA 4DUYT 5LHIB 1FEWA 4TN7B 4LFCT 3H3MA 4GIWA 2IMLA 2EHOA 2Q9QD 2LKHA 4U74A 2ZMAA 3AE9A 4H9NC 4JEUB 4J2CA 5L4EA 3HA4A 1KF6A 2XHEB 5LJMA 2W00A 2XM2A 2V8SV 3TLWA 5FYMA 3P50A 2X0YA 2MPKA 2X68A 4AKLA 1JNRA 3UU4A 3LJCA 3OBVE 1ZP0A 2WAUA 3TKLB 4ZOLE 2L9QA 3EDVA 2VK9A 4TV8E 2C5JA 4H9PC 1T98A 2DWGA 5LNKA 3W15B 3SS1A 4AKHA 2N9DA 1YKEB 3I1AA 1Y01A 2WMNA 4CXXA 2G0UA 1UK5A 1R8IA 5CFBA 5HWXA 3G06A 1S94A 5AQPB 3MZKB 1N32T 4C90A 4L0RA 3AE2A 3FZKB 4A98A 3FZLB 3RC8A 3N9OA 1MMAA 2AE9A 2C0SA 1KNPA 2XQ7A 4CI2B 4K0KT 4YFSA 1LVFA 3HKEE 5JREA 4HFVA 1W9RA 4COFA 3PE0A 3QOFA 2BVLA 3ONLC 4WYVA 3UU8A 3UTKA 5CA1E 3C4WA 2XJ7A 3TLUA 5EK3A 3AEFA 4LMKA 3ZLIA 4O4JE 4PJJA 3FZHB 3PUAA 5LOVE 3LK3B 4UF0B 2H7VC 3AEAA 3EVYA 3P4PA 1YD8G 1OXZA 4HWIB 2RA1A 5KMGP 1KK7A 3ZMSB 3KFWX 2QRXA 5LMNT 5JDHA 3QK6A 4YSZA 2LKGA 2MOZA 2IAKA 5H6QB 2M67A 2UXNB 4HN9A 3CVRA 4JV5T 1SA0E 1HG2A 3A5XA 5ABFA 2XSAA 4EZHA 4AIUA 2D0TA 3ONXA 4EEDA 4U72A 1HFAA 5AQQB 3B57A 2V6XA 3BQIA 4DR3T 3BK9A 3ZSSA 4PJLA 4I50E 1ZHCA 4WNKA 4IGUA 2V7JA 4V1Av 5AQLB 4AKIA 4ZI2D 2C5KT 4E7SA 3RRWA 4XAXB 1VRBA 4HFEA 4YJ2E 4X20E 3UQ4A 4DV7T 3RF1A 2XAFB 4HGAA 4UVCB 2OA5A 1ZEEA 2BS2A 2NTYA 3SRZA 2B1EA 2BKPA 2UXDT 1WCRA 2CCQA 5C8YE 3ZN1B 5LXTE 3OJAA 4ZXLA 1HNWT 3K3QC 2YN6A 3ZT7A 1EZ3A 2CLYC 5E0OA 2HPLA 1UCUA 5HEOA 2CXDA 4MALA 2V7IA 2M6BA 3CQXC 4QHOA 1WRDA 4IDPA 3CX7B 2IW5B 4H63H 1HX1B 2WZHA 3I9WA 2BS4A 3Q9DA 3KV6A 4LF9T 3MJXA 2E9XB 3I9YA 3LBXB 5HYAA 2H89A 1IBLT 3Q5DA 4CN4A 4N78D 1BR4A 3GN5B 4A5XA 3P4QA 2X9YA 4DR1T 3UU3A 2WY2A 3ETUA 5AQNB 4YHHT 1LRZA 3L09A 4P09A 1FIOA 3P4WA 1UX4A 5JRCA 4IDZA 3FB2A 4Q25A 4KP3C 1BR1A 5LHHB 2XQ8A 4PNIA 4LF8T 5JDQA 3O1IA 5CA0E 5H6RB 2YDQA 2LOPA 4IE6A 3AA0B 2QVAA 3T8OA 2BG9A 3S4UA 3V5SA 4L9IA 3LSVA 1AJ3A 3KBTA 3OVUA 1XZYA 4UVAB 3R6NA 1MIWA 3PURA 1B7TA 2KSRA 2VWAA 1SHZC 3FBLA 3ZT6A 2MTQA 3U3IA 2LE8A 5DQVA 1MMGA 2VASA 2CRBA 2DNXA 2BBJA 4HE8A 4GK0E 3PUYF 2CE7A 3AXJA 2JQKA 2ZM0A 3FHNA 4JI5T 3KDSE 4ILBA 3C51A 3F2EA 5LA6E 4WBNE 5HEGA 2V7KA 5FXZA 2ACZA 2Z6EA 5FY1A 3P7IA 3C4XA 2W67A 3F57A 2WSSV 4ILUA 5J2UE 5FY7A 1E2AA 1MIVA 4H9OC 1QUUA 3ZYLA 4TNWA 4AXPA 4JI2T 4GYRA 2HN2A 4U33A 2CBJA 3GMIA 5HCJA 2WB5A 3AE5A 3HKBE 4O8SA 2CHOA 4JI0T 3K3NA 2UU9T 4JI6T 4JBWF 2KZ7B 5JH7E 2P9BA 4X1YE 2KINB 3TLSA 4HWHA 4ZEYA 3O1JA 3VHLA 4QXCB 2XQ4A 2D5UA 3T1YT 2CPTA 4QXBB 5J1GA 4KHZF 1HCIA 4IDNA 2WDVA 2UUBT 5KX5E 2D2SA 3RYIE 1Y64B 4B3ST 2YEVC 3MA9A 4DV2T 5HEHA 5KXJA 4KHPT 1MMDA 5EK4A 1UUSA 4I43B 5ABHA 1OEDC 2DL1A 2VVNA 1W0AA 4IE4A 2W0GA 3ZYKA 5AQSB 2E9XD 4U7YA 4ILCA 4UR9A 4NIQA 2MBGA 2HHHT 2E2AA 3RYFE 4U2YA 3C98B 2MAWA 3CK6A 3RQUA 1WFDA 2V5DA 3ANWB 3FXEB 4CI1B 5HEJA 5ABGA 4HFIA 3RX6A 3BQLA 3JC6D 4MFRA 1YXRA 4Z90A 1YW0A 1ZV4X 1N36T 3WAJA 3FZMB 4DNDA 2K48A 4TV9E 2XPKA 4JYAT 1OEDA 2RP4A 3V5UA 4KMCA 4EZ4A 1I94T 2KWIB 3LK2B 3PDYA 3IBPA 1UURA 2J4GA 3MK7C 2SPCA 3EHZA 2JIWA 3KINB 2CHNA 4DO0A 3T1HT 3JAFA 5FXWA 2FBWA 2FJAA 3NBXX 2XQAA 3ABVA 4FI5A 1VCSA 4GOUA 2VURA 2VL0A 4TWFA 3L39A 3KBUA 2K3WA 3HKCE 3L8RA 3AEDA 3ZCJA 3ZMUB 5JDLA 1NEKA 4YXDA 1XDPA 2VKJA 5JQGE 2EHOB 3QB5A 2LRKA 3KV5A 4ZZBA 4UELA 1U5PA 2VQET 2LEHA 2W4XA 2CEAA 2XQ3A 5L2LA 4HFBA 2C5IT 2L8KA 5LCYA 3VR9A 4TWHA 4DMVA 2A2FX 3D0TA 3N2KE 3N9QA 4ZS3A 4CQIA 5FKYA 4HKAA 3ZSTA 5L3BB 2BG9E 1QSDA 3LFMA 3U78A 3ZT5A 3PTRB 2JQHA 4GKKT 5F8PA 2KWHA 1U4QA 5CB4E 3VKHA 3AEGA 4EYUA 3E08A 4HWCA 2YKSA 2ODUA 3SFEA 2WM9A 5AQHB 2WZIA 2YDSA 4ILAA 3M65A 2NP9A 1NAFA 4BAYB 4O2BE 4TX5A 3WI3A 2XUEA 3AA1B 3OYZA 2KT9A 1T72A 2KNDA 4AKGA 4CXWA 1T8BA 2XASB 5JR9A 5ABEA 5EK2A 2NW8A 4IT4A 3ZJ1A 4H63V 1WR0A 5AQMB 3RKGA 4H9RC 5L3CB 5F3JA 3QC9A 3PJAA 1LVKA 5IYZE 3MXZA 3RYCE 2XQ6A 3B13A 3N2OA 2BBHA 2E5LT 3AAAB 2XQYA 2KXPB 3VR8A 1D0XA 2IDOB 2CM0A 2YINA 2XSBA 2NOXA 3PUGA 5J0ZA 4UIGA 1HF8A 2X9HA 4OX9T 4DMWA 2RPAA 2V1DB 1NENA 5TAOA 4IE7A 4A97A 1MNEA 1W09A 3QNUA 5EZYE 2IC6A 2Q9QC 1ZOYA 2CBIA 3AA6B 4XBFB 3VRAA 4HWDA 2X66A 2E5VA 5CJ5A 2WP9A 5ABFB 4QKNA 2X9XA 1Z0PA 3IEEA 4AQFC 4B3RT 4JI3T 2LM2A 2J47A 3RLFF 2D9DA 4LF7T 1W0BA 2V6YA 5IWAT 4LF6T 4JLEA 3RIUC 2NWBA 2LLYA 4ADZA 4C91A 3MKDA 1DU2A 4AISA 2BG9C 4YTNA 3VKGA 3AE7A 2IIUA 2CXFA 3EDUA 1HNXT 2FUPA 3UFEA 2Q9QA 3PUSA 2PG8A 2Y48B 2K9AA 3NZPA 1IJ5A 2ZM8A 2WDQA 3AECA 2HN1A 4DR4T 1M62A 5HXEA 5HXRA 4L5GA 3M3ZB 4CN1A 2XZEA 4GK5E 2PTFA 4ZI3D 1IZNB 2VB6A 4X1KE 5LB7B 2Y8DA 2WU2A 4AQFA 3TLVA 4O4IE 4DUZT 4HWFA 3LDQB 3ZC0A 2WMOA 1IAPA 4PFPA 4NUUA 2UXCT 3DJBA 3I0OA 3RIUA 1OEDE 1KFYA 3P4SA 4WZXA 5CGMA 2V26A 2QYWA 1KEYA 5JDGA 3AAIA 2ACXA 2CA5A 3JCFA 3N5LA 3UUBA 3ZN0B 4HFCA 2X0LB 4YLHA 3AEBA 3RIFA 3H3AA 4PK6A 4AQGA 5FP3A 5IUXA 2CLYB 2XAGB 2LSJA 5JRCB 3J9X1 1XMOT 2VQFT 4K0UA 5L47A 4OYJA 4NXNT 4DVDA 4KI0F 4DR2T 3N9PA 3OKQA 2LHNA 4NUVA 4YJ3E 1D1CA 3K1SA 3EI0A 3N9LA 1HS7A 3UUMA 4DV5T 1XNRT 5J2TE 3PUQA 1VOMA 5AQJB 2BG9B 1N33T 5LHGB 3N9NA 1O3XA 2JQ9A 3LG7A 2DCFA 5JVDE 2WDRA 2LHRA 5AQUB 2XAHB 4GYSA 2N1GA 3UQ7A 4ZI2C 3GWHA 4EEBA 2ZM6T 2YK0A 2IC9A 2HPJA 3PJAJ 4BJNA 5L3FB 1KNZA 3A7MA 2DHRA 4JEHB 5HEUA 3AXJB 4PW8A 2UUAT 1HG5A 3RIAA 4DV6T 1Z8UA 3ONJA 5AQKB 1MNDA 4YHJA 2W61A 3UULA 1US7B 3RHWA 5LG3A 3ESLA 2XQ9A 1FMWA 2VKOA 1D0ZA 1YQ4A 2W66A 4ISSA 4UV9B 2I6HA 2H88A 3ZCIA 4I55E 4IL9A 4LMLA 1E7PA 2CXLA 3SWHA 4YSYA 3UUXB 4O2AE 2CWYA 3RPUA 5FXVA 3PUXF 5BR8T 3J7Yq 4YTPA 3WAKA 4M1PA 4BJMA 4PFOA 4U7IA 4P0BA 3OTOT 1IBKT 4Z91A 3HR0A 3MACA 4PJNA 4I0UA 2QGSA 4JI1T 4FJOA 3C50A 2L3LA 2JJ9A 2OLTA 2XQ5A 3AE3A 4B3MT 3ZEFB 2ES0A 5L3GB 3KV9A 1XMQT 4UV8B 3CKDA 3P4RA 2CWOA 1VCTA 2MYSA 3IF8B 1H7CA 3Q5WA 1J5ET 1E1HB 4KUMB 4DV1T 4UXNB 3UFGA 1CHUA 4AQYT 3E22E 3OYXA 5AQRB 1G73A 5GONE 3NWIA 2ZLYA 3RKOA 5AQVB 2UUCT 2XM1A 1D1AA 3FXDB 5LMUT 2D0UA 5FL1A 2X67A 1M7KA 1FMVA 4NPPA 1N34T 1J1JA 2PJQA 2WCAA 2IUBA 4AKRB 5F5WA 4ASKA 2I0MA 3EABA 3OPCA 4JI4T 5HWYA 4EV6A 3UUNA 3DTOA 4ERRA 4DV0T 2LRLA 4JI8T 1XDOA 2PFVA 1X79A 3CX6B 1QLBA 2VKDA 3ZMTB 4LF4T 3AE4A 4CXYA 3NRXA 2DWKA 2LJLA 2H7OA 3AVRA 4U3CA 2XAQB 1S35A 2JQQA 4H9QC 1CUNA 3CQGB 4IE0A 1OEDB 3Q5EA 4DR5T 3RC3A 4BA9A 4P0AA 3ZC1A 1YKHB 5ADXL 4UF0A 2V7MA 3VRBA 3A8YC 2H3RA 2WU5A 5JR9C 4HFHA 1SE7A 2UXXB 4DR6T 5HXSA 3CPZA 5C3JA 2V7LA 5HCMA 4DIDB 1L0VA 5FL0A 3H37A 3JAEA 3F31A 1MIYA 4LFAT 4X1IE 4JI7T 3Q2MA 3NZQA 2NTXA 1IBMT 2BDEA 4ZS2A 2AXDS 4B3TT 4NXMT 4X66T 2CMRA 5LBQB 1G8XA 3AA7B 5LGNB 1NWMX
chains in the Genus database with same CATH topology
4JI2T 2HHHT 5BR8T 4JI4T 4DV0T 4JI8T 1HNZT 2E5LT 4DV7T 4DR4T 4DV5T 1XNRT 4DV4T 3OTOT 4LF8T 4GKJT 1IBKT 4X64T 1N33T 4LF4T 4JI0T 4OX9T 2UXDT 2UU9T 4JI6T 4JI1T 4B3MT 4X62T 1N36T 4DR5T 2VQET 4DR7T 2UXBT 1HR0T 2ZM6T 1HNWT 4DUZT 4JYAT 1XMQT 4GKKT 4DV3T 2UXCT 3T1YT 1I94T 2UUAT 5LMNT 4DV6T 4X65T 1J5ET 4DV1T 1FJGT 2UUBT 4DR6T 4JV5T 4B3ST 4AQYT 3T1HT 4LF5T 4JI5T 4DV2T 4KHPT 1N32T 4LFAT 4B3RT 4LF9T 4JI7T 2UUCT 1XNQT 4JI3T 2F4VT 1IBLT 1IBMT 4LF7T 5IWAT 4LF6T 4DR3T 5LMUT 4B3TT 4DR1T 4YY3T 4NXMT 4X66T 4K0KT 4YHHT 4LFBT 1N34T 1XMOT 4DUYT 2VQFT 4NXNT 4LFCT 4DR2T 1HNXT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 T;  2HHH T;  5BR8 T;  4JI4 T;  4DV0 T;  4JI8 T;  1HNZ T;  2E5L T;  4DV7 T;  4DR4 T;  4DV5 T;  1XNR T;  4DV4 T;  3OTO T;  4LF8 T;  4GKJ T;  1IBK T;  4X64 T;  1N33 T;  4LF4 T;  4JI0 T;  4OX9 T;  2UXD T;  2UU9 T;  4JI6 T;  4JI1 T;  4B3M T;  4X62 T;  1N36 T;  4DR5 T;  2VQE T;  4DR7 T;  2UXB T;  1HR0 T;  2ZM6 T;  1HNW T;  4DUZ T;  4JYA T;  1XMQ T;  4GKK T;  4DV3 T;  2UXC T;  3T1Y T;  1I94 T;  2UUA T;  5LMN T;  4DV6 T;  4X65 T;  1J5E T;  4DV1 T;  1FJG T;  2UUB T;  4DR6 T;  4JV5 T;  4B3S T;  4AQY T;  3T1H T;  4LF5 T;  4JI5 T;  4DV2 T;  4KHP T;  1N32 T;  4LFA T;  4B3R T;  4LF9 T;  4JI7 T;  2UUC T;  1XNQ T;  4JI3 T;  2F4V T;  1IBL T;  1IBM T;  4LF7 T;  5IWA T;  4LF6 T;  4DR3 T;  5LMU T;  4B3T T;  4DR1 T;  4YY3 T;  4NXM T;  4X66 T;  4K0K T;  4YHH T;  4LFB T;  1N34 T;  1XMO T;  4DUY T;  2VQF T;  4NXN T;  4LFC T;  4DR2 T;  1HNX T; 
#chains in the Genus database with same CATH topology
 3LK4 2;  4TWD A;  5FY0 A;  3NVO A;  1D0Y A;  3CIR A;  4EYY R;  1ZKE A;  3KV4 A;  4QX8 B;  4MHC A;  4YT0 A;  2E9X C;  4B6X A;  2Y6X A;  4EOZ B;  2KMF A;  4I4T E;  2X51 A;  4QWN B;  4TUY E;  5L3D B;  4TZ4 C;  4KBM B;  3QUJ A;  2XY8 B;  4QH5 A;  2WS3 A;  2JPF A;  2LSI A;  4QXH B;  4IIJ E;  3P8C D;  1WYC A;  2WBL A;  4QX7 B;  3KVA A;  3AB3 B;  5AQT B;  2LM9 A;  2LT3 A;  3I0Q A;  2HH7 A;  3TLT A;  1FJG T;  4QH4 A;  3CML A;  3JC6 C;  3HL6 A;  1BR0 A;  4Z8X A;  2A3D A;  2PBI A;  4CZZ B;  1V9D A;  4TNV A;  2NR4 A;  2IHR 1;  1I6Z A;  3UU5 A;  5FNV E;  2R6G F;  5JR9 B;  4WBO A;  4MBQ A;  5DAB A;  2E9X A;  3LBX A;  5FXX A;  2LOS A;  3UU6 A;  4WW0 A;  5LJN A;  4PK5 A;  3GN5 A;  1UGO A;  5LGU B;  4U2Z A;  5FVL A;  4G2A A;  3SFD A;  2GK9 A;  1KNR A;  3X1D A;  4EGW A;  5HXC A;  4ZI7 E;  5DQW A;  1HNZ T;  4EXT A;  2ZM2 A;  3VU7 H;  5JDF A;  2W62 A;  3PU3 A;  2DI4 A;  3CWZ B;  4AI6 A;  5LGT B;  3QB5 K;  4OHF A;  2N2N A;  4UVB B;  2EHO D;  2K5B B;  2LSG A;  3ZPO A;  2A9U A;  4ANJ A;  3JAD A;  4HEA A;  5LG4 A;  2XAJ B;  4IST A;  3O9X A;  2J62 A;  4ZZC A;  3PU8 A;  2VVS A;  3CQC B;  2XTL A;  3PV0 F;  2V5C A;  4O4L E;  4LF5 T;  4PK4 A;  4G63 A;  2V6Y B;  3E0Z A;  3PUZ F;  4QH1 A;  2BVM A;  2NW7 A;  2JMK A;  3UT5 E;  3EAM A;  1YQ3 A;  1T7S A;  3IA3 A;  2BKN A;  3R84 B;  2LSY A;  4EIW A;  2E8I A;  4JUY A;  2LSK A;  5HAX A;  4KX6 A;  4OFZ A;  2Q9Q B;  1WYB A;  4ZHQ E;  3C64 A;  1MMN A;  4PJM A;  4U31 A;  5DJQ C;  5ETW A;  2QA7 A;  4IE5 A;  5LP6 E;  3RQW A;  2K24 A;  4HFD A;  4PAG A;  4OYK A;  4YTM A;  3PUW F;  4DV4 T;  2KLQ A;  3SOL A;  4X64 T;  3NRY A;  5A1L A;  3DP7 A;  3ZKR A;  1XWM A;  3K8P C;  3BQK A;  2YU2 A;  2W63 A;  4IDQ A;  4MLK A;  1GQE A;  2A72 A;  1WR6 A;  1OWA A;  5JDN A;  2UXB T;  3N9M A;  1HR0 T;  1D1B A;  1X9B A;  3IHR A;  3GA8 A;  1UX5 A;  4O4H E;  4DV3 T;  5AQG B;  3O4X E;  2OV9 A;  5AQI B;  2VL8 A;  2DLR A;  5LBM A;  3CX8 B;  3FZF B;  4IL4 A;  2X9W A;  4X65 T;  1LKX A;  5AFU L;  5HXH A;  3EUH A;  2JRK A;  4EAH A;  5BMV E;  3RGL A;  2VKH A;  3RRC A;  3HI2 A;  4P1N A;  2ODV A;  3O1H A;  1XNQ T;  2BS3 A;  2WWV A;  4EB6 E;  4UEM A;  4IDO A;  1JNZ A;  4DBR A;  1SUM B;  5JTG A;  3FBZ A;  2JMH A;  3NKZ A;  4CN6 A;  3AAE B;  4A56 A;  3AEE A;  3KVB A;  3K3O A;  3PUV F;  3ZMZ B;  4YSX A;  1IJ6 A;  5KDM C;  4DBQ A;  3B5M A;  4OK0 A;  4GKJ T;  2YU1 A;  5AQO B;  5LYJ E;  2FJB A;  3ANW A;  4E7Z A;  2FJD A;  3HKD E;  4X62 T;  4IRE A;  2YDR A;  1HTJ F;  4DR7 T;  3Q5X A;  3ZMV B;  3ETV A;  3AE6 A;  2EHO C;  3RI5 A;  2BZB A;  2I59 A;  5JDM A;  5L3E B;  4F8H A;  3AVS A;  3L3P A;  3N2G E;  5FVK A;  4F6R C;  3ZJ2 A;  5L4H A;  3ZYM A;  4XZC A;  3RH3 A;  2J1D G;  5AQF B;  4ZI3 C;  2W2U A;  4H9S E;  2FJE A;  2WQY A;  3AE1 A;  4X5T A;  5M4Y A;  5IHY A;  5C2T A;  2YOE A;  5FMN A;  1WLX A;  2F4V T;  2NW9 A;  3AE8 A;  4IHJ E;  2BKO A;  1BR2 A;  4YY3 T;  3RYH E;  3C4Z A;  4CI3 B;  2X0H A;  4LFB T;  1J5W A;  4HTE A;  2M6I A;  2WWU A;  2B76 A;  1HX8 A;  4LMJ A;  4DUY T;  5LHI B;  1FEW A;  4TN7 B;  4LFC T;  3H3M A;  4GIW A;  2IML A;  2EHO A;  2Q9Q D;  2LKH A;  4U74 A;  2ZMA A;  3AE9 A;  4H9N C;  4JEU B;  4J2C A;  5L4E A;  3HA4 A;  1KF6 A;  2XHE B;  5LJM A;  2W00 A;  2XM2 A;  2V8S V;  3TLW A;  5FYM A;  3P50 A;  2X0Y A;  2MPK A;  2X68 A;  4AKL A;  1JNR A;  3UU4 A;  3LJC A;  3OBV E;  1ZP0 A;  2WAU A;  3TKL B;  4ZOL E;  2L9Q A;  3EDV A;  2VK9 A;  4TV8 E;  2C5J A;  4H9P C;  1T98 A;  2DWG A;  5LNK A;  3W15 B;  3SS1 A;  4AKH A;  2N9D A;  1YKE B;  3I1A A;  1Y01 A;  2WMN A;  4CXX A;  2G0U A;  1UK5 A;  1R8I A;  5CFB A;  5HWX A;  3G06 A;  1S94 A;  5AQP B;  3MZK B;  1N32 T;  4C90 A;  4L0R A;  3AE2 A;  3FZK B;  4A98 A;  3FZL B;  3RC8 A;  3N9O A;  1MMA A;  2AE9 A;  2C0S A;  1KNP A;  2XQ7 A;  4CI2 B;  4K0K T;  4YFS A;  1LVF A;  3HKE E;  5JRE A;  4HFV A;  1W9R A;  4COF A;  3PE0 A;  3QOF A;  2BVL A;  3ONL C;  4WYV A;  3UU8 A;  3UTK A;  5CA1 E;  3C4W A;  2XJ7 A;  3TLU A;  5EK3 A;  3AEF A;  4LMK A;  3ZLI A;  4O4J E;  4PJJ A;  3FZH B;  3PUA A;  5LOV E;  3LK3 B;  4UF0 B;  2H7V C;  3AEA A;  3EVY A;  3P4P A;  1YD8 G;  1OXZ A;  4HWI B;  2RA1 A;  5KMG P;  1KK7 A;  3ZMS B;  3KFW X;  2QRX A;  5LMN T;  5JDH A;  3QK6 A;  4YSZ A;  2LKG A;  2MOZ A;  2IAK A;  5H6Q B;  2M67 A;  2UXN B;  4HN9 A;  3CVR A;  4JV5 T;  1SA0 E;  1HG2 A;  3A5X A;  5ABF A;  2XSA A;  4EZH A;  4AIU A;  2D0T A;  3ONX A;  4EED A;  4U72 A;  1HFA A;  5AQQ B;  3B57 A;  2V6X A;  3BQI A;  4DR3 T;  3BK9 A;  3ZSS A;  4PJL A;  4I50 E;  1ZHC A;  4WNK A;  4IGU A;  2V7J A;  4V1A v;  5AQL B;  4AKI A;  4ZI2 D;  2C5K T;  4E7S A;  3RRW A;  4XAX B;  1VRB A;  4HFE A;  4YJ2 E;  4X20 E;  3UQ4 A;  4DV7 T;  3RF1 A;  2XAF B;  4HGA A;  4UVC B;  2OA5 A;  1ZEE A;  2BS2 A;  2NTY A;  3SRZ A;  2B1E A;  2BKP A;  2UXD T;  1WCR A;  2CCQ A;  5C8Y E;  3ZN1 B;  5LXT E;  3OJA A;  4ZXL A;  1HNW T;  3K3Q C;  2YN6 A;  3ZT7 A;  1EZ3 A;  2CLY C;  5E0O A;  2HPL A;  1UCU A;  5HEO A;  2CXD A;  4MAL A;  2V7I A;  2M6B A;  3CQX C;  4QHO A;  1WRD A;  4IDP A;  3CX7 B;  2IW5 B;  4H63 H;  1HX1 B;  2WZH A;  3I9W A;  2BS4 A;  3Q9D A;  3KV6 A;  4LF9 T;  3MJX A;  2E9X B;  3I9Y A;  3LBX B;  5HYA A;  2H89 A;  1IBL T;  3Q5D A;  4CN4 A;  4N78 D;  1BR4 A;  3GN5 B;  4A5X A;  3P4Q A;  2X9Y A;  4DR1 T;  3UU3 A;  2WY2 A;  3ETU A;  5AQN B;  4YHH T;  1LRZ A;  3L09 A;  4P09 A;  1FIO A;  3P4W A;  1UX4 A;  5JRC A;  4IDZ A;  3FB2 A;  4Q25 A;  4KP3 C;  1BR1 A;  5LHH B;  2XQ8 A;  4PNI A;  4LF8 T;  5JDQ A;  3O1I A;  5CA0 E;  5H6R B;  2YDQ A;  2LOP A;  4IE6 A;  3AA0 B;  2QVA A;  3T8O A;  2BG9 A;  3S4U A;  3V5S A;  4L9I A;  3LSV A;  1AJ3 A;  3KBT A;  3OVU A;  1XZY A;  4UVA B;  3R6N A;  1MIW A;  3PUR A;  1B7T A;  2KSR A;  2VWA A;  1SHZ C;  3FBL A;  3ZT6 A;  2MTQ A;  3U3I A;  2LE8 A;  5DQV A;  1MMG A;  2VAS A;  2CRB A;  2DNX A;  2BBJ A;  4HE8 A;  4GK0 E;  3PUY F;  2CE7 A;  3AXJ A;  2JQK A;  2ZM0 A;  3FHN A;  4JI5 T;  3KDS E;  4ILB A;  3C51 A;  3F2E A;  5LA6 E;  4WBN E;  5HEG A;  2V7K A;  5FXZ A;  2ACZ A;  2Z6E A;  5FY1 A;  3P7I A;  3C4X A;  2W67 A;  3F57 A;  2WSS V;  4ILU A;  5J2U E;  5FY7 A;  1E2A A;  1MIV A;  4H9O C;  1QUU A;  3ZYL A;  4TNW A;  4AXP A;  4JI2 T;  4GYR A;  2HN2 A;  4U33 A;  2CBJ A;  3GMI A;  5HCJ A;  2WB5 A;  3AE5 A;  3HKB E;  4O8S A;  2CHO A;  4JI0 T;  3K3N A;  2UU9 T;  4JI6 T;  4JBW F;  2KZ7 B;  5JH7 E;  2P9B A;  4X1Y E;  2KIN B;  3TLS A;  4HWH A;  4ZEY A;  3O1J A;  3VHL A;  4QXC B;  2XQ4 A;  2D5U A;  3T1Y T;  2CPT A;  4QXB B;  5J1G A;  4KHZ F;  1HCI A;  4IDN A;  2WDV A;  2UUB T;  5KX5 E;  2D2S A;  3RYI E;  1Y64 B;  4B3S T;  2YEV C;  3MA9 A;  4DV2 T;  5HEH A;  5KXJ A;  4KHP T;  1MMD A;  5EK4 A;  1UUS A;  4I43 B;  5ABH A;  1OED C;  2DL1 A;  2VVN A;  1W0A A;  4IE4 A;  2W0G A;  3ZYK A;  5AQS B;  2E9X D;  4U7Y A;  4ILC A;  4UR9 A;  4NIQ A;  2MBG A;  2HHH T;  2E2A A;  3RYF E;  4U2Y A;  3C98 B;  2MAW A;  3CK6 A;  3RQU A;  1WFD A;  2V5D A;  3ANW B;  3FXE B;  4CI1 B;  5HEJ A;  5ABG A;  4HFI A;  3RX6 A;  3BQL A;  3JC6 D;  4MFR A;  1YXR A;  4Z90 A;  1YW0 A;  1ZV4 X;  1N36 T;  3WAJ A;  3FZM B;  4DND A;  2K48 A;  4TV9 E;  2XPK A;  4JYA T;  1OED A;  2RP4 A;  3V5U A;  4KMC A;  4EZ4 A;  1I94 T;  2KWI B;  3LK2 B;  3PDY A;  3IBP A;  1UUR A;  2J4G A;  3MK7 C;  2SPC A;  3EHZ A;  2JIW A;  3KIN B;  2CHN A;  4DO0 A;  3T1H T;  3JAF A;  5FXW A;  2FBW A;  2FJA A;  3NBX X;  2XQA A;  3ABV A;  4FI5 A;  1VCS A;  4GOU A;  2VUR A;  2VL0 A;  4TWF A;  3L39 A;  3KBU A;  2K3W A;  3HKC E;  3L8R A;  3AED A;  3ZCJ A;  3ZMU B;  5JDL A;  1NEK A;  4YXD A;  1XDP A;  2VKJ A;  5JQG E;  2EHO B;  3QB5 A;  2LRK A;  3KV5 A;  4ZZB A;  4UEL A;  1U5P A;  2VQE T;  2LEH A;  2W4X A;  2CEA A;  2XQ3 A;  5L2L A;  4HFB A;  2C5I T;  2L8K A;  5LCY A;  3VR9 A;  4TWH A;  4DMV A;  2A2F X;  3D0T A;  3N2K E;  3N9Q A;  4ZS3 A;  4CQI A;  5FKY A;  4HKA A;  3ZST A;  5L3B B;  2BG9 E;  1QSD A;  3LFM A;  3U78 A;  3ZT5 A;  3PTR B;  2JQH A;  4GKK T;  5F8P A;  2KWH A;  1U4Q A;  5CB4 E;  3VKH A;  3AEG A;  4EYU A;  3E08 A;  4HWC A;  2YKS A;  2ODU A;  3SFE A;  2WM9 A;  5AQH B;  2WZI A;  2YDS A;  4ILA A;  3M65 A;  2NP9 A;  1NAF A;  4BAY B;  4O2B E;  4TX5 A;  3WI3 A;  2XUE A;  3AA1 B;  3OYZ A;  2KT9 A;  1T72 A;  2KND A;  4AKG A;  4CXW A;  1T8B A;  2XAS B;  5JR9 A;  5ABE A;  5EK2 A;  2NW8 A;  4IT4 A;  3ZJ1 A;  4H63 V;  1WR0 A;  5AQM B;  3RKG A;  4H9R C;  5L3C B;  5F3J A;  3QC9 A;  3PJA A;  1LVK A;  5IYZ E;  3MXZ A;  3RYC E;  2XQ6 A;  3B13 A;  3N2O A;  2BBH A;  2E5L T;  3AAA B;  2XQY A;  2KXP B;  3VR8 A;  1D0X A;  2IDO B;  2CM0 A;  2YIN A;  2XSB A;  2NOX A;  3PUG A;  5J0Z A;  4UIG A;  1HF8 A;  2X9H A;  4OX9 T;  4DMW A;  2RPA A;  2V1D B;  1NEN A;  5TAO A;  4IE7 A;  4A97 A;  1MNE A;  1W09 A;  3QNU A;  5EZY E;  2IC6 A;  2Q9Q C;  1ZOY A;  2CBI A;  3AA6 B;  4XBF B;  3VRA A;  4HWD A;  2X66 A;  2E5V A;  5CJ5 A;  2WP9 A;  5ABF B;  4QKN A;  2X9X A;  1Z0P A;  3IEE A;  4AQF C;  4B3R T;  4JI3 T;  2LM2 A;  2J47 A;  3RLF F;  2D9D A;  4LF7 T;  1W0B A;  2V6Y A;  5IWA T;  4LF6 T;  4JLE A;  3RIU C;  2NWB A;  2LLY A;  4ADZ A;  4C91 A;  3MKD A;  1DU2 A;  4AIS A;  2BG9 C;  4YTN A;  3VKG A;  3AE7 A;  2IIU A;  2CXF A;  3EDU A;  1HNX T;  2FUP A;  3UFE A;  2Q9Q A;  3PUS A;  2PG8 A;  2Y48 B;  2K9A A;  3NZP A;  1IJ5 A;  2ZM8 A;  2WDQ A;  3AEC A;  2HN1 A;  4DR4 T;  1M62 A;  5HXE A;  5HXR A;  4L5G A;  3M3Z B;  4CN1 A;  2XZE A;  4GK5 E;  2PTF A;  4ZI3 D;  1IZN B;  2VB6 A;  4X1K E;  5LB7 B;  2Y8D A;  2WU2 A;  4AQF A;  3TLV A;  4O4I E;  4DUZ T;  4HWF A;  3LDQ B;  3ZC0 A;  2WMO A;  1IAP A;  4PFP A;  4NUU A;  2UXC T;  3DJB A;  3I0O A;  3RIU A;  1OED E;  1KFY A;  3P4S A;  4WZX A;  5CGM A;  2V26 A;  2QYW A;  1KEY A;  5JDG A;  3AAI A;  2ACX A;  2CA5 A;  3JCF A;  3N5L A;  3UUB A;  3ZN0 B;  4HFC A;  2X0L B;  4YLH A;  3AEB A;  3RIF A;  3H3A A;  4PK6 A;  4AQG A;  5FP3 A;  5IUX A;  2CLY B;  2XAG B;  2LSJ A;  5JRC B;  3J9X 1;  1XMO T;  2VQF T;  4K0U A;  5L47 A;  4OYJ A;  4NXN T;  4DVD A;  4KI0 F;  4DR2 T;  3N9P A;  3OKQ A;  2LHN A;  4NUV A;  4YJ3 E;  1D1C A;  3K1S A;  3EI0 A;  3N9L A;  1HS7 A;  3UUM A;  4DV5 T;  1XNR T;  5J2T E;  3PUQ A;  1VOM A;  5AQJ B;  2BG9 B;  1N33 T;  5LHG B;  3N9N A;  1O3X A;  2JQ9 A;  3LG7 A;  2DCF A;  5JVD E;  2WDR A;  2LHR A;  5AQU B;  2XAH B;  4GYS A;  2N1G A;  3UQ7 A;  4ZI2 C;  3GWH A;  4EEB A;  2ZM6 T;  2YK0 A;  2IC9 A;  2HPJ A;  3PJA J;  4BJN A;  5L3F B;  1KNZ A;  3A7M A;  2DHR A;  4JEH B;  5HEU A;  3AXJ B;  4PW8 A;  2UUA T;  1HG5 A;  3RIA A;  4DV6 T;  1Z8U A;  3ONJ A;  5AQK B;  1MND A;  4YHJ A;  2W61 A;  3UUL A;  1US7 B;  3RHW A;  5LG3 A;  3ESL A;  2XQ9 A;  1FMW A;  2VKO A;  1D0Z A;  1YQ4 A;  2W66 A;  4ISS A;  4UV9 B;  2I6H A;  2H88 A;  3ZCI A;  4I55 E;  4IL9 A;  4LML A;  1E7P A;  2CXL A;  3SWH A;  4YSY A;  3UUX B;  4O2A E;  2CWY A;  3RPU A;  5FXV A;  3PUX F;  5BR8 T;  3J7Y q;  4YTP A;  3WAK A;  4M1P A;  4BJM A;  4PFO A;  4U7I A;  4P0B A;  3OTO T;  1IBK T;  4Z91 A;  3HR0 A;  3MAC A;  4PJN A;  4I0U A;  2QGS A;  4JI1 T;  4FJO A;  3C50 A;  2L3L A;  2JJ9 A;  2OLT A;  2XQ5 A;  3AE3 A;  4B3M T;  3ZEF B;  2ES0 A;  5L3G B;  3KV9 A;  1XMQ T;  4UV8 B;  3CKD A;  3P4R A;  2CWO A;  1VCT A;  2MYS A;  3IF8 B;  1H7C A;  3Q5W A;  1J5E T;  1E1H B;  4KUM B;  4DV1 T;  4UXN B;  3UFG A;  1CHU A;  4AQY T;  3E22 E;  3OYX A;  5AQR B;  1G73 A;  5GON E;  3NWI A;  2ZLY A;  3RKO A;  5AQV B;  2UUC T;  2XM1 A;  1D1A A;  3FXD B;  5LMU T;  2D0U A;  5FL1 A;  2X67 A;  1M7K A;  1FMV A;  4NPP A;  1N34 T;  1J1J A;  2PJQ A;  2WCA A;  2IUB A;  4AKR B;  5F5W A;  4ASK A;  2I0M A;  3EAB A;  3OPC A;  4JI4 T;  5HWY A;  4EV6 A;  3UUN A;  3DTO A;  4ERR A;  4DV0 T;  2LRL A;  4JI8 T;  1XDO A;  2PFV A;  1X79 A;  3CX6 B;  1QLB A;  2VKD A;  3ZMT B;  4LF4 T;  3AE4 A;  4CXY A;  3NRX A;  2DWK A;  2LJL A;  2H7O A;  3AVR A;  4U3C A;  2XAQ B;  1S35 A;  2JQQ A;  4H9Q C;  1CUN A;  3CQG B;  4IE0 A;  1OED B;  3Q5E A;  4DR5 T;  3RC3 A;  4BA9 A;  4P0A A;  3ZC1 A;  1YKH B;  5ADX L;  4UF0 A;  2V7M A;  3VRB A;  3A8Y C;  2H3R A;  2WU5 A;  5JR9 C;  4HFH A;  1SE7 A;  2UXX B;  4DR6 T;  5HXS A;  3CPZ A;  5C3J A;  2V7L A;  5HCM A;  4DID B;  1L0V A;  5FL0 A;  3H37 A;  3JAE A;  3F31 A;  1MIY A;  4LFA T;  4X1I E;  4JI7 T;  3Q2M A;  3NZQ A;  2NTX A;  1IBM T;  2BDE A;  4ZS2 A;  2AXD S;  4B3T T;  4NXM T;  4X66 T;  2CMR A;  5LBQ B;  1G8X A;  3AA7 B;  5LGN B;  1NWM X; 
#chains in the Genus database with same CATH homology
 4JI2 T;  2HHH T;  5BR8 T;  4JI4 T;  4DV0 T;  4JI8 T;  1HNZ T;  2E5L T;  4DV7 T;  4DR4 T;  4DV5 T;  1XNR T;  4DV4 T;  3OTO T;  4LF8 T;  4GKJ T;  1IBK T;  4X64 T;  1N33 T;  4LF4 T;  4JI0 T;  4OX9 T;  2UXD T;  2UU9 T;  4JI6 T;  4JI1 T;  4B3M T;  4X62 T;  1N36 T;  4DR5 T;  2VQE T;  4DR7 T;  2UXB T;  1HR0 T;  2ZM6 T;  1HNW T;  4DUZ T;  4JYA T;  1XMQ T;  4GKK T;  4DV3 T;  2UXC T;  3T1Y T;  1I94 T;  2UUA T;  5LMN T;  4DV6 T;  4X65 T;  1J5E T;  4DV1 T;  1FJG T;  2UUB T;  4DR6 T;  4JV5 T;  4B3S T;  4AQY T;  3T1H T;  4LF5 T;  4JI5 T;  4DV2 T;  4KHP T;  1N32 T;  4LFA T;  4B3R T;  4LF9 T;  4JI7 T;  2UUC T;  1XNQ T;  4JI3 T;  2F4V T;  1IBL T;  1IBM T;  4LF7 T;  5IWA T;  4LF6 T;  4DR3 T;  5LMU T;  4B3T T;  4DR1 T;  4YY3 T;  4NXM T;  4X66 T;  4K0K T;  4YHH T;  4LFB T;  1N34 T;  1XMO T;  4DUY T;  2VQF T;  4NXN T;  4LFC T;  4DR2 T;  1HNX T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...