4X64T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 32
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4x64T00
5LMNT 4DUZT 3T1YT 4YY3T 4DV1T 4B3TT 1IBKT 4AQYT 4DR1T 1XMOT 4LF4T 4JV5T 4LF9T 4B3RT 4NXNT 4JI8T 4LFAT 4DV3T 4GKKT 4K0KT 1HNZT 4X62T 4OX9T 2UUCT 4DV5T 1XMQT 4LF7T 5IWAT 1N34T 1J5ET 2UXDT 4LF5T 4DR5T 4JI2T 3T1HT 5BR8T 4JI0T 2UU9T 4DR4T 4DV6T 1HNWT 4LFBT 1I94T 4LFCT 2UUAT 4DUYT 4DV4T 4X64T 4DV0T 4DV2T 4YHHT 1XNQT 4DR3T 1N36T 4DR7T 4GKJT 1XNRT 4DR2T 4B3ST 4X66T 3OTOT 2E5LT 1FJGT 4JYAT 4LF6T 1IBMT 2ZM6T 2HHHT 4B3MT 4JI1T 4JI7T 1HR0T 4NXMT 4JI6T 1IBLT 2VQET 4JI5T 2UXBT 2UXCT 2VQFT 4KHPT 1N33T 4X65T 2F4VT 4LF8T 1N32T 4JI3T 1HNXT 4JI4T 4DR6T 5LMUT 4DV7T 2UUBT
chains in the Genus database with same CATH superfamily
1E1HB 2KT9A 4OK0A 3C4XA 3IHRA 4AQYT 5FY1A 3Q5DA 1UX5A 3AVSA 2DI4A 4PW8A 3IA3A 4WBOA 3PJAJ 2XQ3A 2V6XA 3UQ7A 3PUGA 2ZMAA 3UTKA 3C50A 3CWZB 3O4XE 4DR5T 4QXBB 5FY0A 3UU8A 2WQYA 3P8CD 4U72A 4UF0B 4ZHQE 3AEEA 3E0ZA 5LHIB 1XNQT 2D9DA 3QOFA 5JDFA 5JH7E 4K0UA 3QUJA 3UUMA 5LOVE 5JDLA 3HL6A 3R6NA 4DMVA 2E9XA 2VKOA 4TN7B 5HXRA 3I9WA 3AB3B 4E7SA 4ZI7E 2ACXA 4H9RC 4KP3C 2VQFT 3HKDE 4I55E 5DQWA 3CQGB 1JNZA 5IYZE 5KMGP 1HNXT 4YHJA 5KXJA 2X51A 5J2UE 5JREA 5LHGB 2IC9A 1MIYA 3B57A 3KV4A 5AFUL 5L3EB 3P50A 3CX7B 2W00A 3HI2A 1O3XA 4KHZF 1ZV4X 4ZI2C 4QKNA 1D1AA 2VVNA 2P9BA 5FYMA 4A56A 4IIJE 4ASKA 1KNPA 2JQHA 4EEBA 2IW5B 3GN5B 2WWUA 3KBTA 4KBMB 5HEOA 1V9DA 2CMRA 3AXJA 4XBFB 1BR0A 3AA7B 2CEAA 3RRCA 3P4RA 1X79A 4O4IE 4LMJA 3RIAA 4CXWA 4ILBA 4Z90A 3RRWA 3K3OA 2YDQA 4BAYB 3CPZA 2FUPA 4JUYA 4PJNA 2LSKA 4HN9A 3N9MA 4JLEA 4PJMA 2Y6XA 1YQ3A 5DJQC 4X65T 1JNRA 4AXPA 4M1PA 2G0UA 4JI3T 5F8PA 3ONJA 5FXWA 4GIWA 4AIUA 2JIWA 3JAEA 4DBQA 2XASB 2WU5A 5AQLB 3ZT6A 3OPCA 4YSZA 4EGWA 4CQIA 5AQRB 3ZYLA 4K0KT 4ZI3C 4ANJA 3AEBA 2PJQA 4QXCB 4CN6A 1XMQT 2XSBA 1N34T 2UXDT 3IF8B 2FJEA 1YKEB 2K48A 2PG8A 2IIUA 3QC9A 1WR0A 3ETVA 5HXCA 4ZI2D 5LXTE 5FVLA 2X68A 3MJXA 4QXHB 4QWNB 2VURA 4I0UA 3BK9A 3U78A 2E5LT 5AQUB 5F3JA 2Q9QA 3UUBA 3DTOA 2FJDA 3UFEA 3H3AA 1D1BA 4JI7T 3AE9A 2HPLA 2Q9QD 2CBJA 3PDYA 5ABHA 4A98A 5J1GA 3AE6A 3F31A 1VCSA 2LOSA 5HWXA 3QB5K 4O4JE 2FBWA 5KX5E 3O1IA 3G06A 5LG4A 2VASA 1OWAA 4DUZT 4ZS3A 1S35A 4UELA 2BBJA 3RYHE 3PUVF 4B3TT 4A5XA 2CHOA 1D1CA 4JV5T 4B3RT 2E2AA 2IAKA 1MIVA 2NW9A 4I43B 1VOMA 3RGLA 4NPPA 4ISTA 3RKOA 4X62T 3PJAA 2IDOB 4MBQA 2M6BA 2QRXA 2DCFA 3O1JA 3MACA 2C5KT 3KV9A 2HPJA 1U4QA 1J1JA 1I94T 1YW0A 2JJ9A 4AISA 4FI5A 2KWIB 3O9XA 3P4QA 2X9YA 1GQEA 1LVKA 3KINB 4J2CA 3AECA 1BR1A 5JDQA 5AQOB 3A5XA 4AKLA 1KNZA 3U3IA 1YD8G 3EI0A 5L3GB 4ISSA 3ZMTB 1IBLT 5JVDE 4G63A 3WI3A 3AE1A 3EABA 5JRCA 1Y64B 3FZKB 1T98A 2W61A 3C64A 5DQVA 3ETUA 3MXZA 1YXRA 3VR9A 5AQVB 4ILUA 3T1YT 2XHEB 3A8YC 4AQFA 1IBKT 4DR1T 1OEDA 1UX4A 3AEFA 1W9RA 2EHOA 4LF9T 2ZM0A 3CK6A 4HEAA 2VL8A 2I59A 3PUSA 3CX8B 3SRZA 4GKKT 1I6ZA 3B5MA 3RKGA 2WCAA 4GYRA 4IDZA 2EHOD 2YDSA 2D2SA 4YTPA 1J5ET 2B76A 3EDUA 3ANWB 3V5SA 3ZN0B 1QLBA 1X9BA 4G2AA 1WRDA 4HWDA 5ABFB 2K24A 2X0LB 3AEGA 5JTGA 2BG9A 4P0AA 2V6YB 1B7TA 1MNDA 1M7KA 2CA5A 4X64T 4DV0T 5HCJA 3N5LA 5LYJE 2VKHA 2XZEA 4GKJT 3LBXB 3JCFA 3LSVA 3QNUA 4QH1A 3P7IA 2L3LA 3GMIA 2KWHA 2R6GF 4MLKA 3AAIA 3ZKRA 5HXHA 5JDNA 3AE4A 4QX7B 3LK3B 3UUNA 2WMNA 2E5VA 1T72A 3NVOA 2UXBT 4FJOA 1VRBA 3T8OA 3TLSA 5JDMA 3I0OA 3AAEB 3RQWA 1U5PA 2MAWA 3AE2A 2WY2A 2E9XC 2BBHA 2E9XB 3TLWA 5L4HA 2LEHA 5ADXL 2XAGB 2UXNB 3ZLIA 4DV5T 2OA5A 5CA1E 2BKNA 4U31A 3NWIA 3PUXF 2NTYA 4QH5A 1Z0PA 2VK9A 1HG2A 3ZN1B 5EZYE 4DO0A 3OKQA 4HWHA 1MMDA 2I0MA 3PUZF 2JQ9A 3CMLA 3PUQA 2BKPA 4YHHT 2LM2A 5LP6E 4EV6A 4TX5A 3RIUA 4N78D 3PU8A 5JR9A 4HE8A 3CIRA 2X9HA 4HKAA 2DL1A 1G8XA 4I4TE 5C8YE 4NXMT 2D0TA 4U7YA 1HS7A 2ODVA 2W62A 4YLHA 5F5WA 4UVBB 3NBXX 1CUNA 3H37A 3EHZA 4XZCA 2M6IA 4BJMA 2LSJA 2V5CA 1NENA 1NEKA 4BJNA 2IMLA 4ZOLE 3FXDB 5CB4E 2A72A 1OXZA 2KMFA 4GOUA 2C5JA 2CPTA 2W63A 2WAUA 1XZYA 3PU3A 4EYUA 4HFHA 2UXXB 3FB2A 4TV8E 4PNIA 1XWMA 5HXSA 3ZT7A 5AQJB 3ESLA 2H88A 2V7JA 4HFCA 5LBMA 2XAHB 4UVAB 2H7VC 1UUSA 2CM0A 4TWDA 3RH3A 4CZZB 4MALA 4DR3T 3J9X1 5LA6E 2K5BB 5LBQB 2DHRA 2BKOA 1N36T 3SFEA 5LB7B 3ABVA 2K9AA 4LF6T 5LJNA 1ZEEA 2XQ9A 4UF0A 4JBWF 2LE8A 3K8PC 4IE4A 5AQKB 5HAXA 3ZJ2A 4HTEA 4L5GA 2H7OA 2CBIA 2CE7A 1ZKEA 2YINA 3P4WA 2GK9A 3UU5A 4NUVA 5L3DB 1QSDA 3PUWF 5CGMA 3UU6A 3LJCA 1IJ5A 4I50E 3ZMZB 3FZMB 3C51A 4YTMA 2B1EA 3EUHA 3L3PA 3KDSE 3E08A 4O4HE 5H6RB 3Q5XA 1YQ4A 2DLRA 3AVRA 1HTJF 3NRYA 3ZMSB 3MKDA 4GYSA 2I6HA 2QA7A 3NKZA 2CWOA 4COFA 5FL1A 4ZXLA 1UCUA 5FVKA 2IUBA 3R84B 1W09A 2OLTA 4YJ3E 4IL9A 4JEUB 1SA0E 2XUEA 2CXLA 1ZOYA 3KVAA 3RC3A 1D0ZA 3MA9A 1WYBA 4DR7T 1OEDE 3F57A 5LGTB 4H9OC 2WM9A 3UU4A 4QHOA 2OV9A 4IDQA 4P0BA 1BR2A 5M4YA 3FXEB 3H3MA 2ZM6T 4X1KE 4A97A 4JI1T 2D5UA 4JI6T 5LGNB 3GN5A 4TUYE 3ZSSA 3AEDA 5LJMA 4EXTA 5C2TA 2UXCT 1WFDA 3N9PA 2C5IT 2LSGA 4U33A 5KDMC 4PFOA 2KLQA 3FZHB 1W0BA 3C98B 1HNZT 4AKRB 2W67A 2XPKA 1FMVA 2VL0A 4HFVA 3RHWA 3J7Yq 4YXDA 3A7MA 3HKEE 2XJ7A 3LK2B 4DNDA 4JI8T 1W0AA 5L2LA 4CXYA 2VWAA 3N9QA 1FEWA 4X20E 4IGUA 4EEDA 4H63V 4CI2B 5JDGA 3C4WA 2V1DB 1MMNA 1UK5A 5HEUA 1R8IA 4KMCA 3DJBA 2MPKA 4JI0T 4UVCB 2UU9T 5IUXA 1NAFA 2CXFA 4DV4T 2VKJA 2HN1A 1LKXA 5TAOA 2WP9A 2H3RA 5ETWA 1H7CA 5L3CB 4EOZB 4L9IA 5HEJA 4B3ST 2XM1A 3N2KE 4ZI3D 3ZCJA 1S94A 5HEHA 3EAMA 3O1HA 2ZLYA 4PK6A 1HCIA 5FXVA 2LSIA 5FMNA 2BS2A 4KX6A 4O2BE 4JI4T 2A2FX 2XQAA 1XDOA 3TLVA 4UEMA 4O8SA 1XMOT 3ZSTA 3K3QC 4HFIA 2FJBA 4LFAT 3W15B 2X0YA 3IBPA 3IEEA 2WZIA 3JC6C 2J62A 4H9SE 2VB6A 3AA6B 5J0ZA 5EK2A 3KFWX 3KBUA 4IT4A 5AQNB 4U2ZA 3GA8A 3AA1B 1UGOA 3M3ZB 5H6QB 3ZCIA 2BVMA 4C91A 4GK5E 3HA4A 3FBZA 4DIDB 2V5DA 2NP9A 4MFRA 5FY7A 2HHHT 1HR0T 3VU7H 2JRKA 3VKHA 4H9NC 3F2EA 5FL0A 4YFSA 3PV0F 1T7SA 4KUMB 1SE7A 4LF8T 1FIOA 4PK4A 2DWGA 4TNWA 4PJJA 3RLFF 4DV1T 4CI3B 3RYCE 2JMHA 1D0YA 4P1NA 3VHLA 2LM9A 4GK0E 3OJAA 5CJ5A 2W4XA 2XAJB 2UUCT 1WCRA 4PFPA 3TLUA 2L8KA 2XQ6A 5CFBA 3RYFE 3UUXB 4JI2T 4HWIB 2LHNA 2SPCA 3I1AA 2WB5A 2HH7A 4CI1B 4LMKA 4IREA 3JC6D 3C4ZA 3UULA 4DR2T 5AQFB 3ANWA 4PAGA 1FJGT 5LNKA 4ILAA 1SUMB 1SHZC 4EYYR 1J5WA 3TLTA 2V6YA 4IE6A 2XQYA 4OHFA 2A3DA 3SS1A 3QK6A 2XM2A 4HFEA 1HFAA 3K1SA 5AQHB 1MMGA 3LBXA 4YJ2E 3N9NA 1IAPA 4HWCA 5LMUT 4CN1A 5FNVE 4YY3T 3UFGA 1YKHB 2CWYA 4BA9A 4X1YE 3Q9DA 4IDOA 1KK7A 2BZBA 3P4PA 2V8SV 3ZJ1A 3FZFB 4UV9B 2CLYC 2RA1A 2ACZA 2CLYB 4OX9T 2QYWA 2RP4A 4EZHA 2WS3A 4TZ4C 1HF8A 2X9XA 3AXJB 5BMVE 1HG5A 5FP3A 2MBGA 3T1HT 2CRBA 3MZKB 1HNWT 3AE5A 2Y48B 2V7KA 4UV8B 4DMWA 3ZC0A 3Q5WA 4ZEYA 2YDRA 2MTQA 2LKHA 2E9XD 3ZPOA 3ONLC 3OTOT 1ZP0A 4EB6E 4O2AE 5DABA 2XAFB 4OFZA 3ZYMA 3AE8A 2WDVA 2BDEA 2YOEA 2J1DG 4B3MT 3PE0A 5J2TE 3M65A 3AE7A 2N9DA 3Q2MA 3L8RA 2RPAA 3PTRB 5AQGB 3UU3A 1M62A 3JADA 4O4LE 5JQGE 2WDQA 4H9PC 1KFYA 4PJLA 2ES0A 1AJ3A 4CN4A 2XQ7A 4X1IE 3X1DA 2UUBT 4PK5A 5LMNT 3ONXA 4ERRA 2WMOA 2J47A 2X66A 2AXDS 3KV5A 5AQQB 1MIWA 2L9QA 3AAAB 4TNVA 3BQIA 3JAFA 4YT0A 4P09A 4LF5T 2Q9QC 1IJ6A 2Q9QB 3EDVA 3RI5A 2BS3A 4LFBT 4U2YA 3ZT5A 1VCTA 2X0HA 1E7PA 4IE0A 5LG3A 2WZHA 3OBVE 2IC6A 2NW7A 2W2UA 2LLYA 1UURA 4QH4A 4E7ZA 1EZ3A 2WBLA 2WU2A 1US7B 4OYKA 3B13A 4X5TA 3N9LA 5HEGA 4ADZA 3WAKA 2XSAA 3CX6B 2XQ5A 5FXZA 4Q25A 2MOZA 1E2AA 3LK42 4ZZCA 3ZC1A 2DWKA 1DU2A 2WWVA 3FBLA 4KI0F 1N32T 2NWBA 3CVRA 2LJLA 2ODUA 4DR6T 2JQQA 2NTXA 4IE7A 4NUUA 4CXXA 5ABEA 1XDPA 2Z6EA 5JDHA 2K3WA 2ZM8A 3ZMVB 2WDRA 2BG9E 5E0OA 3V5UA 4WZXA 3BQLA 3CKDA 2LT3A 2YK0A 5AQIB 4JEHB 3OYZA 3UT5E 4TWHA 1T8BA 2BVLA 2D0UA 3N9OA 5IWAT 2MYSA 4LF7T 2V7IA 4IE5A 3MK7C 2N2NA 5FKYA 5BR8T 1KEYA 4UR9A 4DV6T 2W66A 3L09A 4WNKA 2PFVA 4ILCA 5GONE 2YU2A 2UUAT 3LDQB 4DBRA 2CHNA 1WR6A 3PUAA 4NIQA 3AE3A 4EAHA 5AQPB 5JRCB 2V7LA 1XNRT 4HGAA 1Y01A 2W0GA 2ZM2A 4UXNB 2AE9A 2LRKA 2LKGA 4ZS2A 4AQFC 5EK3A 2NR4A 4U3CA 2KSRA 1CHUA 2IHR1 4YTNA 5LHHB 1OEDC 2JMKA 2X9WA 4HFBA 4YSXA 4F8HA 2EHOC 3EVYA 1OEDB 2BS4A 3RQUA 2EHOB 2VQET 2LOPA 2XY8B 4B6XA 1KF6A 1D0XA 3ZYKA 3WAJA 4Z8XA 2VKDA 2XQ4A 3SFDA 3AEAA 5LGUB 2YN6A 1NWMX 2V7MA 4WW0A 3VRBA 2KZ7B 3RC8A 3N2GE 4TWFA 3OYXA 1LVFA 4DV7T 2FJAA 2VVSA 5AQMB 2V26A 2YKSA 3VRAA 2PBIA 2BG9C 2LRLA 2BG9B 2LSYA 2YU1A 3TKLB 2WSSV 4ZZBA 4IHJE 4DV3T 2J4GA 2XAQB 4EZ4A 5LCYA 4C90A 3S4UA 4H9QC 5HCMA 3HKBE 2KINB 3D0TA 5L4EA 3RIFA 2PTFA 1WLXA 3I9YA 4LFCT 1MMAA 1HX1B 3HR0A 3OVUA 4DUYT 3FZLB 5EK4A 3QB5A 3SOLA 4IL4A 1MNEA 1HX8A 5L47A 5HYAA 4X66T 4EIWA 2QGSA 2QVAA 1IBMT 2N1GA 2H89A 4YSYA 3VR8A 1Z8UA 5AQTB 1IZNB 3RX6A 3LFMA 5HXEA 5C3JA 5L3FB 3HKCE 5FXXA 2HN2A 4IDPA 4U7IA 4Z91A 4LMLA 3NZQA 4U74A 2XTLA 4KHPT 2JQKA 3PURA 4HWFA 1N33T 5ABGA 2A9UA 2DNXA 1L0VA 4IDNA 3FHNA 3GWHA 3KVBA 5A1LA 3RYIE 3K3NA 4AQGA 3NZPA 1FMWA 3KV6A 1LRZA 2KXPB 4LF4T 3I0QA 4NXNT 4XAXB 1BR4A 1G73A 3P4SA 5AQSB 3RIUC 5L3BB 5JR9C 2NW8A 4OYJA 5JR9B 4HFDA 4WBNE 2C0SA 4DR4T 3N2OA 4QX8B 4AKIA 1WYCA 3UQ4A 4WYVA 5CA0E 2KNDA 2YEVC 5IHYA 3RF1A 3RPUA 3L39A 4DV2T 3DP7A 3ZEFB 3LG7A 3PUYF 1QUUA 4H63H 3E22E 4AI6A 2CCQA 4JYAT 4TV9E 4L0RA 4AKGA 2E8IA 3ZMUB 2M67A 2NOXA 4UIGA 3CQCB 4DVDA 3SWHA 2CXDA 1KNRA 2X67A 5HWYA 2XQ8A 4JI5T 4F6RC 2LHRA 5ABFA 2F4VT 2Y8DA 4MHCA 3Q5EA 3BQKA 3VKGA 1ZHCA 3CQXC 4AKHA 3NRXA 3AA0B 4V1Av 2JPFA
chains in the Genus database with same CATH topology
5LMNT 4DUZT 3T1YT 4YY3T 4DV1T 4B3TT 1IBKT 4AQYT 4DR1T 1XMOT 4LF4T 4JV5T 4LF9T 4B3RT 4NXNT 4JI8T 4LFAT 4DV3T 4GKKT 4K0KT 1HNZT 4X62T 4OX9T 2UUCT 4DV5T 1XMQT 4LF7T 5IWAT 1N34T 1J5ET 2UXDT 4LF5T 4DR5T 4JI2T 3T1HT 5BR8T 4JI0T 2UU9T 4DR4T 4DV6T 1HNWT 4LFBT 1I94T 4LFCT 2UUAT 4DUYT 4DV4T 4X64T 4DV0T 4DV2T 4YHHT 1XNQT 4DR3T 1N36T 4DR7T 4GKJT 1XNRT 4DR2T 4B3ST 4X66T 3OTOT 2E5LT 1FJGT 4JYAT 4LF6T 1IBMT 2ZM6T 2HHHT 4B3MT 4JI1T 4JI7T 1HR0T 4NXMT 4JI6T 1IBLT 2VQET 4JI5T 2UXBT 2UXCT 2VQFT 4KHPT 1N33T 4X65T 2F4VT 4LF8T 1N32T 4JI3T 1HNXT 4JI4T 4DR6T 5LMUT 4DV7T 2UUBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN T;  4DUZ T;  3T1Y T;  4YY3 T;  4DV1 T;  4B3T T;  1IBK T;  4AQY T;  4DR1 T;  1XMO T;  4LF4 T;  4JV5 T;  4LF9 T;  4B3R T;  4NXN T;  4JI8 T;  4LFA T;  4DV3 T;  4GKK T;  4K0K T;  1HNZ T;  4X62 T;  4OX9 T;  2UUC T;  4DV5 T;  1XMQ T;  4LF7 T;  5IWA T;  1N34 T;  1J5E T;  2UXD T;  4LF5 T;  4DR5 T;  4JI2 T;  3T1H T;  5BR8 T;  4JI0 T;  2UU9 T;  4DR4 T;  4DV6 T;  1HNW T;  4LFB T;  1I94 T;  4LFC T;  2UUA T;  4DUY T;  4DV4 T;  4X64 T;  4DV0 T;  4DV2 T;  4YHH T;  1XNQ T;  4DR3 T;  1N36 T;  4DR7 T;  4GKJ T;  1XNR T;  4DR2 T;  4B3S T;  4X66 T;  3OTO T;  2E5L T;  1FJG T;  4JYA T;  4LF6 T;  1IBM T;  2ZM6 T;  2HHH T;  4B3M T;  4JI1 T;  4JI7 T;  1HR0 T;  4NXM T;  4JI6 T;  1IBL T;  2VQE T;  4JI5 T;  2UXB T;  2UXC T;  2VQF T;  4KHP T;  1N33 T;  4X65 T;  2F4V T;  4LF8 T;  1N32 T;  4JI3 T;  1HNX T;  4JI4 T;  4DR6 T;  5LMU T;  4DV7 T;  2UUB T; 
#chains in the Genus database with same CATH topology
 1E1H B;  2KT9 A;  4OK0 A;  3C4X A;  3IHR A;  4AQY T;  5FY1 A;  3Q5D A;  1UX5 A;  3AVS A;  2DI4 A;  4PW8 A;  3IA3 A;  4WBO A;  3PJA J;  2XQ3 A;  2V6X A;  3UQ7 A;  3PUG A;  2ZMA A;  3UTK A;  3C50 A;  3CWZ B;  3O4X E;  4DR5 T;  4QXB B;  5FY0 A;  3UU8 A;  2WQY A;  3P8C D;  4U72 A;  4UF0 B;  4ZHQ E;  3AEE A;  3E0Z A;  5LHI B;  1XNQ T;  2D9D A;  3QOF A;  5JDF A;  5JH7 E;  4K0U A;  3QUJ A;  3UUM A;  5LOV E;  5JDL A;  3HL6 A;  3R6N A;  4DMV A;  2E9X A;  2VKO A;  4TN7 B;  5HXR A;  3I9W A;  3AB3 B;  4E7S A;  4ZI7 E;  2ACX A;  4H9R C;  4KP3 C;  2VQF T;  3HKD E;  4I55 E;  5DQW A;  3CQG B;  1JNZ A;  5IYZ E;  5KMG P;  1HNX T;  4YHJ A;  5KXJ A;  2X51 A;  5J2U E;  5JRE A;  5LHG B;  2IC9 A;  1MIY A;  3B57 A;  3KV4 A;  5AFU L;  5L3E B;  3P50 A;  3CX7 B;  2W00 A;  3HI2 A;  1O3X A;  4KHZ F;  1ZV4 X;  4ZI2 C;  4QKN A;  1D1A A;  2VVN A;  2P9B A;  5FYM A;  4A56 A;  4IIJ E;  4ASK A;  1KNP A;  2JQH A;  4EEB A;  2IW5 B;  3GN5 B;  2WWU A;  3KBT A;  4KBM B;  5HEO A;  1V9D A;  2CMR A;  3AXJ A;  4XBF B;  1BR0 A;  3AA7 B;  2CEA A;  3RRC A;  3P4R A;  1X79 A;  4O4I E;  4LMJ A;  3RIA A;  4CXW A;  4ILB A;  4Z90 A;  3RRW A;  3K3O A;  2YDQ A;  4BAY B;  3CPZ A;  2FUP A;  4JUY A;  4PJN A;  2LSK A;  4HN9 A;  3N9M A;  4JLE A;  4PJM A;  2Y6X A;  1YQ3 A;  5DJQ C;  4X65 T;  1JNR A;  4AXP A;  4M1P A;  2G0U A;  4JI3 T;  5F8P A;  3ONJ A;  5FXW A;  4GIW A;  4AIU A;  2JIW A;  3JAE A;  4DBQ A;  2XAS B;  2WU5 A;  5AQL B;  3ZT6 A;  3OPC A;  4YSZ A;  4EGW A;  4CQI A;  5AQR B;  3ZYL A;  4K0K T;  4ZI3 C;  4ANJ A;  3AEB A;  2PJQ A;  4QXC B;  4CN6 A;  1XMQ T;  2XSB A;  1N34 T;  2UXD T;  3IF8 B;  2FJE A;  1YKE B;  2K48 A;  2PG8 A;  2IIU A;  3QC9 A;  1WR0 A;  3ETV A;  5HXC A;  4ZI2 D;  5LXT E;  5FVL A;  2X68 A;  3MJX A;  4QXH B;  4QWN B;  2VUR A;  4I0U A;  3BK9 A;  3U78 A;  2E5L T;  5AQU B;  5F3J A;  2Q9Q A;  3UUB A;  3DTO A;  2FJD A;  3UFE A;  3H3A A;  1D1B A;  4JI7 T;  3AE9 A;  2HPL A;  2Q9Q D;  2CBJ A;  3PDY A;  5ABH A;  4A98 A;  5J1G A;  3AE6 A;  3F31 A;  1VCS A;  2LOS A;  5HWX A;  3QB5 K;  4O4J E;  2FBW A;  5KX5 E;  3O1I A;  3G06 A;  5LG4 A;  2VAS A;  1OWA A;  4DUZ T;  4ZS3 A;  1S35 A;  4UEL A;  2BBJ A;  3RYH E;  3PUV F;  4B3T T;  4A5X A;  2CHO A;  1D1C A;  4JV5 T;  4B3R T;  2E2A A;  2IAK A;  1MIV A;  2NW9 A;  4I43 B;  1VOM A;  3RGL A;  4NPP A;  4IST A;  3RKO A;  4X62 T;  3PJA A;  2IDO B;  4MBQ A;  2M6B A;  2QRX A;  2DCF A;  3O1J A;  3MAC A;  2C5K T;  3KV9 A;  2HPJ A;  1U4Q A;  1J1J A;  1I94 T;  1YW0 A;  2JJ9 A;  4AIS A;  4FI5 A;  2KWI B;  3O9X A;  3P4Q A;  2X9Y A;  1GQE A;  1LVK A;  3KIN B;  4J2C A;  3AEC A;  1BR1 A;  5JDQ A;  5AQO B;  3A5X A;  4AKL A;  1KNZ A;  3U3I A;  1YD8 G;  3EI0 A;  5L3G B;  4ISS A;  3ZMT B;  1IBL T;  5JVD E;  4G63 A;  3WI3 A;  3AE1 A;  3EAB A;  5JRC A;  1Y64 B;  3FZK B;  1T98 A;  2W61 A;  3C64 A;  5DQV A;  3ETU A;  3MXZ A;  1YXR A;  3VR9 A;  5AQV B;  4ILU A;  3T1Y T;  2XHE B;  3A8Y C;  4AQF A;  1IBK T;  4DR1 T;  1OED A;  1UX4 A;  3AEF A;  1W9R A;  2EHO A;  4LF9 T;  2ZM0 A;  3CK6 A;  4HEA A;  2VL8 A;  2I59 A;  3PUS A;  3CX8 B;  3SRZ A;  4GKK T;  1I6Z A;  3B5M A;  3RKG A;  2WCA A;  4GYR A;  4IDZ A;  2EHO D;  2YDS A;  2D2S A;  4YTP A;  1J5E T;  2B76 A;  3EDU A;  3ANW B;  3V5S A;  3ZN0 B;  1QLB A;  1X9B A;  4G2A A;  1WRD A;  4HWD A;  5ABF B;  2K24 A;  2X0L B;  3AEG A;  5JTG A;  2BG9 A;  4P0A A;  2V6Y B;  1B7T A;  1MND A;  1M7K A;  2CA5 A;  4X64 T;  4DV0 T;  5HCJ A;  3N5L A;  5LYJ E;  2VKH A;  2XZE A;  4GKJ T;  3LBX B;  3JCF A;  3LSV A;  3QNU A;  4QH1 A;  3P7I A;  2L3L A;  3GMI A;  2KWH A;  2R6G F;  4MLK A;  3AAI A;  3ZKR A;  5HXH A;  5JDN A;  3AE4 A;  4QX7 B;  3LK3 B;  3UUN A;  2WMN A;  2E5V A;  1T72 A;  3NVO A;  2UXB T;  4FJO A;  1VRB A;  3T8O A;  3TLS A;  5JDM A;  3I0O A;  3AAE B;  3RQW A;  1U5P A;  2MAW A;  3AE2 A;  2WY2 A;  2E9X C;  2BBH A;  2E9X B;  3TLW A;  5L4H A;  2LEH A;  5ADX L;  2XAG B;  2UXN B;  3ZLI A;  4DV5 T;  2OA5 A;  5CA1 E;  2BKN A;  4U31 A;  3NWI A;  3PUX F;  2NTY A;  4QH5 A;  1Z0P A;  2VK9 A;  1HG2 A;  3ZN1 B;  5EZY E;  4DO0 A;  3OKQ A;  4HWH A;  1MMD A;  2I0M A;  3PUZ F;  2JQ9 A;  3CML A;  3PUQ A;  2BKP A;  4YHH T;  2LM2 A;  5LP6 E;  4EV6 A;  4TX5 A;  3RIU A;  4N78 D;  3PU8 A;  5JR9 A;  4HE8 A;  3CIR A;  2X9H A;  4HKA A;  2DL1 A;  1G8X A;  4I4T E;  5C8Y E;  4NXM T;  2D0T A;  4U7Y A;  1HS7 A;  2ODV A;  2W62 A;  4YLH A;  5F5W A;  4UVB B;  3NBX X;  1CUN A;  3H37 A;  3EHZ A;  4XZC A;  2M6I A;  4BJM A;  2LSJ A;  2V5C A;  1NEN A;  1NEK A;  4BJN A;  2IML A;  4ZOL E;  3FXD B;  5CB4 E;  2A72 A;  1OXZ A;  2KMF A;  4GOU A;  2C5J A;  2CPT A;  2W63 A;  2WAU A;  1XZY A;  3PU3 A;  4EYU A;  4HFH A;  2UXX B;  3FB2 A;  4TV8 E;  4PNI A;  1XWM A;  5HXS A;  3ZT7 A;  5AQJ B;  3ESL A;  2H88 A;  2V7J A;  4HFC A;  5LBM A;  2XAH B;  4UVA B;  2H7V C;  1UUS A;  2CM0 A;  4TWD A;  3RH3 A;  4CZZ B;  4MAL A;  4DR3 T;  3J9X 1;  5LA6 E;  2K5B B;  5LBQ B;  2DHR A;  2BKO A;  1N36 T;  3SFE A;  5LB7 B;  3ABV A;  2K9A A;  4LF6 T;  5LJN A;  1ZEE A;  2XQ9 A;  4UF0 A;  4JBW F;  2LE8 A;  3K8P C;  4IE4 A;  5AQK B;  5HAX A;  3ZJ2 A;  4HTE A;  4L5G A;  2H7O A;  2CBI A;  2CE7 A;  1ZKE A;  2YIN A;  3P4W A;  2GK9 A;  3UU5 A;  4NUV A;  5L3D B;  1QSD A;  3PUW F;  5CGM A;  3UU6 A;  3LJC A;  1IJ5 A;  4I50 E;  3ZMZ B;  3FZM B;  3C51 A;  4YTM A;  2B1E A;  3EUH A;  3L3P A;  3KDS E;  3E08 A;  4O4H E;  5H6R B;  3Q5X A;  1YQ4 A;  2DLR A;  3AVR A;  1HTJ F;  3NRY A;  3ZMS B;  3MKD A;  4GYS A;  2I6H A;  2QA7 A;  3NKZ A;  2CWO A;  4COF A;  5FL1 A;  4ZXL A;  1UCU A;  5FVK A;  2IUB A;  3R84 B;  1W09 A;  2OLT A;  4YJ3 E;  4IL9 A;  4JEU B;  1SA0 E;  2XUE A;  2CXL A;  1ZOY A;  3KVA A;  3RC3 A;  1D0Z A;  3MA9 A;  1WYB A;  4DR7 T;  1OED E;  3F57 A;  5LGT B;  4H9O C;  2WM9 A;  3UU4 A;  4QHO A;  2OV9 A;  4IDQ A;  4P0B A;  1BR2 A;  5M4Y A;  3FXE B;  3H3M A;  2ZM6 T;  4X1K E;  4A97 A;  4JI1 T;  2D5U A;  4JI6 T;  5LGN B;  3GN5 A;  4TUY E;  3ZSS A;  3AED A;  5LJM A;  4EXT A;  5C2T A;  2UXC T;  1WFD A;  3N9P A;  2C5I T;  2LSG A;  4U33 A;  5KDM C;  4PFO A;  2KLQ A;  3FZH B;  1W0B A;  3C98 B;  1HNZ T;  4AKR B;  2W67 A;  2XPK A;  1FMV A;  2VL0 A;  4HFV A;  3RHW A;  3J7Y q;  4YXD A;  3A7M A;  3HKE E;  2XJ7 A;  3LK2 B;  4DND A;  4JI8 T;  1W0A A;  5L2L A;  4CXY A;  2VWA A;  3N9Q A;  1FEW A;  4X20 E;  4IGU A;  4EED A;  4H63 V;  4CI2 B;  5JDG A;  3C4W A;  2V1D B;  1MMN A;  1UK5 A;  5HEU A;  1R8I A;  4KMC A;  3DJB A;  2MPK A;  4JI0 T;  4UVC B;  2UU9 T;  5IUX A;  1NAF A;  2CXF A;  4DV4 T;  2VKJ A;  2HN1 A;  1LKX A;  5TAO A;  2WP9 A;  2H3R A;  5ETW A;  1H7C A;  5L3C B;  4EOZ B;  4L9I A;  5HEJ A;  4B3S T;  2XM1 A;  3N2K E;  4ZI3 D;  3ZCJ A;  1S94 A;  5HEH A;  3EAM A;  3O1H A;  2ZLY A;  4PK6 A;  1HCI A;  5FXV A;  2LSI A;  5FMN A;  2BS2 A;  4KX6 A;  4O2B E;  4JI4 T;  2A2F X;  2XQA A;  1XDO A;  3TLV A;  4UEM A;  4O8S A;  1XMO T;  3ZST A;  3K3Q C;  4HFI A;  2FJB A;  4LFA T;  3W15 B;  2X0Y A;  3IBP A;  3IEE A;  2WZI A;  3JC6 C;  2J62 A;  4H9S E;  2VB6 A;  3AA6 B;  5J0Z A;  5EK2 A;  3KFW X;  3KBU A;  4IT4 A;  5AQN B;  4U2Z A;  3GA8 A;  3AA1 B;  1UGO A;  3M3Z B;  5H6Q B;  3ZCI A;  2BVM A;  4C91 A;  4GK5 E;  3HA4 A;  3FBZ A;  4DID B;  2V5D A;  2NP9 A;  4MFR A;  5FY7 A;  2HHH T;  1HR0 T;  3VU7 H;  2JRK A;  3VKH A;  4H9N C;  3F2E A;  5FL0 A;  4YFS A;  3PV0 F;  1T7S A;  4KUM B;  1SE7 A;  4LF8 T;  1FIO A;  4PK4 A;  2DWG A;  4TNW A;  4PJJ A;  3RLF F;  4DV1 T;  4CI3 B;  3RYC E;  2JMH A;  1D0Y A;  4P1N A;  3VHL A;  2LM9 A;  4GK0 E;  3OJA A;  5CJ5 A;  2W4X A;  2XAJ B;  2UUC T;  1WCR A;  4PFP A;  3TLU A;  2L8K A;  2XQ6 A;  5CFB A;  3RYF E;  3UUX B;  4JI2 T;  4HWI B;  2LHN A;  2SPC A;  3I1A A;  2WB5 A;  2HH7 A;  4CI1 B;  4LMK A;  4IRE A;  3JC6 D;  3C4Z A;  3UUL A;  4DR2 T;  5AQF B;  3ANW A;  4PAG A;  1FJG T;  5LNK A;  4ILA A;  1SUM B;  1SHZ C;  4EYY R;  1J5W A;  3TLT A;  2V6Y A;  4IE6 A;  2XQY A;  4OHF A;  2A3D A;  3SS1 A;  3QK6 A;  2XM2 A;  4HFE A;  1HFA A;  3K1S A;  5AQH B;  1MMG A;  3LBX A;  4YJ2 E;  3N9N A;  1IAP A;  4HWC A;  5LMU T;  4CN1 A;  5FNV E;  4YY3 T;  3UFG A;  1YKH B;  2CWY A;  4BA9 A;  4X1Y E;  3Q9D A;  4IDO A;  1KK7 A;  2BZB A;  3P4P A;  2V8S V;  3ZJ1 A;  3FZF B;  4UV9 B;  2CLY C;  2RA1 A;  2ACZ A;  2CLY B;  4OX9 T;  2QYW A;  2RP4 A;  4EZH A;  2WS3 A;  4TZ4 C;  1HF8 A;  2X9X A;  3AXJ B;  5BMV E;  1HG5 A;  5FP3 A;  2MBG A;  3T1H T;  2CRB A;  3MZK B;  1HNW T;  3AE5 A;  2Y48 B;  2V7K A;  4UV8 B;  4DMW A;  3ZC0 A;  3Q5W A;  4ZEY A;  2YDR A;  2MTQ A;  2LKH A;  2E9X D;  3ZPO A;  3ONL C;  3OTO T;  1ZP0 A;  4EB6 E;  4O2A E;  5DAB A;  2XAF B;  4OFZ A;  3ZYM A;  3AE8 A;  2WDV A;  2BDE A;  2YOE A;  2J1D G;  4B3M T;  3PE0 A;  5J2T E;  3M65 A;  3AE7 A;  2N9D A;  3Q2M A;  3L8R A;  2RPA A;  3PTR B;  5AQG B;  3UU3 A;  1M62 A;  3JAD A;  4O4L E;  5JQG E;  2WDQ A;  4H9P C;  1KFY A;  4PJL A;  2ES0 A;  1AJ3 A;  4CN4 A;  2XQ7 A;  4X1I E;  3X1D A;  2UUB T;  4PK5 A;  5LMN T;  3ONX A;  4ERR A;  2WMO A;  2J47 A;  2X66 A;  2AXD S;  3KV5 A;  5AQQ B;  1MIW A;  2L9Q A;  3AAA B;  4TNV A;  3BQI A;  3JAF A;  4YT0 A;  4P09 A;  4LF5 T;  2Q9Q C;  1IJ6 A;  2Q9Q B;  3EDV A;  3RI5 A;  2BS3 A;  4LFB T;  4U2Y A;  3ZT5 A;  1VCT A;  2X0H A;  1E7P A;  4IE0 A;  5LG3 A;  2WZH A;  3OBV E;  2IC6 A;  2NW7 A;  2W2U A;  2LLY A;  1UUR A;  4QH4 A;  4E7Z A;  1EZ3 A;  2WBL A;  2WU2 A;  1US7 B;  4OYK A;  3B13 A;  4X5T A;  3N9L A;  5HEG A;  4ADZ A;  3WAK A;  2XSA A;  3CX6 B;  2XQ5 A;  5FXZ A;  4Q25 A;  2MOZ A;  1E2A A;  3LK4 2;  4ZZC A;  3ZC1 A;  2DWK A;  1DU2 A;  2WWV A;  3FBL A;  4KI0 F;  1N32 T;  2NWB A;  3CVR A;  2LJL A;  2ODU A;  4DR6 T;  2JQQ A;  2NTX A;  4IE7 A;  4NUU A;  4CXX A;  5ABE A;  1XDP A;  2Z6E A;  5JDH A;  2K3W A;  2ZM8 A;  3ZMV B;  2WDR A;  2BG9 E;  5E0O A;  3V5U A;  4WZX A;  3BQL A;  3CKD A;  2LT3 A;  2YK0 A;  5AQI B;  4JEH B;  3OYZ A;  3UT5 E;  4TWH A;  1T8B A;  2BVL A;  2D0U A;  3N9O A;  5IWA T;  2MYS A;  4LF7 T;  2V7I A;  4IE5 A;  3MK7 C;  2N2N A;  5FKY A;  5BR8 T;  1KEY A;  4UR9 A;  4DV6 T;  2W66 A;  3L09 A;  4WNK A;  2PFV A;  4ILC A;  5GON E;  2YU2 A;  2UUA T;  3LDQ B;  4DBR A;  2CHN A;  1WR6 A;  3PUA A;  4NIQ A;  3AE3 A;  4EAH A;  5AQP B;  5JRC B;  2V7L A;  1XNR T;  4HGA A;  1Y01 A;  2W0G A;  2ZM2 A;  4UXN B;  2AE9 A;  2LRK A;  2LKG A;  4ZS2 A;  4AQF C;  5EK3 A;  2NR4 A;  4U3C A;  2KSR A;  1CHU A;  2IHR 1;  4YTN A;  5LHH B;  1OED C;  2JMK A;  2X9W A;  4HFB A;  4YSX A;  4F8H A;  2EHO C;  3EVY A;  1OED B;  2BS4 A;  3RQU A;  2EHO B;  2VQE T;  2LOP A;  2XY8 B;  4B6X A;  1KF6 A;  1D0X A;  3ZYK A;  3WAJ A;  4Z8X A;  2VKD A;  2XQ4 A;  3SFD A;  3AEA A;  5LGU B;  2YN6 A;  1NWM X;  2V7M A;  4WW0 A;  3VRB A;  2KZ7 B;  3RC8 A;  3N2G E;  4TWF A;  3OYX A;  1LVF A;  4DV7 T;  2FJA A;  2VVS A;  5AQM B;  2V26 A;  2YKS A;  3VRA A;  2PBI A;  2BG9 C;  2LRL A;  2BG9 B;  2LSY A;  2YU1 A;  3TKL B;  2WSS V;  4ZZB A;  4IHJ E;  4DV3 T;  2J4G A;  2XAQ B;  4EZ4 A;  5LCY A;  4C90 A;  3S4U A;  4H9Q C;  5HCM A;  3HKB E;  2KIN B;  3D0T A;  5L4E A;  3RIF A;  2PTF A;  1WLX A;  3I9Y A;  4LFC T;  1MMA A;  1HX1 B;  3HR0 A;  3OVU A;  4DUY T;  3FZL B;  5EK4 A;  3QB5 A;  3SOL A;  4IL4 A;  1MNE A;  1HX8 A;  5L47 A;  5HYA A;  4X66 T;  4EIW A;  2QGS A;  2QVA A;  1IBM T;  2N1G A;  2H89 A;  4YSY A;  3VR8 A;  1Z8U A;  5AQT B;  1IZN B;  3RX6 A;  3LFM A;  5HXE A;  5C3J A;  5L3F B;  3HKC E;  5FXX A;  2HN2 A;  4IDP A;  4U7I A;  4Z91 A;  4LML A;  3NZQ A;  4U74 A;  2XTL A;  4KHP T;  2JQK A;  3PUR A;  4HWF A;  1N33 T;  5ABG A;  2A9U A;  2DNX A;  1L0V A;  4IDN A;  3FHN A;  3GWH A;  3KVB A;  5A1L A;  3RYI E;  3K3N A;  4AQG A;  3NZP A;  1FMW A;  3KV6 A;  1LRZ A;  2KXP B;  4LF4 T;  3I0Q A;  4NXN T;  4XAX B;  1BR4 A;  1G73 A;  3P4S A;  5AQS B;  3RIU C;  5L3B B;  5JR9 C;  2NW8 A;  4OYJ A;  5JR9 B;  4HFD A;  4WBN E;  2C0S A;  4DR4 T;  3N2O A;  4QX8 B;  4AKI A;  1WYC A;  3UQ4 A;  4WYV A;  5CA0 E;  2KND A;  2YEV C;  5IHY A;  3RF1 A;  3RPU A;  3L39 A;  4DV2 T;  3DP7 A;  3ZEF B;  3LG7 A;  3PUY F;  1QUU A;  4H63 H;  3E22 E;  4AI6 A;  2CCQ A;  4JYA T;  4TV9 E;  4L0R A;  4AKG A;  2E8I A;  3ZMU B;  2M67 A;  2NOX A;  4UIG A;  3CQC B;  4DVD A;  3SWH A;  2CXD A;  1KNR A;  2X67 A;  5HWY A;  2XQ8 A;  4JI5 T;  4F6R C;  2LHR A;  5ABF A;  2F4V T;  2Y8D A;  4MHC A;  3Q5E A;  3BQK A;  3VKG A;  1ZHC A;  3CQX C;  4AKH A;  3NRX A;  3AA0 B;  4V1A v;  2JPF A; 
#chains in the Genus database with same CATH homology
 5LMN T;  4DUZ T;  3T1Y T;  4YY3 T;  4DV1 T;  4B3T T;  1IBK T;  4AQY T;  4DR1 T;  1XMO T;  4LF4 T;  4JV5 T;  4LF9 T;  4B3R T;  4NXN T;  4JI8 T;  4LFA T;  4DV3 T;  4GKK T;  4K0K T;  1HNZ T;  4X62 T;  4OX9 T;  2UUC T;  4DV5 T;  1XMQ T;  4LF7 T;  5IWA T;  1N34 T;  1J5E T;  2UXD T;  4LF5 T;  4DR5 T;  4JI2 T;  3T1H T;  5BR8 T;  4JI0 T;  2UU9 T;  4DR4 T;  4DV6 T;  1HNW T;  4LFB T;  1I94 T;  4LFC T;  2UUA T;  4DUY T;  4DV4 T;  4X64 T;  4DV0 T;  4DV2 T;  4YHH T;  1XNQ T;  4DR3 T;  1N36 T;  4DR7 T;  4GKJ T;  1XNR T;  4DR2 T;  4B3S T;  4X66 T;  3OTO T;  2E5L T;  1FJG T;  4JYA T;  4LF6 T;  1IBM T;  2ZM6 T;  2HHH T;  4B3M T;  4JI1 T;  4JI7 T;  1HR0 T;  4NXM T;  4JI6 T;  1IBL T;  2VQE T;  4JI5 T;  2UXB T;  2UXC T;  2VQF T;  4KHP T;  1N33 T;  4X65 T;  2F4V T;  4LF8 T;  1N32 T;  4JI3 T;  1HNX T;  4JI4 T;  4DR6 T;  5LMU T;  4DV7 T;  2UUB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...