4X65F

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 28
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4x65F00
4YHHF 4DV2F 1RISA 4DUZF 2E5LF 4X65F 4DR6F 4DV1F 2B7BB 4DR3F 4JI1F 4B3SF 1N32F 2ZM6F 1N36F 1J5EF 5LMNF 4DV0F 2UXCF 4JI0F 1N34F 2HHHF 2KJWA 4LFCF 2UUBF 1XNRF 1GH8A 4X62F 1XNQF 3OTOF 2BXJA 1FJGF 5BR8F 1F60B 4DR5F 4DV4F 4DR7F 3T1HF 1IBMF 2UUAF 4GKJF 4LF9F 2UU9F 1VMBA 2RJZA 4LF8F 2BVZA 4JI2F 4LFAF 4DUYF 1XMQF 4JI4F 3T1YF 4B3MF 5IWAF 1B64A 4JI7F 4GKKF 4JI8F 2J5AA 1HNZF 2VQEF 1QJHA 1G1XA 4K0KF 4B3TF 4X66F 4DV7F 1IJFB 5AJ3F 4JV5F 2UXDF 2KJVA 4DV3F 1HR0F 1CQMA 2VQFF 1G7CB 5LMUF 2B7CB 1XMOF 4LFBF 4KHPF 1IBLF 4DR2F 4LF5F 4JI5F 1FKAF 1LOUA 1I94F 4DV6F 4NXMF 1CQNA 1HNWF 4LF7F 4B3RF 4AQYF 2UUCF 4DR4F 2YY3A 4OX9F 4JI3F 3ZZPA 2F4VF 4X64F 4DR1F 1N33F 4YY3F 4LF6F 1IJEB 4DV5F 4NXNF 4JYAF 4JI6F 4LF4F 3R3TA 1HNXF 2UXBF 1IBKF
chains in the Genus database with same CATH superfamily
5HVHA 3AA9A 2LQ8A 3T6JA 4B3SF 1QAJA 3VAKA 1VQYA 5KFAA 3C6TA 2F9DA 3ILOA 3PHEA 3DKDA 1HBMA 1EETA 2RQ4A 2C2OB 2DHSA 3QGPA 4LBPA 2HFSA 1U09A 4ZVSB 5BXIA 5I3PA 4ZPVR 1UMJA 4N8NA 1P6TA 1RU2A 3UN3A 2HHVA 2MJNA 3W2WA 1LWFA 2GQQA 2MZRA 2K7JA 3D0IE 2FC8A 5F3TA 4P71A 1FFWB 3CNQP 3RZAA 3MUTP 1I94F 4ZCMA 3VV2B 2CFXA 3GG1A 2PMWA 3M2RA 4AYBD 1WJ9A 4N56A 4WKYA 1JLAB 1S1VA 2L48A 4F0HA 5CZXA 2DGOA 4QYZJ 4WZMA 3UDCA 4NLSA 2P9GA 1HD0A 4KJIA 3U1LA 2ASJA 4U8VA 2K2PA 1VJQA 4ECWA 2EBEA 2M88A 4GRSA 1XMOJ 3GILA 4MYUA 1ZYQA 3NNHA 4ZPAA 5AE3A 4FYWB 2F4VJ 4RNFA 4DFJA 1R27B 4HACA 1YJRA 2E9RX 2P2CB 4ELTA 4Y2AA 4W92B 1SL1A 3LGMA 5HMXA 4KO0A 4LJMA 3PW5A 4OZ3A 2KJVA 4CO4A 5HI7A 2DH8A 4I56A 2E44A 2GVDB 4GC7A 2FZKB 4WYWA 5ETOA 2EEYA 3GE9A 2QSFA 2DY9A 4X64F 3W8PA 4O0NA 1UWBB 1ZAVA 1UJ4A 4Q0BA 2W9CA 2YPYA 2YKNB 4IG3B 2HMIB 4DG1B 3MOZA 3OFFA 2QN6B 4Y28C 2FHJA 1JLBA 4K4TA 1H73A 5FDLB 1WOPA 1W7WA 1RWMB 1UW9A 4J9QA 4K4YA 2BDPA 3QFWA 2MQNA 1N32J 1L3SA 4NLOA 4LRDA 5C24B 3A8IA 1TMJA 5HAOA 2VG7A 4ZPCA 1JXVA 4CLYA 4KGMA 2WVBA 1CULB 3B54A 4QYZK 3FBBA 3UCZP 2R7XA 4M8LA 3BM7A 3EZUA 3DRSB 1HIYA 1KQKA 4RO0A 4DCJB 1I51B 2Y8WA 4C3LA 2OFHX 2LQJA 2HHXA 3MURP 2IHR1 1S1UA 3E01B 4TU7A 3CC4S 2AJQA 4F4AA 4FPRA 4UY85 3JAMY 1VQLS 3KK2A 2W7AA 3GONA 3NY0A 4IR1A 3PVXA 3Q23A 2W2PP 2LQBA 2WAQD 4ETXA 3HVRA 1S48A 2WCXA 3W5XA 1UW4A 4NXNJ 5CHCB 3RRGA 2NXUA 2V4JA 2DNQA 1G3OA 4MKAA 1YRTA 3UVJB 1NSAA 1IBMF 3ET6B 4R25A 4L74A 2GMHA 4LF8F 4LBIA 2X3GA 3M8PB 4L73A 2MKHA 4K4ZA 2J5AA 1FJGJ 1MROB 5K9FA 1B7FA 2ATCB 1VBKA 3J7YU 2ZBPA 1VQSA 5K8MA 3CDEA 2PI4A 4DV3F 5B09A 2Z57B 2HVZA 4NWBA 3AOAA 5KFTA 1V6HA 2BJ3A 3PACA 3RJMB 1NXIA 2MKJA 1BUXA 1IWGA 2DXEA 5HLFB 5KFUA 4AQYF 3GIIA 3N79A 3OL9A 2F8EX 3TAMA 3MMCB 2MQQA 1OQ6A 3GIRA 3EZOA 4DL5A 4DXLA 2OTLS 2V4RA 4J9PA 4X4QA 1GK8A 4LBHA 3BKUA 4PR6A 4X4PA 1WHXA 4IFVA 1WHVA 2OI2A 4RL1A 3KDOA 3IRXA 1YI2S 1X0FA 4AXJA 2RSQA 1YJWS 4URSA 2OKQA 1FRXA 2MY8A 2BYCA 2CQDA 1F60B 5I3UB 1B70B 4USUA 3W65A 4WFAQ 3QYYA 4TLRA 3KUHA 2AZ3A 5KOWA 4CCHA 2WTFA 4EGLA 1SH0A 2AEJA 3MEDA 2NCKL 3QT7A 2P9EA 5HN0A 4DFKA 5D3GA 1N5TA 3PX0A 3GZ7A 1VOMA 4RW9B 2L08A 1D3WA 5I42B 2BV3A 5KG5A 3BO3A 2WBMA 1QVGR 1ZTTA 1JLEB 4ENOA 2AEMA 2BX6A 2FIUA 3M6WA 1JLCA 3ONQA 2X1AA 2DNHA 5L38A 9ATCB 4Y2CA 2XZTB 4ES2A 1BXNA 2IJFA 1GMWD 4J9OA 2GVZB 3NGSA 3OR2A 1AZSB 4FYYB 1R0AB 2MZJA 1FF2A 2ZOGA 3VVUA 4R5PA 3DOMA 3Q8YA 2V9WA 3X3UA 5IC4B 4CTAA 1TKDA 5HANA 3H20A 2HHQA 2AHOB 3N6MA 2D7SA 3MPUB 5E3RA 5C42A 2DHXA 1BGXT 4BC9A 1RP5A 2UUAF 4TU8A 1UPPA 5KFCA 2RJZA 4ILLA 1WEZA 1REVB 2UP1A 4PQAA 2VA3A 3K7RA 4XDDA 2RDJA 1HNZF 2BE9B 4DCOB 2YX1A 3TEHB 1RTHA 1U6BA 3UQSA 4ZA1A 1R8HA 2A6OA 3HZGA 3EPGA 5E2QA 1RKIA 3CCUS 4NEZA 2W2MP 2KXFA 1JIHA 3K5NA 3I96A 2B43A 2QIFA 3L7UA 1F6TA 5C7PA 4UOCA 2AD9A 2AJ4A 4BDPA 1HQ2A 1YHQS 3M2VA 4M95A 2ABYA 3BGRA 3ITHA 4WPAA 4DPWA 5JXSA 2KG0A 4ZLPA 2VBYA 4KV8B 2BANB 2NXCA 2D3ZA 4Y65A 3JS9A 1K1QA 2ZBRA 1N34F 2EFQA 4PXCA 5CCMA 1XERA 3NBPA 4L75A 1WDDA 3EGVA 2AJFE 2KDOA 5KOXA 5F41A 1DZ5A 4LQ9A 4DR1J 2KKHA 2QLFB 1VBZA 3DXBA 4K4VA 5J2QB 2NYIA 5FIIA 1IN0A 4CLFA 1RHMB 2NSCA 3O6QA 3EGNA 4J91A 2Z0GA 3SQGA 3PY8A 3H5XA 2RQMA 4Q44A 3CJTA 1XMOF 5KFXA 3KLFA 1S9EB 1HQUA 4HTIA 1S79A 1AW0A 3RB6A 1WTFA 3P4UB 2G9OA 2UZAA 4UT4A 2W4DA 4H4KA 4OX9F 2F4VF 1IJEB 1P9QC 4ZPBA 4USHA 3GJQB 3LP1A 1QAIA 2OEKA 3AH6A 3OW2R 1NO8A 4IQXA 2WVEA 5EX0A 3RBZA 1YDLA 2OH2A 4LRFA 2HKEA 1EKRA 2LQ9A 2OD4A 2UUTA 4DQQA 2UV8G 2H1YA 4F4WA 3C2PA 3NCPA 4YR0A 1TVRB 1WC6A 1SC6A 2R4FA 4Q8FA 1TL1B 4YY3J 5JMNA 3OPKA 3S8SA 2HPUA 4ZVOB 4B9SA 3BO4A 4YB7A 1PG5B 3GIJA 4OX7A 2D41A 1TFWA 2AGOA 3L9ZA 1KOHA 3KG1A 1Z4UA 3IR5B 2RUSA 2J0WA 4ECZA 2BZ2A 5F8JA 2BJ1A 3RRKA 4ZP8A 3JQMA 2P9CA 4NLQA 3QT6A 2C3OA 1HI8A 2XMWA 1ZPWX 3IXQA 5ITHA 4DR7J 5KFSA 1XN9A 2WSCC 2CQ4A 1WSRA 4C4WA 3HT3A 1G2EA 1RISA 4USIA 1HWIA 2B9XA 3GPAA 5L46A 2QA4G 5J1EA 4BBYA 1GXTA 4FYVB 4KRWA 2J8AA 3W8GA 1M5HA 3I55S 3BPDA 2ZEJA 2CG8A 2DPIA 1RT5B 4RWXA 4EI2A 2VHGA 3KG4A 5IFMA 4ECVA 1Q1KA 4X4VA 5CYMA 1S6OA 2B4VA 4Y34A 2R7UA 3T1YF 4TY9A 2JL9A 4CWBA 3QT5A 3OFHA 4XTTA 5KT4A 1O6XA 1RAIB 4NLTA 1RAOA 2EC2A 2F4FA 1NEEA 2HAFA 4MAKA 3QJJA 1DQAA 3FFIB 2FLOA 2C2EA 1LXNA 4KR0B 1S9GB 4N76A 2ZITA 2NLWA 2PEBA 2WBRA 4Q2MA 4IOBA 2OPSB 3DLGA 1Q81T 1NCLA 5DG7A 3R5AA 1HW9A 2QLWA 2V2VA 3CF5Q 2DR7A 2L9WA 3R97A 1V9OA 3MM8B 3UW1A 2DCLA 5E3AA 1M5SA 3NS7B 3M8QB 3VALA 1JNRB 1YJ9S 1P1LA 3A12A 5HJXA 2CZ4A 2JEFA 4RNMA 5CABA 1A0OB 5HP1A 3Q0AA 1CJVB 4J90A 3KLHB 2IMOA 3Q8PB 4ZKAA 3L95X 1WNEA 2L41A 3D3BJ 3H0PA 2DNRA 3QFHA 5D78A 4NASA 4I2QA 5K5MA 1JWWA 2OMLA 4OX6A 1J2VA 3J7A1 3GR0A 3MD3A 1WKLA 4WIIA 3D68A 2CYYA 2MXYA 1Q5YA 2ZKUA 2HWIA 4KKOA 4USWA 2EC0A 4FKYA 4DX7A 4E98A 1XC9A 3QATA 4NX9A 1MWYA 2BE2B 5CD4A 3W5YA 1Q79A 3ENVA 3KK1B 4P2SA 3T3FA 1JLQA 4LFAJ 2XYGB 2BJ8A 1CJTA 1T9XA 1HI1A 4F2RA 1R8PA 3WIUA 3OR1A 3CCWA 1ELOA 4DV0F 4O44B 2QJ3A 3U1NA 3M4XA 2HRTA 2OLWA 4MK8A 3NKYA 4ZPTR 3TR5A 4EO8A 2HNDB 4R0JA 2W9BA 4C8OA 2IBOA 4B3RJ 2E5HA 1S0OA 3HSGA 5MLCV 2Y1JA 2BKNA 1VQ6S 2KL8A 1S6PB 1NJWA 1OYEA 2VU5A 2VD3A 1CC8A 1K9MT 3RR8A 1HW8A 3FEXB 3AQPA 5EX3A 3LTOA 2XHWA 4GKJJ 1AA1B 2AV5A 5DRKA 2GQ2A 3W2VA 3KLGA 3BH7B 5JUMA 4B3OA 2QMUB 8RUCA 3FUYA 3G8SA 4WXWA 3BZQA 2AGQA 3QO9A 2YWFA 3A3OB 4R8UA 3BF4A 1NU4A 1S1XB 3TJAA 4OJHA 4ICLB 4MFBB 2KVQE 2P5VA 3G82B 2UXCF 5IS2A 2B8PA 3M1VB 4O0IA 2VJVA 5LMUJ 3NAHA 3DRRB 3RAXA 2VFTA 1X5OA 3MAQA 2CRLA 3CSKA 1P9YA 1X5PA 3RAQA 4CLWA 2BACA 4DU8A 4IG0B 5D0EA 2UVVA 4JI6J 1Q8LA 4MK7A 3OVSA 1JJ2R 3GU0A 4Q7AA 2Y1RI 2QSWA 1VQ4S 2MGZA 2QMXA 4KIAA 4RJVA 4U6PA 3JQJA 4F8RA 3QBCA 4NMXA 3TX8A 3ZNJ1 2M4MA 3EWGA 4ZVHA 4CYUB 2C3MA 3DLEB 1LXJA 1HNWF 2NYHA 1ZZFA 3A1YG 1DJ0A 4DR1F 2XMJA 2PT0A 3M30B 1K8AT 3V81B 1AUSL 1NK6A 3UFCX 2Q1LA 1H6KX 4FKXA 4DSKA 2IVMA 1NAQA 4B9TA 2KFNA 4DOZA 2DIUA 3I4HX 3V4IA 2MKKA 4DR4J 3LGHA 2HVDA 2HWHA 1LK7A 1UVNA 4LIRA 1VS3A 1HI0P 4EZ6A 1WACA 1IKVB 2R8GA 5KFJA 1AT1B 1VC6A 4LSLA 1NH8A 1TELA 5F0WA 4I67A 5DG9A 3PZPA 2XLIA 3BKTA 1UETA 2B6AB 2WONA 3BYRA 3NRBA 2LEPA 3JSRA 1XJWB 4ZJQA 3THVA 1S6UA 4ECYA 4DLEA 3MCSA 4NA1A 2OTJS 1Y0HA 4LQ3A 4ZS6A 2NZ4A 3MAAB 4YY3F 3S7RA 4EMDA 2E1PA 1ZOTA 3EDQB 4H4KC 4O3QA 3Q2SC 1IKXB 1KQGB 1UEUA 5CQGA 4CDIA 2O67A 4GC6A 4P6QA 4I4BA 1NLKL 2NQPA 2HK3A 4GO5X 1Y11A 3PRBA 3C16A 2XY6A 3I0RB 2V63A 3L3CA 2V2QA 5F8IA 5CCLA 1VC0A 4CT9A 6FDRA 4ECUA 2N4CA 2JEJA 1M5PC 4DR7F 3TARA 2UU9F 3D3CJ 2XNRA 3GB0A 2U2FA 4F3QA 1Y5LB 3KLIA 1RT2B 1HBNB 1C4CA 1KKHA 2Z2ZA 1RT6B 3N0VA 1HBOA 4LR8A 3WC2A 2GV1A 4KGZB 1NSKL 4FF3A 4W4MA 2EK6A 3GSDA 4C48A 1T03A 2HFNA 1MWQA 2ZDOA 4NZ0A 3DRPB 2JSXA 1KDNA 3BGUA 4KYZA 4DR2F 5J2PB 5L39A 5M2RA 2RS2A 2HS4A 3MM5A 5DQGA 4A8WA 2CUYA 3PG9A 4PQUB 2J0XA 1F2HA 2V34A 1BQMA 1FRKA 4KHRA 3G9CA 2FVQA 1C0TA 2V67A 3DOKA 2ZD1B 2C2RA 2LXUA 1IR2A 2ZH9A 1SH2A 2CQCA 1TAUA 4BWJA 1FRMA 4OYWA 5C5JA 4LF7J 2C2NA 4WFYA 1LWXA 2HHWA 2P8IA 1ZM9A 5L1LA 4UF4A 2XS5A 2CDRB 2QLBB 3SCKE 1QJHA 1KD1T 4DR5J 2CQIA 2YNHB 2CPIA 2VJUA 2QA4S 3M6VA 4E8UA 1Q82T 2X1BA 1LNQA 3DLKA 1HYSB 3OFGA 3FK4A 2XGQA 4KB7A 2VDHA 1F3VA 1UCNA 2QFJA 2I38A 3FMBA 5D4LA 1S1TB 1IKYB 4N41A 4IH5A 4P7VA 5KFNA 3FSYA 5J2MA 4HT5A 1KVJA 3K17A 1FK9B 5HBMA 1VHIA 2R3VA 3W66A 3CCJS 2AEFA 5IQQA 2C28A 1EX8A 3ILIA 3LH2S 4O3RA 3NGRA 1HQEA 4DV4F 2RDIA 2GJFA 5DDPC 2YPZA 1W2IA 1Q16B 4AE5A 2DNPA 5BYQA 4LFAF 2DNLA 2ZHAA 1KQFB 5B0DA 4RNNA 1YSJA 2IPOB 4G3IA 3CW2C 4OI4A 5A8KA 2OAUA 1WC1A 1J5EJ 3RB0A 1GEHA 3T9NA 3D67A 3CJKB 4B3RF 1JQGA 3G6XA 4NZ7A 1FD8A 3OVBA 4F7VA 3FRZA 3J81Y 1HMVA 3TA0A 1T9YA 5IT9Y 1NUEA 4GVBA 3KOAA 2IAJB 1RQ0A 2DGTA 1NHUA 3DOLA 1FRJA 2QYGA 4U9RA 5DGAA 5KFGA 2RD5C 2GZOA 4WP3A 1R3NA 1JB0C 1DQ8A 4JI5J 1RTIA 2G2OA 3T9ZA 2BJ7A 4HT7A 1MMNA 3D6HB 5SZTA 1PSDA 3DU6A 4GO7X 1BQXA 1NRKA 4W98A 2AYMA 3AQOA 2GHPA 3CO9A 3KK3A 1T3OA 1N5QA 3R5JB 5EHHA 4UW2A 1VLYA 4DX8H 2EXUA 5BJRA 1PAUB 3CCES 3LALA 2H4YB 5ETQA 4BC7A 3MR7A 1WD6A 1D8ZA 3FGVA 4CQ1A 5LMUF 1NJXA 3HKZD 3WZ0A 2KZMA 2ZJQQ 4M5IA 1U1RA 1S0MA 3EDRB 1FKOA 3IS9A 2XYHB 3TJ9A 4MJKA 4M5MA 2VG5B 3I4PA 1RWKB 1ZH5A 2DGWA 1PILA 2C3PA 3T5LA 3NS5A 4JI2J 1HPZA 4JI6F 3HSJA 4KHPJ 4OYOA 1HNXF 1OY9A 4V19J 4OI0A 2VA2A 3QGGA 3CMAS 3J80Y 1Y5IB 4YR2A 3PCOB 5DQHA 2R2RA 1T9UA 3CCTA 1B4SA 3F0NA 3MR6A 2CNNB 3QWPA 5GMDA 3H59A 2M7SA 1Q4RA 2O5DA 1U0SA 2GJIA 2WW8A 4KY3A 3QIPB 1WOSA 1BWVA 3FZBA 3QZ7A 3CMES 3BSOA 2WVCA 1SV5A 3MM7B 5SUHA 1S6QA 2W2QP 4PKDB 1BWEA 3RB3A 2ZJRQ 1BQNA 1IBKJ 4YHHJ 4QBUA 2GIQA 4NLVA 1L3TA 2PFDA 2VPZB 1PC5A 3KDNA 5E5NA 2C22A 3U02A 1QUPA 2YNFB 4JV5F 2RRNA 1WDTA 2BA9A 5LMNJ 3MEGB 3SSRA 2FYXA 2BKOA 1BMQB 4J9LA 4X62J 4PWWA 2LKZA 4C8ZA 1LWEB 1IM4A 1CPZA 5KT5A 4DR4F 2XB2D 3N28A 3P6YC 1RABB 4HYKA 2ROPA 3BN7A 3S6EA 5KG3A 1T11A 3G8TA 2VPWB 3D5MA 1LWFB 2GO9A 1L3KA 1NK0A 1PCAA 2M52A 4CLPA 3NG8A 3KNGA 4FYDA 4JOUA 4C98A 1FVQA 2BM0A 3CUNA 1Z2ZA 3TZYA 5G0RB 1GH8A 3UN5A 3I0SA 1NJZA 1FNXH 2HIYA 2XLJA 2LEAA 1FX2A 1LEOA 2QL7B 1PIEA 4RKUC 2XM3A 4DPYA 1QE1B 2HFUA 3R5GA 2YH1A 2HLUA 4N7TA 4ANCA 3CD5A 3EVMA 3M8WA 1BY9A 2CWXA 3H42A 5KT2A 3HM9A 4DR3J 5CH7B 2E1CA 3HZEA 2CQ3A 1D8YA 1VQOS 4U8YA 4RBVA 4KPCA 2DH7A 3RW7A 3HVTA 3H5SA 4JV0A 3E2EA 2K1RA 3IR6B 4NRUA 5ETTA 1JLFA 1T05A 4JI4J 2KI2A 4J9UE 4OQJA 4BWMA 3LAKA 2DJWA 4DSFA 5L9XA 2JX2A 4NEYA 2LECA 3PW4A 3TWZA 1RGVA 2ALYB 4OL8A 3PDNA 4OZJA 2NPFA 3AD7C 4B9LA 5JVHQ 4EFAC 4RW4A 3V5RA 4F0MA 2VG6A 1RHRB 2DIVA 1TK8A 1VGYA 2JEGA 4HHHA 4CO2A 2W9CB 2LA4A 2CNKB 4NPOA 4JV2A 3OD2A 2NZCA 2CQPA 4NLDA 4WKRA 3KTQA 2W01A 2JZ5A 5DO2A 1V3RA 1YBAA 2FHJD 3CC7S 3MR2A 2G13A 2CPFA 2B4OA 1SBRA 2DGXA 5ETNA 5KFWA 2ZJPQ 4F4YA 2GGPA 1I3OB 3OHAA 1AFIA 2FGOA 5KG7A 4CM0A 1TKZB 4M94A 4LF7F 2C3YA 3CVKA 1TKTA 4FDFA 3Q8UA 3LWLA 1YJUA 4JUZA 1S1WA 4JB8B 2UV8A 1UVIA 2ZVSA 4IFYB 3W9JA 4PXBA 2H65B 4ED6A 2E29A 1UEVA 2QV6A 3B8HA 4HTJA 2MLYA 4KC5A 4WBFA 3GFXA 1A9NB 2K3IA 3E3XA 1RT3B 3TZZA 2AJ1A 4HH0A 5L1IA 4CIOA 3H4DA 1S1UB 3M8YA 4DV6J 1X9WA 3EZ5A 3Q8SB 2MQMA 2KB2A 2Y3YA 1D9DA 1VK3A 3SZ2A 1TR0A 1UFLA 2XMKA 5K8PA 4DHVA 2G1HA 2ZHOA 2OPPB 4J9VA 2FZGB 3CIMA 3K58A 4P2FA 1GMUA 2ADCA 2KN4A 1JLAA 3GLJA 1FDDA 2XWXA 2OPRA 2HW3A 1R6VA 4O4GB 4CO5A 3AAWB 3AOCA 4ITSA 3AFGA 3IAS9 2HG4A 2ZWPA 1S99A 5IWAJ 5K8NA 2VFRA 2VBXA 5KFBA 5AXMA 3WBZA 2ZC4A 1FT8A 4DV7J 2FY8A 3AB2B 1LV5A 1J5EF 4DSEA 1NDKA 1KTVA 1RT7B 4FS1A 3TAMB 2DGVA 2WVDA 5T41A 5FJ4A 1IQZA 5LJ3Y 1NSPA 4B3SJ 1UAWA 2ZH8A 1DFDA 3DC2A 1OY6A 1I6JA 5GMKa 4TU9A 1E6YB 2NR0A 2HVHA 2MKCA 3DLHA 1LW0A 4CZCA 1T9WA 3BSNA 2GVDA 2ROGA 2KT2A 5LT5A 4QIFA 3J7Z5 3Q89A 4JI5F 1VRTA 3NMRA 1UWBA 1VQ7S 2RF2A 3BQ2A 4OZNA 3LANA 1DBDA 3GYXB 3IBWA 2G0CA 3LF0A 2YKNA 3MMBB 3HHLB 4IG3A 1DY3A 3GCWP 4DG1A 4B9NA 1FFSB 1F5CA 3QAUA 3OTBA 3OL6A 1H3DA 1VQMS 2EK1A 1RSCA 1I94J 4S0MA 2ADBA 1GAOA 4K50A 5FDLA 1MLAA 4HR2A 1R43A 2VL1A 2F3JA 1EAYC 5T7LA 2YWHA 1NH7A 1Q7LB 2DGQA 2PA3A 1Q95G 2W7OA 2EW9A 4DSJA 3A8EA 2VASA 3TZWA 4CO1A 2JLGA 3OR2B 3BR9A 5C24A 3MI7X 1FRIA 4JI2F 3K5LA 3DM2B 4CP5A 4OHZA 2MKIA 1CULA 2XSJB 4HLBA 2CPJA 1OS5A 4CI0B 2R7QA 3DRSA 1Q78A 1SIWB 1UP1A 1U8SA 1RAJA 4CLTA 3GMGA 1SPBP 2G1DA 3TRGA 5LXRA 4MTPA 1IBLF 4DBQA 5B0EA 3E01A 4L3NA 1RB0A 1WC5A 3GSIA 1RU1A 1TL3B 3ZZPA 2NXJA 4Q8EA 3ICLA 1RZMA 2XS7A 1IBKF 4DS5A 4YHHF 2Y1LB 5E41A 4ZVQB 3FSIA 4ECSA 1VDHA 4RW6A 3C8YA 3I56S 2Y8YA 5DZ6A 4J9KA 4X64J 2R7VA 5LMNF 5KT7A 4P2XA 3UVJA 4M5LA 5E3PA 4X62F 2R8JA 3ET6A 1TAQA 1HWKA 1PYOB 5CAAA 3JSYA 1VRUB 2B51A 3M8PA 3TX0A 2FVCA 4ATNA 4NLPA 1JLGA 1VMBA 5KFPA 4ZPWR 1S5ZA 2YKQA 4NCBA 5A8WB 2IC3B 1Y5NB 1VCTA 3G4SS 4IKAA 5IT0A 5DLGA 4ZDNA 2G2ZA 1RBOB 4DMZA 1BD6A 2XULA 5GAEU 3P5TL 4PXEA 3HLUA 2FJVA 2HQFA 4TVAB 4N77A 1ZZNA 4F50A 3TUPA 1C1BB 3MMCA 1U1MA 3EJMA 1TL7B 2LLZA 5FD1A 1WEYA 3MWBA 4X84A 2OP5A 2VONA 1D09B 3E8OA 3SQGB 2ZH1A 2MZTA 1TV6A 3QMQA 4DR3F 3KLFB 2VBZA 5J1NA 5HVGA 2HQCA 5I3UA 3CPWR 1R89A 1PGZA 4EBCA 2NSBA 4RUBA 3TQ1A 4OLPA 4ZP9A 4QYRA 3ZTOA 4ZCKA 4EK2A 3UE2A 2V6AA 2XSFA 4ED3A 4JI4F 2PIIA 2DR8A 2QRRA 4YOEA 1GTEA 2KFZA 1FDAA 5I42A 2O1PA 2V8HA 5JJBA 1YWXA 3HO1A 4C9DA 2VFSA 3M9OB 2R7TA 2R7OA 3NCRA 1RAFB 1TL5A 2GVZA 1AZSA 4IRCA 1FXDA 3M32B 2DK2A 4A46A 3KXDA 2HBZB 3CCQS 2M8DB 3OUYB 1S7IA 2ZDPA 2KH9A 2GS8A 1EP4B 4EYIB 2EG2A 4NE9C 1RYRA 2YXLA 1B0PA 4AL7A 5EN1A 4DN0A 1YX2A 2IJNA 1REVA 4ED4A 1KLMB 2XLKA 1H7WA 5KFQA 4YP3A 1D9FA 3OV7A 2E1AA 1ZETA 2RE1A 5DJBA 4CLKA 2CJYB 2LDYA 4JYAJ 1KS2A 4CNZA 3QRQA 1B64A 2IA6A 3F56A 1RWWB 4OHWA 3GIMA 4U7UD 4DV1J 2PDAA 3VGVA 3THPA 1NHVA 3CEDA 4OZ0A 4DV6F 3DHWC 3CD7A 3JTPA 1HWUA 3CTRA 1VR6A 3DCAA 1ROFA 1T94A 1AYEA 2MB0B 2CJ9A 2HK2A 1WG4A 4GKKJ 4KV8A 3MECB 4KGVB 2BANA 2BUNA 3POTB 3C14A 2DXDA 2MQPA 4Y0FA 2ZH3A 1MU2A 3OSPA 1VQKS 3DLGB 4IRKA 2DHAA 2IA0A 3U1MA 3H5UA 2QTWA 3VTIA 1NPRA 2J8SA 2YVSA 2UUCJ 3AXMA 5J2QA 5GAGU 1Q86T 2NUHA 1PO6A 2BM1A 1M0SA 5GAGI 1YG0A 5IWAF 3A8JA 2YQ0A 1E6VB 2IVFB 1HNVB 3R5CA 3EPIA 2GA7A 1JJ4A 1BHNA 2XMVA 4CM2A 4DV7F 2UUAJ 2DISA 1S9EA 4UOGA 3UD3P 1U1PA 1FD2A 1SKSA 4O3SA 3G6ES 3I9ZA 5CYJA 1SI9A 2AWZA 1GMVA 3H8YA 4RU9A 1HNZJ 1FEEA 5K8OA 4O3OA 3IFEA 4QPTA 4P9SA 2GAGC 3KJNB 3IG1B 1WF1A 4A8OA 4ECXA 1VISA 4NI2A 2FVRA 3JSMB 1UL3A 2QT7A 2X51A 1UA1A 4G1QB 2YH0A 1VJWA 3DLJA 1U45A 3D1QA 4KGXB 3H2VE 3CCSS 3LP2B 4ZP6A 3MZIA 4LFBJ 1X9SA 5EWGA 2CZVC 3UNGC 4MKVA 4HVZA 2GFFA 1IUJA 1TL1A 1JLQB 1LK5A 2AX0A 2W2OP 1KEKA 4QZVB 1N8RT 1R8CA 4LF6J 3GFHA 3I31A 1N34J 3A3PB 5CYQA 4C0HA 2BBEA 2R8HA 2L9NA 2DNGA 2NXNA 2E5LJ 2BQUA 5HK4A 3C3LA 3V6DB 1X60A 3HHEA 2M0GB 2CJBA 1IJFB 2GX8A 3A3NB 3KUGA 4NA3A 2OD6A 1GTHA 3CJ2A 3KJFB 1GQEA 3I5BA 4DSIA 1X4EA 1FO1A 5DDRC 3R2CJ 4L72B 2P6SA 4KH0B 4IOCQ 4MYTA 1WHYA 4EEYA 3C46A 2A2DA 1XR5A 2PD1A 1J5OB 2KRBA 4LVOP 2HHSA 1C0UB 1X4AA 1XMQJ 2HRYA 2F8HA 3W60A 1EB0A 4U67Q 3KLGB 2B7BB 2OGUA 4OX9J 3HJVA 3FQKA 2E9TA 2ZOMA 1RT5A 4RNHA 1HBUB 1A6LA 3R7SB 3MAHA 1FVSA 4LT6A 4R8UB 2WSEC 4TKTA 1FEHA 5KFMA 1YQHA 4WK3A 4ERDA 4UUWA 4NYZA 2M70A 5D0RA 2N7YA 3BS9A 3QZ8A 4K0KF 3FFIA 1FXLA 4DLGA 1S9GA 2FJBB 3VAJA 1RT1A 2HNYB 5ETVA 4FVCA 3QIDA 4J9MA 2DH9A 1JMTA 1N88A 2OPSA 2V8GA 2V94A 3B4DA 1XMBA 4WE1A 4DDFA 3IBFB 2BE7D 4HL9A 3MM8A 5IZHA 1BC6A 2FVSA 3QJPA 1CJKB 3ZZZA 5HROA 3M8QA 4M63A 1PBUA 1WI6A 1S4EA 3M05A 5A6WA 3NL0A 3AA8A 2YWKA 1CJVA 1DTQB 5AJ3J 3KLHA 2CKWA 1U49A 3GP9A 2LCWA 3TI0A 3I6PA 3SBMA 2J9CA 4ZPDA 4QIEA 1U47A 3VQSA 1N5YB 1TP7A 2ZH6A 1KN6A 4ZLNA 4WP8A 4PG7A 3R7BB 2Z56B 2EVZA 4OX8A 3IMQJ 3IP0A 2D1CA 3PR4A 4X4NA 3FC9A 3T1YJ 3V4IB 3KLVA 2AKWB 2XY7A 2BE2A 1HA1A 3QGIA 1QAYA 2R2SA 2MZ1A 4B17A 3AJ1A 4RZRA 2BOPA 5KFIA 2RAQA 3HI9A 4PPZA 1U8WA 4YR3A 3AY0A 2CQ1A 2AYGA 3PXGa 1X7VA 2H51B 3FSXA 3AODA 4OI2A 5LSLA 1YZ7A 1JJCB 2UUWA 1O0PA 4O44A 4Q5VA 2PMHA 1RDRA 4OLOA 1NDLA 3CD6S 1X8DA 2HNDA 1RTZA 1HD1A 4FBTA 2RB7A 3CD0A 3MTJA 3T5JA 5HSPA 2AMCB 3FBFA 3S01A 2J9EA 3MM6B 5LM7E 2ERRA 3UCGA 1S6PA 3PIOQ 4ID5B 1DAXA 3HSZA 3N5FA 5IQ6A 5BYSA 4RW7B 2XY5A 3VAMA 3LA0A 4K5SA 3PJXA 1M90T 3C16B 1CS4B 3JTNA 3MOJB 4RWWA 1WUUA 2ZM6J 3A13A 5E3CA 1AUDA 2DO4A 3SMZA 4PPDA 2VB6A 3IAM9 2DEJA 3KHLA 3BN4A 2FQQB 4P7TA 3PEHA 3DMJB 4JP8A 3UNYA 2OO4A 2YQ3A 1S1XA 1YJVA 2DVIA 1G6BA 4K4XA 4JYAF 2V9KA 4ICLA 1FJCA 4KE5A 4QPXA 1YZ6A 4MFBA 4DWIA 4DV2F 3G82A 4X65F 4DV1F 2IDLA 3M1VA 1KSPA 3DRRA 3TA2A 3NEKA 5D15A 1XK8A 4QWBA 2PN6A 2LU1A 4MH8A 4J5OA 2V50A 1TFYA 1S76D 1IVZA 2JDJA 2QLJB 1YK9A 3CJQA 4JI3J 2JOQA 3RU0A 2IIHA 4USKA 1NDPA 3PW7A 4DV0J 2FGCA 5IXUA 4GKKF 1FERA 2Z2LA 4TLQA 1M5VC 1I1GA 2H4WB 2W4PA 4OYAA 2EKNA 1RTDB 1RLCL 4CYUA 3DLEA 1FNOA 1HR0F 4HI2A 2ZBCA 1ZM3A 1MW7A 4NYOA 4LF5F 3DDNA 1JXLA 2UVWA 3CC2S 2NS1B 2UUCF 4HEA9 3M30A 3IWLA 2QFIA 2VODA 4YDDB 4ZJLA 3V81A 4NYPA 4LF2A 4N8OA 2RHSB 2RT3A 2LVWA 2EFNA 2ALZA 1DLOB 1ULRA 3P45B 2I9SA 1RAGB 1SC3B 1IBCB 2Z30B 1YRXA 4LRBA 1IM6A 1KVKA 4RR5A 4N5SA 1RCOB 2D9OA 3RG6A 5F9NA 4OHXA 1WG5A 4QCLA 2UXCJ 5KFEA 2N4DA 5FLXU 2J9DA 5HBMB 4K4WA 2B6AA 4KGKA 1DTTB 3RR7A 1B0TA 3W1YC 2XMAA 4B3TF 2MDAA 2HZCA 3US5A 2ZE2B 3FCWA 2VPYB 1OPIA 4DF4A 3DU5A 1G7CB 3KMQA 4LFBF 2DEIA 3MAAA 1QVFR 2H5IB 3BGFA 4OZ1A 3CJ0A 1KVIA 1FWPA 2CPXA 3Q2TC 4B9VA 2K7KA 2RHQB 2EFPA 1IKXA 4U7CA 4LF6F 4C8LA 1QSYA 2DRAA 3GJTB 4DS4A 1N6QA 1RJJA 3NGTA 5ADZA 2YNGA 1FX4A 2E5LF 1HNWJ 2A3JA 5E33A 5MAOA 4H4OA 3I0RA 4QW9A 1C2PA 1NM2A 2RQCA 2OUGA 4ALZA 3LPEA 1V3ZA 2H48B 4ZOSA 5KT3A 3TJ8A 4RBUA 2J7KA 2EPIA 4P52A 4UQGA 1HBNA 1I5OB 1EKSA 2VPXB 3G71S 1RT6A 3PR5B 2FLPA 2KRRA 1XMQF 2VC0A 3UWTA 3CIZA 4LR9A 2V69A 3IWXA 3M9MB 3BJYA 2Q43A 3KWMA 1PYTA 4Z2XA 4MIWA 3DRPA 3PO5A 4CLSA 2GC8A 4DU7A 2XQCA 2FJDB 5T14A 5J2PA 3Q8RB 1NMEB 1K73T 1U0HB 2G0IA 4HDHA 4WTOB 3T41A 4NCGB 3R1LA 4YB5A 4OYMA 4Y2KA 2F8MA 1RACB 2RRBA 4DFMA 2HHPA 5EWEA 3KG0A 1GX6A 4ECQA 1WKKA 2RQKA 2APOA 1TKXA 1VQ9S 3MGJA 4YMEA 2PE8A 4F2SA 2ZD1A 3NLCA 3UI3A 3A4TA 5D6GA 1DARA 2J7UA 2FJXA 2G4BA 2RU9A 3GYNA 4ZMMA 5GVQA 3HFKA 1U25A 2OSRA 4CRJA 4FXWA 4YUDA 2KM8C 1VQ8S 3CO0P 3I32A 4DQIA 3UCUP 2XBPA 1HPZB 1CJUB 2B0GA 4LRCA 2F1FA 2CAJA 4ED1A 5J2NA 1WC0A 1Q7YT 4DV5J 5F8MA 3FNNA 2EBGA 4R0EA 4LF4J 3EUNA 3N6NA 3OHBA 2DHGA 2YNHA 1S0VA 2J6SA 3BQ1A 3MPWA 2ASLA 3TVYA 5KG0A 5AJ3F 4A4JA 8ATCB 3TZXA 5L1JA 2UU9J 4ED0A 4Y00A 3ENQA 4JI0J 5U47A 4QWAA 2LXFA 3L4BC 3NCQA 3RGIA 2QO3A 4IOAQ 1SV5B 3CJSA 1S1TA 3O8WA 2AJ2A 4F04B 2V8PA 1IKYA 2EFOA 2RH3A 1LWCB 3G87A 1Z1ZA 4B3MJ 4DR2J 1W26A 4AT1B 5HMWA 4KT0C 5DS7A 4LSNA 3SCLE 4URQU 1KOOA 4ILRA 3FQLA 3QGHA 2V68A 1N0UA 2GNKA 2DT9A 2YQ1A 2PSZA 1CG2A 4NCAA 3DI6B 3NGKA 2ZUGA 4ECRA 4DL3A 3R27A 4ZHRA 4DUYF 3C15B 1KTQA 2E5IA 4C0BA 4ELVA 3WIVA 3HPOA 2J6TA 3KJQB 4PCQA 3LP0B 2SXLA 2B7CB 4KQZA 4DL2A 3ZZ0A 2VC1A 1FKPB 4I6AA 3ZTPA 4K2XA 4F3OA 2XGPA 2Z8QA 2WOMB 3V6KA 1Q0NA 2W7PA 3D6TB 3GR1A 1ZBTA 4FF2A 1RWOB 3C66A 3N4WA 1QTMA 1T0TV 5BYRA 1U2FA 4H54A 2JVOA 2POKA 2DR9A 1VRQC 5HL7Q 4PABA 2ZKTA 3LUYA 2N7CA 1FDBA 2ZM6F 2LQ5A 5EWFA 1FWLA 3HVTB 3VZHA 2IFXA 2VIHA 3JYTB 3UR0A 4ZCIA 4IQMA 4O3NA 2CJXB 5G4DA 5DZ7A 2OIHA 1KP6A 9RUBA 3BBCA 3RBDA 4M5JA 4I2PA 4XAKA 1S97A 1CSJA 2HGNA 1SH3A 1RHUB 2F63A 4IH6A 4IO1A 4IYQA 3PKYA 1KONA 4OI6A 3QQCD 2LMIA 3QLHB 1N48A 1JKHA 4DV4J 4RW8B 4E0DA 3PM9A 2KZZA 3HF5A 4RW4B 2W8KA 4OZLA 2JLEA 1X9MA 2AP6A 1IKWB 4YB6A 1CQMA 2CXEA 1SJ1A 2X1FA 1FKAF 3LAMA 5D77A 2VG5A 3LWMA 4EWTA 2P6TA 2JFDA 4JI3F 3GV7B 3P49B 4ZIWA 3PO4A 2NUUG 2RILA 4DUTA 3BB5A 4FP9A 4P2MA 3TAQA 2JLFA 3OLBA 2LYVA 3O5TB 2PEHA 4FN5A 4CLLA 3VZIA 1XTZA 3M8ZA 5K14B 3CDBA 3QT8A 2AT1B 2V2KA 1TKTB 5KFVA 2VOOA 1XNQF 2DTJA 4UQTA 5IOLA 3QIPA 3J81j 4PYAA 2R9LA 3MM7A 4V19X 2ZVIA 3FCVA 2H5EA 3D2WA 2XS2A 4UTGA 2W1BA 3I82A 3HP6A 4J9NA 1B0VA 5ETKA 4LIWA 2UVUA 2GIFA 2YNFA 4PG4A 1R6YA 1R31A 3MEGA 2F7VA 5A2QU 1FE0A 4J37A 1LWEA 1C4AA 1X31C 3V4MA 3R6GB 1QAXA 2HHHJ 1U1QA 2HHTA 3NOGA 2BQRA 1VFJA 3V6JA 1WEXA 2YNIB 3P5BP 2YKMA 1C1CA 1NKEA 3VCDA 1RAAB 5DQIA 4ED2A 3F73A 2ATLA 4Y6IA 1H98A 2KHDA 4JI7J 1XBWA 1SVDA 3N01A 2VQEJ 3FEYB 2CVEA 4OYIA 5G0RA 1YITS 1B3TA 2CPDA 1NPPA 4NRTA 1AFJA 2OPRB 1Y7PA 5KFKA 3DGPB 1HNXJ 1FA0A 2K06A 3I5CA 2FHOB 1QE1A 4M5GA 3CCMS 3KHGA 2E66A 4C11A 3ZXWA 1VK8A 4FYXB 2CPZA 2R7WA 1FESA 5F0UA 4QIVA 1HHTP 3G96A 4PWDB 2MTLA 5LOQA 2EG1A 3FKBA 3R5DA 3GIKA 3M2UB 4ES1A 2M5YA 2VKZG 1K0VA 1LW2B 1Y3KA 3HSDA 4A8KA 1REGX 3R5BA 3B82A 1U7LA 1ZA1B 4H4MA 3ZTQA 2QYCA 1FJ7A 3ZZOA 3TYTA 4NA2A 4UY8T 4JV5J 2JWNA 3SSQA 1B99A 4J9RA 2DNZA 4M5DB 1LW0B 1RAHB 4EYHB 3UD5A 4ZITA 4WJBA 2ZUAA 2WK4A 4K2JA 1VRTB 1H2TZ 3K8WA 1U26A 2KJWA 2RF2B 1R8AA 4OI1A 1T8EA 2BXJA 1YJNS 2WZ1A 2HVIA 2E1RA 3U7JA 4EUVA 5H9EJ 5A0YB 2D9PA 2R2TA 2HNZB 5T7LB 1U6ZA 4B9UA 2JFKA 3BH6B 1ZAWA 1TKZA 1X4GA 2XZWA 4X4OA 2ROEA 3G6VA 4IFYA 5KFZA 3AXKA 2ILZA 2HGLA 5KFLA 3CJRA 2IJRA 4DV5F 5J1PA 1SUQB 2YX7A 1S12A 1H0HB 3SIPB 3TP2A 3A8KA 2OFGX 4LF4F 3RRHA 3P96A 1RT3A 2HAIA 2AU0A 2PMZD 4ZN1A 3EMTA 3UDLA 3VAFA 2CPYA 2RNEA 3CWJA 5GADU 1G4CA 3MPVA 2XCPA 2B9WA 4JI0F 1TUGB 2RKIB 1Y4ZB 5GADI 1OIAA 1U6FA 2IVYA 4EBDA 4WCEQ 5DM7Q 3HJFA 2C2DA 4PUOB 3CMQA 3GTYX 5IT4A 1ZA2B 1U4BA 1HLWA 2OPPA 5LSRA 3PX6A 4RW6B 4B3MF 3CB4A 1UZDA 1NKBA 4USTA 2HVEA 1H72C 2DB1A 4G1IA 2KG1A 2XWYA 2W24A 1TMMA 2DNYA 2AQ4A 3KHRA 4AXIA 3D9BA 2M3DA 4ZVGA 4B02A 2ZWOA 4O4GA 1RT4B 4CNYA 1JLGB 4MT1A 3EX7B 5C2CA 1U2RA 2LEBA 1NB2A 1UJ5A 7AT1B 1VLOA 3J7YI 2ZBIA 3O3LA 5A8RB 2IM1A 4G6VB 4F4XA 2E5JA 5F8LA 5H9EK 1RT7A 4JV1A 5HO4A 3T5HA 2CQBA 2JC1A 3JQKA 2EWHA 3D1OA 2DHHA 3IA0A 3D0GE 3C6UB 2R2UA 2WB1D 3SCIE 4NOHA 2CJKA 1E6YA 1X4FA 1TV6B 4QR2A 2B4UA 1Q53A 3RTVA 3C19A 1CBKA 2DBBA 5A6PA 1T3NA 1TZ0A 2KO1A 4RX6A 2GW8A 3DYAB 1AXQA 3VR1A 2VF3A 3KHHA 4OIXA 4Y3CA 2PGCA 5D4OA 3P8BB 1FRHA 3ULHA 1XNRJ 5KG1A 2DRDA 4URGA 3MMBA 3HHLA 2ZBQA 4PRFA 3UN2A 2ZH5A 3IO1A 2AYBA 3BPSP 3SDEA 2FDNA 2H5JB 1YLXA 4EZ9A 1NKCA 3H2LA 3D7SB 1S57A 4M5KA 3SQOP 4DZ6A 1NJIT 5KFOA 4Y2IA 2RS8A 4RUAA 4CH1A 5C25B 4OYZA 4Z37A 4TY8B 1MNEA 2XI2A 3DGVA 3DM2A 4QU7A 1S7HA 3BDPA 5IM0B 2M9KA 2XSJA 4B9MA 2O66A 1NBEB 3NOCA 4IDKB 1KC8T 2MZSA 1RWUA 3FZ2A 1QTNB 3BGOP 3ZO7A 2ZH4A 2MSSA 4AUKA 2B5JB 2MEWA 1U2CA 1QM9A 3D0HE 2PA8D 1TL3A 4NMLA 4OV1A 5THWA 4KFBB 1UPMB 3G2XA 3OTOJ 3MMAB 2CPEA 2AYEA 1S4FA 3ISNC 4LF9J 5HMYA 1T9VA 4D3GA 2D3OR 3L7PA 1PAEX 3ZZYA 2NXEA 1UVMA 4ZVUB 1SJRA 2VV5A 3CJ3A 3HKWA 2ZNZA 2MQOA 3RBXA 2XYPB 3DLLQ 3HMJG 1EIYB 2OPQB 1RYSA 1X0PA 3EXYA 1VRUA 5ETSA 2HHHF 3PFEA 1IR1A 2B8QA 2JVRA 5B0CA 2CDQA 3DNCA 2XMUA 3ENAA 1RLDA 5AXNA 3D1HA 4DF8A 5A8WA 1H74A 2IC3A 2ZZMA 4K5RA 2Z2MA 4DX5A 3C14B 2XCAA 1FNMA 1P8GA 5LXYA 1PJ6A 4JI7F 3ZTSA 4ETZA 2VQEF 1MU2B 2FJWA 4QWEA 4U7UK 1K0TA 3MEEB 4I7FB 1C1BA 3RYLA 3EICA 5C2GA 2Y1IA 1TL7A 2J0SD 3OJSA 2AW0A 5HMZA 3BKFA 1OQ3A 1QSSA 2BEFA 2DITA 5IC6B 3D4JA 3T1HJ 3EVWA 2JEIA 3BDEA 4BS2A 4FZVA 3CJ4A 3G8QA 1HHQA 4OZ2A 2LP4A 4OHVA 2W25A 1IBLJ 3KLEB 1O51A 3CXCR 3NP5A 2FHKA 3VF0B 2DR6A 4YEAA 4KBIA 3OL8A 1L3VA 3MPDA 2YWWA 3IBCB 1TL4A 3E51A 3PYGA 3HVWA 4NXMJ 3MCOA 2KVIA 4NI2B 1KRPA 2ACMA 2QG9B 3C6TB 2QMWA 2BRLA 4WU2A 4IO9Q 1HBMB 1EETB 3QPIA 4F4ZA 2EKYA 2CADA 4IUFA 1EZZB 2HQ3A 3AJ2A 1O5JA 4M5NA 3HD1A 2BJ9A 5AXKA 3THTA 4MK9A 2EFVA 3SSSA 1SXLA 2HURA 3W2WB 2LDIA 1X4BA 2KYZA 3T1AA 4DL6A 3M32A 5CYQB 1XR7A 1HNIA 3S1TA 3RW6A 3TW0A 3OUYA 3ZZUA 3M2RB 2RVJA 3D6FB 1EP4A 2X7IA 1S1VB 2F9JA 4QIWD 1IWAA 4MKYA 2MHEA 4LUBA 4G65A 1RADB 2G0JA 1N32F 3GG0A 3SEOA 2KXHA 1SCJB 3ELHA 2IY5B 1FTCA 3QRPA 3CT9A 2MYFA 1KLMA 1F1BB 5H9FJ 1RTJA 1UTAA 2HIQA 4LREA 4I68A 2CQGA 3TA1A 2N3OA 1KBRA 4ZIVA 3KKFA 2L3MA 2KM8B 2BOAA 2I5JA 4HACB 3K5OA 3LQVA 4L3KA 2OHDA 1U48A 1JK9B 1S77D 2QGFB 4JI1J 1YGYA 4DX6A 3IR7B 4KO0B 1QSLA 3GV8B 1N52B 3MM9A 2J9DE 1KHVA 4UZCA 2E5GA 3IGNA 1WHWA 2B9EA 3Q8QB 5A76A 2V2ZA 3HULA 2YY3A 3FBCA 2A1BA 4MIAA 3MECA 4CLUA 2E7VA 3POTA 4L76A 4NXNF 4TQSA 1HWLA 1RT1B 2B56A 3FMWA 3UR3C 5E7OB 1FI4A 3TNVA 4ELUA 4Q0BB 1X4CA 1F0XA 4FPIA 1Y3JA 2UXDJ 4QQBA 2I1RA 4DFPA 5D0HA 3ILJA 4WE1B 3VHQA 2ASDA 4K4UA 1JLBB 1FJGF 2YKAA 4WTYA 4DPTA 4PWUA 1WORA 1E6VA 2DNKA 5HROB 2OELA 3ZNUA 1HNVA 4K59A 3KNAA 2R8KA 2J0QD 3KJVA 3K59A 4PG6A 1WELA 1WC3A 4LR7A 3Q8VA 2GHWA 1U1KA 1G1XA 3H98A 2FJAB 1HARA 2XO7A 3KFWX 2VG7B 1AB8A 1SKWA 3OL7A 1WSVA 2VFVA 1LOUA 1VQPS 3IG1A 5E3QA 3JSMA 3RAMA 5H9FK 1S9FA 4FNIA 2IM2A 2ZZNA 2L9DA 4G1QA 1JXEA 2I0XA 4ID8A 2CA9A 4ED8A 1RA6A 4HKQA 1V3SA 3SV3A 1UKUA 1NNDA 2A18A 4QW8A 4TXSA 1PKUA 3LP2A 3MUMP 1SJ3P 2ZH2A 2N82B 1T95A 1NZAA 2IM3A 3KK2B 2IMWP 1YRUA 2CNLB 1F5AA 1SQGA 1XNRF 4WK1A 1YKWA 3CJ8A 3PV8A 4ZVTB 2D3O1 1KQSR 3FEZA 3ETMA 2V4JB 5L1KA 4ZCLA 1RKJA 1ITPA 3U27A 3MUVP 3V6DA 2WSFC 2HZAA 4WFXA 7FD1A 1H7XA 4KPYA 5ETMA 2AGPA 4O23A 1B7YB 2BW7A 3HVAA 4J7CA 3I87A 1ZAXA 1ZM4A 3TO8A 5F3ZA 2UUBJ 2J7WA 1J5OA 5F8HA 5CZVA 1Y10A 1C0UA 3UDVA 3NGDA 4HHJA 4WXOA 2QEXS 2M8HA 1P27B 2MQ8A 3LPYA 4C8MA 1VIXA 3W9HA 3HHLC 1HWJA 2HWTA 2W8LA 1FTRA 2MHNA 4RUHA 3LGNA 4RBTA 1T02A 1HBUA 2DGUA 3CE8A 4CH0S 3W5ZA 2O3DA 4IFVB 4C3MA 3EVOA 1W25A 3H2UB 3B78A 3OTOF 2D74B 3IRXB 3OSNA 3ETOA 1RXOB 4ZVPB 3KUEA 1GNKA 4LF9F 4C0OC 1TU0B 4ED5A 2ASYA 1H2UX 2Q6BA 4C2MA 1XEZA 1MN7A 4L6V3 5KG2A 2FTRA 2HNYA 1RWPB 3W63A 1KLNA 2E9ZA 2V8DA 3GJSB 4YFUA 2OJ3A 3PJ9A 4FVMA 2ZNYA 1U02A 5LSOA 2CQ2A 2HMIA 3MEDB 5D3GB 2E7WA 4OHYA 1MWZA 4BLGA 2X3DA 1CQNA 4USVA 4X4RA 5HQLA 1WWHA 3CCLS 3LW5C 4WFBQ 1HFEL 1CJKA 2BABA 1FCAA 2HQIA 1JLCB 2GMLA 1FHTA 3CCRS 2DR5A 4TQRA 1NZ8A 4U96A 4C8NA 3VAHA 4AL6A 2BJEA 4XPEA 2YWGA 1DTQA 4JI8J 4A8MP 2KHCA 4KSEB 3JXOA 3BGLA 1N54B 1ACMB 4R5PB 3P3DA 3DOMB 3TEGA 4YN3B 3OXLA 4UUXA 4X4SA 3SI8A 2HQDA 3GV5B 4CTAB 1N5YA 1M5OC 4I69A 1NK5A 4YS2A 1GFWB 5D0GA 3H90A 2NREA 3JAMU 4Q45A 3T1HF 3GQCA 5DM6Q 1CVJA 1KNZA 5C42B 1LKZA 1SL0A 1U24A 2ILYA 2V0NA 3BBBA 3VQTA 1QLNA 1RBAA 1N5VA 2Q66A 1RTHB 5M2PA 2JJ4D 2CWKA 4NLXA 2C1EB 2QE5A 4NXMF 4ILMA 2A2CA 2OMOA 3V2UC 5KFYA 1TQLA 3RB4A 3K2YA 4K0KJ 4OMFG 2ZZTA 2C3UA 2BR0A 4BCAA 4DQPA 1FJEB 3MDFA 3W64A 3WDOA 3TUZC 3EGZA 2RDDA 3NGUA 1RWVB 2IM0A 4FBUA 4Q43A 5AE2A 1P1TA 3GCXP 3OLAA 3ZFVA 2A10A 5FLXY 2UVRA 1RK8A 5D8HB 3BV8A 3M2VB 2DY1A 2VICA 1MROA 4PXDA 3BGRB 3ITHB 4TN2A 2HBQB 2IRYA 3MM6A 3GWCA 4NLGA 1KR4A 1OSDA 4ID5A 3HX9A 4USMA 4IH7A 3DDKA 3VVTA 4RW7A 1N6QB 1Z2LA 5HLFA 3NBPB 3KYLA 1T7PA 2RUGA 2YNGB 1SC4B 3UO0A 4H4OB 1UZHA 4WWSA 1CS4A 2Q6CA 3H40A 3IM9A 3R6LB 5CXTA 4XO0A 4FXVA 3T19A 4WFNQ 1IQTA 1UEKA 5EUHA 1FRLA 2GAHC 4PEOA 3M8RA 4ZK7M 5DETA 3DMJA 3AD9C 2CNOB 3BEGB 1TK5A 2WB4A 5DG8A 3MHYA 1DHMA 4P73A 2FLNA 4K7QA 2CQ0A 2W2NP 2HQGA 2BRKA 1VBYA 4WP9A 5GAHU 2BMBA 2RMLA 2CPHA 1HQUB 2FLLA 6AT1B 5GAHI 4HI1A 3OFEA 5B0AA 4ZN3A 3SCJE 2FD2A 1VYAA 3W3SA 3LP1B 4JI1F 1KFDA 2R8IA 2IDEA 4TYBA 2PC6A 4FXDA 3DHXA 3W61A 2QX0A 2KT5A 4RW9A 1OSCA 2HFVA 1FDNA 1R0BG 4P72A 1TKXB 4U95A 1V5IB 2R7SA 3FDSA 2QL5B 1JLEA 1F5BA 3ZZTA 1JX4A 5E0OA 2XZDB 2MZQA 5F8NA 2R7RA 3QSYB 1RTDA 4K4SA 1GMWA 3FVYA 2DNMA 2CQHA 1W2BR 2HYIB 2CVIA 2UXDF 1R0AA 4XDCA 1SKRA 2JH3A 4Q2LA 1X5TA 2BKPA 1KWMA 5J2NB 5HATA 4C97A 1QUVA 5F8GA 3NNCA 4N47A 4F67A 4P74A 4A8YA 4ZLJA 2HFOA 5H1SV 3B6BA 2H54B 2J76E 1DLOA 4OV6A 2KU7A 2Q3PA 2YBVA 3GYGA 3D28A 4NL5A 4OJ3A 1NB7A 4PG8A 2GQCA 3PTWA 4UOFA 3L09A 2PO4A 5J1EB 4DV2J 3LO3A 3G6YA 4X65J 2NPIA 1OMSA 3ZZRA 1UVLA 3HCXA 2CJQA 1WTBA 2RU3A 4FNHA 1DTTA 3MPYA 2JC0A 3MR5A 3AJDA 4LSNB 2OSQA 3N5BA 2ZE2A 3WHIA 5CYMB 4DPUA 3K5PA 1RAEB 3MEKA 2MSTA 3NMAA 3T6BA 4F3MA 1CEZA 5B7WA 5CA5A 4WIQA 2K8GA 1YJ7A 4LF1A 4DPOA 5KAKA 4LFCJ 2LU2A 3HHDA 1D1UA 3VWSA 4J9SA 3BSCA 3VGSA 4ZHRB 2LXIA 1UVJA 3OTCA 1HKAA 4I6YA 4IRDA 2DD8S 1URRA 1HR0J 2ACYA 2YTCA 3D54A 4DQSA 3CULA 3R3TA 4WU3A 4QWCA 4LF5J 3PRDA 3F44A 3LOUA 1NSQA 4GMKA 1RA7A 2COLA 3W9IA 3I9V9 2XI3A 1WG1A 3QNWB 2HBRB 3NWGA 2I2YA 1VHFA 4ZVRB 4ANDA 1GT8A 2D69A 2VQFJ 2WW4A 2UUBF 5B0GA 3UDEA 2ZHBA 2MLZA 2VZ9A 4G1PA 5HP1B 4GKJF 1SIZA 1SJ4P 4K8RA 2QLXA 3ZTRA 4ECTA 4V1Ak 3EGWB 1YTYA 1VBXA 1TUWA 3HFVA 1UA0A 3PW2A 3H5YA 2A0FB 1Y00A 1X4DA 4I2QB 2Z4PA 4CH7A 1YBTA 2A6MA 1U0HA 1N0VC 4NCGA 3AD8C 4P10A 2FHMA 1FFGB 3CDAA 3BYPA 1YIJS 4KKOB 2E7XA 1NPKA 4I2PB 3HXMA 4C8KA 4Y2MA 2CG4A 4C6AA 2OEJA 5BR8J 1V5VA 3W62A 4A8XA 8AT1B 2Y0BB 2DO0A 4B3TJ 1FWKA 4HHUA 4F02A 2DPJA 2JRSA 1M5KC 1TVRA 1XQIA 2KT3A 2MJUA 2Z2YB 3WQPA 2WRMA 1QY7A 1JKHB 4DL4A 3CGIA 3M9NB 3SYZA 1EHWA 2HLTA 2Y9HA 2DRBA 1CJTB 5L9NA 1PJ5A 4MKBA 2LFVA 4XIUA 3ISND 4F36A 5LJ5Y 1T9TA 3OVAA 3MCMA 3OR1B 1CJUA 4DL7A 3ILLA 4QR0A 3VGUA 1SQFA 3MD1A 1X5SA 2H3EB 3J7AN 4RUCA 2FUG9 1N33J 2W9BB 1YBUA 3OTEA 4JI8F 1TK0A 3SFUA 1F3FA 4O3PA 1ZS6A 4QWDA 4CLZA 4F26A 1N36J 3BSAA 4DN9A 3QRRA 4I1TA 2HHUA 2HRUA 2VUGA 3W2VB 1U1OA 1LWCA 1WOOA 3N9UC 2M2BA 1OPZA 1HL6A 3WC0A 4EO6A 5AT1B 4B3OB 4XK8C 4E2FB 4USJC 3PYEA 1GX5A 5IV4A 3NWRA 3K0JA 4WF9Q 3QO9B 2C2KB 2V5HG 4M1KA 4JBCA 3DI6A 5I4MA 2W4CA 3BR8A 2QA1A 2YKMB 5A2QY 4UZBA 1C1CB 3PX4A 4AL5A 3C15A 4DZDA 4YQWA 2O01C 1VC5A 3EYZA 3O1LA 4A47A 5HVFA 5ETPA 5DDQC 3DRYA 4NZ6A 3FRYA 1X4HA 2YKOA 2AZ1A 3LP0A 4X2BA 4I0WA 4DUZJ 4WYLA 4DR6J 1BLUA 1N5SA 1PC4A 3DXSX 3NNAA 5KT6A 1FKPA 4NLUA 3K8VA 2WOMA 1N56A 4NLYA 1O8BA 1QDUB 4C11B 3IWNC 2MGZB 1F2GA 1RWNB 1MG7A 3IN5A 1WI8A 2KFYA 3HDSA 3GFZA 4LRAA 4UOHA 4A48A 1ZM2A 2BJDA 2RIJA 2E1MC 2IBKA 3FJ2A 3WX4A 2FZCB 5RUBA 3EXCX 4PAAA 1GXUA 3JYTA 5KFDA 2BW2A 2F40A 3DN9A 3HHNB 2HFZA 4H4MB 1HHSA 3SV4A 1R0CB 2B3TB 1S49A 3Q22A 3N6LA 1DURA 3O2IA 1CC7A 5CD4H 3QLHA 4BHQA 4RW8A 2VBWA 3PYDA 3KK1A 1OYDA 3H4BA 4LSZB 4I6WA 3NXZA 4RLEA 1IKWA 4OJGA 5KG4A 3R8YA 4ANEA 1EQ0A 1SQEA 4LSLB 2BQ3A 4DUYJ 1UWAA 4ZVFA 1WF0A 2WONB 1LFWA 2J6UA 1U1NA 2QL9B 5D4NA 3PRVA 2IYGA 3OXFA 2GMJA 2DGSA 3MTKA 5ETRA 2QC3A 4A8QA 3QAEA 5F9LA 1JJHA 3PYFA 4HDGA 4QJVA 3HFZB 5K14A 1M1KT 2RRAA 4MIBA 2IRXA 3IC1A 1DRZA 3CCZA 2VKRA 2XHCA 4CO0A 2C42A 5B0FA 3MXHP 2AF6A 2HSEB 4DR5F 1RE1B 2XMMA 4ZP7A 1MMLA 2GCFA 4MMOA 1R7IA 4ES3A 1EARA 2UXBJ 2QZ8A 3KLIB 4KTQA 2CJAA 2CZ9A 2V8VA 1UVKA 2XNQA 2DYAA 2MQLA 3J7ZT 1HBOB 2DCUB 4ZLLA 4WFZA 3PNIA 2YNIA 3CDUA 1T03B 3VAIA 1Q8KA 1URNA 3AT1B 4DCPB 3GJRB 3BREA 1S59A 1OY8A 4OFZA 1H2VZ 2ZFHA 1FE4A 1SB6A 3MM5B 3Q86A 3MF5A 5K20B 4TYAA 1NHKL 4NLWA 4IG0A 5ETLA 1SL2A 3ZC4A 4FF1A 3DGPA 4X66J 3UD4P 4AFFA 1FXRA 1NK4A 1VIOA 1YVFA 4HH1A 1BQMB 4KH1B 3SFGA 2C2MB 4LFCF 4ER8A 3PW0A 1C0TB 3DOKB 2DNNA 3H25A 1D0EA 2GHVC 5B08A 5HQMA 4PWDA 3NAIA 2ZC3A 2MKSA 2V4QA 3PHTA 2FJEB 1OO0B 3M2UA 2N3LA 1XNQJ 4OYPA 2EI5A 2MMYA 1LW2A 3ENWA 3H7HB 4GVLA 3RBEA 3MFIA 3FCHA 4AD6A 2VQFF 2B9YA 3OTDA 2EFGA 3DLBA 3IGVA 3PJWA 1KFSA 4LVNP 3DLKB 2I6WA 4M5DA 3M8SA 1NJYA 4ZVEA 1PYSB 2DKOB 1DQ9A 5KG6A 3NS6A 4DI6A 5DGBA 1IKVA 2F5GA 3CCVS 2G2YA 5J2MB 2H9ZA 3HHLD 2KYXA 2U1AA 3SDEB 1N4LA 5A0YA 5BR8F 1U1LA 2B4PA 2ZOFA 2HNZA 1MN9A 1ZPVA 2LA6A 2YWEA 1JNZB 2HS3A 2FPHX 4C3KA 1HQEB 3QSIA 4YDXA 3TVKA 4B08A 4OI3A 4OJ1A 1WF2A 4P75A 2FB0A 2XO6A 3OXGA 2AX1A 2VH7A 1D9AA 1LQ9A 1KHWA 4TNOA 4RU2A 2GIRA 1Y9OA 3CJ5A 4C7QA 4KHPF 1RWXB 3ADAC 5A8KB 1F9HA 1SUQA 1RHJB 4ED7A 2KTQA 2Z58B 5AE1A 1IR0A 3W7BA 4KAIA 1N33F 3TUIC 4A8FA 4DSLA 1L5UA 1EQMA 3MMJA 4I64A 4OYBA 1HMVB 3R7NB 4DQRA 1RT2A 2RKIA 1OWXA 3OJUA 4KHMA 1PBAA 2F65A 1Q8IA 4GVBB 2DNOA 3AOBA 1N36F 5HJYA 4X4UA 4F25A 5EGYA 2IRUA 2K3KA 2YX4A 3DFEA 1NK8A 3L7OA 2JHEA 3DOLB 3FBEA 2FY1A 4X4TA 2DXFA 4PUOA 5I3QA 4RPFA 3R9LA 2KXNB 1TUVA 3F41A 4Z7YA 3AB4B 1RCXB 1UFWA 4Z7CA 1GXLA 1RTIB 3T5KA 2BVZA 3TUJC 3TOQA 3TANA 4A8SA 1F9EB 1NK9A 5KFHA 1MSWD 3GFYA 1J27A 3KK3B 4PQUA 2JNJA 3PKMA 2OEMA 1VI7A 1RT4A 2W9AA 2HZVA 4DJBA 1NDCA 1M1GA 3HHKA 2I8EA 2MLXA 1ICEB 2QA2A 3BO2A 1SC1B 3MFHA 3JB9k 3TQEA 5KTQA 5A8RA 3HK2A 5JVGQ 1M1HA 1FKOB 3MCNA 2D3UA 4PZVA 3IS9B 4DEZA 5GAEI 3OT9A 3D6MB 5DDOC 3OQ2A 4IR9A 4OZ5A 4DUZF 4DR6F 1Q5VA 2GJ2A 4O4RA 1XWLA 2MY7A 3PEJA 2HEKA 7FDRA 1UJ6A 1UFKA 5AXLA 3D66A 3C6UA 1HYSA 2IYIA 5B0BA 3DDIA 4W90B 1EJ7L 4ZJOA 1APSA 2ZH7A 2GO8A 4QIGA 2WHOA 1MMDA 3DYAA 2PFFB 1OJ4A 3R2DJ 3K89A 4QR1A 1S6QB 3SXLA 2HGMA 4DPXA 3X1LB 5GMEA 1YJTA 1BQNB 1NK7A 4EBEA 1SJQA 4PG5A 1FK9A 4D3HA 1ZTWA 2Q79A 4QU6A 4OYXA 2R42A 2XTJP 3MR3A 1RI7A 1IBMJ 4CT8A 4YB1P 4LMZA 3I5AA 4LF8J 3BQ0A 1WC4A 3BBFA 5D4PA 1RHKB 5KFRA 1S72S 5C25A 2XG8A 2XEXA 1IXKA 3M7VA 1BE4A 4TY8A 4DV3J 2XC9A 5IM0A 1HNIB 4FF4A 3J81U 1SJFA 4IDKA 3K5MA 5IT9U 4AQYJ 3I0SB 1RHQB 3CJKA 4XPCA 4F0KA 3AHPA 2PI5A 3B4MA 1VQ5S 1L3UA 1XR6A 4FS2A 5EDWA 4WZQA 2B5JA 3IRWP 1WKJA 3VAGA 1S10A 2AIRB 1H38A 1RTJB 3EE3A 4M5HA 3KMSA 3PFOA 4KFBA 2IAJA 3MMAA 1K1SA 2WVFA 3EM1A 3DRXA 1RUSA 3UPFA 6FD1A 3Q24A 1S0NA 5LL6d 4CO3A 3M6XA 2I5JB 1XIQA 2VFUA 5KFFA 1Q8BA 4C8YA 3JSBA 2K1RB 2Y0SD 1AROP 3CDWA 1A7GE 1K44A 3O44A 1PJ7A 3IM8A 2UXBF 2VOPA 4QOTA 5HQ8A 2OPQA 3TAPA 1JLFB 4NLRA 1T05B 3MM9B 4DL0C 3WX8A 1CLFA 3JTOA 3V6HA 3RUBL 2C2ZB 2CIMA 5IV3A 3QWUA 3TVZA 3G86A 3HT0A 2VDIA 1K47A 3ISZA 2VG6B 3R1HA 1R8BA 1QD1A 4PYDA 1RBLA 3J80U 4EU0A 5M2UA 3MEEA 4I7FA 3M6UA 3OBIA 2X1GA 3Q83A 5L8RC 2AJ0A 4RNOA 2XMTA 4X66F 2YKPA 4F4KA 2FVPA 3PIPQ 2HS0A 1VQNS 3VGTA 2MPUA 2MKYA 1F9FA 1TTHB 2GGPB 1SKUB 1LFPA 3HD2A 3KJVB 3KLEA 2HBYB 2FC9A 3QJLA 3K57A 5DLFA 1S1WB
chains in the Genus database with same CATH topology
2W8LA 1FTRA 2RT3A 3KOAA 3AA9A 2MHNA 4RUHA 2IAJB 2LVWA 2EFNA 3T6JA 1RQ0A 3LGNA 4RBTA 1T02A 1NHUA 2DGTA 1HBUA 3DOLA 2DGUA 2ALZA 1DLOB 1FRJA 1ULRA 3CE8A 4B3SF 2I9SA 4U9RA 5DGAA 1QAJA 4CH0S 3VAKA 2O3DA 5KFGA 4IFVB 1VQYA 4C3MA 1YRXA 1W25A 2RD5C 3H2UB 3B78A 5KFAA 1R3NA 1JB0C 1DQ8A 2D74B 3IRXB 3OTOF 3C6TA 2F9DA 1RTIA 3OSNA 3ETOA 4N5SA 3T9ZA 4HT7A 1MMNA 3PHEA 1GNKA 1HBMA 1EETA 2D9OA 5SZTA 1PSDA 2RQ4A 3DU6A 4GO7X 4LF9F 4C0OC 1BQXA 2DHSA 3QGPA 1NRKA 4OHXA 5F9NA 4ED5A 2ASYA 1WG5A 2AYMA 1H2UX 4QCLA 3AQOA 2GHPA 3CO9A 3KK3A 1U09A 2Q6BA 1T3OA 4C2MA 5KFEA 1N5QA 1XEZA 2N4DA 4L6V3 5EHHA 4UW2A 1VLYA 2FTRA 5KG2A 5I3PA 4ZPVR 2J9DA 4DX8H 5HBMB 1UMJA 2B6AA 4K4WA 4KGKA 1DTTB 2HNYA 1P6TA 4N8NA 5BJRA 3RR7A 1B0TA 1KLNA 3CCES 2E9ZA 2V8DA 3LALA 4B3TF 2HHVA 4YFUA 2OJ3A 2MJNA 3W2WA 1LWFA 4FVMA 2MDAA 2ZNYA 2HZCA 4BC7A 1WD6A 2GQQA 3US5A 2ZE2B 2VPYB 2CQ2A 1OPIA 2MZRA 3MEDB 5LSOA 4DF4A 2HMIA 1D8ZA 3DU5A 3FGVA 2K7JA 3D0IE 4CQ1A 2FC8A 1G7CB 5D3GB 2E7WA 5F3TA 3KMQA 5LMUF 1NJXA 3HKZD 4OHYA 4LFBF 1MWZA 3WZ0A 2ZJQQ 2KZMA 1QVFR 3RZAA 3MUTP 1U1RA 4OZ1A 3BGFA 1I94F 3CJ0A 4ZCMA 1KVIA 1S0MA 2CFXA 1CQNA 1FKOA 3IS9A 2CPXA 3GG1A 3Q2TC 3M2RA 4MJKA 4X4RA 4B9VA 2K7KA 1WWHA 2EFPA 3CCLS 4AYBD 3LW5C 4N56A 4WKYA 1IKXA 1HFEL 4U7CA 4WFBQ 1ZH5A 1JLAB 2VG5B 1S1VA 3I4PA 2L48A 2BABA 2DGWA 4C8LA 1FCAA 1QSYA 4LF6F 5CZXA 2DRAA 1PILA 2C3PA 2HQIA 3T5LA 3NS5A 1JLCB 2GMLA 2DGOA 3CCRS 2DR5A 1FHTA 1HPZA 4JI6F 4QYZJ 4TQRA 4WZMA 4DS4A 4C8NA 3UDCA 4NLSA 3VAHA 1N6QA 2P9GA 1HNXF 4AL6A 1HD0A 2BJEA 4XPEA 4V19J 1RJJA 1DTQA 2YWGA 4OI0A 4KJIA 5ADZA 2VA2A 2YNGA 4A8MP 2E5LF 2A3JA 5E33A 3QGGA 4H4OA 5MAOA 2KHCA 3CMAS 3U1LA 4KSEB 3I0RA 4QW9A 1C2PA 3J80Y 1Y5IB 4YR2A 2RQCA 5DQHA 2ASJA 4ALZA 2R2RA 3BGLA 1N54B 2K2PA 4ECWA 2EBEA 3CCTA 4R5PB 3P3DA 2M88A 1V3ZA 4ZOSA 3OXLA 4UUXA 5KT3A 4X4SA 3SI8A 3GILA 3MR6A 3QWPA 3GV5B 4MYUA 4CTAB 1ZYQA 1N5YA 1M5OC 3H59A 3NNHA 4I69A 1NK5A 2M7SA 4RBUA 1Q4RA 2J7KA 2EPIA 2O5DA 2GJIA 4ZPAA 2NREA 4UQGA 2WW8A 5AE3A 4Q45A 3T1HF 3GQCA 1HBNA 2VPXB 5DM6Q 3G71S 3QIPB 4RNFA 3FZBA 3QZ7A 3CMES 1RT6A 5C42B 3PR5B 4DFJA 1LKZA 3BSOA 2FLPA 1CVJA 2KRRA 1SL0A 1SV5A 1R27B 1XMQF 3MM7B 1YJRA 2VC0A 3UWTA 5SUHA 2E9RX 1S6QA 1U24A 2ILYA 3CIZA 4PKDB 1BWEA 4ELTA 3RB3A 3IWXA 2V0NA 4Y2AA 4W92B 2ZJRQ 1SL1A 1BQNA 3M9MB 3BJYA 2Q43A 3LGMA 4KO0A 4LJMA 4QBUA 5HMXA 2GIQA 4NLVA 3KWMA 1L3TA 4Z2XA 4MIWA 2VPZB 3DRPA 1PC5A 2C22A 5E5NA 3PO5A 3U02A 1QUPA 2GC8A 3PW5A 2FJDB 3VQTA 5T14A 2YNFB 5J2PA 4JV5F 2KJVA 2RRNA 1QLNA 4CO4A 5HI7A 3Q8RB 2DH8A 1K73T 1N5VA 2BA9A 4I56A 2Q66A 3MEGB 3SSRA 4HDHA 1RTHB 5M2PA 2JJ4D 4NCGB 4J9LA 3R1LA 4YB5A 2E44A 4NLXA 2LKZA 4Y2KA 4GC7A 2QE5A 4NXMF 2F8MA 4WYWA 1LWEB 2RRBA 4C8ZA 4DFMA 4ILMA 2A2CA 2OMOA 3GE9A 1IM4A 3V2UC 2HHPA 5KFYA 1CPZA 1TQLA 3RB4A 5EWEA 5KT5A 2QSFA 3K2YA 4DR4F 2XB2D 4OMFG 3N28A 3P6YC 4HYKA 2C3UA 1NJIT 3KG0A 4X64F 1GX6A 4ECQA 2BR0A 4BCAA 2ROPA 2RQKA 3BN7A 3S6EA 2APOA 4DQPA 1UWBB 1ZAVA 1TKXA 5KG3A 1FJEB 1UJ4A 3G8TA 4Q0BA 1VQ9S 2VPWB 3D5MA 3MGJA 1LWFB 2W9CA 3MDFA 3WDOA 2GO9A 1L3KA 4YMEA 3TUZC 2PE8A 1NK0A 2M52A 2YKNB 3EGZA 2IM0A 3NG8A 4IG3B 2HMIB 4DG1B 3KNGA 4F2SA 4FBUA 2ZD1A 4Q43A 3MOZA 3OFFA 5AE2A 3NLCA 3UI3A 4FYDA 5D6GA 1DARA 1P1TA 1UVIA 4JOUA 4C98A 2J7UA 3OLAA 2FJXA 2G4BA 4Y28C 1FVQA 2BM0A 1JLBA 2RU9A 2A10A 2FHJA 1RK8A 3GYNA 3ZFVA 4ZMMA 5FLXY 3CUNA 2UVRA 5D8HB 3M2VB 1Z2ZA 5GVQA 5FDLB 1MROA 3HFKA 4PXDA 1U25A 3BGRB 3ITHB 4TN2A 2IRYA 5G0RB 2OSRA 3MM6A 3GWCA 1GH8A 4J9QA 4FXWA 4NLGA 4YUDA 1KR4A 3I0SA 2KM8C 1VQ8S 4K4YA 1NJZA 1OSDA 1FNXH 2XLJA 2BDPA 3I32A 4DQIA 2LEAA 4ID5A 3UCUP 3HX9A 4IH7A 2XBPA 3DDKA 4RKUC 1HPZB 4RW7A 2B0GA 2MQNA 1N6QB 1Z2LA 5HLFA 1QE1B 3NBPB 3KYLA 2F1FA 1L3SA 1T7PA 4ED1A 5J2NA 2RUGA 1Q7YT 2YNGB 4NLOA 5F8MA 2YH1A 2HLUA 3FNNA 2EBGA 4H4OB 4R0EA 3EUNA 2Q6CA 3H40A 3N6NA 5C24B 3CD5A 5CXTA 4XO0A 3OHBA 2DHGA 2YNHA 4FXVA 3T19A 4WFNQ 2VG7A 1S0VA 1IQTA 4ZPCA 5EUHA 2J6SA 1BY9A 3BQ1A 3MPWA 5KT2A 3TVYA 2ASLA 3HM9A 4KGMA 1FRLA 5KG0A 5CH7B 2E1CA 5AJ3F 4A4JA 3HZEA 3M8RA 2CQ3A 5L1JA 3UCZP 4ZK7M 1D8YA 2R7XA 4M8LA 3BM7A 3EZUA 1VQOS 5DETA 4ED0A 4Y00A 3ENQA 3DRSB 4RBVA 3DMJA 1KQKA 3BEGB 1TK5A 2WB4A 5U47A 5DG8A 3MHYA 4C3LA 1DHMA 2DH7A 4QWAA 2LXFA 3NCQA 3HVTA 3RW7A 2FLNA 3H5SA 2QO3A 4JV0A 3E2EA 2OFHX 4IOAQ 2CQ0A 1SV5B 2LQJA 2HHXA 2K1RA 2BRKA 1VBYA 5GAHU 3MURP 1S1TA 3O8WA 2IHR1 1S1UA 2RMLA 2CPHA 1HQUB 1IKYA 2EFOA 2RH3A 3IR6B 1LWCB 3E01B 2FLLA 5GAHI 4NRUA 1Z1ZA 4TU7A 3CC4S 2AJQA 4HI1A 1JLFA 4FPRA 4UY85 3OFEA 1T05A 3JAMY 1VQLS 2KI2A 5B0AA 3KK2A 2W7AA 5HMWA 4OQJA 3SCJE 2FD2A 4BWMA 3LAKA 2DJWA 4IR1A 4KT0C 4DSFA 3PVXA 5DS7A 5L9XA 3W3SA 2JX2A 3Q23A 2LECA 2LQBA 2WAQD 3LP1B 3PW4A 4LSNA 4JI1F 1RGVA 4ETXA 3HVRA 1KFDA 2R8IA 3SCLE 1S48A 4OL8A 4URQU 3PDNA 2WCXA 1KOOA 4OZJA 2NPFA 4TYBA 1UW4A 2PC6A 4ILRA 4FXDA 4B9LA 3FQLA 3QGHA 3DHXA 4EFAC 5JVHQ 4RW4A 1N0UA 5CHCB 3RRGA 2NXUA 2V4JA 2DNQA 2KT5A 1G3OA 4MKAA 3V5RA 2GNKA 4RW9A 2DT9A 1OSCA 2VG6A 2PSZA 1CG2A 2DIVA 1YRTA 4NCAA 1FDNA 1TK8A 1TKXB 3DI6B 1VGYA 1IBMF 2R7SA 2JEGA 3FDSA 3NGKA 1JLEA 2ZUGA 4ECRA 1F5BA 4R25A 3ZZTA 4CO2A 2W9CB 4DL3A 2LA4A 1JX4A 3R27A 2GMHA 4NPOA 5E0OA 4JV2A 4LF8F 2MZQA 4ZHRA 4DUYF 5F8NA 1KTQA 2CQPA 2X3GA 3M8PB 2R7RA 4NLDA 4WKRA 2E5IA 4C0BA 3KTQA 2MKHA 4ELVA 4K4ZA 2JZ5A 2J5AA 1RTDA 5DO2A 4K4SA 1V3RA 3HPOA 1YBAA 2FHJD 3FVYA 1MROB 2DNMA 2G13A 5K9FA 3MR2A 3CC7S 1B7FA 2CPFA 3J7YU 2B4OA 1SBRA 2CQHA 1VQSA 5K8MA 2DGXA 1W2BR 2HYIB 3CDEA 2J6TA 2CVIA 2PI4A 4PCQA 2UXDF 5KFWA 3LP0B 2ZJPQ 4DV3F 4F4YA 1R0AA 5B09A 2HVZA 4XDCA 2GGPA 4NWBA 1SKRA 2SXLA 2JH3A 3OHAA 1AFIA 2B7CB 4KQZA 5KFTA 4DL2A 4Q2LA 1X5TA 1V6HA 2FGOA 5KG7A 3ZZ0A 3PACA 2MKJA 5HLFB 1TKZB 2VC1A 1FKPB 4I6AA 4K2XA 5J2NB 4F3OA 4C97A 1QUVA 5KFUA 5F8GA 4M94A 4LF7F 2XGPA 3NNCA 2Z8QA 2WOMB 2C3YA 3CVKA 1TKTA 4AQYF 3V6KA 2W7PA 3GIIA 4N47A 3GR1A 1ZBTA 4F67A 3N79A 3OL9A 2F8EX 3LWLA 1YJUA 4JUZA 4FF2A 1S1WA 2UV8A 3C66A 2ZVSA 3TAMA 3N4WA 2HFOA 4IFYB 4A8YA 3MMCB 2MQQA 5H1SV 1QTMA 1OQ6A 4PXBA 4DL5A 5BYRA 2OTLS 2V4RA 4J9PA 4ED6A 4X4QA 2J76E 2E29A 1DLOA 1UEVA 1U2FA 2JVOA 2POKA 4H54A 2DR9A 2QV6A 3B8HA 4HTJA 5HL7Q 4PR6A 2KU7A 4KC5A 2Q3PA 4X4PA 1WHXA 2ZKTA 3GFXA 3LUYA 2N7CA 4IFVA 1WHVA 1A9NB 1FDBA 2K3IA 3E3XA 1RT3B 2AJ1A 3D28A 4NL5A 4OJ3A 1NB7A 4HH0A 2ZM6F 2LQ5A 5EWFA 3IRXA 4PG8A 1YI2S 1X0FA 3VZHA 3HVTB 5L1IA 4AXJA 2GQCA 2RSQA 2IFXA 1YJWS 3JYTB 4CIOA 3L09A 2PO4A 4URSA 3H4DA 3UR0A 4ZCIA 2OKQA 4IQMA 1S1UB 1FRXA 5J1EB 2MY8A 4O3NA 2BYCA 3LO3A 2CQDA 5G4DA 3G6YA 1X9WA 2OIHA 1F60B 2NPIA 5I3UB 3EZ5A 3ZZRA 3RBDA 1UVLA 3Q8SB 2CJQA 2MQMA 2KB2A 1D9DA 4I2PA 4XAKA 1S97A 1VK3A 4WFAQ 1CSJA 1WTBA 2HGNA 2RU3A 3SZ2A 3QYYA 4FNHA 1DTTA 1SH3A 3MPYA 4TLRA 1TR0A 5KOWA 1UFLA 2JC0A 3MR5A 2XMKA 4IH6A 4LSNB 4IO1A 4CCHA 4IYQA 3PKYA 2OSQA 2WTFA 4EGLA 1KONA 1SH0A 3N5BA 5K8PA 2ZE2A 4DHVA 4OI6A 3MEDA 5CYMB 2ZHOA 2LMIA 3QLHB 1N48A 3K5PA 2OPPB 1JKHA 2P9EA 5HN0A 4DFKA 4RW8B 5D3GA 1N5TA 3MEKA 3PM9A 3PX0A 4E0DA 2MSTA 2KZZA 3HF5A 3NMAA 3T6BA 4RW4B 4F3MA 3GZ7A 1CEZA 2W8KA 3CIMA 1VOMA 5B7WA 4OZLA 5CA5A 3K58A 4RW9B 2JLEA 1X9MA 2L08A 2AP6A 1D3WA 1IKWB 2K8GA 4YB6A 5I42B 1CQMA 2BV3A 5KG5A 4DPOA 1SJ1A 5KAKA 3BO3A 2ADCA 2WBMA 1QVGR 2LU2A 1ZTTA 3HHDA 1JLEB 2X1FA 2KN4A 1D1UA 1FKAF 3LAMA 5D77A 1JLAA 2VG5A 3VWSA 3LWMA 4EWTA 4J9SA 1FDDA 2FIUA 3BSCA 3M6WA 4ZHRB 2XWXA 1JLCA 2LXIA 1UVJA 3OTCA 3ONQA 2X1AA 2OPRA 2DNHA 5L38A 2HW3A 4I6YA 2P6TA 4IRDA 2DD8S 4O4GB 2JFDA 4CO5A 1URRA 4JI3F 3AAWB 3GV7B 3P49B 4Y2CA 2ACYA 4ITSA 3PO4A 4ES2A 2NUUG 2YTCA 2IJFA 3D54A 3IAS9 2HG4A 4J9OA 2RILA 1S99A 4DQSA 3CULA 3R3TA 3BB5A 4WU3A 5K8NA 2VFRA 3OR2A 4QWCA 4FP9A 2VBXA 3PRDA 3F44A 3TAQA 3LOUA 1R0AB 2JLFA 2MZJA 3OLBA 1FF2A 2LYVA 2ZOGA 4GMKA 5KFBA 1RA7A 4R5PA 3DOMA 2COLA 5AXMA 3O5TB 2PEHA 2V9WA 3WBZA 3X3UA 3I9V9 2XI3A 1WG1A 2ZC4A 4FN5A 1FT8A 3VZIA 4CTAA 1XTZA 1TKDA 3NWGA 3AB2B 5K14B 1LV5A 1J5EF 2I2YA 1VHFA 3H20A 3CDBA 4DSEA 2HHQA 1GT8A 2V2KA 1TKTB 2UUBF 5KFVA 1KTVA 2VOOA 3N6MA 1XNQF 1RT7B 2D7SA 2DTJA 4UQTA 5B0GA 3QIPA 4FS1A 3TAMB 5E3RA 2ZHBA 2DGVA 5C42A 2DHXA 5T41A 2R9LA 3MM7A 2VZ9A 4G1PA 1IQZA