4X65I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x65I00
3ZZTA 4XTJA 4DPWA 4DUYI 2HFUA 2UUBE 2UXBI 5LMNI 4LFCI 4B3SE 1HNZI 1B63A 4JI5E 5IWAI 4DV1E 1N34I 2J7KA 1NHJA 1ZM3A 4DR1I 4FWHA 1Z0CA 2V2QA 4JV5I 1RREA 4AQYE 4P7AA 3QT5A 1XHKA 4DV3E 1KIJA 1J5EE 1XMOI 1N0UA 1HNXE 4DR5I 1N36E 2NPFA 4DV6I 1KTVA 3PYFA 4HACA 2BM0A 3ZKBA 4DR2E 3PYEA 1VISA 5L3JA 4KHPE 1N32E 1Z59A 3T1YE 1I94I 3LTOA 1FNMA 2ZM6E 4K0KE 2F4VI 3T1HI 5IT9Q 4YHHE 1FWLA 4JG4A 4P52A 4LFAI 2E5LI 3GONA 4FN5A 1HR0E 1FJGE 2X7IA 4LF6I 4DV2I 3D4JA 1PIEA 4LF8I 1WUUA 5IT9C 4JI7I 4X65E 2WW4A 4LF5I 4B3MI 1XMQE 2UU9I 1ZM9A 5BR8E 4ED4A 4JI6I 4B3RI 3H4LA 1FKAE 4DV4I 4JI4I 2X36A 4JI5I 4DV1I 1Z5BA 3K17A 4OX9I 4DV5E 2HHHI 1MG7A 4LF7E 2AJ4A 4ZVIA 5LMUE 3V2UC 2UUAE 1BKNA 4DPYA 4DV3I 4DPTA 4PRXA 1J5EI 3V5RA 3QT6A 2V2ZA 4MYUA 5GMEA 2R42A 1HNXI 2HFSA 1N36I 4HY1A 2LJPA 1H7SA 1RR9A 3ZZ0A 4JI8E 1ZXNA 4DR2I 2HKJA 4DV7I 1XNQE 2UXCI 1H72C 1N32I 1Z5AA 2V2VA 2CZ9A 1Z0TA 4YY3I 1Z0GA 2ZM6I 1K47A 4NXMI 4K0KI 4DUYE 4LF4E 2UXBE 5LMNE 4NXNE 1HNZE 4DU8A 1XNRE 5IWAE 4YHHI 1ELOA 4PRVA 3J7AG 4I3HA 1A6FA 4DR3E 4DR1E 5GMDA 4FW9A 4JI3E 1IBME 5LL6R 4DV0I 1HR0I 1QZRA 1FWKA 4KQVA 4JYAE 4DR6I 4X65I 2A2CA 2HK3A 1KKHA 4X64E 1NZ0A 4WUDA 1XMOE 4PU9A 5A2QQ 1HNWE 4GKJE 2VQEI 4B3TI 4DR5E 1Z0WA 4DV6E 1Z5CA 4UT4A 4JI1I 2GS8A 2BV3A 4DPXA 4DUZE 4LF9I 2HKEA 1ZXMA 1ZM4A 4USKA 1MU5A 3OTOE 1U2RA 3M6AA 1N33E 3B78A 4GKKE 5A2QC 3F0NA 2ZITA 4DV5I 1IBLE 1PKPA 3J81Q 1S4EA 4DR4E 3WU3A 3J7AM 4DR7I 3T1HE 2ZBKB 1Z0VA 2UUBI 3WU4A 5LMUI 4JI2E 4B3SI 1EA6A 1EI1A 4Z7YA 4X62E 4LFBE 3J80Q 2VQFE 3QT7A 4UTGA 4M1KA 3J81C 4FWDA 1Z0BA 4LF8E 1ZM2A 1FI4A 4JI7E 4WUBA 4X66E 4LF5E 1DARA 4B3ME 4AQYI 4FWGA 2UUCE 1MX0A 4JI8I 1XNQI 3Q1QA 2Q2EB 1IBKE 4B3RE 3J80C 4DV4E 4LF4I 1KVKA 2XEXA 3QT8A 3LPSA 3PYGA 4NXNI 4JI4E 1XNRI 2VF3A 4DR3I 4JI0E 4OX9E 4KHPI 4JI3I 3T1YI 1IBMI 4MYTA 2HHHE 2UXDE 3K1JA 5FLXQ 4JYAI 4LFCE 3ZZUA 3ZM7A 1H7UA 1N34E 4DXLA 3B82A 3ZKDA 3HULA 4EMDA 4X64I 1HNWI 2R3VA 4GKJI 4RPFA 4JV5E 1FJGI 5FLXC 4URLA 1H74A 4DUZI 2OI2A 4HYMA 4DV7E 3OTOI 2UXCE 1XMQI 1N33I 1OJ4A 3LNUA 1NHHA 4GKKI 4DU7A 1PVGA 3PYDA 4YY3E 1IBLI 4DR4I 4NXME 5BR8I 1UEKA 3B8HA 2E1RA 2EFGA 4JI2I 3JAMQ 1N0VC 2HK2A 1S16A 4X62I 2A2DA 1I94E 4DV0E 1D6TA 4LFBI 2VQFI 2F4VE 4LF7I 4DR6E 4HACB 1H73A 2UUAI 4LFAE 4R1FA 4X66I 2E5LE 2UUCI 3JAMC 2VQEE 4WUCA 4B3TE 4LF6E 1IBKI 4DV2E 4USMA 4JI1E 3WU5A 1Z0EA 3CWVA 4DPUA 4LF9E 2V34A 1B62A 3WU6A 2UU9E 4JI0I 1NHIA 2BM1A 2V8PA 4HXZA 2DEJA 2UXDI 4JI6E 4DR7E 4Z7CA 2DEIA
chains in the Genus database with same CATH superfamily
3ZZTA 4XTJA 4DPWA 4IS9A 4DUYI 2HFUA 2UUBE 3CDIA 2UXBI 5LMNI 4LFCI 4LPFA 4B3SE 1HNZI 1B63A 4JI5E 5IWAI 4DV1E 1N34I 2J7KA 1NHJA 1ZM3A 4U3DA 4DR1I 4FWHA 1Z0CA 2V2QA 4JV5I 1RREA 2GO3A 2NN6D 2PO1B 2PNMA 4AQYE 4P7AA 3QT5A 5C0XA 1XHKA 4DV3E 1KIJA 1J5EE 1XMOI 2Z5CB 1N0UA 1HNXE 2CGEA 4DR5I 1N36E 2NPFA 4DV6I 1KTVA 3PYFA 4HACA 2BR2A 2BM0A 1YH8A 3ZKBA 2JEBB 4DR2E 3PYEA 1VISA 5JEAD 5K36C 5L3JA 4KHPE 1N32E 1Z59A 2JE6B 5DNXA 3T1YE 2PO2A 1I94I 1Y4UA 3LTOA 1FNMA 2ZM6E 1UDNA 2F1DA 2Z5BB 4K0KE 5K36F 3U1YA 2F4VI 3T1HI 5IT9Q 4YHHE 4IFDB 1FWLA 2JT2A 4JG4A 4P52A 4LFAI 2E5LI 3GONA 4FN5A 1Y4SA 4MU1A 1HR0E 4QNJA 4BA2A 1FJGE 3P3GA 5C0XE 2X7IA 4LF6I 4DV2I 4OKGA 3D4JA 1PIEA 4LF8I 1WUUA 3P3CA 5IT9C 4JI7I 4X65E 2WW4A 2NN6A 2BA1G 1Y5YA 4LF5I 4B3MI 1XMQE 4N3OA 4GQUA 2UU9I 2PO2B 3CDJA 1ZM9A 2C39A 5BR8E 4ED4A 4JI6I 4B3RI 3H4LA 1FKAE 4FW5A 4DV4I 2PO1A 4QNKA 4NBQA 4JI4I 2X36A 4JI5I 4DV1I 1Z5BA 2BA1D 3K17A 1R6MA 2Z5CA 4OX9I 4DV5E 1VI7A 2BA0G 2HHHI 1MG7A 4LF7E 2AJ4A 4FW4A 4ZVIA 5LMUE 3V2UC 2UUAE 1BKNA 2JEBA 3M85G 2NN6B 2JE6A 4DPYA 5C0XF 4DV3I 4DPTA 4PRXA 1J5EI 3V5RA 1USUA 2V2ZA 3QT6A 4MYUA 2WNRB 4MU0A 5GMEA 2R42A 2C39B 2NN6E 2Z5BA 1HNXI 5K36B 2HFSA 3PRYA 1N36I 4IFDA 4HY1A 2LJPA 3B4TA 1H7SA 1RR9A 3KRNA 4OO1C 4LOMA 3ZZ0A 4JI8E 1ZXNA 4DR2I 4AIMA 2HKJA 1OYSA 4DV7I 1XNQE 2UXCI 5JEAB 1H72C 1N32I 1Z5AA 1Y60A 5K36D 2C37B 2V2VA 2CZ9A 1Z0TA 4YY3I 4OO1F 1Z0GA 1R6LA 2ZM6I 1K47A 4NXMI 4J3DA 4K0KI 4DUYE 4LF4E 2UXBE 5LMNE 4NXNE 1HNZE 4IZJB 1E3PA 4DU8A 2AE8A 1XNRE 5IWAE 4YHHI 1ELOA 4PRVA 3J7AG 1OYPA 5ELWA 2CVEA 4I3HA 1A6FA 4DR3E 4DR1E 5GMDA 4FW9A 4JI3E 1IBME 5LL6R 4DV0I 1HR0I 1QZRA 1FWKA 4KQVA 4FW7A 4IZJD 4JYAE 2VESA 2C38B 4DR6I 3L7ZB 4LCFA 4X65I 2A2CA 2HK3A 1KKHA 4X64E 1NZ0A 4WUDA 1XMOE 4PU9A 2GQ0A 5A2QQ 1HNWE 4IFDE 4GKJE 2IOPA 2VQEI 5EKWA 1E3HA 4DR5E 4B3TI 1Z0WA 3PS3A 4DV6E 1Z5CA 4UT4A 2Z5EA 4JI1I 2GS8A 2BV3A 4DPXA 4DUZE 4LF9I 2HKEA 3PS2A 1ZXMA 1ZM4A 4ISAA 1MU5A 4USKA 3OTOE 2IERA 1U2RA 3M6AA 1N33E 2O1WA 3B78A 3H1CA 2WNRA 4GKKE 5A2QC 3F0NA 2ZITA 4DV5I 1IBLE 1PKPA 3J81Q 1S4EA 4DR4E 1XXEA 5K36A 2PNLA 3WU3A 3J7AM 4DR7I 3T1HE 1P42A 2ZBKB 1Z0VA 2UUBI 3WU4A 5LMUI 3P3EA 2WP8B 4B3SI 4JI2E 1EA6A 2IOQA 1EI1A 4Z7YA 5JEAA 4X62E 4IFDC 2C37A 4LFBE 3J80Q 2VQFE 3QT7A 4OO1B 5C0XC 4UTGA 4M1KA 3J81C 4FWDA 4AIDA 1Z0BA 4IZJA 4LF8E 1ZM2A 1FI4A 4JI7E 4IFDF 4WUBA 4X66E 3HJCA 4LF5E 1DARA 4B3ME 4AQYI 4FWGA 2UUCE 4U3BA 1MX0A 4OZEA 4JI8I 1XNQI 3Q1QA 4OO1D 2Q2EB 1IBKE 3HKMA 2BA0D 4B3RE 3J80C 2O1VA 2C38A 1RHYA 4DV4E 4LF4I 1KVKA 2XEXA 4NXNI 3L7ZA 3LPSA 3PYGA 3K85A 3QT8A 4JI4E 1XNRI 1OYRA 2VF3A 5K36E 3M85D 4DR3I 4JI0E 4OX9E 4KHPI 3NZKA 4JI3I 3T1YI 1IBMI 4MYTA 2HHHE 2UXDE 3K1JA 1UDOA 5DROA 1UDSA 5FLXQ 5JEAE 3P06A 2PNZB 4JYAI 4LFCE 3ZZUA 4IZKA 3ZM7A 1H7UA 1N34E 4DXLA 2O1UA 3B82A 3ZKDA 3HULA 4EMDA 4X64I 3Q6NA 1YHCA 1USVA 1HNWI 2R3VA 4BA1A 4GKJI 4RPFA 2O1TA 4JV5E 4MU3A 2NN6C 3PS1A 1FJGI 5FWKA 4AM3A 5FLXC 2WP8A 4URLA 1H74A 5DRQA 4DUZI 2OI2A 4HYMA 3Q6MA 4DV7E 2JEAA 3OTOI 2NN6F 4MU4A 2UXCE 1XMQI 1N33I 1OJ4A 3LNUA 1NHHA 4GKKI 1HK7A 4DU7A 1PVGA 4OO1A 3PYDA 4YY3E 1IBLI 5DRPA 5EL9A 4DR4I 4NXME 5BR8I 5DRRA 1UEKA 4FW3A 5JEAC 3B8HA 2E1RA 2EFGA 3UHMA 4IZKB 4JI2I 3JAMQ 1N0VC 5C0XB 2HK2A 1S16A 2O3ZA 2PO0A 2A2DA 4X62I 5JEAF 1I94E 4DV0E 4FW6A 3GLLA 4BA1B 1D6TA 4LFBI 2VQFI 2F4VE 4IFDD 1UDQA 4LF7I 2J65A 3DD6A 4DR6E 4HACB 1H73A 2BR2B 5C0XD 2UUAI 4LFAE 4R1FA 4X66I 2IESA 3M7NG 3P76A 2E5LE 1Y6ZA 2UUCI 2GO4A 3JAMC 2JEAB 4LCHA 2VQEE 4WUCA 4B3TE 4LF6E 1IBKI 4DV2E 4LCGA 4USMA 3GMEA 4MDTA 4MQYA 2PNZA 4JI1E 3WU5A 1Z0EA 3CWVA 3GCMA 4DPUA 4LF9E 4OO1E 2V34A 3M7ND 5DNLA 1B62A 3WU6A 2CG9A 3U1KA 4JI0I 2UU9E 2PO0B 1NHIA 2BM1A 2V8PA 4HXZA 2DEJA 2UXDI 4JI6E 4BA2B 4DR7E 4Z7CA 2DEIA
chains in the Genus database with same CATH topology
3ZZTA 4XTJA 4DPWA 4DUYI 2HFUA 2UUBE 2UXBI 5LMNI 4LFCI 4B3SE 1HNZI 1B63A 4JI5E 5IWAI 4DV1E 1N34I 2J7KA 1NHJA 1ZM3A 4DR1I 4FWHA 1Z0CA 2V2QA 4JV5I 1RREA 2PNMA 4AQYE 4P7AA 3QT5A 1XHKA 4DV3E 1KIJA 1J5EE 1XMOI 2Z5CB 1N0UA 1HNXE 4DR5I 2CGEA 1N36E 2NPFA 4DV6I 1KTVA 3PYFA 4HACA 2BM0A 3ZKBA 4DR2E 3PYEA 1VISA 5L3JA 4KHPE 1N32E 1Z59A 3T1YE 1I94I 1Y4UA 3LTOA 1FNMA 2ZM6E 2Z5BB 4K0KE 2F4VI 3T1HI 5IT9Q 4YHHE 1FWLA 4JG4A 4P52A 4LFAI 2E5LI 3GONA 4FN5A 1Y4SA 1HR0E 1FJGE 2X7IA 4LF6I 4DV2I 3D4JA 1PIEA 4LF8I 1WUUA 5IT9C 4JI7I 4X65E 2WW4A 4LF5I 4B3MI 1XMQE 4N3OA 2UU9I 1ZM9A 5BR8E 4ED4A 4JI6I 4B3RI 3H4LA 1FKAE 4DV4I 4JI4I 2X36A 4JI5I 4DV1I 1Z5BA 3K17A 2Z5CA 4OX9I 4DV5E 2HHHI 1MG7A 4LF7E 2AJ4A 4ZVIA 5LMUE 3V2UC 2UUAE 1BKNA 4DPYA 4DV3I 4DPTA 4PRXA 1J5EI 3V5RA 1USUA 2V2ZA 3QT6A 4MYUA 5GMEA 2R42A 1HNXI 2Z5BA 2HFSA 3PRYA 1N36I 4HY1A 2LJPA 1H7SA 1RR9A 3ZZ0A 4JI8E 1ZXNA 4DR2I 2HKJA 4DV7I 1XNQE 2UXCI 1H72C 1N32I 1Z5AA 2V2VA 2CZ9A 1Z0TA 4YY3I 1Z0GA 2ZM6I 1K47A 4NXMI 4K0KI 4DUYE 4LF4E 2UXBE 5LMNE 4NXNE 1HNZE 4IZJB 4DU8A 1XNRE 5IWAE 4YHHI 1ELOA 4PRVA 3J7AG 4I3HA 1A6FA 4DR3E 4DR1E 5GMDA 4FW9A 4JI3E 1IBME 5LL6R 4DV0I 1HR0I 1QZRA 1FWKA 4KQVA 4IZJD 4JYAE 4DR6I 4X65I 2A2CA 2HK3A 1KKHA 4X64E 1NZ0A 4WUDA 1XMOE 4PU9A 2GQ0A 5A2QQ 1HNWE 4GKJE 2IOPA 2VQEI 4B3TI 4DR5E 1Z0WA 4DV6E 1Z5CA 4UT4A 2Z5EA 4JI1I 2GS8A 2BV3A 4DPXA 4DUZE 4LF9I 2HKEA 1ZXMA 1ZM4A 4USKA 1MU5A 3OTOE 1U2RA 3M6AA 1N33E 2O1WA 3B78A 4GKKE 5A2QC 3F0NA 2ZITA 4DV5I 1IBLE 1PKPA 3J81Q 1S4EA 4DR4E 2PNLA 3WU3A 3J7AM 4DR7I 3T1HE 2ZBKB 1Z0VA 2UUBI 3WU4A 5LMUI 4JI2E 4B3SI 1EA6A 2IOQA 1EI1A 4Z7YA 4X62E 4LFBE 3J80Q 2VQFE 3QT7A 4UTGA 4M1KA 3J81C 4FWDA 1Z0BA 4IZJA 4LF8E 1ZM2A 1FI4A 4JI7E 4WUBA 4X66E 3HJCA 4LF5E 1DARA 4B3ME 4AQYI 4FWGA 2UUCE 1MX0A 4JI8I 1XNQI 3Q1QA 2Q2EB 1IBKE 4B3RE 3J80C 2O1VA 4DV4E 4LF4I 1KVKA 2XEXA 3QT8A 3LPSA 3PYGA 4NXNI 3K85A 4JI4E 1XNRI 2VF3A 4DR3I 4JI0E 4OX9E 4KHPI 4JI3I 3T1YI 1IBMI 4MYTA 2HHHE 2UXDE 3K1JA 5FLXQ 3P06A 4JYAI 4LFCE 3ZZUA 4IZKA 3ZM7A 1H7UA 1N34E 4DXLA 2O1UA 3B82A 3ZKDA 3HULA 4EMDA 4X64I 3Q6NA 1USVA 1HNWI 2R3VA 4GKJI 4RPFA 2O1TA 4JV5E 1FJGI 5FWKA 5FLXC 4URLA 1H74A 4DUZI 2OI2A 4HYMA 3Q6MA 4DV7E 3OTOI 2UXCE 1XMQI 1N33I 1OJ4A 3LNUA 1NHHA 4GKKI 1HK7A 4DU7A 1PVGA 3PYDA 4YY3E 1IBLI 4DR4I 4NXME 5BR8I 1UEKA 3B8HA 2E1RA 2EFGA 4IZKB 4JI2I 3JAMQ 1N0VC 2HK2A 1S16A 4X62I 2A2DA 1I94E 4DV0E 1D6TA 4LFBI 2VQFI 2F4VE 4LF7I 4DR6E 4HACB 1H73A 2UUAI 4LFAE 4R1FA 4X66I 2E5LE 1Y6ZA 2UUCI 3JAMC 2VQEE 4WUCA 4B3TE 4LF6E 1IBKI 4DV2E 4USMA 4JI1E 3WU5A 1Z0EA 3CWVA 4DPUA 4LF9E 2V34A 1B62A 3WU6A 2CG9A 2UU9E 4JI0I 1NHIA 2BM1A 2V8PA 4HXZA 2DEJA 2UXDI 4JI6E 4DR7E 4Z7CA 2DEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZT A;  4XTJ A;  4DPW A;  4DUY I;  2HFU A;  2UUB E;  2UXB I;  5LMN I;  4LFC I;  4B3S E;  1HNZ I;  1B63 A;  4JI5 E;  5IWA I;  4DV1 E;  1N34 I;  2J7K A;  1NHJ A;  1ZM3 A;  4DR1 I;  4FWH A;  1Z0C A;  2V2Q A;  4JV5 I;  1RRE A;  4AQY E;  4P7A A;  3QT5 A;  1XHK A;  4DV3 E;  1KIJ A;  1J5E E;  1XMO I;  1N0U A;  1HNX E;  4DR5 I;  1N36 E;  2NPF A;  4DV6 I;  1KTV A;  3PYF A;  4HAC A;  2BM0 A;  3ZKB A;  4DR2 E;  3PYE A;  1VIS A;  5L3J A;  4KHP E;  1N32 E;  1Z59 A;  3T1Y E;  1I94 I;  3LTO A;  1FNM A;  2ZM6 E;  4K0K E;  2F4V I;  3T1H I;  5IT9 Q;  4YHH E;  1FWL A;  4JG4 A;  4P52 A;  4LFA I;  2E5L I;  3GON A;  4FN5 A;  1HR0 E;  1FJG E;  2X7I A;  4LF6 I;  4DV2 I;  3D4J A;  1PIE A;  4LF8 I;  1WUU A;  5IT9 C;  4JI7 I;  4X65 E;  2WW4 A;  4LF5 I;  4B3M I;  1XMQ E;  2UU9 I;  1ZM9 A;  5BR8 E;  4ED4 A;  4JI6 I;  4B3R I;  3H4L A;  1FKA E;  4DV4 I;  4JI4 I;  2X36 A;  4JI5 I;  4DV1 I;  1Z5B A;  3K17 A;  4OX9 I;  4DV5 E;  2HHH I;  1MG7 A;  4LF7 E;  2AJ4 A;  4ZVI A;  5LMU E;  3V2U C;  2UUA E;  1BKN A;  4DPY A;  4DV3 I;  4DPT A;  4PRX A;  1J5E I;  3V5R A;  3QT6 A;  2V2Z A;  4MYU A;  5GME A;  2R42 A;  1HNX I;  2HFS A;  1N36 I;  4HY1 A;  2LJP A;  1H7S A;  1RR9 A;  3ZZ0 A;  4JI8 E;  1ZXN A;  4DR2 I;  2HKJ A;  4DV7 I;  1XNQ E;  2UXC I;  1H72 C;  1N32 I;  1Z5A A;  2V2V A;  2CZ9 A;  1Z0T A;  4YY3 I;  1Z0G A;  2ZM6 I;  1K47 A;  4NXM I;  4K0K I;  4DUY E;  4LF4 E;  2UXB E;  5LMN E;  4NXN E;  1HNZ E;  4DU8 A;  1XNR E;  5IWA E;  4YHH I;  1ELO A;  4PRV A;  3J7A G;  4I3H A;  1A6F A;  4DR3 E;  4DR1 E;  5GMD A;  4FW9 A;  4JI3 E;  1IBM E;  5LL6 R;  4DV0 I;  1HR0 I;  1QZR A;  1FWK A;  4KQV A;  4JYA E;  4DR6 I;  4X65 I;  2A2C A;  2HK3 A;  1KKH A;  4X64 E;  1NZ0 A;  4WUD A;  1XMO E;  4PU9 A;  5A2Q Q;  1HNW E;  4GKJ E;  2VQE I;  4B3T I;  4DR5 E;  1Z0W A;  4DV6 E;  1Z5C A;  4UT4 A;  4JI1 I;  2GS8 A;  2BV3 A;  4DPX A;  4DUZ E;  4LF9 I;  2HKE A;  1ZXM A;  1ZM4 A;  4USK A;  1MU5 A;  3OTO E;  1U2R A;  3M6A A;  1N33 E;  3B78 A;  4GKK E;  5A2Q C;  3F0N A;  2ZIT A;  4DV5 I;  1IBL E;  1PKP A;  3J81 Q;  1S4E A;  4DR4 E;  3WU3 A;  3J7A M;  4DR7 I;  3T1H E;  2ZBK B;  1Z0V A;  2UUB I;  3WU4 A;  5LMU I;  4JI2 E;  4B3S I;  1EA6 A;  1EI1 A;  4Z7Y A;  4X62 E;  4LFB E;  3J80 Q;  2VQF E;  3QT7 A;  4UTG A;  4M1K A;  3J81 C;  4FWD A;  1Z0B A;  4LF8 E;  1ZM2 A;  1FI4 A;  4JI7 E;  4WUB A;  4X66 E;  4LF5 E;  1DAR A;  4B3M E;  4AQY I;  4FWG A;  2UUC E;  1MX0 A;  4JI8 I;  1XNQ I;  3Q1Q A;  2Q2E B;  1IBK E;  4B3R E;  3J80 C;  4DV4 E;  4LF4 I;  1KVK A;  2XEX A;  3QT8 A;  3LPS A;  3PYG A;  4NXN I;  4JI4 E;  1XNR I;  2VF3 A;  4DR3 I;  4JI0 E;  4OX9 E;  4KHP I;  4JI3 I;  3T1Y I;  1IBM I;  4MYT A;  2HHH E;  2UXD E;  3K1J A;  5FLX Q;  4JYA I;  4LFC E;  3ZZU A;  3ZM7 A;  1H7U A;  1N34 E;  4DXL A;  3B82 A;  3ZKD A;  3HUL A;  4EMD A;  4X64 I;  1HNW I;  2R3V A;  4GKJ I;  4RPF A;  4JV5 E;  1FJG I;  5FLX C;  4URL A;  1H74 A;  4DUZ I;  2OI2 A;  4HYM A;  4DV7 E;  3OTO I;  2UXC E;  1XMQ I;  1N33 I;  1OJ4 A;  3LNU A;  1NHH A;  4GKK I;  4DU7 A;  1PVG A;  3PYD A;  4YY3 E;  1IBL I;  4DR4 I;  4NXM E;  5BR8 I;  1UEK A;  3B8H A;  2E1R A;  2EFG A;  4JI2 I;  3JAM Q;  1N0V C;  2HK2 A;  1S16 A;  4X62 I;  2A2D A;  1I94 E;  4DV0 E;  1D6T A;  4LFB I;  2VQF I;  2F4V E;  4LF7 I;  4DR6 E;  4HAC B;  1H73 A;  2UUA I;  4LFA E;  4R1F A;  4X66 I;  2E5L E;  2UUC I;  3JAM C;  2VQE E;  4WUC A;  4B3T E;  4LF6 E;  1IBK I;  4DV2 E;  4USM A;  4JI1 E;  3WU5 A;  1Z0E A;  3CWV A;  4DPU A;  4LF9 E;  2V34 A;  1B62 A;  3WU6 A;  2UU9 E;  4JI0 I;  1NHI A;  2BM1 A;  2V8P A;  4HXZ A;  2DEJ A;  2UXD I;  4JI6 E;  4DR7 E;  4Z7C A;  2DEI A; 
#chains in the Genus database with same CATH topology
 3ZZT A;  4XTJ A;  4DPW A;  4IS9 A;  4DUY I;  2HFU A;  2UUB E;  3CDI A;  2UXB I;  5LMN I;  4LFC I;  4LPF A;  4B3S E;  1HNZ I;  1B63 A;  4JI5 E;  5IWA I;  4DV1 E;  1N34 I;  2J7K A;  1NHJ A;  1ZM3 A;  4U3D A;  4DR1 I;  4FWH A;  1Z0C A;  2V2Q A;  4JV5 I;  1RRE A;  2GO3 A;  2NN6 D;  2PO1 B;  2PNM A;  4AQY E;  4P7A A;  3QT5 A;  5C0X A;  1XHK A;  4DV3 E;  1KIJ A;  1J5E E;  1XMO I;  2Z5C B;  1N0U A;  1HNX E;  2CGE A;  4DR5 I;  1N36 E;  2NPF A;  4DV6 I;  1KTV A;  3PYF A;  4HAC A;  2BR2 A;  2BM0 A;  1YH8 A;  3ZKB A;  2JEB B;  4DR2 E;  3PYE A;  1VIS A;  5JEA D;  5K36 C;  5L3J A;  4KHP E;  1N32 E;  1Z59 A;  2JE6 B;  5DNX A;  3T1Y E;  2PO2 A;  1I94 I;  1Y4U A;  3LTO A;  1FNM A;  2ZM6 E;  1UDN A;  2F1D A;  2Z5B B;  4K0K E;  5K36 F;  3U1Y A;  2F4V I;  3T1H I;  5IT9 Q;  4YHH E;  4IFD B;  1FWL A;  2JT2 A;  4JG4 A;  4P52 A;  4LFA I;  2E5L I;  3GON A;  4FN5 A;  1Y4S A;  4MU1 A;  1HR0 E;  4QNJ A;  4BA2 A;  1FJG E;  3P3G A;  5C0X E;  2X7I A;  4LF6 I;  4DV2 I;  4OKG A;  3D4J A;  1PIE A;  4LF8 I;  1WUU A;  3P3C A;  5IT9 C;  4JI7 I;  4X65 E;  2WW4 A;  2NN6 A;  2BA1 G;  1Y5Y A;  4LF5 I;  4B3M I;  1XMQ E;  4N3O A;  4GQU A;  2UU9 I;  2PO2 B;  3CDJ A;  1ZM9 A;  2C39 A;  5BR8 E;  4ED4 A;  4JI6 I;  4B3R I;  3H4L A;  1FKA E;  4FW5 A;  4DV4 I;  2PO1 A;  4QNK A;  4NBQ A;  4JI4 I;  2X36 A;  4JI5 I;  4DV1 I;  1Z5B A;  2BA1 D;  3K17 A;  1R6M A;  2Z5C A;  4OX9 I;  4DV5 E;  1VI7 A;  2BA0 G;  2HHH I;  1MG7 A;  4LF7 E;  2AJ4 A;  4FW4 A;  4ZVI A;  5LMU E;  3V2U C;  2UUA E;  1BKN A;  2JEB A;  3M85 G;  2NN6 B;  2JE6 A;  4DPY A;  5C0X F;  4DV3 I;  4DPT A;  4PRX A;  1J5E I;  3V5R A;  1USU A;  2V2Z A;  3QT6 A;  4MYU A;  2WNR B;  4MU0 A;  5GME A;  2R42 A;  2C39 B;  2NN6 E;  2Z5B A;  1HNX I;  5K36 B;  2HFS A;  3PRY A;  1N36 I;  4IFD A;  4HY1 A;  2LJP A;  3B4T A;  1H7S A;  1RR9 A;  3KRN A;  4OO1 C;  4LOM A;  3ZZ0 A;  4JI8 E;  1ZXN A;  4DR2 I;  4AIM A;  2HKJ A;  1OYS A;  4DV7 I;  1XNQ E;  2UXC I;  5JEA B;  1H72 C;  1N32 I;  1Z5A A;  1Y60 A;  5K36 D;  2C37 B;  2V2V A;  2CZ9 A;  1Z0T A;  4YY3 I;  4OO1 F;  1Z0G A;  1R6L A;  2ZM6 I;  1K47 A;  4NXM I;  4J3D A;  4K0K I;  4DUY E;  4LF4 E;  2UXB E;  5LMN E;  4NXN E;  1HNZ E;  4IZJ B;  1E3P A;  4DU8 A;  2AE8 A;  1XNR E;  5IWA E;  4YHH I;  1ELO A;  4PRV A;  3J7A G;  1OYP A;  5ELW A;  2CVE A;  4I3H A;  1A6F A;  4DR3 E;  4DR1 E;  5GMD A;  4FW9 A;  4JI3 E;  1IBM E;  5LL6 R;  4DV0 I;  1HR0 I;  1QZR A;  1FWK A;  4KQV A;  4FW7 A;  4IZJ D;  4JYA E;  2VES A;  2C38 B;  4DR6 I;  3L7Z B;  4LCF A;  4X65 I;  2A2C A;  2HK3 A;  1KKH A;  4X64 E;  1NZ0 A;  4WUD A;  1XMO E;  4PU9 A;  2GQ0 A;  5A2Q Q;  1HNW E;  4IFD E;  4GKJ E;  2IOP A;  2VQE I;  5EKW A;  1E3H A;  4DR5 E;  4B3T I;  1Z0W A;  3PS3 A;  4DV6 E;  1Z5C A;  4UT4 A;  2Z5E A;  4JI1 I;  2GS8 A;  2BV3 A;  4DPX A;  4DUZ E;  4LF9 I;  2HKE A;  3PS2 A;  1ZXM A;  1ZM4 A;  4ISA A;  1MU5 A;  4USK A;  3OTO E;  2IER A;  1U2R A;  3M6A A;  1N33 E;  2O1W A;  3B78 A;  3H1C A;  2WNR A;  4GKK E;  5A2Q C;  3F0N A;  2ZIT A;  4DV5 I;  1IBL E;  1PKP A;  3J81 Q;  1S4E A;  4DR4 E;  1XXE A;  5K36 A;  2PNL A;  3WU3 A;  3J7A M;  4DR7 I;  3T1H E;  1P42 A;  2ZBK B;  1Z0V A;  2UUB I;  3WU4 A;  5LMU I;  3P3E A;  2WP8 B;  4B3S I;  4JI2 E;  1EA6 A;  2IOQ A;  1EI1 A;  4Z7Y A;  5JEA A;  4X62 E;  4IFD C;  2C37 A;  4LFB E;  3J80 Q;  2VQF E;  3QT7 A;  4OO1 B;  5C0X C;  4UTG A;  4M1K A;  3J81 C;  4FWD A;  4AID A;  1Z0B A;  4IZJ A;  4LF8 E;  1ZM2 A;  1FI4 A;  4JI7 E;  4IFD F;  4WUB A;  4X66 E;  3HJC A;  4LF5 E;  1DAR A;  4B3M E;  4AQY I;  4FWG A;  2UUC E;  4U3B A;  1MX0 A;  4OZE A;  4JI8 I;  1XNQ I;  3Q1Q A;  4OO1 D;  2Q2E B;  1IBK E;  3HKM A;  2BA0 D;  4B3R E;  3J80 C;  2O1V A;  2C38 A;  1RHY A;  4DV4 E;  4LF4 I;  1KVK A;  2XEX A;  4NXN I;  3L7Z A;  3LPS A;  3PYG A;  3K85 A;  3QT8 A;  4JI4 E;  1XNR I;  1OYR A;  2VF3 A;  5K36 E;  3M85 D;  4DR3 I;  4JI0 E;  4OX9 E;  4KHP I;  3NZK A;  4JI3 I;  3T1Y I;  1IBM I;  4MYT A;  2HHH E;  2UXD E;  3K1J A;  1UDO A;  5DRO A;  1UDS A;  5FLX Q;  5JEA E;  3P06 A;  2PNZ B;  4JYA I;  4LFC E;  3ZZU A;  4IZK A;  3ZM7 A;  1H7U A;  1N34 E;  4DXL A;  2O1U A;  3B82 A;  3ZKD A;  3HUL A;  4EMD A;  4X64 I;  3Q6N A;  1YHC A;  1USV A;  1HNW I;  2R3V A;  4BA1 A;  4GKJ I;  4RPF A;  2O1T A;  4JV5 E;  4MU3 A;  2NN6 C;  3PS1 A;  1FJG I;  5FWK A;  4AM3 A;  5FLX C;  2WP8 A;  4URL A;  1H74 A;  5DRQ A;  4DUZ I;  2OI2 A;  4HYM A;  3Q6M A;  4DV7 E;  2JEA A;  3OTO I;  2NN6 F;  4MU4 A;  2UXC E;  1XMQ I;  1N33 I;  1OJ4 A;  3LNU A;  1NHH A;  4GKK I;  1HK7 A;  4DU7 A;  1PVG A;  4OO1 A;  3PYD A;  4YY3 E;  1IBL I;  5DRP A;  5EL9 A;  4DR4 I;  4NXM E;  5BR8 I;  5DRR A;  1UEK A;  4FW3 A;  5JEA C;  3B8H A;  2E1R A;  2EFG A;  3UHM A;  4IZK B;  4JI2 I;  3JAM Q;  1N0V C;  5C0X B;  2HK2 A;  1S16 A;  2O3Z A;  2PO0 A;  2A2D A;  4X62 I;  5JEA F;  1I94 E;  4DV0 E;  4FW6 A;  3GLL A;  4BA1 B;  1D6T A;  4LFB I;  2VQF I;  2F4V E;  4IFD D;  1UDQ A;  4LF7 I;  2J65 A;  3DD6 A;  4DR6 E;  4HAC B;  1H73 A;  2BR2 B;  5C0X D;  2UUA I;  4LFA E;  4R1F A;  4X66 I;  2IES A;  3M7N G;  3P76 A;  2E5L E;  1Y6Z A;  2UUC I;  2GO4 A;  3JAM C;  2JEA B;  4LCH A;  2VQE E;  4WUC A;  4B3T E;  4LF6 E;  1IBK I;  4DV2 E;  4LCG A;  4USM A;  3GME A;  4MDT A;  4MQY A;  2PNZ A;  4JI1 E;  3WU5 A;  1Z0E A;  3CWV A;  3GCM A;  4DPU A;  4LF9 E;  4OO1 E;  2V34 A;  3M7N D;  5DNL A;  1B62 A;  3WU6 A;  2CG9 A;  3U1K A;  4JI0 I;  2UU9 E;  2PO0 B;  1NHI A;  2BM1 A;  2V8P A;  4HXZ A;  2DEJ A;  2UXD I;  4JI6 E;  4BA2 B;  4DR7 E;  4Z7C A;  2DEI A; 
#chains in the Genus database with same CATH homology
 3ZZT A;  4XTJ A;  4DPW A;  4DUY I;  2HFU A;  2UUB E;  2UXB I;  5LMN I;  4LFC I;  4B3S E;  1HNZ I;  1B63 A;  4JI5 E;  5IWA I;  4DV1 E;  1N34 I;  2J7K A;  1NHJ A;  1ZM3 A;  4DR1 I;  4FWH A;  1Z0C A;  2V2Q A;  4JV5 I;  1RRE A;  2PNM A;  4AQY E;  4P7A A;  3QT5 A;  1XHK A;  4DV3 E;  1KIJ A;  1J5E E;  1XMO I;  2Z5C B;  1N0U A;  1HNX E;  4DR5 I;  2CGE A;  1N36 E;  2NPF A;  4DV6 I;  1KTV A;  3PYF A;  4HAC A;  2BM0 A;  3ZKB A;  4DR2 E;  3PYE A;  1VIS A;  5L3J A;  4KHP E;  1N32 E;  1Z59 A;  3T1Y E;  1I94 I;  1Y4U A;  3LTO A;  1FNM A;  2ZM6 E;  2Z5B B;  4K0K E;  2F4V I;  3T1H I;  5IT9 Q;  4YHH E;  1FWL A;  4JG4 A;  4P52 A;  4LFA I;  2E5L I;  3GON A;  4FN5 A;  1Y4S A;  1HR0 E;  1FJG E;  2X7I A;  4LF6 I;  4DV2 I;  3D4J A;  1PIE A;  4LF8 I;  1WUU A;  5IT9 C;  4JI7 I;  4X65 E;  2WW4 A;  4LF5 I;  4B3M I;  1XMQ E;  4N3O A;  2UU9 I;  1ZM9 A;  5BR8 E;  4ED4 A;  4JI6 I;  4B3R I;  3H4L A;  1FKA E;  4DV4 I;  4JI4 I;  2X36 A;  4JI5 I;  4DV1 I;  1Z5B A;  3K17 A;  2Z5C A;  4OX9 I;  4DV5 E;  2HHH I;  1MG7 A;  4LF7 E;  2AJ4 A;  4ZVI A;  5LMU E;  3V2U C;  2UUA E;  1BKN A;  4DPY A;  4DV3 I;  4DPT A;  4PRX A;  1J5E I;  3V5R A;  1USU A;  2V2Z A;  3QT6 A;  4MYU A;  5GME A;  2R42 A;  1HNX I;  2Z5B A;  2HFS A;  3PRY A;  1N36 I;  4HY1 A;  2LJP A;  1H7S A;  1RR9 A;  3ZZ0 A;  4JI8 E;  1ZXN A;  4DR2 I;  2HKJ A;  4DV7 I;  1XNQ E;  2UXC I;  1H72 C;  1N32 I;  1Z5A A;  2V2V A;  2CZ9 A;  1Z0T A;  4YY3 I;  1Z0G A;  2ZM6 I;  1K47 A;  4NXM I;  4K0K I;  4DUY E;  4LF4 E;  2UXB E;  5LMN E;  4NXN E;  1HNZ E;  4IZJ B;  4DU8 A;  1XNR E;  5IWA E;  4YHH I;  1ELO A;  4PRV A;  3J7A G;  4I3H A;  1A6F A;  4DR3 E;  4DR1 E;  5GMD A;  4FW9 A;  4JI3 E;  1IBM E;  5LL6 R;  4DV0 I;  1HR0 I;  1QZR A;  1FWK A;  4KQV A;  4IZJ D;  4JYA E;  4DR6 I;  4X65 I;  2A2C A;  2HK3 A;  1KKH A;  4X64 E;  1NZ0 A;  4WUD A;  1XMO E;  4PU9 A;  2GQ0 A;  5A2Q Q;  1HNW E;  4GKJ E;  2IOP A;  2VQE I;  4B3T I;  4DR5 E;  1Z0W A;  4DV6 E;  1Z5C A;  4UT4 A;  2Z5E A;  4JI1 I;  2GS8 A;  2BV3 A;  4DPX A;  4DUZ E;  4LF9 I;  2HKE A;  1ZXM A;  1ZM4 A;  4USK A;  1MU5 A;  3OTO E;  1U2R A;  3M6A A;  1N33 E;  2O1W A;  3B78 A;  4GKK E;  5A2Q C;  3F0N A;  2ZIT A;  4DV5 I;  1IBL E;  1PKP A;  3J81 Q;  1S4E A;  4DR4 E;  2PNL A;  3WU3 A;  3J7A M;  4DR7 I;  3T1H E;  2ZBK B;  1Z0V A;  2UUB I;  3WU4 A;  5LMU I;  4JI2 E;  4B3S I;  1EA6 A;  2IOQ A;  1EI1 A;  4Z7Y A;  4X62 E;  4LFB E;  3J80 Q;  2VQF E;  3QT7 A;  4UTG A;  4M1K A;  3J81 C;  4FWD A;  1Z0B A;  4IZJ A;  4LF8 E;  1ZM2 A;  1FI4 A;  4JI7 E;  4WUB A;  4X66 E;  3HJC A;  4LF5 E;  1DAR A;  4B3M E;  4AQY I;  4FWG A;  2UUC E;  1MX0 A;  4JI8 I;  1XNQ I;  3Q1Q A;  2Q2E B;  1IBK E;  4B3R E;  3J80 C;  2O1V A;  4DV4 E;  4LF4 I;  1KVK A;  2XEX A;  3QT8 A;  3LPS A;  3PYG A;  4NXN I;  3K85 A;  4JI4 E;  1XNR I;  2VF3 A;  4DR3 I;  4JI0 E;  4OX9 E;  4KHP I;  4JI3 I;  3T1Y I;  1IBM I;  4MYT A;  2HHH E;  2UXD E;  3K1J A;  5FLX Q;  3P06 A;  4JYA I;  4LFC E;  3ZZU A;  4IZK A;  3ZM7 A;  1H7U A;  1N34 E;  4DXL A;  2O1U A;  3B82 A;  3ZKD A;  3HUL A;  4EMD A;  4X64 I;  3Q6N A;  1USV A;  1HNW I;  2R3V A;  4GKJ I;  4RPF A;  2O1T A;  4JV5 E;  1FJG I;  5FWK A;  5FLX C;  4URL A;  1H74 A;  4DUZ I;  2OI2 A;  4HYM A;  3Q6M A;  4DV7 E;  3OTO I;  2UXC E;  1XMQ I;  1N33 I;  1OJ4 A;  3LNU A;  1NHH A;  4GKK I;  1HK7 A;  4DU7 A;  1PVG A;  3PYD A;  4YY3 E;  1IBL I;  4DR4 I;  4NXM E;  5BR8 I;  1UEK A;  3B8H A;  2E1R A;  2EFG A;  4IZK B;  4JI2 I;  3JAM Q;  1N0V C;  2HK2 A;  1S16 A;  4X62 I;  2A2D A;  1I94 E;  4DV0 E;  1D6T A;  4LFB I;  2VQF I;  2F4V E;  4LF7 I;  4DR6 E;  4HAC B;  1H73 A;  2UUA I;  4LFA E;  4R1F A;  4X66 I;  2E5L E;  1Y6Z A;  2UUC I;  3JAM C;  2VQE E;  4WUC A;  4B3T E;  4LF6 E;  1IBK I;  4DV2 E;  4USM A;  4JI1 E;  3WU5 A;  1Z0E A;  3CWV A;  4DPU A;  4LF9 E;  2V34 A;  1B62 A;  3WU6 A;  2CG9 A;  2UU9 E;  4JI0 I;  1NHI A;  2BM1 A;  2V8P A;  4HXZ A;  2DEJ A;  2UXD I;  4JI6 E;  4DR7 E;  4Z7C A;  2DEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...