4X65I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x65I00
4X62I 1IBLE 4LFAI 1H7UA 4DV6E 2HFSA 1Z0VA 2ZM6E 4AQYE 2LJPA 2UXBE 4PRVA 4YHHE 4K0KE 4LF4I 4DV4I 4AQYI 4P7AA 4WUCA 1I94E 4JI3E 4FWHA 4DUYI 4OX9E 4DU7A 1S16A 2J7KA 4DV3I 2E1RA 2UXCI 4NXNE 4JI1I 4LF5E 1Z0BA 2V2VA 1ZM2A 4GKJE 3J80C 1BKNA 1MG7A 4DR1E 2OI2A 2Q2EB 2E5LE 1B62A 3WU6A 3K17A 4B3MI 3WU5A 2UUCI 3B8HA 2EFGA 4DV0E 2A2DA 1HNZI 1HR0I 1MU5A 5LMUE 1Z0TA 1N32I 4XTJA 1Z0CA 4LF7E 5FLXQ 4DV7I 4JI0I 4JI6I 4JI2I 2UUBI 4B3SE 1RR9A 1N0UA 4JI4I 1XMQI 3J7AM 4LF8E 2V2QA 4X64I 4DV3E 3WU4A 4LF9E 4USKA 4JI5I 3WU3A 4DR5I 1Z0GA 4ED4A 4JI3I 1A6FA 2HK2A 2AJ4A 3ZKBA 5FLXC 1ZM4A 1HNWI 1D6TA 4LFAE 1ZXMA 5IWAE 3PYFA 1Z5AA 1K47A 4LF8I 1XMQE 3ZZUA 1IBMI 4WUBA 3OTOI 4FW9A 4B3SI 5GMEA 4KQVA 4DR6E 4DV2E 2V2ZA 2ZITA 4DU8A 2VF3A 4DR3I 1VISA 2HKJA 1N33I 1J5EI 4YY3E 5GMDA 4X65E 4DV7E 2UUCE 1H7SA 2HFUA 4DR7E 1FWKA 1ELOA 1N32E 1H73A 5LMUI 1B63A 2UXDI 4YY3I 1J5EE 1KKHA 4DR2E 1XNRE 4DR1I 1OJ4A 4PRXA 1Z5CA 4GKJI 1N33E 4FWGA 4FWDA 5BR8E 4DV1E 2WW4A 4USMA 3JAMC 4DPWA 2BM1A 4EMDA 3ZM7A 1IBKI 4LFCI 4OX9I 2F4VE 2HK3A 2R3VA 3ZKDA 4YHHI 4K0KI 5IT9Q 2UXBI 3J7AG 5LMNI 1NHHA 1KIJA 3PYEA 2HHHI 1Z0EA 2F4VI 3HULA 4LFCE 4DUZI 4DR5E 1N36E 4JI5E 1IBLI 4X62E 1MX0A 2HKEA 1RREA 2GS8A 1DARA 4JI4E 4KHPI 2CZ9A 4HACB 3J81Q 4Z7YA 4JI2E 4X66E 4DPUA 5LL6R 2DEJA 1XNRI 5L3JA 4DR4E 4JI7I 1EA6A 3CWVA 4PU9A 4LF7I 2VQFE 4JV5I 2UXDE 1XNQE 4DR7I 4MYTA 2VQFI 1XMOE 3QT8A 4DV2I 4RPFA 1FWLA 1KVKA 1H74A 4DV5E 4LF5I 1KTVA 3OTOE 1N0VC 4WUDA 1ZM9A 1NHJA 1PKPA 1UEKA 2A2CA 2BM0A 3LPSA 4KHPE 3K1JA 4NXNI 3V5RA 3LNUA 3B78A 4URLA 2ZM6I 4DUZE 1N36I 2HHHE 1NZ0A 4HY1A 1I94I 5LMNE 1HNWE 4LF4E 4HXZA 3B82A 3QT6A 3QT5A 3LTOA 1IBKE 3ZZTA 4LF9I 1FNMA 2DEIA 4DXLA 4DV1I 2NPFA 5BR8I 2UUBE 4R1FA 4JI6E 4JI0E 4B3RI 2V8PA 3T1YI 1FKAE 1HNXI 1H72C 4JYAI 2R42A 2XEXA 3T1HI 3ZZ0A 1XNQI 4JYAE 1HR0E 3D4JA 4ZVIA 1ZXNA 2E5LI 1EI1A 4DPTA 4X65I 3V2UC 1N34I 2X36A 3T1HE 4DR4I 4GKKE 2UUAE 4UTGA 2X7IA 3QT7A 1HNXE 1Z5BA 3PYDA 4JG4A 4B3RE 4X66I 4B3TI 1QZRA 4DV4E 1IBME 4DPXA 2UXCE 2BV3A 3H4LA 4DV6I 5IWAI 1FI4A 5IT9C 3Q1QA 3F0NA 4DUYE 4P52A 3GONA 1PVGA 4NXMI 4B3TE 4DPYA 1S4EA 1PIEA 1Z0WA 4X64E 4LF6I 4I3HA 4FN5A 3PYGA 2UU9E 2UUAI 4GKKI 4DV5I 2VQEI 4HYMA 3M6AA 1N34E 1ZM3A 1WUUA 1XHKA 4JI8E 1Z59A 4LFBE 1FJGI 4DR2I 4M1KA 4HACA 4JV5E 1HNZE 1FJGE 3J80Q 3JAMQ 4DV0I 3J81C 5A2QQ 2V34A 1XMOI 4JI8I 4B3ME 4DR3E 4Z7CA 4UT4A 4LFBI 3T1YE 4LF6E 1U2RA 1NHIA 4MYUA 4DR6I 2VQEE 4NXME 4JI7E 4JI1E 2ZBKB 2UU9I 5A2QC
chains in the Genus database with same CATH superfamily
1OYSA 5FWKA 3M7NG 4X62I 1HK7A 1IBLE 4IZKB 4LFAI 1H7UA 4DV6E 1Z0VA 2HFSA 2ZM6E 4AQYE 1YH8A 2LJPA 5C0XB 2UXBE 4PRVA 4YHHE 4K0KE 2IESA 4LF4I 4DV4I 4AQYI 4P7AA 4WUCA 1I94E 4JI3E 4LOMA 4FWHA 2PO0B 4DUYI 3P3GA 2O1TA 4OX9E 4DU7A 1UDOA 1S16A 2Z5CA 2PNZA 2J7KA 4NBQA 4DV3I 4BA1A 2E1RA 2UXCI 4NXNE 4JI1I 4BA2B 3GCMA 5C0XE 4LF5E 1Z0BA 2V2VA 1ZM2A 4GKJE 3J80C 1BKNA 1MG7A 5C0XD 4DR1E 2OI2A 2Q2EB 2E5LE 2PNMA 1B62A 2F1DA 3WU6A 2NN6A 3K17A 4MU1A 3WU5A 4B3MI 2BA0D 5DRPA 2WNRA 5K36F 2UUCI 3B8HA 2EFGA 5K36D 3NZKA 2PNZB 4DV0E 2GO4A 2A2DA 1HNZI 1HR0I 1MU5A 4QNJA 2BA0G 1Z0TA 5LMUE 4BA2A 1N32I 4XTJA 2IOPA 1Z0CA 4LF7E 5FLXQ 4QNKA 4DV7I 3HKMA 2O1WA 4OO1D 5DNXA 4JI0I 4JI6I 2JE6A 2WP8A 4JI2I 2UUBI 4B3SE 2AE8A 4IFDC 1RR9A 1N0UA 4FW4A 4JI4I 1XMQI 3J7AM 4LF8E 3B4TA 2V2QA 2O1UA 4X64I 3WU4A 4DV3E 4LF9E 4USKA 4JI5I 3WU3A 1E3HA 4DR5I 1Z0GA 1UDSA 4ED4A 2C38A 3P76A 4JI3I 1A6FA 2HK2A 2AJ4A 3ZKBA 5FLXC 1ZM4A 1HNWI 2PO1B 1D6TA 2BR2B 4LFAE 1ZXMA 5IWAE 3PYFA 1Z5AA 1K47A 4LF8I 2C39B 1XMQE 3PS2A 4ISAA 3ZZUA 1IBMI 4WUBA 3OTOI 4FW9A 4B3SI 5GMEA 3PS3A 4KQVA 4DR6E 4DV2E 2V2ZA 1USUA 2ZITA 2C38B 4DU8A 4LCFA 5K36C 2VF3A 4DR3I 1VISA 2HKJA 1N33I 1J5EI 4YY3E 3Q6NA 3PRYA 5GMDA 4IZJB 4GQUA 4X65E 5K36A 4DV7E 1OYRA 2UUCE 1H7SA 2HFUA 4FW6A 5K36E 4DR7E 1FWKA 1ELOA 3M7ND 5LMUI 1H73A 1N32E 1B63A 3GLLA 2UXDI 4YY3I 1J5EE 1KKHA 1P42A 4DR2E 1XNRE 1Y5YA 4DR1I 1OJ4A 4PRXA 1Z5CA 4GKJI 2BA1D 1N33E 4FWGA 4IZJD 4FWDA 5BR8E 4DV1E 2WW4A 4USMA 3JAMC 4DPWA 2BM1A 4EMDA 3ZM7A 4LPFA 1IBKI 3U1YA 4LFCI 4OX9I 2F4VE 1RHYA 2CG9A 2HK3A 4IS9A 5C0XA 5JEAB 2R3VA 2Z5EA 3ZKDA 4YHHI 4K0KI 5IT9Q 2UXBI 3J7AG 3UHMA 5LMNI 2IOQA 1NHHA 2NN6D 5DNLA 1KIJA 3PYEA 2HHHI 1Z0EA 2F4VI 3HULA 4LFCE 3GMEA 4DUZI 4DR5E 1N36E 4JI5E 1IBLI 4IFDB 4X62E 2JT2A 2CGEA 2Z5CB 1MX0A 2HKEA 2NN6C 4FW7A 1RREA 2GS8A 1DARA 3CDJA 3U1KA 2CZ9A 4JI4E 4KHPI 4IFDD 4HACB 3L7ZB 3J81Q 4Z7YA 4JI2E 4U3DA 4X66E 4DPUA 5LL6R 2DEJA 1XNRI 5JEAE 2NN6B 2PO0A 5L3JA 4DR4E 4JI7I 1EA6A 3CWVA 4PU9A 4LF7I 3K85A 2VQFE 2CVEA 1Y4SA 2C37A 4IFDA 4JV5I 2UXDE 1XNQE 3M85G 4DR7I 4MDTA 4MYTA 2VQFI 1XMOE 3QT8A 5C0XF 4DV2I 4RPFA 1OYPA 1FWLA 1KVKA 4AM3A 1H74A 4DV5E 4LF5I 2JEBB 1KTVA 3M85D 3OTOE 1N0VC 4WUDA 1ZM9A 1NHJA 2Z5BA 1PKPA 1UEKA 2A2CA 2PO2B 2BM0A 4BA1B 3LPSA 1XXEA 5JEAC 4KHPE 3K1JA 4NXNI 1Y4UA 3CDIA 3V5RA 3LNUA 3DD6A 4OO1F 3B78A 4URLA 2ZM6I 4DUZE 1N36I 2J65A 2HHHE 1NZ0A 4MU4A 4HY1A 3L7ZA 1I94I 5DRRA 5LMNE 1HNWE 2IERA 4LF4E 4HXZA 3B82A 3QT6A 5JEAA 3QT5A 3LTOA 2O1VA 1IBKE 3ZZTA 4LF9I 1FNMA 1YHCA 2DEIA 4J3DA 5DRQA 4DXLA 4DV1I 2NPFA 5BR8I 1E3PA 1USVA 4OO1E 2GQ0A 2UUBE 3P3CA 4R1FA 4JI6E 4OO1C 4JI0E 4B3RI 4N3OA 2V8PA 4IFDE 3T1YI 1FKAE 4IZKA 1HNXI 4U3BA 1H72C 4OKGA 4JYAI 2R42A 2O3ZA 2XEXA 3T1HI 3ZZ0A 1XNQI 4JYAE 1HR0E 3D4JA 4ZVIA 1ZXNA 2E5LI 4OO1B 1EI1A 4OO1A 4DPTA 4X65I 3V2UC 4LCGA 1N34I 2WNRB 2X36A 3T1HE 4DR4I 4GKKE 4AIMA 2UUAE 4UTGA 2X7IA 3QT7A 1HNXE 1Z5BA 3PS1A 5JEAF 2PNLA 3PYDA 4JG4A 4B3RE 4X66I 5EKWA 4B3TI 2JE6B 2WP8B 1QZRA 4DV4E 1IBME 4DPXA 2UXCE 2BV3A 3H4LA 4DV6I 2JEBA 5IWAI 2GO3A 1FI4A 5IT9C 2NN6E 3Q1QA 2C37B 3F0NA 4DUYE 4P52A 3GONA 3P3EA 1PVGA 4OZEA 1VI7A 5K36B 3H1CA 4NXMI 3HJCA 4B3TE 4DPYA 2BR2A 1S4EA 3Q6MA 1PIEA 1Z0WA 4X64E 4LF6I 1UDNA 4AIDA 4I3HA 4FW5A 2NN6F 2C39A 4FN5A 2JEAA 3PYGA 2UU9E 2JEAB 2UUAI 4GKKI 4DV5I 4MU0A 2Z5BB 4HYMA 2VQEI 3M6AA 1N34E 1ZM3A 4LCHA 1WUUA 1XHKA 4JI8E 5DROA 1Z59A 4IFDF 4LFBE 1FJGI 4DR2I 4M1KA 4HACA 2PO2A 4JV5E 1R6MA 1HNZE 4MQYA 1FJGE 3J80Q 5EL9A 3P06A 3JAMQ 4DV0I 2PO1A 3J81C 5A2QQ 2V34A 3KRNA 1XMOI 4JI8I 2VESA 4IZJA 4B3ME 5ELWA 1R6LA 2BA1G 1Y60A 4DR3E 4Z7CA 4UT4A 4LFBI 3T1YE 4LF6E 5C0XC 5JEAD 1U2RA 1NHIA 4MYUA 4MU3A 1Y6ZA 4DR6I 1UDQA 2VQEE 4NXME 4FW3A 4JI7E 4JI1E 2ZBKB 2UU9I 5A2QC
chains in the Genus database with same CATH topology
5FWKA 4X62I 1HK7A 1IBLE 4IZKB 4LFAI 1H7UA 4DV6E 2HFSA 1Z0VA 2ZM6E 4AQYE 2LJPA 2UXBE 4PRVA 4YHHE 4K0KE 4LF4I 4DV4I 4AQYI 4P7AA 4WUCA 1I94E 4JI3E 4FWHA 4DUYI 2O1TA 4OX9E 4DU7A 1S16A 2Z5CA 2J7KA 4DV3I 2E1RA 2UXCI 4NXNE 4JI1I 4LF5E 1Z0BA 2V2VA 1ZM2A 4GKJE 3J80C 1BKNA 1MG7A 4DR1E 2OI2A 2Q2EB 2E5LE 2PNMA 1B62A 3WU6A 3K17A 4B3MI 3WU5A 2UUCI 3B8HA 2EFGA 4DV0E 2A2DA 1HNZI 1HR0I 1MU5A 5LMUE 1Z0TA 1N32I 4XTJA 2IOPA 1Z0CA 4LF7E 5FLXQ 4DV7I 2O1WA 4JI0I 4JI6I 4JI2I 2UUBI 4B3SE 1RR9A 1N0UA 4JI4I 1XMQI 3J7AM 4LF8E 2V2QA 2O1UA 4X64I 3WU4A 4DV3E 4LF9E 4USKA 4JI5I 3WU3A 4DR5I 1Z0GA 4ED4A 4JI3I 1A6FA 2HK2A 2AJ4A 3ZKBA 5FLXC 1ZM4A 1HNWI 1D6TA 4LFAE 1ZXMA 5IWAE 3PYFA 1Z5AA 1K47A 4LF8I 1XMQE 3ZZUA 1IBMI 4WUBA 3OTOI 4FW9A 4B3SI 5GMEA 4KQVA 4DR6E 4DV2E 2V2ZA 1USUA 2ZITA 4DU8A 2VF3A 4DR3I 1VISA 2HKJA 1N33I 1J5EI 4YY3E 3Q6NA 3PRYA 5GMDA 4IZJB 4X65E 4DV7E 2UUCE 1H7SA 2HFUA 4DR7E 1FWKA 1ELOA 5LMUI 1H73A 1N32E 1B63A 2UXDI 4YY3I 1J5EE 1KKHA 4DR2E 1XNRE 4DR1I 1OJ4A 4PRXA 1Z5CA 4GKJI 1N33E 4FWGA 4IZJD 4FWDA 5BR8E 4DV1E 2WW4A 4USMA 3JAMC 4DPWA 2BM1A 4EMDA 3ZM7A 1IBKI 4LFCI 4OX9I 2F4VE 2CG9A 2HK3A 2R3VA 2Z5EA 3ZKDA 4YHHI 4K0KI 5IT9Q 2UXBI 3J7AG 5LMNI 2IOQA 1NHHA 1KIJA 3PYEA 2HHHI 1Z0EA 2F4VI 3HULA 4LFCE 4DUZI 4DR5E 1N36E 4JI5E 1IBLI 4X62E 2CGEA 2Z5CB 1MX0A 2HKEA 1RREA 2GS8A 1DARA 4JI4E 4KHPI 2CZ9A 4HACB 3J81Q 4Z7YA 4JI2E 4X66E 4DPUA 5LL6R 2DEJA 1XNRI 5L3JA 4DR4E 4JI7I 1EA6A 3CWVA 4PU9A 4LF7I 3K85A 2VQFE 1Y4SA 4JV5I 2UXDE 1XNQE 4DR7I 4MYTA 2VQFI 1XMOE 3QT8A 4DV2I 4RPFA 1FWLA 1KVKA 1H74A 4DV5E 4LF5I 1KTVA 3OTOE 1N0VC 4WUDA 1ZM9A 1NHJA 2Z5BA 1PKPA 1UEKA 2A2CA 2BM0A 3LPSA 4KHPE 3K1JA 4NXNI 1Y4UA 3V5RA 3LNUA 3B78A 4URLA 2ZM6I 4DUZE 1N36I 2HHHE 1NZ0A 4HY1A 1I94I 5LMNE 1HNWE 4LF4E 4HXZA 3B82A 3QT6A 3QT5A 3LTOA 2O1VA 1IBKE 3ZZTA 4LF9I 1FNMA 2DEIA 4DXLA 4DV1I 2NPFA 5BR8I 1USVA 2GQ0A 2UUBE 4R1FA 4JI6E 4JI0E 4B3RI 4N3OA 2V8PA 3T1YI 1FKAE 4IZKA 1HNXI 1H72C 4JYAI 2R42A 2XEXA 3T1HI 3ZZ0A 1XNQI 4JYAE 1HR0E 3D4JA 4ZVIA 1ZXNA 2E5LI 1EI1A 4DPTA 4X65I 3V2UC 1N34I 2X36A 3T1HE 4DR4I 4GKKE 2UUAE 4UTGA 2X7IA 3QT7A 1HNXE 1Z5BA 2PNLA 3PYDA 4JG4A 4B3RE 4X66I 4B3TI 1QZRA 4DV4E 1IBME 4DPXA 2UXCE 2BV3A 3H4LA 4DV6I 5IWAI 1FI4A 5IT9C 3Q1QA 3F0NA 4DUYE 4P52A 3GONA 1PVGA 4NXMI 3HJCA 4B3TE 4DPYA 1S4EA 3Q6MA 1PIEA 1Z0WA 4X64E 4LF6I 4I3HA 4FN5A 3PYGA 2UU9E 2UUAI 4GKKI 4DV5I 2Z5BB 4HYMA 2VQEI 3M6AA 1N34E 1ZM3A 1WUUA 1XHKA 4JI8E 1Z59A 4LFBE 1FJGI 4DR2I 4M1KA 4HACA 4JV5E 1HNZE 1FJGE 3J80Q 3P06A 3JAMQ 4DV0I 3J81C 5A2QQ 2V34A 1XMOI 4JI8I 4IZJA 4B3ME 4DR3E 4Z7CA 4UT4A 4LFBI 3T1YE 4LF6E 1U2RA 1NHIA 4MYUA 1Y6ZA 4DR6I 2VQEE 4NXME 4JI7E 4JI1E 2ZBKB 2UU9I 5A2QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 I;  1IBL E;  4LFA I;  1H7U A;  4DV6 E;  2HFS A;  1Z0V A;  2ZM6 E;  4AQY E;  2LJP A;  2UXB E;  4PRV A;  4YHH E;  4K0K E;  4LF4 I;  4DV4 I;  4AQY I;  4P7A A;  4WUC A;  1I94 E;  4JI3 E;  4FWH A;  4DUY I;  4OX9 E;  4DU7 A;  1S16 A;  2J7K A;  4DV3 I;  2E1R A;  2UXC I;  4NXN E;  4JI1 I;  4LF5 E;  1Z0B A;  2V2V A;  1ZM2 A;  4GKJ E;  3J80 C;  1BKN A;  1MG7 A;  4DR1 E;  2OI2 A;  2Q2E B;  2E5L E;  1B62 A;  3WU6 A;  3K17 A;  4B3M I;  3WU5 A;  2UUC I;  3B8H A;  2EFG A;  4DV0 E;  2A2D A;  1HNZ I;  1HR0 I;  1MU5 A;  5LMU E;  1Z0T A;  1N32 I;  4XTJ A;  1Z0C A;  4LF7 E;  5FLX Q;  4DV7 I;  4JI0 I;  4JI6 I;  4JI2 I;  2UUB I;  4B3S E;  1RR9 A;  1N0U A;  4JI4 I;  1XMQ I;  3J7A M;  4LF8 E;  2V2Q A;  4X64 I;  4DV3 E;  3WU4 A;  4LF9 E;  4USK A;  4JI5 I;  3WU3 A;  4DR5 I;  1Z0G A;  4ED4 A;  4JI3 I;  1A6F A;  2HK2 A;  2AJ4 A;  3ZKB A;  5FLX C;  1ZM4 A;  1HNW I;  1D6T A;  4LFA E;  1ZXM A;  5IWA E;  3PYF A;  1Z5A A;  1K47 A;  4LF8 I;  1XMQ E;  3ZZU A;  1IBM I;  4WUB A;  3OTO I;  4FW9 A;  4B3S I;  5GME A;  4KQV A;  4DR6 E;  4DV2 E;  2V2Z A;  2ZIT A;  4DU8 A;  2VF3 A;  4DR3 I;  1VIS A;  2HKJ A;  1N33 I;  1J5E I;  4YY3 E;  5GMD A;  4X65 E;  4DV7 E;  2UUC E;  1H7S A;  2HFU A;  4DR7 E;  1FWK A;  1ELO A;  1N32 E;  1H73 A;  5LMU I;  1B63 A;  2UXD I;  4YY3 I;  1J5E E;  1KKH A;  4DR2 E;  1XNR E;  4DR1 I;  1OJ4 A;  4PRX A;  1Z5C A;  4GKJ I;  1N33 E;  4FWG A;  4FWD A;  5BR8 E;  4DV1 E;  2WW4 A;  4USM A;  3JAM C;  4DPW A;  2BM1 A;  4EMD A;  3ZM7 A;  1IBK I;  4LFC I;  4OX9 I;  2F4V E;  2HK3 A;  2R3V A;  3ZKD A;  4YHH I;  4K0K I;  5IT9 Q;  2UXB I;  3J7A G;  5LMN I;  1NHH A;  1KIJ A;  3PYE A;  2HHH I;  1Z0E A;  2F4V I;  3HUL A;  4LFC E;  4DUZ I;  4DR5 E;  1N36 E;  4JI5 E;  1IBL I;  4X62 E;  1MX0 A;  2HKE A;  1RRE A;  2GS8 A;  1DAR A;  4JI4 E;  4KHP I;  2CZ9 A;  4HAC B;  3J81 Q;  4Z7Y A;  4JI2 E;  4X66 E;  4DPU A;  5LL6 R;  2DEJ A;  1XNR I;  5L3J A;  4DR4 E;  4JI7 I;  1EA6 A;  3CWV A;  4PU9 A;  4LF7 I;  2VQF E;  4JV5 I;  2UXD E;  1XNQ E;  4DR7 I;  4MYT A;  2VQF I;  1XMO E;  3QT8 A;  4DV2 I;  4RPF A;  1FWL A;  1KVK A;  1H74 A;  4DV5 E;  4LF5 I;  1KTV A;  3OTO E;  1N0V C;  4WUD A;  1ZM9 A;  1NHJ A;  1PKP A;  1UEK A;  2A2C A;  2BM0 A;  3LPS A;  4KHP E;  3K1J A;  4NXN I;  3V5R A;  3LNU A;  3B78 A;  4URL A;  2ZM6 I;  4DUZ E;  1N36 I;  2HHH E;  1NZ0 A;  4HY1 A;  1I94 I;  5LMN E;  1HNW E;  4LF4 E;  4HXZ A;  3B82 A;  3QT6 A;  3QT5 A;  3LTO A;  1IBK E;  3ZZT A;  4LF9 I;  1FNM A;  2DEI A;  4DXL A;  4DV1 I;  2NPF A;  5BR8 I;  2UUB E;  4R1F A;  4JI6 E;  4JI0 E;  4B3R I;  2V8P A;  3T1Y I;  1FKA E;  1HNX I;  1H72 C;  4JYA I;  2R42 A;  2XEX A;  3T1H I;  3ZZ0 A;  1XNQ I;  4JYA E;  1HR0 E;  3D4J A;  4ZVI A;  1ZXN A;  2E5L I;  1EI1 A;  4DPT A;  4X65 I;  3V2U C;  1N34 I;  2X36 A;  3T1H E;  4DR4 I;  4GKK E;  2UUA E;  4UTG A;  2X7I A;  3QT7 A;  1HNX E;  1Z5B A;  3PYD A;  4JG4 A;  4B3R E;  4X66 I;  4B3T I;  1QZR A;  4DV4 E;  1IBM E;  4DPX A;  2UXC E;  2BV3 A;  3H4L A;  4DV6 I;  5IWA I;  1FI4 A;  5IT9 C;  3Q1Q A;  3F0N A;  4DUY E;  4P52 A;  3GON A;  1PVG A;  4NXM I;  4B3T E;  4DPY A;  1S4E A;  1PIE A;  1Z0W A;  4X64 E;  4LF6 I;  4I3H A;  4FN5 A;  3PYG A;  2UU9 E;  2UUA I;  4GKK I;  4DV5 I;  2VQE I;  4HYM A;  3M6A A;  1N34 E;  1ZM3 A;  1WUU A;  1XHK A;  4JI8 E;  1Z59 A;  4LFB E;  1FJG I;  4DR2 I;  4M1K A;  4HAC A;  4JV5 E;  1HNZ E;  1FJG E;  3J80 Q;  3JAM Q;  4DV0 I;  3J81 C;  5A2Q Q;  2V34 A;  1XMO I;  4JI8 I;  4B3M E;  4DR3 E;  4Z7C A;  4UT4 A;  4LFB I;  3T1Y E;  4LF6 E;  1U2R A;  1NHI A;  4MYU A;  4DR6 I;  2VQE E;  4NXM E;  4JI7 E;  4JI1 E;  2ZBK B;  2UU9 I;  5A2Q C; 
#chains in the Genus database with same CATH topology
 1OYS A;  5FWK A;  3M7N G;  4X62 I;  1HK7 A;  1IBL E;  4IZK B;  4LFA I;  1H7U A;  4DV6 E;  1Z0V A;  2HFS A;  2ZM6 E;  4AQY E;  1YH8 A;  2LJP A;  5C0X B;  2UXB E;  4PRV A;  4YHH E;  4K0K E;  2IES A;  4LF4 I;  4DV4 I;  4AQY I;  4P7A A;  4WUC A;  1I94 E;  4JI3 E;  4LOM A;  4FWH A;  2PO0 B;  4DUY I;  3P3G A;  2O1T A;  4OX9 E;  4DU7 A;  1UDO A;  1S16 A;  2Z5C A;  2PNZ A;  2J7K A;  4NBQ A;  4DV3 I;  4BA1 A;  2E1R A;  2UXC I;  4NXN E;  4JI1 I;  4BA2 B;  3GCM A;  5C0X E;  4LF5 E;  1Z0B A;  2V2V A;  1ZM2 A;  4GKJ E;  3J80 C;  1BKN A;  1MG7 A;  5C0X D;  4DR1 E;  2OI2 A;  2Q2E B;  2E5L E;  2PNM A;  1B62 A;  2F1D A;  3WU6 A;  2NN6 A;  3K17 A;  4MU1 A;  3WU5 A;  4B3M I;  2BA0 D;  5DRP A;  2WNR A;  5K36 F;  2UUC I;  3B8H A;  2EFG A;  5K36 D;  3NZK A;  2PNZ B;  4DV0 E;  2GO4 A;  2A2D A;  1HNZ I;  1HR0 I;  1MU5 A;  4QNJ A;  2BA0 G;  1Z0T A;  5LMU E;  4BA2 A;  1N32 I;  4XTJ A;  2IOP A;  1Z0C A;  4LF7 E;  5FLX Q;  4QNK A;  4DV7 I;  3HKM A;  2O1W A;  4OO1 D;  5DNX A;  4JI0 I;  4JI6 I;  2JE6 A;  2WP8 A;  4JI2 I;  2UUB I;  4B3S E;  2AE8 A;  4IFD C;  1RR9 A;  1N0U A;  4FW4 A;  4JI4 I;  1XMQ I;  3J7A M;  4LF8 E;  3B4T A;  2V2Q A;  2O1U A;  4X64 I;  3WU4 A;  4DV3 E;  4LF9 E;  4USK A;  4JI5 I;  3WU3 A;  1E3H A;  4DR5 I;  1Z0G A;  1UDS A;  4ED4 A;  2C38 A;  3P76 A;  4JI3 I;  1A6F A;  2HK2 A;  2AJ4 A;  3ZKB A;  5FLX C;  1ZM4 A;  1HNW I;  2PO1 B;  1D6T A;  2BR2 B;  4LFA E;  1ZXM A;  5IWA E;  3PYF A;  1Z5A A;  1K47 A;  4LF8 I;  2C39 B;  1XMQ E;  3PS2 A;  4ISA A;  3ZZU A;  1IBM I;  4WUB A;  3OTO I;  4FW9 A;  4B3S I;  5GME A;  3PS3 A;  4KQV A;  4DR6 E;  4DV2 E;  2V2Z A;  1USU A;  2ZIT A;  2C38 B;  4DU8 A;  4LCF A;  5K36 C;  2VF3 A;  4DR3 I;  1VIS A;  2HKJ A;  1N33 I;  1J5E I;  4YY3 E;  3Q6N A;  3PRY A;  5GMD A;  4IZJ B;  4GQU A;  4X65 E;  5K36 A;  4DV7 E;  1OYR A;  2UUC E;  1H7S A;  2HFU A;  4FW6 A;  5K36 E;  4DR7 E;  1FWK A;  1ELO A;  3M7N D;  5LMU I;  1H73 A;  1N32 E;  1B63 A;  3GLL A;  2UXD I;  4YY3 I;  1J5E E;  1KKH A;  1P42 A;  4DR2 E;  1XNR E;  1Y5Y A;  4DR1 I;  1OJ4 A;  4PRX A;  1Z5C A;  4GKJ I;  2BA1 D;  1N33 E;  4FWG A;  4IZJ D;  4FWD A;  5BR8 E;  4DV1 E;  2WW4 A;  4USM A;  3JAM C;  4DPW A;  2BM1 A;  4EMD A;  3ZM7 A;  4LPF A;  1IBK I;  3U1Y A;  4LFC I;  4OX9 I;  2F4V E;  1RHY A;  2CG9 A;  2HK3 A;  4IS9 A;  5C0X A;  5JEA B;  2R3V A;  2Z5E A;  3ZKD A;  4YHH I;  4K0K I;  5IT9 Q;  2UXB I;  3J7A G;  3UHM A;  5LMN I;  2IOQ A;  1NHH A;  2NN6 D;  5DNL A;  1KIJ A;  3PYE A;  2HHH I;  1Z0E A;  2F4V I;  3HUL A;  4LFC E;  3GME A;  4DUZ I;  4DR5 E;  1N36 E;  4JI5 E;  1IBL I;  4IFD B;  4X62 E;  2JT2 A;  2CGE A;  2Z5C B;  1MX0 A;  2HKE A;  2NN6 C;  4FW7 A;  1RRE A;  2GS8 A;  1DAR A;  3CDJ A;  3U1K A;  2CZ9 A;  4JI4 E;  4KHP I;  4IFD D;  4HAC B;  3L7Z B;  3J81 Q;  4Z7Y A;  4JI2 E;  4U3D A;  4X66 E;  4DPU A;  5LL6 R;  2DEJ A;  1XNR I;  5JEA E;  2NN6 B;  2PO0 A;  5L3J A;  4DR4 E;  4JI7 I;  1EA6 A;  3CWV A;  4PU9 A;  4LF7 I;  3K85 A;  2VQF E;  2CVE A;  1Y4S A;  2C37 A;  4IFD A;  4JV5 I;  2UXD E;  1XNQ E;  3M85 G;  4DR7 I;  4MDT A;  4MYT A;  2VQF I;  1XMO E;  3QT8 A;  5C0X F;  4DV2 I;  4RPF A;  1OYP A;  1FWL A;  1KVK A;  4AM3 A;  1H74 A;  4DV5 E;  4LF5 I;  2JEB B;  1KTV A;  3M85 D;  3OTO E;  1N0V C;  4WUD A;  1ZM9 A;  1NHJ A;  2Z5B A;  1PKP A;  1UEK A;  2A2C A;  2PO2 B;  2BM0 A;  4BA1 B;  3LPS A;  1XXE A;  5JEA C;  4KHP E;  3K1J A;  4NXN I;  1Y4U A;  3CDI A;  3V5R A;  3LNU A;  3DD6 A;  4OO1 F;  3B78 A;  4URL A;  2ZM6 I;  4DUZ E;  1N36 I;  2J65 A;  2HHH E;  1NZ0 A;  4MU4 A;  4HY1 A;  3L7Z A;  1I94 I;  5DRR A;  5LMN E;  1HNW E;  2IER A;  4LF4 E;  4HXZ A;  3B82 A;  3QT6 A;  5JEA A;  3QT5 A;  3LTO A;  2O1V A;  1IBK E;  3ZZT A;  4LF9 I;  1FNM A;  1YHC A;  2DEI A;  4J3D A;  5DRQ A;  4DXL A;  4DV1 I;  2NPF A;  5BR8 I;  1E3P A;  1USV A;  4OO1 E;  2GQ0 A;  2UUB E;  3P3C A;  4R1F A;  4JI6 E;  4OO1 C;  4JI0 E;  4B3R I;  4N3O A;  2V8P A;  4IFD E;  3T1Y I;  1FKA E;  4IZK A;  1HNX I;  4U3B A;  1H72 C;  4OKG A;  4JYA I;  2R42 A;  2O3Z A;  2XEX A;  3T1H I;  3ZZ0 A;  1XNQ I;  4JYA E;  1HR0 E;  3D4J A;  4ZVI A;  1ZXN A;  2E5L I;  4OO1 B;  1EI1 A;  4OO1 A;  4DPT A;  4X65 I;  3V2U C;  4LCG A;  1N34 I;  2WNR B;  2X36 A;  3T1H E;  4DR4 I;  4GKK E;  4AIM A;  2UUA E;  4UTG A;  2X7I A;  3QT7 A;  1HNX E;  1Z5B A;  3PS1 A;  5JEA F;  2PNL A;  3PYD A;  4JG4 A;  4B3R E;  4X66 I;  5EKW A;  4B3T I;  2JE6 B;  2WP8 B;  1QZR A;  4DV4 E;  1IBM E;  4DPX A;  2UXC E;  2BV3 A;  3H4L A;  4DV6 I;  2JEB A;  5IWA I;  2GO3 A;  1FI4 A;  5IT9 C;  2NN6 E;  3Q1Q A;  2C37 B;  3F0N A;  4DUY E;  4P52 A;  3GON A;  3P3E A;  1PVG A;  4OZE A;  1VI7 A;  5K36 B;  3H1C A;  4NXM I;  3HJC A;  4B3T E;  4DPY A;  2BR2 A;  1S4E A;  3Q6M A;  1PIE A;  1Z0W A;  4X64 E;  4LF6 I;  1UDN A;  4AID A;  4I3H A;  4FW5 A;  2NN6 F;  2C39 A;  4FN5 A;  2JEA A;  3PYG A;  2UU9 E;  2JEA B;  2UUA I;  4GKK I;  4DV5 I;  4MU0 A;  2Z5B B;  4HYM A;  2VQE I;  3M6A A;  1N34 E;  1ZM3 A;  4LCH A;  1WUU A;  1XHK A;  4JI8 E;  5DRO A;  1Z59 A;  4IFD F;  4LFB E;  1FJG I;  4DR2 I;  4M1K A;  4HAC A;  2PO2 A;  4JV5 E;  1R6M A;  1HNZ E;  4MQY A;  1FJG E;  3J80 Q;  5EL9 A;  3P06 A;  3JAM Q;  4DV0 I;  2PO1 A;  3J81 C;  5A2Q Q;  2V34 A;  3KRN A;  1XMO I;  4JI8 I;  2VES A;  4IZJ A;  4B3M E;  5ELW A;  1R6L A;  2BA1 G;  1Y60 A;  4DR3 E;  4Z7C A;  4UT4 A;  4LFB I;  3T1Y E;  4LF6 E;  5C0X C;  5JEA D;  1U2R A;  1NHI A;  4MYU A;  4MU3 A;  1Y6Z A;  4DR6 I;  1UDQ A;  2VQE E;  4NXM E;  4FW3 A;  4JI7 E;  4JI1 E;  2ZBK B;  2UU9 I;  5A2Q C; 
#chains in the Genus database with same CATH homology
 5FWK A;  4X62 I;  1HK7 A;  1IBL E;  4IZK B;  4LFA I;  1H7U A;  4DV6 E;  2HFS A;  1Z0V A;  2ZM6 E;  4AQY E;  2LJP A;  2UXB E;  4PRV A;  4YHH E;  4K0K E;  4LF4 I;  4DV4 I;  4AQY I;  4P7A A;  4WUC A;  1I94 E;  4JI3 E;  4FWH A;  4DUY I;  2O1T A;  4OX9 E;  4DU7 A;  1S16 A;  2Z5C A;  2J7K A;  4DV3 I;  2E1R A;  2UXC I;  4NXN E;  4JI1 I;  4LF5 E;  1Z0B A;  2V2V A;  1ZM2 A;  4GKJ E;  3J80 C;  1BKN A;  1MG7 A;  4DR1 E;  2OI2 A;  2Q2E B;  2E5L E;  2PNM A;  1B62 A;  3WU6 A;  3K17 A;  4B3M I;  3WU5 A;  2UUC I;  3B8H A;  2EFG A;  4DV0 E;  2A2D A;  1HNZ I;  1HR0 I;  1MU5 A;  5LMU E;  1Z0T A;  1N32 I;  4XTJ A;  2IOP A;  1Z0C A;  4LF7 E;  5FLX Q;  4DV7 I;  2O1W A;  4JI0 I;  4JI6 I;  4JI2 I;  2UUB I;  4B3S E;  1RR9 A;  1N0U A;  4JI4 I;  1XMQ I;  3J7A M;  4LF8 E;  2V2Q A;  2O1U A;  4X64 I;  3WU4 A;  4DV3 E;  4LF9 E;  4USK A;  4JI5 I;  3WU3 A;  4DR5 I;  1Z0G A;  4ED4 A;  4JI3 I;  1A6F A;  2HK2 A;  2AJ4 A;  3ZKB A;  5FLX C;  1ZM4 A;  1HNW I;  1D6T A;  4LFA E;  1ZXM A;  5IWA E;  3PYF A;  1Z5A A;  1K47 A;  4LF8 I;  1XMQ E;  3ZZU A;  1IBM I;  4WUB A;  3OTO I;  4FW9 A;  4B3S I;  5GME A;  4KQV A;  4DR6 E;  4DV2 E;  2V2Z A;  1USU A;  2ZIT A;  4DU8 A;  2VF3 A;  4DR3 I;  1VIS A;  2HKJ A;  1N33 I;  1J5E I;  4YY3 E;  3Q6N A;  3PRY A;  5GMD A;  4IZJ B;  4X65 E;  4DV7 E;  2UUC E;  1H7S A;  2HFU A;  4DR7 E;  1FWK A;  1ELO A;  5LMU I;  1H73 A;  1N32 E;  1B63 A;  2UXD I;  4YY3 I;  1J5E E;  1KKH A;  4DR2 E;  1XNR E;  4DR1 I;  1OJ4 A;  4PRX A;  1Z5C A;  4GKJ I;  1N33 E;  4FWG A;  4IZJ D;  4FWD A;  5BR8 E;  4DV1 E;  2WW4 A;  4USM A;  3JAM C;  4DPW A;  2BM1 A;  4EMD A;  3ZM7 A;  1IBK I;  4LFC I;  4OX9 I;  2F4V E;  2CG9 A;  2HK3 A;  2R3V A;  2Z5E A;  3ZKD A;  4YHH I;  4K0K I;  5IT9 Q;  2UXB I;  3J7A G;  5LMN I;  2IOQ A;  1NHH A;  1KIJ A;  3PYE A;  2HHH I;  1Z0E A;  2F4V I;  3HUL A;  4LFC E;  4DUZ I;  4DR5 E;  1N36 E;  4JI5 E;  1IBL I;  4X62 E;  2CGE A;  2Z5C B;  1MX0 A;  2HKE A;  1RRE A;  2GS8 A;  1DAR A;  4JI4 E;  4KHP I;  2CZ9 A;  4HAC B;  3J81 Q;  4Z7Y A;  4JI2 E;  4X66 E;  4DPU A;  5LL6 R;  2DEJ A;  1XNR I;  5L3J A;  4DR4 E;  4JI7 I;  1EA6 A;  3CWV A;  4PU9 A;  4LF7 I;  3K85 A;  2VQF E;  1Y4S A;  4JV5 I;  2UXD E;  1XNQ E;  4DR7 I;  4MYT A;  2VQF I;  1XMO E;  3QT8 A;  4DV2 I;  4RPF A;  1FWL A;  1KVK A;  1H74 A;  4DV5 E;  4LF5 I;  1KTV A;  3OTO E;  1N0V C;  4WUD A;  1ZM9 A;  1NHJ A;  2Z5B A;  1PKP A;  1UEK A;  2A2C A;  2BM0 A;  3LPS A;  4KHP E;  3K1J A;  4NXN I;  1Y4U A;  3V5R A;  3LNU A;  3B78 A;  4URL A;  2ZM6 I;  4DUZ E;  1N36 I;  2HHH E;  1NZ0 A;  4HY1 A;  1I94 I;  5LMN E;  1HNW E;  4LF4 E;  4HXZ A;  3B82 A;  3QT6 A;  3QT5 A;  3LTO A;  2O1V A;  1IBK E;  3ZZT A;  4LF9 I;  1FNM A;  2DEI A;  4DXL A;  4DV1 I;  2NPF A;  5BR8 I;  1USV A;  2GQ0 A;  2UUB E;  4R1F A;  4JI6 E;  4JI0 E;  4B3R I;  4N3O A;  2V8P A;  3T1Y I;  1FKA E;  4IZK A;  1HNX I;  1H72 C;  4JYA I;  2R42 A;  2XEX A;  3T1H I;  3ZZ0 A;  1XNQ I;  4JYA E;  1HR0 E;  3D4J A;  4ZVI A;  1ZXN A;  2E5L I;  1EI1 A;  4DPT A;  4X65 I;  3V2U C;  1N34 I;  2X36 A;  3T1H E;  4DR4 I;  4GKK E;  2UUA E;  4UTG A;  2X7I A;  3QT7 A;  1HNX E;  1Z5B A;  2PNL A;  3PYD A;  4JG4 A;  4B3R E;  4X66 I;  4B3T I;  1QZR A;  4DV4 E;  1IBM E;  4DPX A;  2UXC E;  2BV3 A;  3H4L A;  4DV6 I;  5IWA I;  1FI4 A;  5IT9 C;  3Q1Q A;  3F0N A;  4DUY E;  4P52 A;  3GON A;  1PVG A;  4NXM I;  3HJC A;  4B3T E;  4DPY A;  1S4E A;  3Q6M A;  1PIE A;  1Z0W A;  4X64 E;  4LF6 I;  4I3H A;  4FN5 A;  3PYG A;  2UU9 E;  2UUA I;  4GKK I;  4DV5 I;  2Z5B B;  4HYM A;  2VQE I;  3M6A A;  1N34 E;  1ZM3 A;  1WUU A;  1XHK A;  4JI8 E;  1Z59 A;  4LFB E;  1FJG I;  4DR2 I;  4M1K A;  4HAC A;  4JV5 E;  1HNZ E;  1FJG E;  3J80 Q;  3P06 A;  3JAM Q;  4DV0 I;  3J81 C;  5A2Q Q;  2V34 A;  1XMO I;  4JI8 I;  4IZJ A;  4B3M E;  4DR3 E;  4Z7C A;  4UT4 A;  4LFB I;  3T1Y E;  4LF6 E;  1U2R A;  1NHI A;  4MYU A;  1Y6Z A;  4DR6 I;  2VQE E;  4NXM E;  4JI7 E;  4JI1 E;  2ZBK B;  2UU9 I;  5A2Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...