4X65I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x65I00
1ZXNA 4JI0I 2CZ9A 4X62E 4B3TE 2X7IA 4LF9I 4HXZA 2VQFE 1MU5A 4PRVA 4DR7I 2ZBKB 3JAMQ 1XNQI 3H4LA 4DV3E 1IBLI 1XNRI 4DR6E 4DR1I 1ZM9A 4DPWA 2HFUA 4LF5I 3ZZ0A 4DV7E 4DR5E 4JYAE 1HNZI 3PYFA 2UXCI 4YY3E 1Z0VA 2EFGA 1N36E 1MX0A 3B78A 4FW9A 2UUCI 2LJPA 4JI0E 1D6TA 4DV5E 3J7AM 4K0KI 5A2QQ 1S4EA 1ZXMA 4DUZI 2UXDE 4DPTA 3ZKBA 4YHHI 1MG7A 4KHPE 3ZZTA 4WUCA 2UUBE 4DR1E 2Q2EB 1H73A 3T1HI 1XNRE 4OX9I 2E5LE 5BR8E 3ZZUA 4DV7I 4EMDA 1RREA 4ED4A 2UXBI 3JAMC 1ZM3A 4JI2I 3WU4A 4LF7I 3OTOE 1IBKE 5GMDA 4X65I 2ZITA 1HNZE 4X66E 3HULA 3ZKDA 4HACB 3B82A 4LFCE 1Z0CA 5LMNE 2HHHE 4MYTA 1N34I 4DUYI 4DPUA 4URLA 5LL6R 1H7UA 4FN5A 2F4VE 4DR4I 1HNWI 1H7SA 4P7AA 4JI5E 4DR3I 4NXME 1XHKA 2VQFI 4JI6I 1U2RA 4DV0I 4HACA 1Z0EA 1N33I 5LMUE 4DUYE 4M1KA 1NHIA 2VQEE 4LFAE 1Z5AA 5A2QC 4YY3I 4KHPI 4Z7YA 1PKPA 4JV5I 1Z0TA 2V34A 4DR6I 4UT4A 4P52A 3QT8A 3WU5A 1NHJA 1FNMA 4JI1I 4DV3I 1N33E 1UEKA 4DPXA 1IBMI 1FKAE 3CWVA 1BKNA 4JI5I 3GONA 4DV2I 1K47A 3ZM7A 1XMOE 3J81Q 3J81C 2F4VI 4B3RE 4AQYI 4DR4E 2AJ4A 4DV1E 1N34E 1KVKA 3PYEA 1S16A 4XTJA 2V2QA 3V5RA 4YHHE 5IT9Q 2HHHI 4GKKE 3LTOA 2OI2A 2A2DA 1ZM4A 1PIEA 2DEJA 1FI4A 2UU9E 4JI3I 1HNWE 4JI4I 2V2ZA 5LMUI 4ZVIA 1XMQE 4MYUA 3Q1QA 1H72C 4X66I 4B3MI 3J80C 2HK3A 4DV4E 1RR9A 2R3VA 4RPFA 1DARA 4LF7E 3WU3A 4DV6I 1OJ4A 1B62A 2X36A 1Z5CA 3OTOI 1IBKI 1NZ0A 4Z7CA 2ZM6E 2E5LI 2BV3A 4LF8I 4I3HA 1FJGI 3PYGA 4NXNI 4JI2E 3WU6A 4DV4I 5IT9C 4JV5E 4AQYE 2V2VA 3QT6A 4JYAI 4GKJE 4DR2E 1HR0I 3T1HE 1J5EI 2HFSA 1NHHA 4DV0E 1PVGA 1WUUA 2J7KA 4USKA 4PU9A 3K17A 4DR5I 1VISA 2R42A 4LF5E 1Z59A 4FWHA 4OX9E 4R1FA 4NXNE 4LFBE 3M6AA 4LF8E 2UUBI 4DR2I 4B3RI 1XNQE 5L3JA 1XMOI 1I94E 3D4JA 4DU7A 4DUZE 5IWAE 1XMQI 4X62I 4B3TI 1N0UA 1J5EE 4JI4E 2UU9I 4JI3E 5GMEA 3LPSA 2XEXA 4LFCI 5LMNI 4WUBA 5BR8I 4JI8I 3LNUA 4LF9E 2BM0A 4DXLA 3F0NA 4UTGA 1IBLE 4WUDA 1Z5BA 3T1YI 2HKJA 1Z0BA 4JI7I 4FWGA 4DR3E 2HKEA 1EI1A 1A6FA 2WW4A 1N32I 4GKKI 2NPFA 4KQVA 4HY1A 4JG4A 3PYDA 1KIJA 4X64E 1N36I 5FLXC 4LF6E 4FWDA 1QZRA 4JI8E 4DPYA 2UXCE 4DV2E 2HK2A 3J7AG 4NXMI 1KKHA 1FWKA 1IBME 4K0KE 4USMA 4DV1I 4B3SI 1HNXE 1FJGE 4DU8A 4JI1E 2UUCE 4DR7E 5IWAI 2UXBE 2A2CA 3K1JA 1HR0E 1ELOA 4GKJI 4JI7E 2BM1A 1B63A 4DV6E 4LF6I 1ZM2A 1KTVA 3T1YE 3J80Q 2DEIA 1HNXI 1H74A 4HYMA 1Z0GA 3QT5A 2VF3A 2ZM6I 2GS8A 2UUAI 2E1RA 2V8PA 3V2UC 4LFAI 4X64I 4LF4E 1EA6A 4LF4I 1Z0WA 4B3SE 4JI6E 1N32E 3QT7A 5FLXQ 1I94I 2UUAE 4B3ME 4X65E 1N0VC 2UXDI 4LFBI 3B8HA 1FWLA 2VQEI 4DV5I 4PRXA
chains in the Genus database with same CATH superfamily
1HK7A 1ZXNA 4JI0I 2CZ9A 4X62E 4B3TE 4OO1C 2WP8A 2X7IA 4LF9I 1Y60A 4IS9A 4HXZA 2VQFE 4MU3A 4LCHA 1MU5A 2AE8A 4PRVA 4DR7I 2ZBKB 4OKGA 3JAMQ 1XNQI 3H4LA 4DV3E 4IFDE 2BA0G 1IBLI 1XNRI 4DR6E 4DR1I 1ZM9A 4DPWA 5C0XA 2HFUA 4LF5I 3ZZ0A 4DV7E 2C37B 3PRYA 4LCGA 3P3GA 4DR5E 1HNZI 4JYAE 3PYFA 2UXCI 2IESA 4YY3E 1Z0VA 2EFGA 4MU4A 1N36E 2BA1G 1MX0A 3B78A 4FW9A 2VESA 2O1WA 2UUCI 2LJPA 4JI0E 4OO1E 1D6TA 2O1VA 3P3CA 4DV5E 3DD6A 1Y6ZA 4AIDA 3J7AM 4QNJA 4K0KI 5A2QQ 1S4EA 1ZXMA 2GO4A 4DUZI 2UXDE 4DPTA 3ZKBA 2PNZB 4YHHI 1MG7A 4KHPE 3ZZTA 4WUCA 2UUBE 4DR1E 2Q2EB 1H73A 3T1HI 1XNRE 3M7NG 4IZKB 2IOQA 4OX9I 1Y5YA 2F1DA 4BA2A 2E5LE 5BR8E 2PO2A 5C0XF 3ZZUA 4DV7I 5JEAE 4EMDA 1RREA 4ED4A 2UXBI 5C0XD 3L7ZA 3JAMC 1ZM3A 4JI2I 3WU4A 4BA1A 4LF7I 4IFDF 4MQYA 4FW4A 3OTOE 1IBKE 5GMDA 4U3DA 4LCFA 4X65I 5C0XB 2ZITA 2BR2B 1HNZE 2O1TA 4LOMA 4X66E 3HULA 3ZKDA 4HACB 3B82A 5LMNE 1Z0CA 2HHHE 4LFCE 3UHMA 4MYTA 1N34I 4DUYI 3U1KA 4DPUA 4URLA 2Z5BA 5K36A 5LL6R 1H7UA 4FN5A 4OZEA 2F4VE 4DR4I 1HNWI 1H7SA 4N3OA 1UDQA 4P7AA 5EL9A 5K36E 4JI5E 2C38A 4DR3I 4NXME 1XHKA 2VQFI 4JI6I 1U2RA 4J3DA 1UDNA 2PNMA 4DV0I 4HACA 2BR2A 1Z0EA 1N33I 5LMUE 4DUYE 4M1KA 1NHIA 3P76A 2VQEE 4AM3A 4LFAE 2CVEA 1Z5AA 5A2QC 4YY3I 4KHPI 4Z7YA 1PKPA 4JV5I 1Z0TA 1VI7A 2PNLA 3L7ZB 2V34A 4DR6I 4UT4A 4P52A 3QT8A 3WU5A 1NHJA 3CDJA 1FNMA 2BA1D 4JI1I 4DV3I 1N33E 1UEKA 1Y4UA 4DPXA 2BA0D 1IBMI 2JEBA 3GMEA 1YHCA 4U3BA 1FKAE 3CWVA 4IZKA 1BKNA 4JI5I 2JE6A 3CDIA 3GONA 4DV2I 1K47A 3ZM7A 1XMOE 3J81Q 3J81C 2F4VI 4FW3A 4AQYI 4B3RE 4DR4E 2AJ4A 4FW7A 4DV1E 1N34E 4IZJB 1KVKA 2C38B 3PYEA 2IOPA 1S16A 3KRNA 3K85A 3V5RA 2V2QA 4XTJA 4YHHE 5IT9Q 2HHHI 5ELWA 4GKKE 3LTOA 2OI2A 2A2DA 1ZM4A 4FW6A 1PIEA 2C39A 2DEJA 1FI4A 2UU9E 4JI3I 1HNWE 4JI4I 2V2ZA 5LMUI 1OYPA 4ZVIA 1XMQE 3P3EA 4MYUA 3Q1QA 5JEAB 1H72C 2NN6E 4X66I 4B3MI 3J80C 2HK3A 4DV4E 1RR9A 1UDOA 1USUA 2R3VA 4RPFA 1DARA 2PO2B 4LF7E 3WU3A 4DV6I 4BA2B 5DRPA 2J65A 1OJ4A 1B62A 4IFDB 3M85D 2X36A 1Z5CA 3OTOI 1IBKI 1NZ0A 4NBQA 4Z7CA 2ZM6E 2E5LI 2BV3A 2PNZA 4LF8I 4I3HA 2JEBB 4IZJD 1FJGI 3PYGA 4NXNI 2C39B 4JI2E 2JEAA 3WU6A 4DV4I 4ISAA 5IT9C 4JV5E 4AQYE 5K36B 2V2VA 3QT6A 4JYAI 2NN6C 4GKJE 4DR2E 1HR0I 4IZJA 4OO1D 3B4TA 5DRRA 3T1HE 2IERA 2C37A 3PS3A 4QNKA 2HFSA 1J5EI 1NHHA 4DV0E 1PVGA 1WUUA 5EKWA 1YH8A 2J7KA 4USKA 4PU9A 4OO1A 3K17A 4DR5I 1VISA 2R42A 4LF5E 2JT2A 1Z59A 4FWHA 4OX9E 3PS1A 4R1FA 4NXNE 2PO1A 4LFBE 3M6AA 4LF8E 2Z5BB 2UUBI 4DR2I 5JEAA 3M7ND 1XNQE 4B3RI 5DROA 5L3JA 1XMOI 4MU1A 1I94E 3D4JA 4DU7A 4DUZE 5IWAE 5FWKA 2JE6B 1XMQI 4X62I 4B3TI 1N0UA 4IFDC 1J5EE 4LPFA 2WNRB 2Z5CB 4JI4E 1OYSA 2UU9I 4JI3E 2PO1B 5GMEA 3LPSA 2XEXA 4LFCI 3H1CA 5LMNI 4WUBA 5BR8I 4JI8I 5DNLA 2GO3A 3LNUA 4LF9E 5DRQA 2BM0A 4DXLA 1XXEA 1R6MA 3F0NA 4UTGA 1IBLE 4WUDA 1Z5BA 3T1YI 2HKJA 5JEAF 1USVA 1Z0BA 1R6LA 4JI7I 4FWGA 4DR3E 2HKEA 2PO0B 1EI1A 1A6FA 2WW4A 3PS2A 1N32I 4GKKI 2NPFA 4BA1B 1P42A 1Y4SA 2CG9A 4KQVA 4HY1A 4JG4A 3PYDA 1KIJA 4X64E 2JEAB 1N36I 5FLXC 4LF6E 4OO1B 2WP8B 3GLLA 1QZRA 4FWDA 4JI8E 4DPYA 2UXCE 2WNRA 2Z5CA 5C0XC 4DV2E 2HK2A 5JEAC 3J7AG 3U1YA 4NXMI 1KKHA 1RHYA 3GCMA 5K36D 1FWKA 1IBME 4K0KE 4USMA 4DV1I 4B3SI 1HNXE 1FJGE 4DU8A 4JI1E 4AIMA 4GQUA 2UUCE 2GQ0A 2Z5EA 2NN6F 4DR7E 5IWAI 1UDSA 2UXBE 2A2CA 3K1JA 1HR0E 4IFDD 1ELOA 2O3ZA 4GKJI 4JI7E 2BM1A 1B63A 4DV6E 4LF6I 1ZM2A 1KTVA 3T1YE 3J80Q 2DEIA 1HNXI 2PO0A 1H74A 1OYRA 1E3HA 3NZKA 3M85G 4IFDA 4HYMA 4MU0A 4OO1F 1Z0GA 3QT5A 2VF3A 2ZM6I 2GS8A 3P06A 2UUAI 4FW5A 5K36C 2E1RA 5C0XE 2V8PA 2O1UA 3V2UC 5JEAD 4LFAI 4X64I 5DNXA 4LF4E 1EA6A 3Q6NA 4LF4I 1E3PA 2NN6B 1Z0WA 4B3SE 2NN6A 4JI6E 3HJCA 1N32E 3QT7A 5FLXQ 3HKMA 5K36F 1I94I 2UUAE 4B3ME 4X65E 2CGEA 1N0VC 2UXDI 3Q6MA 4LFBI 3B8HA 1FWLA 2NN6D 4MDTA 2VQEI 4DV5I 4PRXA
chains in the Genus database with same CATH topology
1HK7A 1ZXNA 4JI0I 2CZ9A 4X62E 4B3TE 2X7IA 4LF9I 4HXZA 2VQFE 1MU5A 4PRVA 4DR7I 2ZBKB 3JAMQ 1XNQI 3H4LA 4DV3E 1IBLI 1XNRI 4DR6E 4DR1I 1ZM9A 4DPWA 2HFUA 4LF5I 3ZZ0A 4DV7E 3PRYA 4DR5E 4JYAE 1HNZI 3PYFA 2UXCI 4YY3E 1Z0VA 2EFGA 1N36E 1MX0A 3B78A 4FW9A 2O1WA 2UUCI 2LJPA 4JI0E 1D6TA 2O1VA 4DV5E 3J7AM 1Y6ZA 4K0KI 5A2QQ 1S4EA 1ZXMA 4DUZI 2UXDE 4DPTA 3ZKBA 4YHHI 1MG7A 4KHPE 3ZZTA 4WUCA 2UUBE 4DR1E 2Q2EB 1H73A 3T1HI 1XNRE 4IZKB 2IOQA 4OX9I 2E5LE 5BR8E 3ZZUA 4DV7I 4EMDA 1RREA 4ED4A 2UXBI 3JAMC 1ZM3A 4JI2I 3WU4A 4LF7I 3OTOE 1IBKE 5GMDA 4X65I 2ZITA 1HNZE 2O1TA 4X66E 3HULA 3ZKDA 4HACB 3B82A 5LMNE 1Z0CA 2HHHE 4LFCE 4MYTA 1N34I 4DUYI 4DPUA 4URLA 2Z5BA 5LL6R 1H7UA 4FN5A 2F4VE 4DR4I 1HNWI 1H7SA 4N3OA 4P7AA 4JI5E 4DR3I 4NXME 1XHKA 2VQFI 4JI6I 1U2RA 4DV0I 2PNMA 4HACA 1Z0EA 1N33I 5LMUE 4DUYE 4M1KA 1NHIA 2VQEE 4LFAE 1Z5AA 5A2QC 4YY3I 4KHPI 4Z7YA 1PKPA 4JV5I 1Z0TA 2PNLA 2V34A 4DR6I 4UT4A 4P52A 3QT8A 3WU5A 1NHJA 1FNMA 4JI1I 4DV3I 1N33E 1UEKA 1Y4UA 4DPXA 1IBMI 1FKAE 3CWVA 4IZKA 1BKNA 4JI5I 3GONA 4DV2I 1K47A 3ZM7A 1XMOE 3J81Q 3J81C 2F4VI 4B3RE 4AQYI 4DR4E 2AJ4A 4DV1E 1N34E 4IZJB 1KVKA 3PYEA 2IOPA 1S16A 3K85A 2V2QA 4XTJA 3V5RA 4YHHE 5IT9Q 2HHHI 4GKKE 3LTOA 2OI2A 2A2DA 1ZM4A 1PIEA 2DEJA 1FI4A 2UU9E 4JI3I 1HNWE 4JI4I 2V2ZA 5LMUI 4ZVIA 1XMQE 4MYUA 3Q1QA 1H72C 4X66I 4B3MI 3J80C 2HK3A 4DV4E 1RR9A 1USUA 2R3VA 4RPFA 1DARA 4LF7E 3WU3A 4DV6I 1OJ4A 1B62A 2X36A 1Z5CA 3OTOI 1IBKI 1NZ0A 4Z7CA 2ZM6E 2E5LI 2BV3A 4LF8I 4I3HA 4IZJD 1FJGI 3PYGA 4NXNI 4JI2E 3WU6A 4DV4I 5IT9C 4JV5E 4AQYE 2V2VA 3QT6A 4JYAI 4GKJE 4DR2E 1HR0I 4IZJA 3T1HE 1J5EI 2HFSA 1NHHA 4DV0E 1PVGA 1WUUA 2J7KA 4USKA 4PU9A 3K17A 4DR5I 1VISA 2R42A 4LF5E 1Z59A 4FWHA 4OX9E 4R1FA 4NXNE 4LFBE 3M6AA 4LF8E 2Z5BB 2UUBI 4DR2I 4B3RI 1XNQE 5L3JA 1XMOI 1I94E 3D4JA 4DU7A 4DUZE 5IWAE 5FWKA 1XMQI 4X62I 4B3TI 1N0UA 1J5EE 2Z5CB 4JI4E 2UU9I 4JI3E 5GMEA 3LPSA 2XEXA 4LFCI 5LMNI 4WUBA 5BR8I 4JI8I 3LNUA 4LF9E 2BM0A 4DXLA 3F0NA 4UTGA 1IBLE 4WUDA 1Z5BA 3T1YI 2HKJA 1USVA 1Z0BA 4JI7I 4FWGA 4DR3E 2HKEA 1EI1A 1A6FA 2WW4A 1N32I 4GKKI 2NPFA 1Y4SA 2CG9A 4KQVA 4HY1A 4JG4A 3PYDA 1KIJA 4X64E 1N36I 5FLXC 4LF6E 4FWDA 1QZRA 4JI8E 4DPYA 2UXCE 2Z5CA 4DV2E 2HK2A 3J7AG 4NXMI 1KKHA 1FWKA 1IBME 4K0KE 4USMA 4DV1I 4B3SI 1HNXE 1FJGE 4DU8A 4JI1E 2UUCE 2GQ0A 2Z5EA 4DR7E 5IWAI 2UXBE 2A2CA 3K1JA 1HR0E 1ELOA 4GKJI 4JI7E 2BM1A 1B63A 4DV6E 4LF6I 1ZM2A 1KTVA 3T1YE 3J80Q 2DEIA 1HNXI 1H74A 4HYMA 1Z0GA 3QT5A 2VF3A 2ZM6I 2GS8A 3P06A 2UUAI 2E1RA 2V8PA 2O1UA 3V2UC 4LFAI 4X64I 4LF4E 1EA6A 3Q6NA 4LF4I 1Z0WA 4B3SE 4JI6E 3HJCA 1N32E 3QT7A 5FLXQ 1I94I 2UUAE 4B3ME 4X65E 2CGEA 1N0VC 2UXDI 3Q6MA 4LFBI 3B8HA 1FWLA 2VQEI 4DV5I 4PRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXN A;  4JI0 I;  2CZ9 A;  4X62 E;  4B3T E;  2X7I A;  4LF9 I;  4HXZ A;  2VQF E;  1MU5 A;  4PRV A;  4DR7 I;  2ZBK B;  3JAM Q;  1XNQ I;  3H4L A;  4DV3 E;  1IBL I;  1XNR I;  4DR6 E;  4DR1 I;  1ZM9 A;  4DPW A;  2HFU A;  4LF5 I;  3ZZ0 A;  4DV7 E;  4DR5 E;  4JYA E;  1HNZ I;  3PYF A;  2UXC I;  4YY3 E;  1Z0V A;  2EFG A;  1N36 E;  1MX0 A;  3B78 A;  4FW9 A;  2UUC I;  2LJP A;  4JI0 E;  1D6T A;  4DV5 E;  3J7A M;  4K0K I;  5A2Q Q;  1S4E A;  1ZXM A;  4DUZ I;  2UXD E;  4DPT A;  3ZKB A;  4YHH I;  1MG7 A;  4KHP E;  3ZZT A;  4WUC A;  2UUB E;  4DR1 E;  2Q2E B;  1H73 A;  3T1H I;  1XNR E;  4OX9 I;  2E5L E;  5BR8 E;  3ZZU A;  4DV7 I;  4EMD A;  1RRE A;  4ED4 A;  2UXB I;  3JAM C;  1ZM3 A;  4JI2 I;  3WU4 A;  4LF7 I;  3OTO E;  1IBK E;  5GMD A;  4X65 I;  2ZIT A;  1HNZ E;  4X66 E;  3HUL A;  3ZKD A;  4HAC B;  3B82 A;  4LFC E;  1Z0C A;  5LMN E;  2HHH E;  4MYT A;  1N34 I;  4DUY I;  4DPU A;  4URL A;  5LL6 R;  1H7U A;  4FN5 A;  2F4V E;  4DR4 I;  1HNW I;  1H7S A;  4P7A A;  4JI5 E;  4DR3 I;  4NXM E;  1XHK A;  2VQF I;  4JI6 I;  1U2R A;  4DV0 I;  4HAC A;  1Z0E A;  1N33 I;  5LMU E;  4DUY E;  4M1K A;  1NHI A;  2VQE E;  4LFA E;  1Z5A A;  5A2Q C;  4YY3 I;  4KHP I;  4Z7Y A;  1PKP A;  4JV5 I;  1Z0T A;  2V34 A;  4DR6 I;  4UT4 A;  4P52 A;  3QT8 A;  3WU5 A;  1NHJ A;  1FNM A;  4JI1 I;  4DV3 I;  1N33 E;  1UEK A;  4DPX A;  1IBM I;  1FKA E;  3CWV A;  1BKN A;  4JI5 I;  3GON A;  4DV2 I;  1K47 A;  3ZM7 A;  1XMO E;  3J81 Q;  3J81 C;  2F4V I;  4B3R E;  4AQY I;  4DR4 E;  2AJ4 A;  4DV1 E;  1N34 E;  1KVK A;  3PYE A;  1S16 A;  4XTJ A;  2V2Q A;  3V5R A;  4YHH E;  5IT9 Q;  2HHH I;  4GKK E;  3LTO A;  2OI2 A;  2A2D A;  1ZM4 A;  1PIE A;  2DEJ A;  1FI4 A;  2UU9 E;  4JI3 I;  1HNW E;  4JI4 I;  2V2Z A;  5LMU I;  4ZVI A;  1XMQ E;  4MYU A;  3Q1Q A;  1H72 C;  4X66 I;  4B3M I;  3J80 C;  2HK3 A;  4DV4 E;  1RR9 A;  2R3V A;  4RPF A;  1DAR A;  4LF7 E;  3WU3 A;  4DV6 I;  1OJ4 A;  1B62 A;  2X36 A;  1Z5C A;  3OTO I;  1IBK I;  1NZ0 A;  4Z7C A;  2ZM6 E;  2E5L I;  2BV3 A;  4LF8 I;  4I3H A;  1FJG I;  3PYG A;  4NXN I;  4JI2 E;  3WU6 A;  4DV4 I;  5IT9 C;  4JV5 E;  4AQY E;  2V2V A;  3QT6 A;  4JYA I;  4GKJ E;  4DR2 E;  1HR0 I;  3T1H E;  1J5E I;  2HFS A;  1NHH A;  4DV0 E;  1PVG A;  1WUU A;  2J7K A;  4USK A;  4PU9 A;  3K17 A;  4DR5 I;  1VIS A;  2R42 A;  4LF5 E;  1Z59 A;  4FWH A;  4OX9 E;  4R1F A;  4NXN E;  4LFB E;  3M6A A;  4LF8 E;  2UUB I;  4DR2 I;  4B3R I;  1XNQ E;  5L3J A;  1XMO I;  1I94 E;  3D4J A;  4DU7 A;  4DUZ E;  5IWA E;  1XMQ I;  4X62 I;  4B3T I;  1N0U A;  1J5E E;  4JI4 E;  2UU9 I;  4JI3 E;  5GME A;  3LPS A;  2XEX A;  4LFC I;  5LMN I;  4WUB A;  5BR8 I;  4JI8 I;  3LNU A;  4LF9 E;  2BM0 A;  4DXL A;  3F0N A;  4UTG A;  1IBL E;  4WUD A;  1Z5B A;  3T1Y I;  2HKJ A;  1Z0B A;  4JI7 I;  4FWG A;  4DR3 E;  2HKE A;  1EI1 A;  1A6F A;  2WW4 A;  1N32 I;  4GKK I;  2NPF A;  4KQV A;  4HY1 A;  4JG4 A;  3PYD A;  1KIJ A;  4X64 E;  1N36 I;  5FLX C;  4LF6 E;  4FWD A;  1QZR A;  4JI8 E;  4DPY A;  2UXC E;  4DV2 E;  2HK2 A;  3J7A G;  4NXM I;  1KKH A;  1FWK A;  1IBM E;  4K0K E;  4USM A;  4DV1 I;  4B3S I;  1HNX E;  1FJG E;  4DU8 A;  4JI1 E;  2UUC E;  4DR7 E;  5IWA I;  2UXB E;  2A2C A;  3K1J A;  1HR0 E;  1ELO A;  4GKJ I;  4JI7 E;  2BM1 A;  1B63 A;  4DV6 E;  4LF6 I;  1ZM2 A;  1KTV A;  3T1Y E;  3J80 Q;  2DEI A;  1HNX I;  1H74 A;  4HYM A;  1Z0G A;  3QT5 A;  2VF3 A;  2ZM6 I;  2GS8 A;  2UUA I;  2E1R A;  2V8P A;  3V2U C;  4LFA I;  4X64 I;  4LF4 E;  1EA6 A;  4LF4 I;  1Z0W A;  4B3S E;  4JI6 E;  1N32 E;  3QT7 A;  5FLX Q;  1I94 I;  2UUA E;  4B3M E;  4X65 E;  1N0V C;  2UXD I;  4LFB I;  3B8H A;  1FWL A;  2VQE I;  4DV5 I;  4PRX A; 
#chains in the Genus database with same CATH topology
 1HK7 A;  1ZXN A;  4JI0 I;  2CZ9 A;  4X62 E;  4B3T E;  4OO1 C;  2WP8 A;  2X7I A;  4LF9 I;  1Y60 A;  4IS9 A;  4HXZ A;  2VQF E;  4MU3 A;  4LCH A;  1MU5 A;  2AE8 A;  4PRV A;  4DR7 I;  2ZBK B;  4OKG A;  3JAM Q;  1XNQ I;  3H4L A;  4DV3 E;  4IFD E;  2BA0 G;  1IBL I;  1XNR I;  4DR6 E;  4DR1 I;  1ZM9 A;  4DPW A;  5C0X A;  2HFU A;  4LF5 I;  3ZZ0 A;  4DV7 E;  2C37 B;  3PRY A;  4LCG A;  3P3G A;  4DR5 E;  1HNZ I;  4JYA E;  3PYF A;  2UXC I;  2IES A;  4YY3 E;  1Z0V A;  2EFG A;  4MU4 A;  1N36 E;  2BA1 G;  1MX0 A;  3B78 A;  4FW9 A;  2VES A;  2O1W A;  2UUC I;  2LJP A;  4JI0 E;  4OO1 E;  1D6T A;  2O1V A;  3P3C A;  4DV5 E;  3DD6 A;  1Y6Z A;  4AID A;  3J7A M;  4QNJ A;  4K0K I;  5A2Q Q;  1S4E A;  1ZXM A;  2GO4 A;  4DUZ I;  2UXD E;  4DPT A;  3ZKB A;  2PNZ B;  4YHH I;  1MG7 A;  4KHP E;  3ZZT A;  4WUC A;  2UUB E;  4DR1 E;  2Q2E B;  1H73 A;  3T1H I;  1XNR E;  3M7N G;  4IZK B;  2IOQ A;  4OX9 I;  1Y5Y A;  2F1D A;  4BA2 A;  2E5L E;  5BR8 E;  2PO2 A;  5C0X F;  3ZZU A;  4DV7 I;  5JEA E;  4EMD A;  1RRE A;  4ED4 A;  2UXB I;  5C0X D;  3L7Z A;  3JAM C;  1ZM3 A;  4JI2 I;  3WU4 A;  4BA1 A;  4LF7 I;  4IFD F;  4MQY A;  4FW4 A;  3OTO E;  1IBK E;  5GMD A;  4U3D A;  4LCF A;  4X65 I;  5C0X B;  2ZIT A;  2BR2 B;  1HNZ E;  2O1T A;  4LOM A;  4X66 E;  3HUL A;  3ZKD A;  4HAC B;  3B82 A;  5LMN E;  1Z0C A;  2HHH E;  4LFC E;  3UHM A;  4MYT A;  1N34 I;  4DUY I;  3U1K A;  4DPU A;  4URL A;  2Z5B A;  5K36 A;  5LL6 R;  1H7U A;  4FN5 A;  4OZE A;  2F4V E;  4DR4 I;  1HNW I;  1H7S A;  4N3O A;  1UDQ A;  4P7A A;  5EL9 A;  5K36 E;  4JI5 E;  2C38 A;  4DR3 I;  4NXM E;  1XHK A;  2VQF I;  4JI6 I;  1U2R A;  4J3D A;  1UDN A;  2PNM A;  4DV0 I;  4HAC A;  2BR2 A;  1Z0E A;  1N33 I;  5LMU E;  4DUY E;  4M1K A;  1NHI A;  3P76 A;  2VQE E;  4AM3 A;  4LFA E;  2CVE A;  1Z5A A;  5A2Q C;  4YY3 I;  4KHP I;  4Z7Y A;  1PKP A;  4JV5 I;  1Z0T A;  1VI7 A;  2PNL A;  3L7Z B;  2V34 A;  4DR6 I;  4UT4 A;  4P52 A;  3QT8 A;  3WU5 A;  1NHJ A;  3CDJ A;  1FNM A;  2BA1 D;  4JI1 I;  4DV3 I;  1N33 E;  1UEK A;  1Y4U A;  4DPX A;  2BA0 D;  1IBM I;  2JEB A;  3GME A;  1YHC A;  4U3B A;  1FKA E;  3CWV A;  4IZK A;  1BKN A;  4JI5 I;  2JE6 A;  3CDI A;  3GON A;  4DV2 I;  1K47 A;  3ZM7 A;  1XMO E;  3J81 Q;  3J81 C;  2F4V I;  4FW3 A;  4AQY I;  4B3R E;  4DR4 E;  2AJ4 A;  4FW7 A;  4DV1 E;  1N34 E;  4IZJ B;  1KVK A;  2C38 B;  3PYE A;  2IOP A;  1S16 A;  3KRN A;  3K85 A;  3V5R A;  2V2Q A;  4XTJ A;  4YHH E;  5IT9 Q;  2HHH I;  5ELW A;  4GKK E;  3LTO A;  2OI2 A;  2A2D A;  1ZM4 A;  4FW6 A;  1PIE A;  2C39 A;  2DEJ A;  1FI4 A;  2UU9 E;  4JI3 I;  1HNW E;  4JI4 I;  2V2Z A;  5LMU I;  1OYP A;  4ZVI A;  1XMQ E;  3P3E A;  4MYU A;  3Q1Q A;  5JEA B;  1H72 C;  2NN6 E;  4X66 I;  4B3M I;  3J80 C;  2HK3 A;  4DV4 E;  1RR9 A;  1UDO A;  1USU A;  2R3V A;  4RPF A;  1DAR A;  2PO2 B;  4LF7 E;  3WU3 A;  4DV6 I;  4BA2 B;  5DRP A;  2J65 A;  1OJ4 A;  1B62 A;  4IFD B;  3M85 D;  2X36 A;  1Z5C A;  3OTO I;  1IBK I;  1NZ0 A;  4NBQ A;  4Z7C A;  2ZM6 E;  2E5L I;  2BV3 A;  2PNZ A;  4LF8 I;  4I3H A;  2JEB B;  4IZJ D;  1FJG I;  3PYG A;  4NXN I;  2C39 B;  4JI2 E;  2JEA A;  3WU6 A;  4DV4 I;  4ISA A;  5IT9 C;  4JV5 E;  4AQY E;  5K36 B;  2V2V A;  3QT6 A;  4JYA I;  2NN6 C;  4GKJ E;  4DR2 E;  1HR0 I;  4IZJ A;  4OO1 D;  3B4T A;  5DRR A;  3T1H E;  2IER A;  2C37 A;  3PS3 A;  4QNK A;  2HFS A;  1J5E I;  1NHH A;  4DV0 E;  1PVG A;  1WUU A;  5EKW A;  1YH8 A;  2J7K A;  4USK A;  4PU9 A;  4OO1 A;  3K17 A;  4DR5 I;  1VIS A;  2R42 A;  4LF5 E;  2JT2 A;  1Z59 A;  4FWH A;  4OX9 E;  3PS1 A;  4R1F A;  4NXN E;  2PO1 A;  4LFB E;  3M6A A;  4LF8 E;  2Z5B B;  2UUB I;  4DR2 I;  5JEA A;  3M7N D;  1XNQ E;  4B3R I;  5DRO A;  5L3J A;  1XMO I;  4MU1 A;  1I94 E;  3D4J A;  4DU7 A;  4DUZ E;  5IWA E;  5FWK A;  2JE6 B;  1XMQ I;  4X62 I;  4B3T I;  1N0U A;  4IFD C;  1J5E E;  4LPF A;  2WNR B;  2Z5C B;  4JI4 E;  1OYS A;  2UU9 I;  4JI3 E;  2PO1 B;  5GME A;  3LPS A;  2XEX A;  4LFC I;  3H1C A;  5LMN I;  4WUB A;  5BR8 I;  4JI8 I;  5DNL A;  2GO3 A;  3LNU A;  4LF9 E;  5DRQ A;  2BM0 A;  4DXL A;  1XXE A;  1R6M A;  3F0N A;  4UTG A;  1IBL E;  4WUD A;  1Z5B A;  3T1Y I;  2HKJ A;  5JEA F;  1USV A;  1Z0B A;  1R6L A;  4JI7 I;  4FWG A;  4DR3 E;  2HKE A;  2PO0 B;  1EI1 A;  1A6F A;  2WW4 A;  3PS2 A;  1N32 I;  4GKK I;  2NPF A;  4BA1 B;  1P42 A;  1Y4S A;  2CG9 A;  4KQV A;  4HY1 A;  4JG4 A;  3PYD A;  1KIJ A;  4X64 E;  2JEA B;  1N36 I;  5FLX C;  4LF6 E;  4OO1 B;  2WP8 B;  3GLL A;  1QZR A;  4FWD A;  4JI8 E;  4DPY A;  2UXC E;  2WNR A;  2Z5C A;  5C0X C;  4DV2 E;  2HK2 A;  5JEA C;  3J7A G;  3U1Y A;  4NXM I;  1KKH A;  1RHY A;  3GCM A;  5K36 D;  1FWK A;  1IBM E;  4K0K E;  4USM A;  4DV1 I;  4B3S I;  1HNX E;  1FJG E;  4DU8 A;  4JI1 E;  4AIM A;  4GQU A;  2UUC E;  2GQ0 A;  2Z5E A;  2NN6 F;  4DR7 E;  5IWA I;  1UDS A;  2UXB E;  2A2C A;  3K1J A;  1HR0 E;  4IFD D;  1ELO A;  2O3Z A;  4GKJ I;  4JI7 E;  2BM1 A;  1B63 A;  4DV6 E;  4LF6 I;  1ZM2 A;  1KTV A;  3T1Y E;  3J80 Q;  2DEI A;  1HNX I;  2PO0 A;  1H74 A;  1OYR A;  1E3H A;  3NZK A;  3M85 G;  4IFD A;  4HYM A;  4MU0 A;  4OO1 F;  1Z0G A;  3QT5 A;  2VF3 A;  2ZM6 I;  2GS8 A;  3P06 A;  2UUA I;  4FW5 A;  5K36 C;  2E1R A;  5C0X E;  2V8P A;  2O1U A;  3V2U C;  5JEA D;  4LFA I;  4X64 I;  5DNX A;  4LF4 E;  1EA6 A;  3Q6N A;  4LF4 I;  1E3P A;  2NN6 B;  1Z0W A;  4B3S E;  2NN6 A;  4JI6 E;  3HJC A;  1N32 E;  3QT7 A;  5FLX Q;  3HKM A;  5K36 F;  1I94 I;  2UUA E;  4B3M E;  4X65 E;  2CGE A;  1N0V C;  2UXD I;  3Q6M A;  4LFB I;  3B8H A;  1FWL A;  2NN6 D;  4MDT A;  2VQE I;  4DV5 I;  4PRX A; 
#chains in the Genus database with same CATH homology
 1HK7 A;  1ZXN A;  4JI0 I;  2CZ9 A;  4X62 E;  4B3T E;  2X7I A;  4LF9 I;  4HXZ A;  2VQF E;  1MU5 A;  4PRV A;  4DR7 I;  2ZBK B;  3JAM Q;  1XNQ I;  3H4L A;  4DV3 E;  1IBL I;  1XNR I;  4DR6 E;  4DR1 I;  1ZM9 A;  4DPW A;  2HFU A;  4LF5 I;  3ZZ0 A;  4DV7 E;  3PRY A;  4DR5 E;  4JYA E;  1HNZ I;  3PYF A;  2UXC I;  4YY3 E;  1Z0V A;  2EFG A;  1N36 E;  1MX0 A;  3B78 A;  4FW9 A;  2O1W A;  2UUC I;  2LJP A;  4JI0 E;  1D6T A;  2O1V A;  4DV5 E;  3J7A M;  1Y6Z A;  4K0K I;  5A2Q Q;  1S4E A;  1ZXM A;  4DUZ I;  2UXD E;  4DPT A;  3ZKB A;  4YHH I;  1MG7 A;  4KHP E;  3ZZT A;  4WUC A;  2UUB E;  4DR1 E;  2Q2E B;  1H73 A;  3T1H I;  1XNR E;  4IZK B;  2IOQ A;  4OX9 I;  2E5L E;  5BR8 E;  3ZZU A;  4DV7 I;  4EMD A;  1RRE A;  4ED4 A;  2UXB I;  3JAM C;  1ZM3 A;  4JI2 I;  3WU4 A;  4LF7 I;  3OTO E;  1IBK E;  5GMD A;  4X65 I;  2ZIT A;  1HNZ E;  2O1T A;  4X66 E;  3HUL A;  3ZKD A;  4HAC B;  3B82 A;  5LMN E;  1Z0C A;  2HHH E;  4LFC E;  4MYT A;  1N34 I;  4DUY I;  4DPU A;  4URL A;  2Z5B A;  5LL6 R;  1H7U A;  4FN5 A;  2F4V E;  4DR4 I;  1HNW I;  1H7S A;  4N3O A;  4P7A A;  4JI5 E;  4DR3 I;  4NXM E;  1XHK A;  2VQF I;  4JI6 I;  1U2R A;  4DV0 I;  2PNM A;  4HAC A;  1Z0E A;  1N33 I;  5LMU E;  4DUY E;  4M1K A;  1NHI A;  2VQE E;  4LFA E;  1Z5A A;  5A2Q C;  4YY3 I;  4KHP I;  4Z7Y A;  1PKP A;  4JV5 I;  1Z0T A;  2PNL A;  2V34 A;  4DR6 I;  4UT4 A;  4P52 A;  3QT8 A;  3WU5 A;  1NHJ A;  1FNM A;  4JI1 I;  4DV3 I;  1N33 E;  1UEK A;  1Y4U A;  4DPX A;  1IBM I;  1FKA E;  3CWV A;  4IZK A;  1BKN A;  4JI5 I;  3GON A;  4DV2 I;  1K47 A;  3ZM7 A;  1XMO E;  3J81 Q;  3J81 C;  2F4V I;  4B3R E;  4AQY I;  4DR4 E;  2AJ4 A;  4DV1 E;  1N34 E;  4IZJ B;  1KVK A;  3PYE A;  2IOP A;  1S16 A;  3K85 A;  2V2Q A;  4XTJ A;  3V5R A;  4YHH E;  5IT9 Q;  2HHH I;  4GKK E;  3LTO A;  2OI2 A;  2A2D A;  1ZM4 A;  1PIE A;  2DEJ A;  1FI4 A;  2UU9 E;  4JI3 I;  1HNW E;  4JI4 I;  2V2Z A;  5LMU I;  4ZVI A;  1XMQ E;  4MYU A;  3Q1Q A;  1H72 C;  4X66 I;  4B3M I;  3J80 C;  2HK3 A;  4DV4 E;  1RR9 A;  1USU A;  2R3V A;  4RPF A;  1DAR A;  4LF7 E;  3WU3 A;  4DV6 I;  1OJ4 A;  1B62 A;  2X36 A;  1Z5C A;  3OTO I;  1IBK I;  1NZ0 A;  4Z7C A;  2ZM6 E;  2E5L I;  2BV3 A;  4LF8 I;  4I3H A;  4IZJ D;  1FJG I;  3PYG A;  4NXN I;  4JI2 E;  3WU6 A;  4DV4 I;  5IT9 C;  4JV5 E;  4AQY E;  2V2V A;  3QT6 A;  4JYA I;  4GKJ E;  4DR2 E;  1HR0 I;  4IZJ A;  3T1H E;  1J5E I;  2HFS A;  1NHH A;  4DV0 E;  1PVG A;  1WUU A;  2J7K A;  4USK A;  4PU9 A;  3K17 A;  4DR5 I;  1VIS A;  2R42 A;  4LF5 E;  1Z59 A;  4FWH A;  4OX9 E;  4R1F A;  4NXN E;  4LFB E;  3M6A A;  4LF8 E;  2Z5B B;  2UUB I;  4DR2 I;  4B3R I;  1XNQ E;  5L3J A;  1XMO I;  1I94 E;  3D4J A;  4DU7 A;  4DUZ E;  5IWA E;  5FWK A;  1XMQ I;  4X62 I;  4B3T I;  1N0U A;  1J5E E;  2Z5C B;  4JI4 E;  2UU9 I;  4JI3 E;  5GME A;  3LPS A;  2XEX A;  4LFC I;  5LMN I;  4WUB A;  5BR8 I;  4JI8 I;  3LNU A;  4LF9 E;  2BM0 A;  4DXL A;  3F0N A;  4UTG A;  1IBL E;  4WUD A;  1Z5B A;  3T1Y I;  2HKJ A;  1USV A;  1Z0B A;  4JI7 I;  4FWG A;  4DR3 E;  2HKE A;  1EI1 A;  1A6F A;  2WW4 A;  1N32 I;  4GKK I;  2NPF A;  1Y4S A;  2CG9 A;  4KQV A;  4HY1 A;  4JG4 A;  3PYD A;  1KIJ A;  4X64 E;  1N36 I;  5FLX C;  4LF6 E;  4FWD A;  1QZR A;  4JI8 E;  4DPY A;  2UXC E;  2Z5C A;  4DV2 E;  2HK2 A;  3J7A G;  4NXM I;  1KKH A;  1FWK A;  1IBM E;  4K0K E;  4USM A;  4DV1 I;  4B3S I;  1HNX E;  1FJG E;  4DU8 A;  4JI1 E;  2UUC E;  2GQ0 A;  2Z5E A;  4DR7 E;  5IWA I;  2UXB E;  2A2C A;  3K1J A;  1HR0 E;  1ELO A;  4GKJ I;  4JI7 E;  2BM1 A;  1B63 A;  4DV6 E;  4LF6 I;  1ZM2 A;  1KTV A;  3T1Y E;  3J80 Q;  2DEI A;  1HNX I;  1H74 A;  4HYM A;  1Z0G A;  3QT5 A;  2VF3 A;  2ZM6 I;  2GS8 A;  3P06 A;  2UUA I;  2E1R A;  2V8P A;  2O1U A;  3V2U C;  4LFA I;  4X64 I;  4LF4 E;  1EA6 A;  3Q6N A;  4LF4 I;  1Z0W A;  4B3S E;  4JI6 E;  3HJC A;  1N32 E;  3QT7 A;  5FLX Q;  1I94 I;  2UUA E;  4B3M E;  4X65 E;  2CGE A;  1N0V C;  2UXD I;  3Q6M A;  4LFB I;  3B8H A;  1FWL A;  2VQE I;  4DV5 I;  4PRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...