4X65I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x65I00
5IWAE 2UUBI 4B3RE 4JI8E 1ZXNA 4DUZE 4JI3E 1NHJA 3WU5A 3JAMQ 4GKJI 4JI1I 2ZM6E 2UUBE 2UUAE 4JI8I 2HK3A 2UXBI 4LFAE 1HNXI 4DR4I 4DUYE 1KTVA 5GMEA 3ZZTA 4Z7CA 1FJGI 1XHKA 1ZM9A 1N36I 4JI4E 4DV5E 4LF7E 1FJGE 1HNWI 3QT5A 4FW9A 1S16A 5LMUI 4K0KE 4MYTA 4DV2I 3H4LA 5IWAI 4JYAE 2A2CA 1Z0VA 4X65I 2NPFA 5BR8I 1ZM3A 4M1KA 4DV2E 1FWKA 2ZBKB 4LFCE 4X65E 1N0UA 1S4EA 1ZM4A 3LNUA 1PKPA 3WU3A 1N34E 1MX0A 4DV1E 2R3VA 4B3TE 4DV0E 3T1YE 4JI7I 4GKJE 1BKNA 4DR6E 3J80Q 4DPXA 4DR2E 1VISA 1H74A 4P52A 4DR7E 1N33E 4X66E 1H72C 4JI4I 4DR5I 3WU6A 1N32I 1EA6A 4LF5E 1NHHA 4YHHE 4LF9E 3CWVA 2DEIA 2CZ9A 2J7KA 4HACB 4LFCI 2BM0A 2V2VA 4AQYE 4JI3I 4JI1E 3M6AA 2AJ4A 2ZITA 2XEXA 4DV1I 4R1FA 4JYAI 2UU9I 1IBLE 4NXME 3HULA 4P7AA 3T1HI 2F4VE 2HKEA 4K0KI 1HNXE 5A2QQ 4DR2I 4PRVA 1XMOE 1NHIA 1IBLI 4LFBE 5LMNI 4DV5I 1HNZI 4OX9I 4LF9I 1MU5A 4HACA 2VQEI 3ZZ0A 4DV0I 2UXBE 4B3SI 4DPUA 2VQEE 1RREA 4HY1A 4JI0E 3OTOE 1NZ0A 2VQFE 4NXNE 1Z0BA 3F0NA 1KKHA 1Z0CA 3WU4A 4DV4E 4PU9A 2GS8A 3ZKDA 3J80C 1ZXMA 4JI2E 3LTOA 3QT6A 4DUYI 4DV6I 1FNMA 2V2ZA 4LF5I 1OJ4A 4X64E 3PYEA 2UUCI 1XNRI 4USMA 1A6FA 4LFBI 4YY3E 1J5EE 4JI6E 1KVKA 2HK2A 1D6TA 1IBME 1FKAE 4YY3I 2X7IA 1N32E 3J81C 1XNQE 4DR1E 4URLA 4X62I 3J7AM 4B3TI 1K47A 3ZKBA 1XMQE 5LMUE 3D4JA 2ZM6I 1IBKI 3QT8A 4LF6I 4LFAI 1Z0EA 4DV3E 5LMNE 2Q2EB 2V34A 4MYUA 4WUDA 2UUCE 1XNRE 2A2DA 3QT7A 3V5RA 2R42A 1N36E 1H73A 2VQFI 4DUZI 4JI5E 3PYGA 1Z59A 1I94I 4DU8A 4JI5I 4DV6E 1HNZE 4USKA 4YHHI 4B3ME 4AQYI 4ED4A 1B63A 1N0VC 4B3MI 4DR3I 4I3HA 1J5EI 4NXMI 4JI6I 3PYDA 4WUCA 4DPWA 1ZM2A 1ELOA 2V2QA 4FWGA 4B3RI 2HFUA 4JI7E 2E5LE 1B62A 2HHHI 2X36A 1UEKA 3PYFA 3ZZUA 4PRXA 2EFGA 2UU9E 3Q1QA 4HYMA 4JI2I 4DPYA 2VF3A 5IT9C 4LF6E 5IT9Q 4DPTA 4DR6I 4DR4E 1FWLA 4ZVIA 1IBKE 4DV4I 2DEJA 1KIJA 2V8PA 2UUAI 1N33I 4UT4A 4DV7E 1Z0TA 1XNQI 1HNWE 4X62E 4DR3E 4DR5E 4B3SE 5BR8E 2HHHE 1WUUA 4LF8E 2HFSA 4KHPI 4JI0I 2HKJA 5L3JA 4DV3I 3K1JA 4LF8I 4RPFA 5LL6R 2E5LI 3J7AG 4X64I 2BV3A 4DR7I 4Z7YA 4GKKI 4DV7I 2OI2A 2BM1A 3B8HA 4JG4A 2WW4A 3J81Q 4DR1I 4GKKE 1QZRA 1Z5AA 2LJPA 1HR0E 2UXCE 3B78A 4KQVA 4NXNI 4WUBA 1U2RA 2UXDE 5GMDA 1EI1A 3V2UC 1Z5BA 4HXZA 3B82A 1PVGA 3JAMC 4LF4E 2UXDI 4EMDA 1Z0WA 1PIEA 4JV5E 1MG7A 1XMQI 4LF4I 5FLXQ 4DXLA 5FLXC 4JV5I 1I94E 5A2QC 1H7UA 1IBMI 4KHPE 3GONA 3T1HE 2F4VI 4X66I 2E1RA 1FI4A 1Z0GA 4FWDA 3K17A 3T1YI 1HR0I 2UXCI 1Z5CA 3LPSA 1H7SA 4OX9E 4LF7I 4FWHA 3ZM7A 1N34I 1RR9A 1XMOI 1DARA 3OTOI 4UTGA 4FN5A 4DU7A 4XTJA
chains in the Genus database with same CATH superfamily
3CDIA 2BR2A 5IWAE 2UUBI 4B3RE 4JI8E 1ZXNA 4U3BA 4DUZE 4JI3E 1NHJA 3WU5A 3JAMQ 4GKJI 2JEBB 2C38B 4JI1I 2JT2A 2ZM6E 2UUBE 4OZEA 4IFDE 2CGEA 2UUAE 2O1TA 4JI8I 2HK3A 2UXBI 4LFAE 3Q6NA 2Z5BA 1HNXI 2Z5BB 4DR4I 4DUYE 1KTVA 5GMEA 3ZZTA 4Z7CA 1FJGI 1XHKA 1ZM9A 3U1KA 2NN6F 1N36I 2PO0A 4LOMA 4MU1A 2PNZB 4JI4E 4DV5E 2IERA 2BA0G 4LF7E 3GMEA 1FJGE 1HNWI 3PS1A 3QT5A 2JEAB 4FW9A 1S16A 2C38A 5LMUI 4K0KE 4MYTA 4DV2I 1Y6ZA 3H4LA 2C37B 5IWAI 5K36D 4JYAE 2A2CA 1Z0VA 4X65I 2NPFA 5BR8I 1ZM3A 3B4TA 4M1KA 4DV2E 1FWKA 3M7NG 2ZBKB 4FW5A 4LFCE 4X65E 1N0UA 1XXEA 1S4EA 1YHCA 1ZM4A 3LNUA 1PKPA 3WU3A 4QNKA 1N34E 1MX0A 4DV1E 2R3VA 4IZKB 4B3TE 4DV0E 3T1YE 4JI7I 3L7ZA 4GKJE 1BKNA 4DR6E 3J80Q 4DPXA 4DR2E 1VISA 1H74A 2NN6E 4P52A 4DR7E 2BA1D 1N33E 4X66E 2NN6B 5K36F 2WP8A 4OO1F 1H72C 2GO3A 4JI4I 4DR5I 3WU6A 1N32I 1EA6A 4LF5E 1NHHA 3CDJA 4LPFA 4YHHE 4LF9E 3M7ND 3CWVA 3KRNA 2DEIA 4IZKA 4IZJB 2CZ9A 2J7KA 2JEBA 4HACB 4LFCI 4IFDC 2BM0A 2V2VA 3U1YA 4AQYE 4JI3I 4FW6A 4JI1E 1R6LA 2AJ4A 3M6AA 5C0XF 2ZITA 2XEXA 4DV1I 4R1FA 4JYAI 5JEAE 2UU9I 5C0XB 1IBLE 4NXME 3HULA 4P7AA 3T1HI 2F4VE 2HKEA 4IFDD 1E3PA 4K0KI 1HNXE 5A2QQ 4DR2I 4MQYA 4PRVA 4ISAA 1R6MA 1XMOE 1NHIA 1IBLI 4LFBE 4IFDF 1UDSA 5EL9A 5JEAF 1Y4SA 5LMNI 3H1CA 4DV5I 1VI7A 3Q6MA 1HNZI 4LF9I 4OX9I 1MU5A 2C37A 4BA2B 4HACA 2AE8A 2CVEA 2VQEI 3ZZ0A 4DV0I 1OYSA 3M85D 2UXBE 4B3SI 4DPUA 4OO1D 3PS2A 2VQEE 1RREA 4HY1A 4JI0E 3OTOE 1NZ0A 4OO1C 2VQFE 5K36B 4GQUA 4NXNE 4OO1B 1Z0BA 3F0NA 1KKHA 1Z0CA 3L7ZB 3WU4A 2GO4A 3P3CA 2CG9A 4DV4E 1USUA 4PU9A 4BA1B 2GS8A 3ZKDA 3J80C 1ZXMA 4LCFA 4JI2E 3LTOA 3QT6A 4DUYI 4DV6I 1FNMA 2V2ZA 1OJ4A 3P3EA 4X64E 4LF5I 3PYEA 2UUCI 1XNRI 4USMA 1Y60A 1A6FA 4LFBI 4YY3E 1J5EE 4JI6E 1KVKA 2HK2A 2O1VA 5K36A 2IOQA 1E3HA 1D6TA 4FW4A 1IBME 2O1UA 1FKAE 4YY3I 2X7IA 1N32E 3HJCA 3J81C 1XNQE 4DR1E 3M85G 1OYPA 4URLA 4X62I 4OKGA 3J7AM 2PO2B 4B3TI 1K47A 5DNXA 5JEAD 3ZKBA 1XMQE 5LMUE 3D4JA 2ZM6I 1IBKI 3QT8A 2PO1A 4LF6I 4QNJA 5JEAC 5DRPA 3DD6A 4LFAI 1Z0EA 4DV3E 1USVA 5LMNE 2Q2EB 2V34A 4MYUA 5C0XA 4WUDA 2UUCE 1XNRE 2A2DA 3QT7A 3V5RA 2R42A 2Z5CA 2JE6A 1N36E 1H73A 2VQFI 4DUZI 4JI5E 3PYGA 1Z59A 2GQ0A 1I94I 2Z5EA 2F1DA 4DU8A 4JI5I 2PNMA 4LCGA 4DV6E 2PO2A 3GCMA 1HNZE 5C0XD 4USKA 4MDTA 4YHHI 2NN6A 4B3ME 4OO1E 4AQYI 4ED4A 5K36E 1B63A 1N0VC 5EKWA 4DR3I 4B3MI 4I3HA 1J5EI 4JI6I 4NXMI 1UDOA 3PYDA 4NBQA 2JE6B 4WUCA 4DPWA 1Y4UA 4IZJA 2JEAA 1ZM2A 2IOPA 1ELOA 2V2QA 4BA2A 4FWGA 4B3RI 2HFUA 4JI7E 2IESA 3P06A 2E5LE 1B62A 2HHHI 2X36A 4BA1A 1UEKA 3PYFA 3ZZUA 4PRXA 2EFGA 2UU9E 3Q1QA 4HYMA 4JI2I 4DPYA 2J65A 3PRYA 2VF3A 5C0XE 5IT9C 4AM3A 4OO1A 2PNZA 1Y5YA 4FW7A 4LF6E 5IT9Q 4MU4A 4DPTA 3GLLA 4DR6I 5ELWA 3UHMA 4DR4E 1FWLA 4ZVIA 1IBKE 4U3DA 4DV4I 2DEJA 1KIJA 2V8PA 2UUAI 2NN6C 1N33I 5JEAB 4UT4A 4DV7E 1Z0TA 1XNQI 2BA0D 1HNWE 4X62E 4LCHA 5DNLA 2WP8B 4DR3E 4DR5E 4B3SE 5BR8E 2HHHE 1WUUA 4LF8E 2HFSA 4KHPI 4JI0I 2HKJA 3NZKA 5L3JA 4DV3I 5C0XC 2BR2B 3K1JA 1OYRA 4IFDB 4LF8I 4RPFA 5LL6R 4IFDA 5JEAA 4AIMA 3K85A 3P76A 2E5LI 2O1WA 3J7AG 4J3DA 4X64I 2BV3A 4DR7I 4Z7YA 4GKKI 4DV7I 2C39B 2OI2A 2BM1A 3B8HA 4JG4A 2WW4A 5DRQA 3J81Q 4DR1I 1RHYA 2WNRA 4GKKE 5FWKA 1QZRA 1Z5AA 2LJPA 2Z5CB 1HR0E 2PO0B 2UXCE 3B78A 4MU3A 4KQVA 4NXNI 5K36C 4WUBA 1U2RA 2PNLA 2UXDE 1UDNA 5GMDA 3HKMA 1EI1A 3V2UC 1Z5BA 1YH8A 4HXZA 3B82A 1PVGA 5DROA 3JAMC 4AIDA 5DRRA 4LF4E 2UXDI 4EMDA 1UDQA 1Z0WA 1PIEA 4JV5E 1MG7A 1XMQI 2C39A 3P3GA 4LF4I 2O3ZA 3PS3A 5FLXQ 2VESA 4DXLA 5FLXC 4JV5I 1I94E 5A2QC 2NN6D 4FW3A 1H7UA 1IBMI 4MU0A 4KHPE 3GONA 1P42A 3T1HE 2F4VI 4X66I 2E1RA 4IS9A 1FI4A 1Z0GA 4FWDA 4IZJD 1HK7A 2PO1B 4N3OA 3K17A 3T1YI 1HR0I 2UXCI 1Z5CA 3LPSA 1H7SA 4OX9E 4LF7I 4FWHA 3ZM7A 1N34I 1RR9A 2WNRB 1XMOI 1DARA 3OTOI 4UTGA 2BA1G 4FN5A 4DU7A 4XTJA
chains in the Genus database with same CATH topology
5IWAE 2UUBI 4B3RE 4JI8E 1ZXNA 4DUZE 4JI3E 1NHJA 3WU5A 3JAMQ 4GKJI 4JI1I 2ZM6E 2UUBE 2CGEA 2UUAE 2O1TA 4JI8I 2HK3A 2UXBI 4LFAE 3Q6NA 2Z5BA 1HNXI 2Z5BB 4DR4I 4DUYE 1KTVA 5GMEA 3ZZTA 4Z7CA 1FJGI 1XHKA 1ZM9A 1N36I 4JI4E 4DV5E 4LF7E 1FJGE 1HNWI 3QT5A 4FW9A 1S16A 5LMUI 4K0KE 4MYTA 4DV2I 1Y6ZA 3H4LA 5IWAI 4JYAE 2A2CA 1Z0VA 4X65I 2NPFA 5BR8I 1ZM3A 4M1KA 4DV2E 1FWKA 2ZBKB 4LFCE 4X65E 1N0UA 1S4EA 1ZM4A 3LNUA 1PKPA 3WU3A 1N34E 1MX0A 4DV1E 2R3VA 4IZKB 4B3TE 4DV0E 3T1YE 4JI7I 4GKJE 1BKNA 4DR6E 3J80Q 4DPXA 4DR2E 1VISA 1H74A 4P52A 4DR7E 1N33E 4X66E 1H72C 4JI4I 4DR5I 3WU6A 1N32I 1EA6A 4LF5E 1NHHA 4YHHE 4LF9E 3CWVA 2DEIA 4IZKA 4IZJB 2CZ9A 2J7KA 4HACB 4LFCI 2BM0A 2V2VA 4AQYE 4JI3I 4JI1E 3M6AA 2AJ4A 2ZITA 2XEXA 4DV1I 4R1FA 4JYAI 2UU9I 1IBLE 4NXME 3HULA 4P7AA 3T1HI 2F4VE 2HKEA 4K0KI 1HNXE 5A2QQ 4DR2I 4PRVA 1XMOE 1NHIA 1IBLI 4LFBE 1Y4SA 5LMNI 4DV5I 1HNZI 3Q6MA 4OX9I 4LF9I 1MU5A 4HACA 2VQEI 3ZZ0A 4DV0I 2UXBE 4B3SI 4DPUA 2VQEE 1RREA 4HY1A 4JI0E 3OTOE 1NZ0A 2VQFE 4NXNE 1Z0BA 3F0NA 1KKHA 1Z0CA 3WU4A 2CG9A 4DV4E 1USUA 4PU9A 2GS8A 3ZKDA 3J80C 1ZXMA 4JI2E 3LTOA 3QT6A 4DUYI 4DV6I 1FNMA 2V2ZA 1OJ4A 4X64E 4LF5I 3PYEA 2UUCI 1XNRI 4USMA 1A6FA 4LFBI 4YY3E 1J5EE 4JI6E 1KVKA 2HK2A 2O1VA 2IOQA 1D6TA 1IBME 2O1UA 1FKAE 4YY3I 2X7IA 1N32E 3HJCA 3J81C 1XNQE 4DR1E 4URLA 4X62I 3J7AM 4B3TI 1K47A 3ZKBA 1XMQE 5LMUE 3D4JA 2ZM6I 1IBKI 3QT8A 4LF6I 4LFAI 1Z0EA 4DV3E 1USVA 5LMNE 2Q2EB 2V34A 4MYUA 4WUDA 2UUCE 1XNRE 2A2DA 3QT7A 3V5RA 2R42A 2Z5CA 1N36E 1H73A 2VQFI 4DUZI 4JI5E 3PYGA 1Z59A 2GQ0A 1I94I 2Z5EA 4DU8A 4JI5I 2PNMA 4DV6E 1HNZE 4USKA 4YHHI 4B3ME 4AQYI 4ED4A 1B63A 1N0VC 4B3MI 4DR3I 4I3HA 1J5EI 4JI6I 4NXMI 3PYDA 4WUCA 4DPWA 1Y4UA 4IZJA 1ZM2A 2IOPA 1ELOA 2V2QA 4FWGA 4B3RI 2HFUA 4JI7E 3P06A 2E5LE 1B62A 2HHHI 2X36A 1UEKA 3PYFA 3ZZUA 4PRXA 2EFGA 2UU9E 3Q1QA 4HYMA 4JI2I 4DPYA 3PRYA 2VF3A 5IT9C 4LF6E 5IT9Q 4DPTA 4DR6I 4DR4E 1FWLA 4ZVIA 1IBKE 4DV4I 2DEJA 1KIJA 2V8PA 2UUAI 1N33I 4UT4A 4DV7E 1Z0TA 1XNQI 1HNWE 4X62E 4DR3E 4DR5E 4B3SE 5BR8E 2HHHE 1WUUA 4LF8E 2HFSA 4KHPI 4JI0I 2HKJA 5L3JA 4DV3I 3K1JA 4LF8I 4RPFA 5LL6R 3K85A 2E5LI 2O1WA 3J7AG 4X64I 2BV3A 4DR7I 4Z7YA 4GKKI 4DV7I 2OI2A 2BM1A 3B8HA 4JG4A 2WW4A 3J81Q 4DR1I 4GKKE 5FWKA 1QZRA 1Z5AA 2LJPA 2Z5CB 1HR0E 2UXCE 3B78A 4KQVA 4NXNI 4WUBA 1U2RA 2PNLA 2UXDE 5GMDA 1EI1A 3V2UC 1Z5BA 4HXZA 3B82A 1PVGA 3JAMC 4LF4E 2UXDI 4EMDA 1Z0WA 1PIEA 4JV5E 1MG7A 1XMQI 4LF4I 5FLXQ 4DXLA 5FLXC 4JV5I 1I94E 5A2QC 1H7UA 1IBMI 4KHPE 3GONA 3T1HE 2F4VI 4X66I 2E1RA 1FI4A 1Z0GA 4FWDA 4IZJD 1HK7A 4N3OA 3K17A 3T1YI 1HR0I 2UXCI 1Z5CA 3LPSA 1H7SA 4OX9E 4LF7I 4FWHA 3ZM7A 1N34I 1RR9A 1XMOI 1DARA 3OTOI 4UTGA 4FN5A 4DU7A 4XTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA E;  2UUB I;  4B3R E;  4JI8 E;  1ZXN A;  4DUZ E;  4JI3 E;  1NHJ A;  3WU5 A;  3JAM Q;  4GKJ I;  4JI1 I;  2ZM6 E;  2UUB E;  2UUA E;  4JI8 I;  2HK3 A;  2UXB I;  4LFA E;  1HNX I;  4DR4 I;  4DUY E;  1KTV A;  5GME A;  3ZZT A;  4Z7C A;  1FJG I;  1XHK A;  1ZM9 A;  1N36 I;  4JI4 E;  4DV5 E;  4LF7 E;  1FJG E;  1HNW I;  3QT5 A;  4FW9 A;  1S16 A;  5LMU I;  4K0K E;  4MYT A;  4DV2 I;  3H4L A;  5IWA I;  4JYA E;  2A2C A;  1Z0V A;  4X65 I;  2NPF A;  5BR8 I;  1ZM3 A;  4M1K A;  4DV2 E;  1FWK A;  2ZBK B;  4LFC E;  4X65 E;  1N0U A;  1S4E A;  1ZM4 A;  3LNU A;  1PKP A;  3WU3 A;  1N34 E;  1MX0 A;  4DV1 E;  2R3V A;  4B3T E;  4DV0 E;  3T1Y E;  4JI7 I;  4GKJ E;  1BKN A;  4DR6 E;  3J80 Q;  4DPX A;  4DR2 E;  1VIS A;  1H74 A;  4P52 A;  4DR7 E;  1N33 E;  4X66 E;  1H72 C;  4JI4 I;  4DR5 I;  3WU6 A;  1N32 I;  1EA6 A;  4LF5 E;  1NHH A;  4YHH E;  4LF9 E;  3CWV A;  2DEI A;  2CZ9 A;  2J7K A;  4HAC B;  4LFC I;  2BM0 A;  2V2V A;  4AQY E;  4JI3 I;  4JI1 E;  3M6A A;  2AJ4 A;  2ZIT A;  2XEX A;  4DV1 I;  4R1F A;  4JYA I;  2UU9 I;  1IBL E;  4NXM E;  3HUL A;  4P7A A;  3T1H I;  2F4V E;  2HKE A;  4K0K I;  1HNX E;  5A2Q Q;  4DR2 I;  4PRV A;  1XMO E;  1NHI A;  1IBL I;  4LFB E;  5LMN I;  4DV5 I;  1HNZ I;  4OX9 I;  4LF9 I;  1MU5 A;  4HAC A;  2VQE I;  3ZZ0 A;  4DV0 I;  2UXB E;  4B3S I;  4DPU A;  2VQE E;  1RRE A;  4HY1 A;  4JI0 E;  3OTO E;  1NZ0 A;  2VQF E;  4NXN E;  1Z0B A;  3F0N A;  1KKH A;  1Z0C A;  3WU4 A;  4DV4 E;  4PU9 A;  2GS8 A;  3ZKD A;  3J80 C;  1ZXM A;  4JI2 E;  3LTO A;  3QT6 A;  4DUY I;  4DV6 I;  1FNM A;  2V2Z A;  4LF5 I;  1OJ4 A;  4X64 E;  3PYE A;  2UUC I;  1XNR I;  4USM A;  1A6F A;  4LFB I;  4YY3 E;  1J5E E;  4JI6 E;  1KVK A;  2HK2 A;  1D6T A;  1IBM E;  1FKA E;  4YY3 I;  2X7I A;  1N32 E;  3J81 C;  1XNQ E;  4DR1 E;  4URL A;  4X62 I;  3J7A M;  4B3T I;  1K47 A;  3ZKB A;  1XMQ E;  5LMU E;  3D4J A;  2ZM6 I;  1IBK I;  3QT8 A;  4LF6 I;  4LFA I;  1Z0E A;  4DV3 E;  5LMN E;  2Q2E B;  2V34 A;  4MYU A;  4WUD A;  2UUC E;  1XNR E;  2A2D A;  3QT7 A;  3V5R A;  2R42 A;  1N36 E;  1H73 A;  2VQF I;  4DUZ I;  4JI5 E;  3PYG A;  1Z59 A;  1I94 I;  4DU8 A;  4JI5 I;  4DV6 E;  1HNZ E;  4USK A;  4YHH I;  4B3M E;  4AQY I;  4ED4 A;  1B63 A;  1N0V C;  4B3M I;  4DR3 I;  4I3H A;  1J5E I;  4NXM I;  4JI6 I;  3PYD A;  4WUC A;  4DPW A;  1ZM2 A;  1ELO A;  2V2Q A;  4FWG A;  4B3R I;  2HFU A;  4JI7 E;  2E5L E;  1B62 A;  2HHH I;  2X36 A;  1UEK A;  3PYF A;  3ZZU A;  4PRX A;  2EFG A;  2UU9 E;  3Q1Q A;  4HYM A;  4JI2 I;  4DPY A;  2VF3 A;  5IT9 C;  4LF6 E;  5IT9 Q;  4DPT A;  4DR6 I;  4DR4 E;  1FWL A;  4ZVI A;  1IBK E;  4DV4 I;  2DEJ A;  1KIJ A;  2V8P A;  2UUA I;  1N33 I;  4UT4 A;  4DV7 E;  1Z0T A;  1XNQ I;  1HNW E;  4X62 E;  4DR3 E;  4DR5 E;  4B3S E;  5BR8 E;  2HHH E;  1WUU A;  4LF8 E;  2HFS A;  4KHP I;  4JI0 I;  2HKJ A;  5L3J A;  4DV3 I;  3K1J A;  4LF8 I;  4RPF A;  5LL6 R;  2E5L I;  3J7A G;  4X64 I;  2BV3 A;  4DR7 I;  4Z7Y A;  4GKK I;  4DV7 I;  2OI2 A;  2BM1 A;  3B8H A;  4JG4 A;  2WW4 A;  3J81 Q;  4DR1 I;  4GKK E;  1QZR A;  1Z5A A;  2LJP A;  1HR0 E;  2UXC E;  3B78 A;  4KQV A;  4NXN I;  4WUB A;  1U2R A;  2UXD E;  5GMD A;  1EI1 A;  3V2U C;  1Z5B A;  4HXZ A;  3B82 A;  1PVG A;  3JAM C;  4LF4 E;  2UXD I;  4EMD A;  1Z0W A;  1PIE A;  4JV5 E;  1MG7 A;  1XMQ I;  4LF4 I;  5FLX Q;  4DXL A;  5FLX C;  4JV5 I;  1I94 E;  5A2Q C;  1H7U A;  1IBM I;  4KHP E;  3GON A;  3T1H E;  2F4V I;  4X66 I;  2E1R A;  1FI4 A;  1Z0G A;  4FWD A;  3K17 A;  3T1Y I;  1HR0 I;  2UXC I;  1Z5C A;  3LPS A;  1H7S A;  4OX9 E;  4LF7 I;  4FWH A;  3ZM7 A;  1N34 I;  1RR9 A;  1XMO I;  1DAR A;  3OTO I;  4UTG A;  4FN5 A;  4DU7 A;  4XTJ A; 
#chains in the Genus database with same CATH topology
 3CDI A;  2BR2 A;  5IWA E;  2UUB I;  4B3R E;  4JI8 E;  1ZXN A;  4U3B A;  4DUZ E;  4JI3 E;  1NHJ A;  3WU5 A;  3JAM Q;  4GKJ I;  2JEB B;  2C38 B;  4JI1 I;  2JT2 A;  2ZM6 E;  2UUB E;  4OZE A;  4IFD E;  2CGE A;  2UUA E;  2O1T A;  4JI8 I;  2HK3 A;  2UXB I;  4LFA E;  3Q6N A;  2Z5B A;  1HNX I;  2Z5B B;  4DR4 I;  4DUY E;  1KTV A;  5GME A;  3ZZT A;  4Z7C A;  1FJG I;  1XHK A;  1ZM9 A;  3U1K A;  2NN6 F;  1N36 I;  2PO0 A;  4LOM A;  4MU1 A;  2PNZ B;  4JI4 E;  4DV5 E;  2IER A;  2BA0 G;  4LF7 E;  3GME A;  1FJG E;  1HNW I;  3PS1 A;  3QT5 A;  2JEA B;  4FW9 A;  1S16 A;  2C38 A;  5LMU I;  4K0K E;  4MYT A;  4DV2 I;  1Y6Z A;  3H4L A;  2C37 B;  5IWA I;  5K36 D;  4JYA E;  2A2C A;  1Z0V A;  4X65 I;  2NPF A;  5BR8 I;  1ZM3 A;  3B4T A;  4M1K A;  4DV2 E;  1FWK A;  3M7N G;  2ZBK B;  4FW5 A;  4LFC E;  4X65 E;  1N0U A;  1XXE A;  1S4E A;  1YHC A;  1ZM4 A;  3LNU A;  1PKP A;  3WU3 A;  4QNK A;  1N34 E;  1MX0 A;  4DV1 E;  2R3V A;  4IZK B;  4B3T E;  4DV0 E;  3T1Y E;  4JI7 I;  3L7Z A;  4GKJ E;  1BKN A;  4DR6 E;  3J80 Q;  4DPX A;  4DR2 E;  1VIS A;  1H74 A;  2NN6 E;  4P52 A;  4DR7 E;  2BA1 D;  1N33 E;  4X66 E;  2NN6 B;  5K36 F;  2WP8 A;  4OO1 F;  1H72 C;  2GO3 A;  4JI4 I;  4DR5 I;  3WU6 A;  1N32 I;  1EA6 A;  4LF5 E;  1NHH A;  3CDJ A;  4LPF A;  4YHH E;  4LF9 E;  3M7N D;  3CWV A;  3KRN A;  2DEI A;  4IZK A;  4IZJ B;  2CZ9 A;  2J7K A;  2JEB A;  4HAC B;  4LFC I;  4IFD C;  2BM0 A;  2V2V A;  3U1Y A;  4AQY E;  4JI3 I;  4FW6 A;  4JI1 E;  1R6L A;  2AJ4 A;  3M6A A;  5C0X F;  2ZIT A;  2XEX A;  4DV1 I;  4R1F A;  4JYA I;  5JEA E;  2UU9 I;  5C0X B;  1IBL E;  4NXM E;  3HUL A;  4P7A A;  3T1H I;  2F4V E;  2HKE A;  4IFD D;  1E3P A;  4K0K I;  1HNX E;  5A2Q Q;  4DR2 I;  4MQY A;  4PRV A;  4ISA A;  1R6M A;  1XMO E;  1NHI A;  1IBL I;  4LFB E;  4IFD F;  1UDS A;  5EL9 A;  5JEA F;  1Y4S A;  5LMN I;  3H1C A;  4DV5 I;  1VI7 A;  3Q6M A;  1HNZ I;  4LF9 I;  4OX9 I;  1MU5 A;  2C37 A;  4BA2 B;  4HAC A;  2AE8 A;  2CVE A;  2VQE I;  3ZZ0 A;  4DV0 I;  1OYS A;  3M85 D;  2UXB E;  4B3S I;  4DPU A;  4OO1 D;  3PS2 A;  2VQE E;  1RRE A;  4HY1 A;  4JI0 E;  3OTO E;  1NZ0 A;  4OO1 C;  2VQF E;  5K36 B;  4GQU A;  4NXN E;  4OO1 B;  1Z0B A;  3F0N A;  1KKH A;  1Z0C A;  3L7Z B;  3WU4 A;  2GO4 A;  3P3C A;  2CG9 A;  4DV4 E;  1USU A;  4PU9 A;  4BA1 B;  2GS8 A;  3ZKD A;  3J80 C;  1ZXM A;  4LCF A;  4JI2 E;  3LTO A;  3QT6 A;  4DUY I;  4DV6 I;  1FNM A;  2V2Z A;  1OJ4 A;  3P3E A;  4X64 E;  4LF5 I;  3PYE A;  2UUC I;  1XNR I;  4USM A;  1Y60 A;  1A6F A;  4LFB I;  4YY3 E;  1J5E E;  4JI6 E;  1KVK A;  2HK2 A;  2O1V A;  5K36 A;  2IOQ A;  1E3H A;  1D6T A;  4FW4 A;  1IBM E;  2O1U A;  1FKA E;  4YY3 I;  2X7I A;  1N32 E;  3HJC A;  3J81 C;  1XNQ E;  4DR1 E;  3M85 G;  1OYP A;  4URL A;  4X62 I;  4OKG A;  3J7A M;  2PO2 B;  4B3T I;  1K47 A;  5DNX A;  5JEA D;  3ZKB A;  1XMQ E;  5LMU E;  3D4J A;  2ZM6 I;  1IBK I;  3QT8 A;  2PO1 A;  4LF6 I;  4QNJ A;  5JEA C;  5DRP A;  3DD6 A;  4LFA I;  1Z0E A;  4DV3 E;  1USV A;  5LMN E;  2Q2E B;  2V34 A;  4MYU A;  5C0X A;  4WUD A;  2UUC E;  1XNR E;  2A2D A;  3QT7 A;  3V5R A;  2R42 A;  2Z5C A;  2JE6 A;  1N36 E;  1H73 A;  2VQF I;  4DUZ I;  4JI5 E;  3PYG A;  1Z59 A;  2GQ0 A;  1I94 I;  2Z5E A;  2F1D A;  4DU8 A;  4JI5 I;  2PNM A;  4LCG A;  4DV6 E;  2PO2 A;  3GCM A;  1HNZ E;  5C0X D;  4USK A;  4MDT A;  4YHH I;  2NN6 A;  4B3M E;  4OO1 E;  4AQY I;  4ED4 A;  5K36 E;  1B63 A;  1N0V C;  5EKW A;  4DR3 I;  4B3M I;  4I3H A;  1J5E I;  4JI6 I;  4NXM I;  1UDO A;  3PYD A;  4NBQ A;  2JE6 B;  4WUC A;  4DPW A;  1Y4U A;  4IZJ A;  2JEA A;  1ZM2 A;  2IOP A;  1ELO A;  2V2Q A;  4BA2 A;  4FWG A;  4B3R I;  2HFU A;  4JI7 E;  2IES A;  3P06 A;  2E5L E;  1B62 A;  2HHH I;  2X36 A;  4BA1 A;  1UEK A;  3PYF A;  3ZZU A;  4PRX A;  2EFG A;  2UU9 E;  3Q1Q A;  4HYM A;  4JI2 I;  4DPY A;  2J65 A;  3PRY A;  2VF3 A;  5C0X E;  5IT9 C;  4AM3 A;  4OO1 A;  2PNZ A;  1Y5Y A;  4FW7 A;  4LF6 E;  5IT9 Q;  4MU4 A;  4DPT A;  3GLL A;  4DR6 I;  5ELW A;  3UHM A;  4DR4 E;  1FWL A;  4ZVI A;  1IBK E;  4U3D A;  4DV4 I;  2DEJ A;  1KIJ A;  2V8P A;  2UUA I;  2NN6 C;  1N33 I;  5JEA B;  4UT4 A;  4DV7 E;  1Z0T A;  1XNQ I;  2BA0 D;  1HNW E;  4X62 E;  4LCH A;  5DNL A;  2WP8 B;  4DR3 E;  4DR5 E;  4B3S E;  5BR8 E;  2HHH E;  1WUU A;  4LF8 E;  2HFS A;  4KHP I;  4JI0 I;  2HKJ A;  3NZK A;  5L3J A;  4DV3 I;  5C0X C;  2BR2 B;  3K1J A;  1OYR A;  4IFD B;  4LF8 I;  4RPF A;  5LL6 R;  4IFD A;  5JEA A;  4AIM A;  3K85 A;  3P76 A;  2E5L I;  2O1W A;  3J7A G;  4J3D A;  4X64 I;  2BV3 A;  4DR7 I;  4Z7Y A;  4GKK I;  4DV7 I;  2C39 B;  2OI2 A;  2BM1 A;  3B8H A;  4JG4 A;  2WW4 A;  5DRQ A;  3J81 Q;  4DR1 I;  1RHY A;  2WNR A;  4GKK E;  5FWK A;  1QZR A;  1Z5A A;  2LJP A;  2Z5C B;  1HR0 E;  2PO0 B;  2UXC E;  3B78 A;  4MU3 A;  4KQV A;  4NXN I;  5K36 C;  4WUB A;  1U2R A;  2PNL A;  2UXD E;  1UDN A;  5GMD A;  3HKM A;  1EI1 A;  3V2U C;  1Z5B A;  1YH8 A;  4HXZ A;  3B82 A;  1PVG A;  5DRO A;  3JAM C;  4AID A;  5DRR A;  4LF4 E;  2UXD I;  4EMD A;  1UDQ A;  1Z0W A;  1PIE A;  4JV5 E;  1MG7 A;  1XMQ I;  2C39 A;  3P3G A;  4LF4 I;  2O3Z A;  3PS3 A;  5FLX Q;  2VES A;  4DXL A;  5FLX C;  4JV5 I;  1I94 E;  5A2Q C;  2NN6 D;  4FW3 A;  1H7U A;  1IBM I;  4MU0 A;  4KHP E;  3GON A;  1P42 A;  3T1H E;  2F4V I;  4X66 I;  2E1R A;  4IS9 A;  1FI4 A;  1Z0G A;  4FWD A;  4IZJ D;  1HK7 A;  2PO1 B;  4N3O A;  3K17 A;  3T1Y I;  1HR0 I;  2UXC I;  1Z5C A;  3LPS A;  1H7S A;  4OX9 E;  4LF7 I;  4FWH A;  3ZM7 A;  1N34 I;  1RR9 A;  2WNR B;  1XMO I;  1DAR A;  3OTO I;  4UTG A;  2BA1 G;  4FN5 A;  4DU7 A;  4XTJ A; 
#chains in the Genus database with same CATH homology
 5IWA E;  2UUB I;  4B3R E;  4JI8 E;  1ZXN A;  4DUZ E;  4JI3 E;  1NHJ A;  3WU5 A;  3JAM Q;  4GKJ I;  4JI1 I;  2ZM6 E;  2UUB E;  2CGE A;  2UUA E;  2O1T A;  4JI8 I;  2HK3 A;  2UXB I;  4LFA E;  3Q6N A;  2Z5B A;  1HNX I;  2Z5B B;  4DR4 I;  4DUY E;  1KTV A;  5GME A;  3ZZT A;  4Z7C A;  1FJG I;  1XHK A;  1ZM9 A;  1N36 I;  4JI4 E;  4DV5 E;  4LF7 E;  1FJG E;  1HNW I;  3QT5 A;  4FW9 A;  1S16 A;  5LMU I;  4K0K E;  4MYT A;  4DV2 I;  1Y6Z A;  3H4L A;  5IWA I;  4JYA E;  2A2C A;  1Z0V A;  4X65 I;  2NPF A;  5BR8 I;  1ZM3 A;  4M1K A;  4DV2 E;  1FWK A;  2ZBK B;  4LFC E;  4X65 E;  1N0U A;  1S4E A;  1ZM4 A;  3LNU A;  1PKP A;  3WU3 A;  1N34 E;  1MX0 A;  4DV1 E;  2R3V A;  4IZK B;  4B3T E;  4DV0 E;  3T1Y E;  4JI7 I;  4GKJ E;  1BKN A;  4DR6 E;  3J80 Q;  4DPX A;  4DR2 E;  1VIS A;  1H74 A;  4P52 A;  4DR7 E;  1N33 E;  4X66 E;  1H72 C;  4JI4 I;  4DR5 I;  3WU6 A;  1N32 I;  1EA6 A;  4LF5 E;  1NHH A;  4YHH E;  4LF9 E;  3CWV A;  2DEI A;  4IZK A;  4IZJ B;  2CZ9 A;  2J7K A;  4HAC B;  4LFC I;  2BM0 A;  2V2V A;  4AQY E;  4JI3 I;  4JI1 E;  3M6A A;  2AJ4 A;  2ZIT A;  2XEX A;  4DV1 I;  4R1F A;  4JYA I;  2UU9 I;  1IBL E;  4NXM E;  3HUL A;  4P7A A;  3T1H I;  2F4V E;  2HKE A;  4K0K I;  1HNX E;  5A2Q Q;  4DR2 I;  4PRV A;  1XMO E;  1NHI A;  1IBL I;  4LFB E;  1Y4S A;  5LMN I;  4DV5 I;  1HNZ I;  3Q6M A;  4OX9 I;  4LF9 I;  1MU5 A;  4HAC A;  2VQE I;  3ZZ0 A;  4DV0 I;  2UXB E;  4B3S I;  4DPU A;  2VQE E;  1RRE A;  4HY1 A;  4JI0 E;  3OTO E;  1NZ0 A;  2VQF E;  4NXN E;  1Z0B A;  3F0N A;  1KKH A;  1Z0C A;  3WU4 A;  2CG9 A;  4DV4 E;  1USU A;  4PU9 A;  2GS8 A;  3ZKD A;  3J80 C;  1ZXM A;  4JI2 E;  3LTO A;  3QT6 A;  4DUY I;  4DV6 I;  1FNM A;  2V2Z A;  1OJ4 A;  4X64 E;  4LF5 I;  3PYE A;  2UUC I;  1XNR I;  4USM A;  1A6F A;  4LFB I;  4YY3 E;  1J5E E;  4JI6 E;  1KVK A;  2HK2 A;  2O1V A;  2IOQ A;  1D6T A;  1IBM E;  2O1U A;  1FKA E;  4YY3 I;  2X7I A;  1N32 E;  3HJC A;  3J81 C;  1XNQ E;  4DR1 E;  4URL A;  4X62 I;  3J7A M;  4B3T I;  1K47 A;  3ZKB A;  1XMQ E;  5LMU E;  3D4J A;  2ZM6 I;  1IBK I;  3QT8 A;  4LF6 I;  4LFA I;  1Z0E A;  4DV3 E;  1USV A;  5LMN E;  2Q2E B;  2V34 A;  4MYU A;  4WUD A;  2UUC E;  1XNR E;  2A2D A;  3QT7 A;  3V5R A;  2R42 A;  2Z5C A;  1N36 E;  1H73 A;  2VQF I;  4DUZ I;  4JI5 E;  3PYG A;  1Z59 A;  2GQ0 A;  1I94 I;  2Z5E A;  4DU8 A;  4JI5 I;  2PNM A;  4DV6 E;  1HNZ E;  4USK A;  4YHH I;  4B3M E;  4AQY I;  4ED4 A;  1B63 A;  1N0V C;  4B3M I;  4DR3 I;  4I3H A;  1J5E I;  4JI6 I;  4NXM I;  3PYD A;  4WUC A;  4DPW A;  1Y4U A;  4IZJ A;  1ZM2 A;  2IOP A;  1ELO A;  2V2Q A;  4FWG A;  4B3R I;  2HFU A;  4JI7 E;  3P06 A;  2E5L E;  1B62 A;  2HHH I;  2X36 A;  1UEK A;  3PYF A;  3ZZU A;  4PRX A;  2EFG A;  2UU9 E;  3Q1Q A;  4HYM A;  4JI2 I;  4DPY A;  3PRY A;  2VF3 A;  5IT9 C;  4LF6 E;  5IT9 Q;  4DPT A;  4DR6 I;  4DR4 E;  1FWL A;  4ZVI A;  1IBK E;  4DV4 I;  2DEJ A;  1KIJ A;  2V8P A;  2UUA I;  1N33 I;  4UT4 A;  4DV7 E;  1Z0T A;  1XNQ I;  1HNW E;  4X62 E;  4DR3 E;  4DR5 E;  4B3S E;  5BR8 E;  2HHH E;  1WUU A;  4LF8 E;  2HFS A;  4KHP I;  4JI0 I;  2HKJ A;  5L3J A;  4DV3 I;  3K1J A;  4LF8 I;  4RPF A;  5LL6 R;  3K85 A;  2E5L I;  2O1W A;  3J7A G;  4X64 I;  2BV3 A;  4DR7 I;  4Z7Y A;  4GKK I;  4DV7 I;  2OI2 A;  2BM1 A;  3B8H A;  4JG4 A;  2WW4 A;  3J81 Q;  4DR1 I;  4GKK E;  5FWK A;  1QZR A;  1Z5A A;  2LJP A;  2Z5C B;  1HR0 E;  2UXC E;  3B78 A;  4KQV A;  4NXN I;  4WUB A;  1U2R A;  2PNL A;  2UXD E;  5GMD A;  1EI1 A;  3V2U C;  1Z5B A;  4HXZ A;  3B82 A;  1PVG A;  3JAM C;  4LF4 E;  2UXD I;  4EMD A;  1Z0W A;  1PIE A;  4JV5 E;  1MG7 A;  1XMQ I;  4LF4 I;  5FLX Q;  4DXL A;  5FLX C;  4JV5 I;  1I94 E;  5A2Q C;  1H7U A;  1IBM I;  4KHP E;  3GON A;  3T1H E;  2F4V I;  4X66 I;  2E1R A;  1FI4 A;  1Z0G A;  4FWD A;  4IZJ D;  1HK7 A;  4N3O A;  3K17 A;  3T1Y I;  1HR0 I;  2UXC I;  1Z5C A;  3LPS A;  1H7S A;  4OX9 E;  4LF7 I;  4FWH A;  3ZM7 A;  1N34 I;  1RR9 A;  1XMO I;  1DAR A;  3OTO I;  4UTG A;  4FN5 A;  4DU7 A;  4XTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...