4X65O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x65O00
1HR0O 4X64O 4DV7O 2JRIA 1N33O 1N32O 4LF9O 3R66A 4YY3O 4DUZO 5LMNO 4OX9O 4OPHA 1YZBA 4DR4O 2FKXA 3T1HO 4LF6O 4DUYO 4DV3O 1HNXO 4NXMO 4A5UB 5BXZA 4JV5O 2UXBO 3SDLA 5FLXN 3F5TA 3T1YO 1AILA 5LMUO 2UUBO 1R1BA 4DR6O 2UU9O 4DV2O 3OTOO 4JI0O 4DV0O 4DR2O 5A2QN 4B3SO 2HHHO 4X65O 4B3MO 2LW7A 4OPAA 4K0KO 1FJGO 4JI7O 1N34O 4JI1O 4DR5O 1HNWO 2VQFO 4YHHO 1G1XB 2N74A 4DR7O 1XNQO 2UUCO 2F4VO 4B3RO 2UUAO 2E5LO 5LL6Y 1IBMO 4JI3O 4DV6O 4KHPO 4LF8O 1AB3A 1J5EO 2VQEO 1A32A 3M8AA 4DR3O 3JAMN 1XMQO 1FYJA 4GKJO 1KUQA 2Z0AA 4B3TO 2UXDO 1DK1A 1I94O 1NS1A 1XEQA 3RT3C 4DV1O 4GKKO 2DOSA 4DV5O 5H5NA 3J7AU 2AGAA 4JI6O 4JYAO 3J81N 4X62O 4LF5O 5IWAO 5IT9N 4DV4O 4DR1O 4JI2O 4AQYO 4LFAO 1F7YA 4LF7O 4LF4O 1FKAO 5BR8O 4LFCO 4JI5O 3J80N 4NXNO 1N36O 2UXCO 1X59A 1XNRO 4X66O 4LFBO 1IBLO 2ZKOA 2ZM6O 4JI8O 4JI4O 1HNZO 1XMOO 1IBKO 3O65A 5BY1A 1D2DA 2DJVA 1R6TA
chains in the Genus database with same CATH superfamily
4D6TH 2EIMB 3CCUV 4J7JA 3SGIA 1D5NA 2EZOA 1JA8A 1Q82W 2QGNA 2UUCB 2GBOA 2OTLV 1N0JA 1QR9A 2UXXA 2HHHB 1V9PA 3EHBB 4LF6O 4TWKA 4E2LA 4NXMO 2CTWA 5JVDA 2VS0A 3OEHG 3QO7A 5KMGB 3AG7A 2NNUA 4L87A 2IH1C 3ML0A 1BT8A 4JI0O 3ZIAG 4OXSA 2PUSA 5LMUB 3RBZA 4MTXA 5C8YA 4JI8B 2JVDA 2ZXWC 1ZAUA 1YVWA 4G28B 1AJPA 5GONA 1KB9F 1RFYA 2OIEA 2EIMC 3LDDA 2GSMB 5LL6Y 3K79A 4EEQA 5K1PA 4RUFA 1I94B 4KHPO 1Y74A 3HPLC 1BGYH 4TQFA 2UXBB 2CTQA 2DWEC 4LF8B 1K34A 1OCZB 3LSQA 2GUZB 2UXDO 2CK3G 1TUBA 4DV6B 1BMFG 4PHZA 3ZRXA 3WFVA 2W0XA 4FVMA 3L74H 3D8CA 2DYSB 4ZKIA 3UQ8A 3CJHB 1K92A 2A9HA 3UT5A 1YTFB 4OX9B 1XQ8A 1Y76B 3PN1A 4GZRB 2AZ0A 1L8DA 1V54B 2X6BA 1W59A 5BR8O 2Q69A 1ROPA 4NXNO 3JAWA 3TCUA 2D3OW 1H8HG 1XNRO 1XOUA 4BWAA 2GHYA 3CCEV 2M7WA 1B3QA 2W6IG 4XDJA 1W0KG 1EFRG 4LF7B 4O2AA 1EZJA 2WAMA 3JALB 4JI4B 2PTMA 4LNUA 3OM3B 4FM2A 4O4IB 1K8AW 2X7RB 4I4TA 1VF5B 1YEWA 3ZRVA 3E86A 2VWJA 5CB4B 4WFGA 1G4YB 1R6KA 5FLXN 3FFQA 2KQXA 5LMUO 4FZ0A 1FD9A 3B4SA 2XAGA 5KAFZ 1TA8A 4DR2O 4MVOA 3HKCA 4UVBA 2YIBA 2XOKG 1YI2V 2LO1A 3NXSA 2LW1A 3ASNB 4TQDA 2QWNB 4WF9V 2VQFO 2WLHA 3RYIB 2DWDC 4TUYA 4MTOA 1ZL8B 2BOBC 3TETA 5EBMC 4CS3A 1BCCH 5L3EA 3T1CA 1YJ9V 3IC7A 1KYOF 5EZYA 5F2VO 1G8MA 1AB3A 4FMTA 5LYJB 1UJWB 4I0XA 1XMQO 1QR8A 2ZDIA 4DV4B 1PL4A 3OTOB 3ZMTA 2IU3A 4XDKA 1YXBA 3AG1C 4YY3B 1YITV 2PY5A 1W2BU 1IXMA 5H5NA 1NTZH 2ATKC 4EB6B 2VQEB 2JGDB 4YJ3A 2PF4E 5JCOC 5IWAO 5KA6A 2ZQMA 2WLKA 3KKYA 3ZJZA 5B1NA 3GB7C 4NKGB 3DC5A 5KMGA 2KG7A 3ABUA 2JJ1G 1F4NA 1N34B 3STZC 3SR2C 4I5SA 4UUJC 1AR1B 4ZHQB 2OCHA 4NVPA 5K1XA 1K5QA 1QU7A 2R72A 2IJIA 1O9GA 5EIBC 5GONB 1K4DC 3TJTA 4NYKA 4B3SB 4B7EA 2CDYA 4JYAB 1AJQA 2Y0PA 3JAKA 2P67A 2A06H 3JD0A 2UXNA 2RN9A 4J9YB 3E8HA 5FL7G 1AR4A 3E83A 1MOFA 4P2ZA 4IL6Z 3G4SV 1XHZA 1KMIZ 3B8NA 1SQPH 3AK2A 4K8ZA 1FJGO 2MK3A 2Q73A 4LBEC 4YHHO 4WFHA 3WG7C 1S0VA 1M93A 1IDSA 2OIGA 2ZR3A 2N05A 1DF5A 1E1QG 3H01A 4DXWA 3JAWB 4LFBB 3KCXA 2ZM6B 5CA1A 3JASB 3OW2U 4O4LB 1XREA 4QPKA 2XTAA 4LFCB 3ETDA 4N21A 3SPHA 3CS5A 4I55A 3J7AU 2AGAA 4MVZA 1WP7A 4I7ZB 4X20B 2BOCC 1Q90D 4AHCA 4X1IA 1B6QA 1FS0G 1F51A 1W0JG 2QKAA 2UUBB 3T4ZA 1M57B 3ZHTA 3E8GA 3ZHVA 1QQCA 2ITDC 3SJBC 1R3JC 2QM4A 2FMLA 4GCZA 3SJQC 5LXTB 1KBHA 2P5OA 2WA3A 4Z2WA 5KX5B 2Z5UA 3HKCB 1DLBA 1SESA 1H2LA 3LUTB 3SYQA 3BA9A 4TUYB 1J5EB 3AG3B 1VF6C 3UO2A 1AROP 4F6RB 5BXZA 2UXBO 1LNQA 3BAAA 4HYOA 1NR7A 4DR7B 2QWQB 3K0GA 4JV5B 1R3LC 1FXVA 5EC2C 3D3QA 3CCRV 4J10A 2M6YA 1MG1A 3SYCA 3WB2A 4JI1O 4TOIA 2EZPA 4DR5O 3RVZA 1Y66A 4RWUA 3LNNA 3F5WC 3ZMZA 1GN4A 1Q6IA 1ZLZA 2AW9A 5LHHA 4RQEA 3Q4HB 4EKWA 3H1LH 3OGCC 1JQ0A 5DECA 1H2GA 4CH3A 3C3SA 4DUYB 1KUQA 3ZRWB 1HW7A 3I55V 1I94O 2ZINA 4HNAB 2EIKC 2DN9A 3UT5B 3K5LA 3MHSC 3K08A 4MVSA 2ARHA 2G38A 1WP8A 3DXRA 4AI8A 4MVUA 1F7YA 1OHHG 3JSLA 3QO8A 3B09A 2H3OA 5IJ9A 3CXCU 2RCVA 4JI5O 1WLEA 4IGGA 4RUEA 1Q7YW 3H1HH 3IJ4A 1EN4A 3IAYA 3OE7G 1R3IC 3E35A 1L0NH 1LR1A 1RP3B 1NQTA 2XAFA 1FFXB 4FFBA 4H33A 4R50A 2JEXA 4NTXA 4LNUB 1AP6A 3CCVV 3OGIB 4FLXA 1BHAA 1NBMG 4X1KA 3RN4A 4I4TB 4CS2A 1GKFA 1B06A 2CH7B 3ABLB 1GRJA 3K06A 5B66Z 2A3QA 4UVCA 5E1AC 4DUYO 3ZHRA 4FM1A 2F66C 2QM7A 3FAVA 4D7TA 1RPOA 2F4VB 3FB6C 1KKCA 2JS3A 3CP1A 2BTOA 2WA4A 4J41A 2EINB 4ZI7A 1AI6A 5A2QN 4FLUA 3G71V 4WFEA 1OCCB 4OPAA 4B3MO 3K5NA 3UM7A 4JI7O 1N34O 3LSSA 1SC5B 4LF9B 3TXQA 4B3RO 2H94A 1K4CC 1G6UA 4XBFA 3BCCH 3ZMUA 1VARA 4X1IB 3CB2A 5LYJA 5L3CA 3JCZA 2HR3A 1FFTB 1US6A 4JI5B 3ZCCA 2YEVB 4B3TB 3HKBA 3N2GA 3ZRSA 1S72V 3EXAA 4DO2A 4IHJB 4RO2A 4DW1A 3OT7A 5JQGA 1VP7A 4U3JA 5LXTA 3CRCA 3CCQV 2OTJV 1XILA 1OJHA 1D5AA 3SYOA 1AVMA 4DR6B 2AZ2A 2PI4A 1JJ2U 1BL8A 1EBOA 5GTHZ 2DW4A 5DEDA 1GO3F 4JYAO 4X62O 1JFFA 1P7BA 1SZXA 2E74B 1QNMA 1SQXH 4MW8A 1BQ0A 2L6LA 1N36O 2UXCO 3B77A 1X59A 2Y48A 4J9ZB 2B9ZA 1WPBA 3D36A 5IE9A 1SA0A 4G2KA 4YJ2B 4PA6A 2WLLA 3ETGA 5JWPA 2EJ7A 4DV5B 2BSKA 1AI7A 4X64O 3X2QC 2JRIA 3AEIA 4BIZA 2XAHA 3OUFA 2WLJA 4AILC 4ICGA 3VOUA 3VQYA 2H8PC 1HR0B 4OX9O 5J2UB 4J7KA 3KG2A 3WB1A 1TVKB 3MDSA 4JV5O 2QA4V 3OFNG 1Q8IA 4U3FH 3OTOO 3CXHF 4J42A 1UFIA 2UXDB 1URFA 1F4MA 1T5EA 1Q3EA 5LA6B 3K9AA 2XUMA 3EVKA 2N04A 4E4EA 5GW7A 2QDOA 5KUKA 2WLMA 1FXKB 3CRMA 4PV1B 2Y4UA 4ABMA 3DXRB 2UUAO 5B3SC 1MA1A 2Q68A 4QJFB 1ORQC 2XHBA 1WA8B 1DTOA 3ABKB 1PD3A 4PDLA 1BE3H 1QLNA 1H8EG 5FNVB 4I9WA 3T2MA 1M56C 4DV1O 2GUZA 2P90A 4PI0A 2ZDIC 3BHPA 2QWPB 1GN3A 3RYCB 5BZBA 2RDCA 5CA0A 1GN2A 2XASA 3ZEDA 3S3XA 1FKAO 3K0DA 1JOYA 1AI4A 1XUQA 3WB0A 1Z5WA 2XNDG 1VQNV 4PI2A 4LFBO 4ZIBA 1XMQB 5CA3A 1GN6A 1V55C 5LHIA 4JI8O 4FLYA 1HP8A 3WU2Z 5J2TB 3SJAC 3VQWA 4JAVA 4WFAV 3ETEA 3FYIB 2HJFC 5CBGA 4PD4F 3JALA 4YY3O 4F6RA 2YI8A 4G27B 4LP8A 1XBLA 3UCSC 2IJKA 4UCUA 5KHHA 2V7QG 4QNHB 1OV9A 4K8XA 4B3SO 3GWKC 4Q20A 2WLNA 4WFBV 1NI8A 2V1DA 3B8MA 2JJ2G 1S5HC 1EN5A 1ZSPA 4KHPB 1Q43A 5LHGA 3L73H 3QG5A 1JFFB 3ETQA 3E22B 2QKSA 4HBNA 4JTDB 4TT3G 2YC0A 5GTIZ 4CH4A 2Q6AA 5LOVA 1DF4A 3U0ZA 1QVFU 4DR5B 3ZRWA 4H0LB 1RM1B 4DR3O 1RPRA 1SQQH 1SA0B 4R7CA 1P49A 5C8YB 3JD3A 1OCOC 3IC9A 1XEQA 4GKKO 4LWSA 1K9MW 1SQVH 1SETA 4Q6GA 4DV4O 1P4RA 1U96A 5EYPB 3VQVA 1Y74B 4LF7O 5BMVB 4UFZA 1GH6A 3CX5F 4YJ3B 2XAQA 1S77D 3K58A 1MNGA 2DYRC 3SYAA 1ZWIC 4FFBB 3OAAG 3RFRA 3T1YB 1CP9A 4F6EA 2X0LA 1TUBB 1HNZO 1YHQV 1BZKA 3O65A 5KHJA 4PDRA 2WLIA 3AG2B 1PM9A 4P9OA 3CJHA 2EX3A 1AR5A 4LF9O 1PNMA 2Y69B 1NR1A 1UPGA 5KLVH 2PZSA 4DK1A 5ITZA 1U97A 4DV3O 5LGTA 1VF6A 5LMNB 3FX7A 4P30A 4DRXA 3QVNA 4ZI7B 1N33B 2VWKA 3RW0A 1R1BA 4GKKB 3F7YC 3M99B 4KUMA 1MSWD 4X8AA 3CWBH 1OCRB 2LGQA 2HHHO 4D7SA 5IJ0A 4X62B 3CC2V 3VQXA 1Q6HA 1H2NA 5KAIZ 3H1KH 2IBZH 1Q6UA 2MW2B 4DV2B 1XNRB 3GVMA 5D5PA 1R3KC 2UUAB 5JQGB 3RYFA 2NR5A 2YDEA 4U3JB 2YSUB 2LFRA 3FB8C 2JK5C 5A9GA 1XMOB 3DGEA 5DM6V 1N32B 4GX1A 2P06A 3N2KB 4CH5A 4GT1A 2FB5A 1NVPB 3OMIB 4FK5C 5HFMA 5CBFA 1ZL8A 2ITCC 3LDCA 1COWG 3CPWU 1VQ4V 1BHBA 4JI2O 4AQYO 2E3CA 1XL6A 2KB1A 4LF4O 4QPJA 1M4UA 4UB8Z 5B3SB 2FTKA 3UO3A 2QR4A 3FB7C 4QIWF 1H2SB 1K97A 4GX2A 3OR7C 4MS2A 3ZHQA 3BPZA 1OCOB 3CD6V 5IYZB 2A0LA 2ZM6O 4ZOLA 3CYOA 1M57C 2LGWA 2AHZA 3L72H 4MT8A 3CRRA 2ADQB 1XHXA 4EB6A 2R9AA 3ZN0A 2B1GA 2YICA 3JD2A 5J2UA 5KX5A 2YIAA 2HP8A 3E8FA 4DUZO 4U7OA 3OTFA 1YZBA 3E22A 3T1HO 3I56V 1HNXO 4ZBMA 4FLZA 2JDIG 1FXHA 3B2EE 2JEUA 1EM1A 2Q8VA 3G80A 3SPIA 1WB7A 2ZIOA 3HKDB 3L75H 2EULA 4B08A 4PDMA 4ASUG 1IX9A 4ZHQA 2HFEC 2Y69C 2LQTA 4UV9A 3AG4C 3E8BA 1VQ7V 2EIJB 2O57A 3RYHA 4R6ZA 2N74A 4JYBA 1E1RG 1S76D 3A2FA 2IM9A 3QF7A 1KKDA 2ETNA 4IT5A 3TK1A 1VQKV 1EZVH 1X4TA 5FNVA 1NVPD 4KXRA 1VQOV 3IFXA 3Q4HA 2LP7A 1V55B 2ZD9A 1NS1A 2WLIB 1EN6A 4YXWG 1RSOA 3STLC 5KHGA 1SS3A 3SPCA 4UCSA 5CA0B 4DR4B 4P9PA 1XI1A 2Q67A 3JD1A 3BVOA 4DR1O 1NU1H 2IJJA 1I0HA 3JARA 3ASOB 4LFCO 4DV1B 2XAJA 1M9NA 4FLVA 2ADPA 1M56B 1CEZA 1VF7A 4IYHA 3JASA 3OUSA 3OR6C 4TV9B 4NTYA 3SPJA 2F93B 1Z2GA 1R73A 1YJWV 2YXYA 3QNEA 5EBWC 2QTSA 1FAFA 5KHIA 1JPXA 1I7FA 3FD9A 4O4HA 1VQ8V 3CHXA 2QM8A 3HKEA 4CC5A 1SZTA 2F1MA 3CCJV 5IDJA 2A79B 1MZEA 4DUZB 3ABLC 2UU9B 3O9OA 2CGNA 2UUBO 1N8RW 4DR6O 1SF9A 3FAVB 5CBHA 3EFFK 5B5EZ 2L35A 3N2KA 5LGUA 2Q7EA 1XL4A 2E75B 2P4KA 1BS3A 4X65B 1NKDA 4LH6A 2ZCEA 3BA8A 5H6RA 1Q5OA 1YSCA 3LNMB 1GM8A 3AG1B 3IGAC 4JAUA 4UXNA 3T4DA 3M8AA 1H2MA 5L3FA 5IYZA 3MAQA 5TISZ 4LWSB 4RQFA 4JI0B 3P32A 4TSFG 2IU0A 4U7NA 2W6JG 1PV0A 4JI1B 5EYPA 1NZ6A 2LFSA 2CE4A 1FPOA 4HAMA 4UB6Z 4JAAA 5D5QA 2BTQB 4PA7A 2AXTZ 3K3WA 4MVRA 4EFBA 1WPXA 3RGBA 4YIOA 2HLDG 2E5LB 1VEWA 4LF4B 4CC6A 3JYCA 3HR0A 5IY5B 3BY6A 2DQ3A 2EILC 4I50A 4JYCA 1XMOO 3TXSA 1BQZA 2DJVA 5JJJB 1YJNV 3CCMV 4MW3A 4FLWA 5EK0A 5ITZB 1OZ0A 2W0FC 1HNXB 4B3RB 4BW9A 1VMGA 2Q0AA 4DRXB 3ZMSA 1M90W 4JI7B 3ABMC 2A7WA 3ABMB 5JH7A 4L8JA 1OCZC 3SDLA 3APQA 3CC4V 1MSDA 5KHKA 3ZN1A 5IJ0B 2Q7HA 4WBNB 1N36B 1GM7A 1JCHA 3CC7V 2Z3YA 1YCIA 2LW7A 4X1KB 3FKSG 1SQGA 2Q4PA 2ZE5A 2E76B 3A0BZ 3P3PA 4J11A 5LA6A 5JJEB 4DR7O 4K0KB 4JTAB 1VQLV 2QE7G 1FXKA 4UCRA 4RAIA 3AK1A 4FLTA 4DYLA 1NH2B 2YXLA 1WA8A 4YHHB 1IBLB 4LF5B 4GKJO 1Z5VA 5B1OA 2B1IA 3P30A 3BRCA 1NH2D 4DV0B 2YIDA 3H9VA 1DK1A 1YF2A 4K35A 5BR8B 4HZ3A 5B1BB 3U11A 2OT5A 2DYRB 3B40A 4C7UA 3OEEG 2EIJC 4IYIA 3K57A 1CPYA 3ICXA 4O2BA 2OWOA 2AHYA 3AG4B 1KU9A 1MABG 4X1YA 4Z1VA 5CB4A 2R9IA 4X66O 2EIKB 4W4LA 3C90A 3L70H 3CEIA 4MSWC 1B04A 1MMMA 2QWOB 2QSAA 4QGPA 3ASNC 2EILB 2ZNIA 4MVQA 1IURA 5J2TA 1GTOA 1PL0A 5KA5A 1KP3A 2GDSA 2DQ0A 4DV3B 1KP2A 3RYIA 4CZZA 3SJCC 4XDLA 2PI5A 2EJRA 2ZE8A 3M7MX 4BR6A 1QHTA 5B1AC 1GAXA 2ZE6A 3HKDA 4FFKA 4JI6B 5H6QA 1K73W 2CTPA 4JASA 2P4VA 1P84F 4JGSA 3SPGA 2ILMA 4BIOA 3F5TA 4PA4A 4YJ2A 3W7SA 3ZMVA 5CN0A 4X65O 3JD4A 4LF6B 3BABA 2JIZG 2C2AA 1G1XB 3CCLV 1N0NA 2BCCH 1XNQO 3K03A 2YUAA 3K04A 2E5LO 4PELA 2BTQA 1IBMO 1TVKA 1IXBA 3ABKC 1A32A 2HKOA 5H9CA 2ZIMA 2WSSG 5LOVB 3GWOA 2KG7B 3D36C 4I50B 4R8CA 2JGUA 3R65A 3CSXA 1VIBA 2BE3A 3ZS8C 2DOSA 4BW5A 1Y76A 4NB5A 3JARB 4Z1MG 4JI6O 2Y0IA 4MVMA 2B5UA 3G6EV 2PYJA 4UCVA 1MZFA 2EBOA 3KCYA 3E89A 3J80N 3A8TA 5LBQA 1GM9A 2WWWA 1ZX3A 4CBCA 2ZT9B 5HFLA 3MHHC 4JI4O 4DR1B 3CRAA 3T1HB 4O4HB 4I9QA 4K3AA 1JVMA 2Y4TA 1M5IA 4KL1A 1N32O 3RYCA 1HDJA 4IIJA 3LSUA 3JSNA 3ZHSA 1VQ6V 5C93A 1R6NA 5B1BC 2HVJC 1AP5A 4BIUA 3ZHUA 1IVSA 2DE0X 4WCEV 2V4DA 3K59A 3L9DA 5CA1B 5JCOA 2P22C 3THOA 3K5MA 2CTRA 4O4LA 1QLEB 3K9SA 2D2CB 1HNWO 2QKCA 5LP6B 2RQ6A 3U10A 3DTUB 2QWRB 2ZR2A 5EZYB 2F4VO 4X20A 5J9PC 4LF8O 3H1IH 1AI5A 1IZ3A 1NTMH 5FPRA 2VQFB 4UV8A 5KUMA 3RYFB 1H38A 5EC1C 1QVGU 1WB8A 3APOA 1HWYA 1XDCA 5EIBD 1OCCC 2HG5C 2UXCB 3W7TA 5IT9N 2F95B 2IH3C 2NN4A 5IYDO 1H2KA 3JATA 1V54C 4LH7A 3FYEB 1M1KW 1FXKC 2YS8A 3VBBA 1IBMB 1IBLO 1WN7A 2ZKOA 3CCSV 4JI2B 1IBKO 2YI9A 5BY1A 2VRZA 4N23A 4FPPA 1Q81W 2Q9LA 3CE2A 3AG2C 4H37A 4ZOLB 4BAYA 1WJZA 4JI3B 3G67A 4DV7O 3MD0A 1GK9A 3R66A 4J80A 1S5JA 5BMVA 2K1EA 5JH7B 1I5XA 4OPHA 2QJ1A 2FKXA 3OMNB 5AG2A 4A5UB 2HVKC 3T1YO 1AILA 1BSMA 4EFEA 5JVDB 1KC8W 1E79G 3E2EA 4DV2O 3A0HZ 2IJHA 4WFFA 4K0KO 4TV8B 5CMUA 1SQFA 3LDEA 1SRYA 2GV9A 2OCCB 1Q86W 3AK3A 3OD4A 1L0LH 3D3IA 3KZIZ 1ZTEA 4JI3O 1PNLA 2DYSC 1N4CA 5IY5C 4FIPC 2PYLA 2YIBD 2KSDA 1HNWB 3X2QB 3JAMN 4X66B 3K5OA 2HEPA 2ZXWB 5IYCO 2RMKB 1FFXA 2QTOA 1OCRC 2WPDG 1Y6XA 2LJ2A 3FB5C 1VQPV 4O2BB 4GKJB 1FJGB 1HNZB 1RSOB 4X1YB 3OMAB 3ABTA 5DN6G 4DV7B 2YXHA 1NT2B 4GX0A 4O4JA 5B1AB 2EINC 3UKMA 2Q7GA 1Y4MA 4H13B 1DGSA 5LGNA 1JX9A 2R70A 4UVAA 1K5SA 2HJDA 2RNBA 2FL4A 4AQYB 4X64B 2CGOA 4JYYA 1YDXA 1S3JA 3C3TA 4DR4O 4O4IA 1PNKA 5H2FZ 3DSQA 2YEVA 1P7GA 3N2GB 4YIPA 3AG3C 3A0RA 3I5DA 1CXZB 4X89A 2UU9O 1VQMV 3W7WA 2PGGA 4JPRA 5L3GA 1KQSU 2CUGA 3ZBHA 2P6JA 3PJSK 1PPJH 2X6AA 2UUCO 1LUWA 3S3WA 4DV6O 3W7XA 1J5EO 1FYJA 3G6BA 4HNAA 1THZA 1WAZA 3N27A 2OCCC 1O9HA 2NLJC 3BFRA 4I0XB 2JS5A 1TGOA 4NXNB 3RT3C 3ZX6A 5JJNB 1RM1C 4DV5O 2FYUH 3RYHB 3QO5A 1KD1W 3QTCA 2BSKB 2F43G 5IJ9B 1VQ9V 4LF5O 5LP6C 2X6CA 2F23A 5FPOA 3JCUZ 4KP4A 4JZ2A 4LFAO 3NR7A 3CMAV 2JGDA 2R9RB 1PKXA 4LCUC 3CRQA 4GLXA 1QLEC 4LFAB 3SYPA 3RVYA 4JTCB 4UCOA 4PDVA 1K33A 1NTKH 3ASOC 1VQ5V 1D2DA 4J7ZA 2CH7A 3HB3B 3BEHA 1F23A 1R6TA 4IIJB 1HR0O 1JMKC 4TV8A 2Q5ZA 1N33O 1K3EA 4QE7A 1SQBH 4GYCB 3TGUH 5LMNO 2OYQA 1IBKB 1J95A 5EBLC 1Y67A 1GMGA 3W7UA 1AJNA 3P3NA 1K7DA 3L71H 3WG7B 2Q0OC 4LR3A 4X9QA 5IYBO 3RWRD 4TV9A 3JAKB 4O2AB 4PJ0Z 4QE9A 2ZNJA 4DV0O 2K9PA 2KKWA 4MTFA 5LP6A 2DMXA 4NXMB 4WBNA 1ENVA 4PA9A 4JZGA 4DR2B 1SERA 1TAEA 1PP9H 1NJIW 3HKEB 1KECA 3F7VC 4KFMA 1S5LZ 2ODMA 3HKBB 4IHJA 1YTFD 4LC1A 1XNQB 4B3MB 1I08A 3CMEV 2VQEO 1LUVA 5E79Z 4O4JB 1L1FA 2Z0AA 4B3TO 1ZUQA 4H44B 4NTWA 4X88A 1QCEA 2RJZA 2XT9A 4DK0A 1QBZA 4OGQB 3JATB 4CH6A 4DR3B 3H1JH 3J81N 2CAZC 4NR1A 4GX5A 1YIJV 4I55B 3DC6A 1WNSA 4GUNA 1I5YA 4MTGA 4FZ1A 5L3BA 5L3DA 2QEXV 2WLLB 1SKVA 2GTSA 5IWAB 4W4KA 2GTAA 4CS4A 4JF3A 2IW5A 4PA3A 4FM0A 2P7TC 1TUEB 1JJOA 4F4LA 1JR9A 4FJCC 4DW0A 4B7KA 2ZE7A 4UCTA
chains in the Genus database with same CATH topology
1HR0O 4X64O 4DV7O 2JRIA 1N33O 1N32O 4LF9O 3R66A 4YY3O 4DUZO 5LMNO 4OX9O 4OPHA 1YZBA 4DR4O 2FKXA 3T1HO 4LF6O 4DUYO 4DV3O 1HNXO 4NXMO 4A5UB 5BXZA 4JV5O 2UXBO 3SDLA 5FLXN 3F5TA 3T1YO 1AILA 5LMUO 2UUBO 1R1BA 4DR6O 2UU9O 4DV2O 3OTOO 4JI0O 4DV0O 4DR2O 5A2QN 4B3SO 2HHHO 4X65O 4B3MO 2LW7A 4OPAA 4K0KO 1FJGO 4JI7O 1N34O 4JI1O 4DR5O 1HNWO 2VQFO 4YHHO 1G1XB 2N74A 4DR7O 1XNQO 2UUCO 2F4VO 4B3RO 2UUAO 2E5LO 5LL6Y 1IBMO 4JI3O 4DV6O 4KHPO 4LF8O 1AB3A 1J5EO 2VQEO 1A32A 3M8AA 4DR3O 3JAMN 1XMQO 1FYJA 4GKJO 1KUQA 2Z0AA 4B3TO 2UXDO 1DK1A 1I94O 1NS1A 1XEQA 3RT3C 4DV1O 4GKKO 2DOSA 4DV5O 5H5NA 3J7AU 2AGAA 4JI6O 4JYAO 3J81N 4X62O 4LF5O 5IWAO 5IT9N 4DV4O 4DR1O 4JI2O 4AQYO 4LFAO 1F7YA 4LF7O 4LF4O 1FKAO 5BR8O 4LFCO 4JI5O 3J80N 4NXNO 1N36O 2UXCO 1X59A 1XNRO 4X66O 4LFBO 1IBLO 2ZKOA 2ZM6O 4JI8O 4JI4O 1HNZO 1XMOO 1IBKO 3O65A 5BY1A 1D2DA 2DJVA 1R6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HR0 O;  4X64 O;  4DV7 O;  2JRI A;  1N33 O;  1N32 O;  4LF9 O;  3R66 A;  4YY3 O;  4DUZ O;  5LMN O;  4OX9 O;  4OPH A;  1YZB A;  4DR4 O;  2FKX A;  3T1H O;  4LF6 O;  4DUY O;  4DV3 O;  1HNX O;  4NXM O;  4A5U B;  5BXZ A;  4JV5 O;  2UXB O;  3SDL A;  5FLX N;  3F5T A;  3T1Y O;  1AIL A;  5LMU O;  2UUB O;  1R1B A;  4DR6 O;  2UU9 O;  4DV2 O;  3OTO O;  4JI0 O;  4DV0 O;  4DR2 O;  5A2Q N;  4B3S O;  2HHH O;  4X65 O;  4B3M O;  2LW7 A;  4OPA A;  4K0K O;  1FJG O;  4JI7 O;  1N34 O;  4JI1 O;  4DR5 O;  1HNW O;  2VQF O;  4YHH O;  1G1X B;  2N74 A;  4DR7 O;  1XNQ O;  2UUC O;  2F4V O;  4B3R O;  2UUA O;  2E5L O;  5LL6 Y;  1IBM O;  4JI3 O;  4DV6 O;  4KHP O;  4LF8 O;  1AB3 A;  1J5E O;  2VQE O;  1A32 A;  3M8A A;  4DR3 O;  3JAM N;  1XMQ O;  1FYJ A;  4GKJ O;  1KUQ A;  2Z0A A;  4B3T O;  2UXD O;  1DK1 A;  1I94 O;  1NS1 A;  1XEQ A;  3RT3 C;  4DV1 O;  4GKK O;  2DOS A;  4DV5 O;  5H5N A;  3J7A U;  2AGA A;  4JI6 O;  4JYA O;  3J81 N;  4X62 O;  4LF5 O;  5IWA O;  5IT9 N;  4DV4 O;  4DR1 O;  4JI2 O;  4AQY O;  4LFA O;  1F7Y A;  4LF7 O;  4LF4 O;  1FKA O;  5BR8 O;  4LFC O;  4JI5 O;  3J80 N;  4NXN O;  1N36 O;  2UXC O;  1X59 A;  1XNR O;  4X66 O;  4LFB O;  1IBL O;  2ZKO A;  2ZM6 O;  4JI8 O;  4JI4 O;  1HNZ O;  1XMO O;  1IBK O;  3O65 A;  5BY1 A;  1D2D A;  2DJV A;  1R6T A; 
#chains in the Genus database with same CATH topology
 4D6T H;  2EIM B;  3CCU V;  4J7J A;  3SGI A;  1D5N A;  2EZO A;  1JA8 A;  1Q82 W;  2QGN A;  2UUC B;  2GBO A;  2OTL V;  1N0J A;  1QR9 A;  2UXX A;  2HHH B;  1V9P A;  3EHB B;  4LF6 O;  4TWK A;  4E2L A;  4NXM O;  2CTW A;  5JVD A;  2VS0 A;  3OEH G;  3QO7 A;  5KMG B;  3AG7 A;  2NNU A;  4L87 A;  2IH1 C;  3ML0 A;  1BT8 A;  4JI0 O;  3ZIA G;  4OXS A;  2PUS A;  5LMU B;  3RBZ A;  4MTX A;  5C8Y A;  4JI8 B;  2JVD A;  2ZXW C;  1ZAU A;  1YVW A;  4G28 B;  1AJP A;  5GON A;  1KB9 F;  1RFY A;  2OIE A;  2EIM C;  3LDD A;  2GSM B;  5LL6 Y;  3K79 A;  4EEQ A;  5K1P A;  4RUF A;  1I94 B;  4KHP O;  1Y74 A;  3HPL C;  1BGY H;  4TQF A;  2UXB B;  2CTQ A;  2DWE C;  4LF8 B;  1K34 A;  1OCZ B;  3LSQ A;  2GUZ B;  2UXD O;  2CK3 G;  1TUB A;  4DV6 B;  1BMF G;  4PHZ A;  3ZRX A;  3WFV A;  2W0X A;  4FVM A;  3L74 H;  3D8C A;  2DYS B;  4ZKI A;  3UQ8 A;  3CJH B;  1K92 A;  2A9H A;  3UT5 A;  1YTF B;  4OX9 B;  1XQ8 A;  1Y76 B;  3PN1 A;  4GZR B;  2AZ0 A;  1L8D A;  1V54 B;  2X6B A;  1W59 A;  5BR8 O;  2Q69 A;  1ROP A;  4NXN O;  3JAW A;  3TCU A;  2D3O W;  1H8H G;  1XNR O;  1XOU A;  4BWA A;  2GHY A;  3CCE V;  2M7W A;  1B3Q A;  2W6I G;  4XDJ A;  1W0K G;  1EFR G;  4LF7 B;  4O2A A;  1EZJ A;  2WAM A;  3JAL B;  4JI4 B;  2PTM A;  4LNU A;  3OM3 B;  4FM2 A;  4O4I B;  1K8A W;  2X7R B;  4I4T A;  1VF5 B;  1YEW A;  3ZRV A;  3E86 A;  2VWJ A;  5CB4 B;  4WFG A;  1G4Y B;  1R6K A;  5FLX N;  3FFQ A;  2KQX A;  5LMU O;  4FZ0 A;  1FD9 A;  3B4S A;  2XAG A;  5KAF Z;  1TA8 A;  4DR2 O;  4MVO A;  3HKC A;  4UVB A;  2YIB A;  2XOK G;  1YI2 V;  2LO1 A;  3NXS A;  2LW1 A;  3ASN B;  4TQD A;  2QWN B;  4WF9 V;  2VQF O;  2WLH A;  3RYI B;  2DWD C;  4TUY A;  4MTO A;  1ZL8 B;  2BOB C;  3TET A;  5EBM C;  4CS3 A;  1BCC H;  5L3E A;  3T1C A;  1YJ9 V;  3IC7 A;  1KYO F;  5EZY A;  5F2V O;  1G8M A;  1AB3 A;  4FMT A;  5LYJ B;  1UJW B;  4I0X A;  1XMQ O;  1QR8 A;  2ZDI A;  4DV4 B;  1PL4 A;  3OTO B;  3ZMT A;  2IU3 A;  4XDK A;  1YXB A;  3AG1 C;  4YY3 B;  1YIT V;  2PY5 A;  1W2B U;  1IXM A;  5H5N A;  1NTZ H;  2ATK C;  4EB6 B;  2VQE B;  2JGD B;  4YJ3 A;  2PF4 E;  5JCO C;  5IWA O;  5KA6 A;  2ZQM A;  2WLK A;  3KKY A;  3ZJZ A;  5B1N A;  3GB7 C;  4NKG B;  3DC5 A;  5KMG A;  2KG7 A;  3ABU A;  2JJ1 G;  1F4N A;  1N34 B;  3STZ C;  3SR2 C;  4I5S A;  4UUJ C;  1AR1 B;  4ZHQ B;  2OCH A;  4NVP A;  5K1X A;  1K5Q A;  1QU7 A;  2R72 A;  2IJI A;  1O9G A;  5EIB C;  5GON B;  1K4D C;  3TJT A;  4NYK A;  4B3S B;  4B7E A;  2CDY A;  4JYA B;  1AJQ A;  2Y0P A;  3JAK A;  2P67 A;  2A06 H;  3JD0 A;  2UXN A;  2RN9 A;  4J9Y B;  3E8H A;  5FL7 G;  1AR4 A;  3E83 A;  1MOF A;  4P2Z A;  4IL6 Z;  3G4S V;  1XHZ A;  1KMI Z;  3B8N A;  1SQP H;  3AK2 A;  4K8Z A;  1FJG O;  2MK3 A;  2Q73 A;  4LBE C;  4YHH O;  4WFH A;  3WG7 C;  1S0V A;  1M93 A;  1IDS A;  2OIG A;  2ZR3 A;  2N05 A;  1DF5 A;  1E1Q G;  3H01 A;  4DXW A;  3JAW B;  4LFB B;  3KCX A;  2ZM6 B;  5CA1 A;  3JAS B;  3OW2 U;  4O4L B;  1XRE A;  4QPK A;  2XTA A;  4LFC B;  3ETD A;  4N21 A;  3SPH A;  3CS5 A;  4I55 A;  3J7A U;  2AGA A;  4MVZ A;  1WP7 A;  4I7Z B;  4X20 B;  2BOC C;  1Q90 D;  4AHC A;  4X1I A;  1B6Q A;  1FS0 G;  1F51 A;  1W0J G;  2QKA A;  2UUB B;  3T4Z A;  1M57 B;  3ZHT A;  3E8G A;  3ZHV A;  1QQC A;  2ITD C;  3SJB C;  1R3J C;  2QM4 A;  2FML A;  4GCZ A;  3SJQ C;  5LXT B;  1KBH A;  2P5O A;  2WA3 A;  4Z2W A;  5KX5 B;  2Z5U A;  3HKC B;  1DLB A;  1SES A;  1H2L A;  3LUT B;  3SYQ A;  3BA9 A;  4TUY B;  1J5E B;  3AG3 B;  1VF6 C;  3UO2 A;  1ARO P;  4F6R B;  5BXZ A;  2UXB O;  1LNQ A;  3BAA A;  4HYO A;  1NR7 A;  4DR7 B;  2QWQ B;  3K0G A;  4JV5 B;  1R3L C;  1FXV A;  5EC2 C;  3D3Q A;  3CCR V;  4J10 A;  2M6Y A;  1MG1 A;  3SYC A;  3WB2 A;  4JI1 O;  4TOI A;  2EZP A;  4DR5 O;  3RVZ A;  1Y66 A;  4RWU A;  3LNN A;  3F5W C;  3ZMZ A;  1GN4 A;  1Q6I A;  1ZLZ A;  2AW9 A;  5LHH A;  4RQE A;  3Q4H B;  4EKW A;  3H1L H;  3OGC C;  1JQ0 A;  5DEC A;  1H2G A;  4CH3 A;  3C3S A;  4DUY B;  1KUQ A;  3ZRW B;  1HW7 A;  3I55 V;  1I94 O;  2ZIN A;  4HNA B;  2EIK C;  2DN9 A;  3UT5 B;  3K5L A;  3MHS C;  3K08 A;  4MVS A;  2ARH A;  2G38 A;  1WP8 A;  3DXR A;  4AI8 A;  4MVU A;  1F7Y A;  1OHH G;  3JSL A;  3QO8 A;  3B09 A;  2H3O A;  5IJ9 A;  3CXC U;  2RCV A;  4JI5 O;  1WLE A;  4IGG A;  4RUE A;  1Q7Y W;  3H1H H;  3IJ4 A;  1EN4 A;  3IAY A;  3OE7 G;  1R3I C;  3E35 A;  1L0N H;  1LR1 A;  1RP3 B;  1NQT A;  2XAF A;  1FFX B;  4FFB A;  4H33 A;  4R50 A;  2JEX A;  4NTX A;  4LNU B;  1AP6 A;  3CCV V;  3OGI B;  4FLX A;  1BHA A;  1NBM G;  4X1K A;  3RN4 A;  4I4T B;  4CS2 A;  1GKF A;  1B06 A;  2CH7 B;  3ABL B;  1GRJ A;  3K06 A;  5B66 Z;  2A3Q A;  4UVC A;  5E1A C;  4DUY O;  3ZHR A;  4FM1 A;  2F66 C;  2QM7 A;  3FAV A;  4D7T A;  1RPO A;  2F4V B;  3FB6 C;  1KKC A;  2JS3 A;  3CP1 A;  2BTO A;  2WA4 A;  4J41 A;  2EIN B;  4ZI7 A;  1AI6 A;  5A2Q N;  4FLU A;  3G71 V;  4WFE A;  1OCC B;  4OPA A;  4B3M O;  3K5N A;  3UM7 A;  4JI7 O;  1N34 O;  3LSS A;  1SC5 B;  4LF9 B;  3TXQ A;  4B3R O;  2H94 A;  1K4C C;  1G6U A;  4XBF A;  3BCC H;  3ZMU A;  1VAR A;  4X1I B;  3CB2 A;  5LYJ A;  5L3C A;  3JCZ A;  2HR3 A;  1FFT B;  1US6 A;  4JI5 B;  3ZCC A;  2YEV B;  4B3T B;  3HKB A;  3N2G A;  3ZRS A;  1S72 V;  3EXA A;  4DO2 A;  4IHJ B;  4RO2 A;  4DW1 A;  3OT7 A;  5JQG A;  1VP7 A;  4U3J A;  5LXT A;  3CRC A;  3CCQ V;  2OTJ V;  1XIL A;  1OJH A;  1D5A A;  3SYO A;  1AVM A;  4DR6 B;  2AZ2 A;  2PI4 A;  1JJ2 U;  1BL8 A;  1EBO A;  5GTH Z;  2DW4 A;  5DED A;  1GO3 F;  4JYA O;  4X62 O;  1JFF A;  1P7B A;  1SZX A;  2E74 B;  1QNM A;  1SQX H;  4MW8 A;  1BQ0 A;  2L6L A;  1N36 O;  2UXC O;  3B77 A;  1X59 A;  2Y48 A;  4J9Z B;  2B9Z A;  1WPB A;  3D36 A;  5IE9 A;  1SA0 A;  4G2K A;  4YJ2 B;  4PA6 A;  2WLL A;  3ETG A;  5JWP A;  2EJ7 A;  4DV5 B;  2BSK A;  1AI7 A;  4X64 O;  3X2Q C;  2JRI A;  3AEI A;  4BIZ A;  2XAH A;  3OUF A;  2WLJ A;  4AIL C;  4ICG A;  3VOU A;  3VQY A;  2H8P C;  1HR0 B;  4OX9 O;  5J2U B;  4J7K A;  3KG2 A;  3WB1 A;  1TVK B;  3MDS A;  4JV5 O;  2QA4 V;  3OFN G;  1Q8I A;  4U3F H;  3OTO O;  3CXH F;  4J42 A;  1UFI A;  2UXD B;  1URF A;  1F4M A;  1T5E A;  1Q3E A;  5LA6 B;  3K9A A;  2XUM A;  3EVK A;  2N04 A;  4E4E A;  5GW7 A;  2QDO A;  5KUK A;  2WLM A;  1FXK B;  3CRM A;  4PV1 B;  2Y4U A;  4ABM A;  3DXR B;  2UUA O;  5B3S C;  1MA1 A;  2Q68 A;  4QJF B;  1ORQ C;  2XHB A;  1WA8 B;  1DTO A;  3ABK B;  1PD3 A;  4PDL A;  1BE3 H;  1QLN A;  1H8E G;  5FNV B;  4I9W A;  3T2M A;  1M56 C;  4DV1 O;  2GUZ A;  2P90 A;  4PI0 A;  2ZDI C;  3BHP A;  2QWP B;  1GN3 A;  3RYC B;  5BZB A;  2RDC A;  5CA0 A;  1GN2 A;  2XAS A;  3ZED A;  3S3X A;  1FKA O;  3K0D A;  1JOY A;  1AI4 A;  1XUQ A;  3WB0 A;  1Z5W A;  2XND G;  1VQN V;  4PI2 A;  4LFB O;  4ZIB A;  1XMQ B;  5CA3 A;  1GN6 A;  1V55 C;  5LHI A;  4JI8 O;  4FLY A;  1HP8 A;  3WU2 Z;  5J2T B;  3SJA C;  3VQW A;  4JAV A;  4WFA V;  3ETE A;  3FYI B;  2HJF C;  5CBG A;  4PD4 F;  3JAL A;  4YY3 O;  4F6R A;  2YI8 A;  4G27 B;  4LP8 A;  1XBL A;  3UCS C;  2IJK A;  4UCU A;  5KHH A;  2V7Q G;  4QNH B;  1OV9 A;  4K8X A;  4B3S O;  3GWK C;  4Q20 A;  2WLN A;  4WFB V;  1NI8 A;  2V1D A;  3B8M A;  2JJ2 G;  1S5H C;  1EN5 A;  1ZSP A;  4KHP B;  1Q43 A;  5LHG A;  3L73 H;  3QG5 A;  1JFF B;  3ETQ A;  3E22 B;  2QKS A;  4HBN A;  4JTD B;  4TT3 G;  2YC0 A;  5GTI Z;  4CH4 A;  2Q6A A;  5LOV A;  1DF4 A;  3U0Z A;  1QVF U;  4DR5 B;  3ZRW A;  4H0L B;  1RM1 B;  4DR3 O;  1RPR A;  1SQQ H;  1SA0 B;  4R7C A;  1P49 A;  5C8Y B;  3JD3 A;  1OCO C;  3IC9 A;  1XEQ A;  4GKK O;  4LWS A;  1K9M W;  1SQV H;  1SET A;  4Q6G A;  4DV4 O;  1P4R A;  1U96 A;  5EYP B;  3VQV A;  1Y74 B;  4LF7 O;  5BMV B;  4UFZ A;  1GH6 A;  3CX5 F;  4YJ3 B;  2XAQ A;  1S77 D;  3K58 A;  1MNG A;  2DYR C;  3SYA A;  1ZWI C;  4FFB B;  3OAA G;  3RFR A;  3T1Y B;  1CP9 A;  4F6E A;  2X0L A;  1TUB B;  1HNZ O;  1YHQ V;  1BZK A;  3O65 A;  5KHJ A;  4PDR A;  2WLI A;  3AG2 B;  1PM9 A;  4P9O A;  3CJH A;  2EX3 A;  1AR5 A;  4LF9 O;  1PNM A;  2Y69 B;  1NR1 A;  1UPG A;  5KLV H;  2PZS A;  4DK1 A;  5ITZ A;  1U97 A;  4DV3 O;  5LGT A;  1VF6 A;  5LMN B;  3FX7 A;  4P30 A;  4DRX A;  3QVN A;  4ZI7 B;  1N33 B;  2VWK A;  3RW0 A;  1R1B A;  4GKK B;  3F7Y C;  3M99 B;  4KUM A;  1MSW D;  4X8A A;  3CWB H;  1OCR B;  2LGQ A;  2HHH O;  4D7S A;  5IJ0 A;  4X62 B;  3CC2 V;  3VQX A;  1Q6H A;  1H2N A;  5KAI Z;  3H1K H;  2IBZ H;  1Q6U A;  2MW2 B;  4DV2 B;  1XNR B;  3GVM A;  5D5P A;  1R3K C;  2UUA B;  5JQG B;  3RYF A;  2NR5 A;  2YDE A;  4U3J B;  2YSU B;  2LFR A;  3FB8 C;  2JK5 C;  5A9G A;  1XMO B;  3DGE A;  5DM6 V;  1N32 B;  4GX1 A;  2P06 A;  3N2K B;  4CH5 A;  4GT1 A;  2FB5 A;  1NVP B;  3OMI B;  4FK5 C;  5HFM A;  5CBF A;  1ZL8 A;  2ITC C;  3LDC A;  1COW G;  3CPW U;  1VQ4 V;  1BHB A;  4JI2 O;  4AQY O;  2E3C A;  1XL6 A;  2KB1 A;  4LF4 O;  4QPJ A;  1M4U A;  4UB8 Z;  5B3S B;  2FTK A;  3UO3 A;  2QR4 A;  3FB7 C;  4QIW F;  1H2S B;  1K97 A;  4GX2 A;  3OR7 C;  4MS2 A;  3ZHQ A;  3BPZ A;  1OCO B;  3CD6 V;  5IYZ B;  2A0L A;  2ZM6 O;  4ZOL A;  3CYO A;  1M57 C;  2LGW A;  2AHZ A;  3L72 H;  4MT8 A;  3CRR A;  2ADQ B;  1XHX A;  4EB6 A;  2R9A A;  3ZN0 A;  2B1G A;  2YIC A;  3JD2 A;  5J2U A;  5KX5 A;  2YIA A;  2HP8 A;  3E8F A;  4DUZ O;  4U7O A;  3OTF A;  1YZB A;  3E22 A;  3T1H O;  3I56 V;  1HNX O;  4ZBM A;  4FLZ A;  2JDI G;  1FXH A;  3B2E E;  2JEU A;  1EM1 A;  2Q8V A;  3G80 A;  3SPI A;  1WB7 A;  2ZIO A;  3HKD B;  3L75 H;  2EUL A;  4B08 A;  4PDM A;  4ASU G;  1IX9 A;  4ZHQ A;  2HFE C;  2Y69 C;  2LQT A;  4UV9 A;  3AG4 C;  3E8B A;  1VQ7 V;  2EIJ B;  2O57 A;  3RYH A;  4R6Z A;  2N74 A;  4JYB A;  1E1R G;  1S76 D;  3A2F A;  2IM9 A;  3QF7 A;  1KKD A;  2ETN A;  4IT5 A;  3TK1 A;  1VQK V;  1EZV H;  1X4T A;  5FNV A;  1NVP D;  4KXR A;  1VQO V;  3IFX A;  3Q4H A;  2LP7 A;  1V55 B;  2ZD9 A;  1NS1 A;  2WLI B;  1EN6 A;  4YXW G;  1RSO A;  3STL C;  5KHG A;  1SS3 A;  3SPC A;  4UCS A;  5CA0 B;  4DR4 B;  4P9P A;  1XI1 A;  2Q67 A;  3JD1 A;  3BVO A;  4DR1 O;  1NU1 H;  2IJJ A;  1I0H A;  3JAR A;  3ASO B;  4LFC O;  4DV1 B;  2XAJ A;  1M9N A;  4FLV A;  2ADP A;  1M56 B;  1CEZ A;  1VF7 A;  4IYH A;  3JAS A;  3OUS A;  3OR6 C;  4TV9 B;  4NTY A;  3SPJ A;  2F93 B;  1Z2G A;  1R73 A;  1YJW V;  2YXY A;  3QNE A;  5EBW C;  2QTS A;  1FAF A;  5KHI A;  1JPX A;  1I7F A;  3FD9 A;  4O4H A;  1VQ8 V;  3CHX A;  2QM8 A;  3HKE A;  4CC5 A;  1SZT A;  2F1M A;  3CCJ V;  5IDJ A;  2A79 B;  1MZE A;  4DUZ B;  3ABL C;  2UU9 B;  3O9O A;  2CGN A;  2UUB O;  1N8R W;  4DR6 O;  1SF9 A;  3FAV B;  5CBH A;  3EFF K;  5B5E Z;  2L35 A;  3N2K A;  5LGU A;  2Q7E A;  1XL4 A;  2E75 B;  2P4K A;  1BS3 A;  4X65 B;  1NKD A;  4LH6 A;  2ZCE A;  3BA8 A;  5H6R A;  1Q5O A;  1YSC A;  3LNM B;  1GM8 A;  3AG1 B;  3IGA C;  4JAU A;  4UXN A;  3T4D A;  3M8A A;  1H2M A;  5L3F A;  5IYZ A;  3MAQ A;  5TIS Z;  4LWS B;  4RQF A;  4JI0 B;  3P32 A;  4TSF G;  2IU0 A;  4U7N A;  2W6J G;  1PV0 A;  4JI1 B;  5EYP A;  1NZ6 A;  2LFS A;  2CE4 A;  1FPO A;  4HAM A;  4UB6 Z;  4JAA A;  5D5Q A;  2BTQ B;  4PA7 A;  2AXT Z;  3K3W A;  4MVR A;  4EFB A;  1WPX A;  3RGB A;  4YIO A;  2HLD G;  2E5L B;  1VEW A;  4LF4 B;  4CC6 A;  3JYC A;  3HR0 A;  5IY5 B;  3BY6 A;  2DQ3 A;  2EIL C;  4I50 A;  4JYC A;  1XMO O;  3TXS A;  1BQZ A;  2DJV A;  5JJJ B;  1YJN V;  3CCM V;  4MW3 A;  4FLW A;  5EK0 A;  5ITZ B;  1OZ0 A;  2W0F C;  1HNX B;  4B3R B;  4BW9 A;  1VMG A;  2Q0A A;  4DRX B;  3ZMS A;  1M90 W;  4JI7 B;  3ABM C;  2A7W A;  3ABM B;  5JH7 A;  4L8J A;  1OCZ C;  3SDL A;  3APQ A;  3CC4 V;  1MSD A;  5KHK A;  3ZN1 A;  5IJ0 B;  2Q7H A;  4WBN B;  1N36 B;  1GM7 A;  1JCH A;  3CC7 V;  2Z3Y A;  1YCI A;  2LW7 A;  4X1K B;  3FKS G;  1SQG A;  2Q4P A;  2ZE5 A;  2E76 B;  3A0B Z;  3P3P A;  4J11 A;  5LA6 A;  5JJE B;  4DR7 O;  4K0K B;  4JTA B;  1VQL V;  2QE7 G;  1FXK A;  4UCR A;  4RAI A;  3AK1 A;  4FLT A;  4DYL A;  1NH2 B;  2YXL A;  1WA8 A;  4YHH B;  1IBL B;  4LF5 B;  4GKJ O;  1Z5V A;  5B1O A;  2B1I A;  3P30 A;  3BRC A;  1NH2 D;  4DV0 B;  2YID A;  3H9V A;  1DK1 A;  1YF2 A;  4K35 A;  5BR8 B;  4HZ3 A;  5B1B B;  3U11 A;  2OT5 A;  2DYR B;  3B40 A;  4C7U A;  3OEE G;  2EIJ C;  4IYI A;  3K57 A;  1CPY A;  3ICX A;  4O2B A;  2OWO A;  2AHY A;  3AG4 B;  1KU9 A;  1MAB G;  4X1Y A;  4Z1V A;  5CB4 A;  2R9I A;  4X66 O;  2EIK B;  4W4L A;  3C90 A;  3L70 H;  3CEI A;  4MSW C;  1B04 A;  1MMM A;  2QWO B;  2QSA A;  4QGP A;  3ASN C;  2EIL B;  2ZNI A;  4MVQ A;  1IUR A;  5J2T A;  1GTO A;  1PL0 A;  5KA5 A;  1KP3 A;  2GDS A;  2DQ0 A;  4DV3 B;  1KP2 A;  3RYI A;  4CZZ A;  3SJC C;  4XDL A;  2PI5 A;  2EJR A;  2ZE8 A;  3M7M X;  4BR6 A;  1QHT A;  5B1A C;  1GAX A;  2ZE6 A;  3HKD A;  4FFK A;  4JI6 B;  5H6Q A;  1K73 W;  2CTP A;  4JAS A;  2P4V A;  1P84 F;  4JGS A;  3SPG A;  2ILM A;  4BIO A;  3F5T A;  4PA4 A;  4YJ2 A;  3W7S A;  3ZMV A;  5CN0 A;  4X65 O;  3JD4 A;  4LF6 B;  3BAB A;  2JIZ G;  2C2A A;  1G1X B;  3CCL V;  1N0N A;  2BCC H;  1XNQ O;  3K03 A;  2YUA A;  3K04 A;  2E5L O;  4PEL A;  2BTQ A;  1IBM O;  1TVK A;  1IXB A;  3ABK C;  1A32 A;  2HKO A;  5H9C A;  2ZIM A;  2WSS G;  5LOV B;  3GWO A;  2KG7 B;  3D36 C;  4I50 B;  4R8C A;  2JGU A;  3R65 A;  3CSX A;  1VIB A;  2BE3 A;  3ZS8 C;  2DOS A;  4BW5 A;  1Y76 A;  4NB5 A;  3JAR B;  4Z1M G;  4JI6 O;  2Y0I A;  4MVM A;  2B5U A;  3G6E V;  2PYJ A;  4UCV A;  1MZF A;  2EBO A;  3KCY A;  3E89 A;  3J80 N;  3A8T A;  5LBQ A;  1GM9 A;  2WWW A;  1ZX3 A;  4CBC A;  2ZT9 B;  5HFL A;  3MHH C;  4JI4 O;  4DR1 B;  3CRA A;  3T1H B;  4O4H B;  4I9Q A;  4K3A A;  1JVM A;  2Y4T A;  1M5I A;  4KL1 A;  1N32 O;  3RYC A;  1HDJ A;  4IIJ A;  3LSU A;  3JSN A;  3ZHS A;  1VQ6 V;  5C93 A;  1R6N A;  5B1B C;  2HVJ C;  1AP5 A;  4BIU A;  3ZHU A;  1IVS A;  2DE0 X;  4WCE V;  2V4D A;  3K59 A;  3L9D A;  5CA1 B;  5JCO A;  2P22 C;  3THO A;  3K5M A;  2CTR A;  4O4L A;  1QLE B;  3K9S A;  2D2C B;  1HNW O;  2QKC A;  5LP6 B;  2RQ6 A;  3U10 A;  3DTU B;  2QWR B;  2ZR2 A;  5EZY B;  2F4V O;  4X20 A;  5J9P C;  4LF8 O;  3H1I H;  1AI5 A;  1IZ3 A;  1NTM H;  5FPR A;  2VQF B;  4UV8 A;  5KUM A;  3RYF B;  1H38 A;  5EC1 C;  1QVG U;  1WB8 A;  3APO A;  1HWY A;  1XDC A;  5EIB D;  1OCC C;  2HG5 C;  2UXC B;  3W7T A;  5IT9 N;  2F95 B;  2IH3 C;  2NN4 A;  5IYD O;  1H2K A;  3JAT A;  1V54 C;  4LH7 A;  3FYE B;  1M1K W;  1FXK C;  2YS8 A;  3VBB A;  1IBM B;  1IBL O;  1WN7 A;  2ZKO A;  3CCS V;  4JI2 B;  1IBK O;  2YI9 A;  5BY1 A;  2VRZ A;  4N23 A;  4FPP A;  1Q81 W;  2Q9L A;  3CE2 A;  3AG2 C;  4H37 A;  4ZOL B;  4BAY A;  1WJZ A;  4JI3 B;  3G67 A;  4DV7 O;  3MD0 A;  1GK9 A;  3R66 A;  4J80 A;  1S5J A;  5BMV A;  2K1E A;  5JH7 B;  1I5X A;  4OPH A;  2QJ1 A;  2FKX A;  3OMN B;  5AG2 A;  4A5U B;  2HVK C;  3T1Y O;  1AIL A;  1BSM A;  4EFE A;  5JVD B;  1KC8 W;  1E79 G;  3E2E A;  4DV2 O;  3A0H Z;  2IJH A;  4WFF A;  4K0K O;  4TV8 B;  5CMU A;  1SQF A;  3LDE A;  1SRY A;  2GV9 A;  2OCC B;  1Q86 W;  3AK3 A;  3OD4 A;  1L0L H;  3D3I A;  3KZI Z;  1ZTE A;  4JI3 O;  1PNL A;  2DYS C;  1N4C A;  5IY5 C;  4FIP C;  2PYL A;  2YIB D;  2KSD A;  1HNW B;  3X2Q B;  3JAM N;  4X66 B;  3K5O A;  2HEP A;  2ZXW B;  5IYC O;  2RMK B;  1FFX A;  2QTO A;  1OCR C;  2WPD G;  1Y6X A;  2LJ2 A;  3FB5 C;  1VQP V;  4O2B B;  4GKJ B;  1FJG B;  1HNZ B;  1RSO B;  4X1Y B;  3OMA B;  3ABT A;  5DN6 G;  4DV7 B;  2YXH A;  1NT2 B;  4GX0 A;  4O4J A;  5B1A B;  2EIN C;  3UKM A;  2Q7G A;  1Y4M A;  4H13 B;  1DGS A;  5LGN A;  1JX9 A;  2R70 A;  4UVA A;  1K5S A;  2HJD A;  2RNB A;  2FL4 A;  4AQY B;  4X64 B;  2CGO A;  4JYY A;  1YDX A;  1S3J A;  3C3T A;  4DR4 O;  4O4I A;  1PNK A;  5H2F Z;  3DSQ A;  2YEV A;  1P7G A;  3N2G B;  4YIP A;  3AG3 C;  3A0R A;  3I5D A;  1CXZ B;  4X89 A;  2UU9 O;  1VQM V;  3W7W A;  2PGG A;  4JPR A;  5L3G A;  1KQS U;  2CUG A;  3ZBH A;  2P6J A;  3PJS K;  1PPJ H;  2X6A A;  2UUC O;  1LUW A;  3S3W A;  4DV6 O;  3W7X A;  1J5E O;  1FYJ A;  3G6B A;  4HNA A;  1THZ A;  1WAZ A;  3N27 A;  2OCC C;  1O9H A;  2NLJ C;  3BFR A;  4I0X B;  2JS5 A;  1TGO A;  4NXN B;  3RT3 C;  3ZX6 A;  5JJN B;  1RM1 C;  4DV5 O;  2FYU H;  3RYH B;  3QO5 A;  1KD1 W;  3QTC A;  2BSK B;  2F43 G;  5IJ9 B;  1VQ9 V;  4LF5 O;  5LP6 C;  2X6C A;  2F23 A;  5FPO A;  3JCU Z;  4KP4 A;  4JZ2 A;  4LFA O;  3NR7 A;  3CMA V;  2JGD A;  2R9R B;  1PKX A;  4LCU C;  3CRQ A;  4GLX A;  1QLE C;  4LFA B;  3SYP A;  3RVY A;  4JTC B;  4UCO A;  4PDV A;  1K33 A;  1NTK H;  3ASO C;  1VQ5 V;  1D2D A;  4J7Z A;  2CH7 A;  3HB3 B;  3BEH A;  1F23 A;  1R6T A;  4IIJ B;  1HR0 O;  1JMK C;  4TV8 A;  2Q5Z A;  1N33 O;  1K3E A;  4QE7 A;  1SQB H;  4GYC B;  3TGU H;  5LMN O;  2OYQ A;  1IBK B;  1J95 A;  5EBL C;  1Y67 A;  1GMG A;  3W7U A;  1AJN A;  3P3N A;  1K7D A;  3L71 H;  3WG7 B;  2Q0O C;  4LR3 A;  4X9Q A;  5IYB O;  3RWR D;  4TV9 A;  3JAK B;  4O2A B;  4PJ0 Z;  4QE9 A;  2ZNJ A;  4DV0 O;  2K9P A;  2KKW A;  4MTF A;  5LP6 A;  2DMX A;  4NXM B;  4WBN A;  1ENV A;  4PA9 A;  4JZG A;  4DR2 B;  1SER A;  1TAE A;  1PP9 H;  1NJI W;  3HKE B;  1KEC A;  3F7V C;  4KFM A;  1S5L Z;  2ODM A;  3HKB B;  4IHJ A;  1YTF D;  4LC1 A;  1XNQ B;  4B3M B;  1I08 A;  3CME V;  2VQE O;  1LUV A;  5E79 Z;  4O4J B;  1L1F A;  2Z0A A;  4B3T O;  1ZUQ A;  4H44 B;  4NTW A;  4X88 A;  1QCE A;  2RJZ A;  2XT9 A;  4DK0 A;  1QBZ A;  4OGQ B;  3JAT B;  4CH6 A;  4DR3 B;  3H1J H;  3J81 N;  2CAZ C;  4NR1 A;  4GX5 A;  1YIJ V;  4I55 B;  3DC6 A;  1WNS A;  4GUN A;  1I5Y A;  4MTG A;  4FZ1 A;  5L3B A;  5L3D A;  2QEX V;  2WLL B;  1SKV A;  2GTS A;  5IWA B;  4W4K A;  2GTA A;  4CS4 A;  4JF3 A;  2IW5 A;  4PA3 A;  4FM0 A;  2P7T C;  1TUE B;  1JJO A;  4F4L A;  1JR9 A;  4FJC C;  4DW0 A;  4B7K A;  2ZE7 A;  4UCT A; 
#chains in the Genus database with same CATH homology
 1HR0 O;  4X64 O;  4DV7 O;  2JRI A;  1N33 O;  1N32 O;  4LF9 O;  3R66 A;  4YY3 O;  4DUZ O;  5LMN O;  4OX9 O;  4OPH A;  1YZB A;  4DR4 O;  2FKX A;  3T1H O;  4LF6 O;  4DUY O;  4DV3 O;  1HNX O;  4NXM O;  4A5U B;  5BXZ A;  4JV5 O;  2UXB O;  3SDL A;  5FLX N;  3F5T A;  3T1Y O;  1AIL A;  5LMU O;  2UUB O;  1R1B A;  4DR6 O;  2UU9 O;  4DV2 O;  3OTO O;  4JI0 O;  4DV0 O;  4DR2 O;  5A2Q N;  4B3S O;  2HHH O;  4X65 O;  4B3M O;  2LW7 A;  4OPA A;  4K0K O;  1FJG O;  4JI7 O;  1N34 O;  4JI1 O;  4DR5 O;  1HNW O;  2VQF O;  4YHH O;  1G1X B;  2N74 A;  4DR7 O;  1XNQ O;  2UUC O;  2F4V O;  4B3R O;  2UUA O;  2E5L O;  5LL6 Y;  1IBM O;  4JI3 O;  4DV6 O;  4KHP O;  4LF8 O;  1AB3 A;  1J5E O;  2VQE O;  1A32 A;  3M8A A;  4DR3 O;  3JAM N;  1XMQ O;  1FYJ A;  4GKJ O;  1KUQ A;  2Z0A A;  4B3T O;  2UXD O;  1DK1 A;  1I94 O;  1NS1 A;  1XEQ A;  3RT3 C;  4DV1 O;  4GKK O;  2DOS A;  4DV5 O;  5H5N A;  3J7A U;  2AGA A;  4JI6 O;  4JYA O;  3J81 N;  4X62 O;  4LF5 O;  5IWA O;  5IT9 N;  4DV4 O;  4DR1 O;  4JI2 O;  4AQY O;  4LFA O;  1F7Y A;  4LF7 O;  4LF4 O;  1FKA O;  5BR8 O;  4LFC O;  4JI5 O;  3J80 N;  4NXN O;  1N36 O;  2UXC O;  1X59 A;  1XNR O;  4X66 O;  4LFB O;  1IBL O;  2ZKO A;  2ZM6 O;  4JI8 O;  4JI4 O;  1HNZ O;  1XMO O;  1IBK O;  3O65 A;  5BY1 A;  1D2D A;  2DJV A;  1R6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...