4X65O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x65O00
3RT3C 2DJVA 4YHHO 5BXZA 4JI7O 4DV1O 1F7YA 3R66A 4DV2O 1N34O 1N33O 4DR2O 1D2DA 4DV5O 4X65O 4DV4O 4JI4O 4B3RO 1G1XB 1YZBA 4OX9O 1IBLO 3M8AA 3T1HO 4JI6O 2UUBO 1XMOO 4B3SO 4LF8O 2E5LO 4GKJO 2N74A 4B3MO 4AQYO 4KHPO 4JI2O 4X64O 5BY1A 4JV5O 2HHHO 5LL6Y 4LFCO 1FKAO 1X59A 3SDLA 1XMQO 2UUAO 2UUCO 4NXMO 2JRIA 5H5NA 5LMNO 4B3TO 3T1YO 4DR5O 1HNZO 1HNWO 5A2QN 3J7AU 3OTOO 2VQFO 2AGAA 2F4VO 4JI5O 2ZM6O 1NS1A 4DR7O 4DR6O 4DR3O 4DV7O 3J81N 1AB3A 1J5EO 1R6TA 1IBKO 2LW7A 3O65A 1FYJA 4OPHA 1HNXO 4K0KO 4DV3O 1DK1A 4DR1O 4X66O 4A5UB 4LF7O 4LFBO 3J80N 4LFAO 1N32O 2UXDO 4DV0O 2DOSA 4JI0O 4X62O 5LMUO 1XEQA 5IT9N 4NXNO 2FKXA 1KUQA 1XNQO 1R1BA 1FJGO 4LF5O 1N36O 3JAMN 1HR0O 4GKKO 4JI1O 2UXCO 2ZKOA 1IBMO 4DV6O 3F5TA 2UU9O 1I94O 4JI8O 5FLXN 5BR8O 4DR4O 1XNRO 2Z0AA 4YY3O 2VQEO 4JYAO 4DUYO 4DUZO 1AILA 4JI3O 2UXBO 1A32A 4OPAA 4LF4O 4LF9O 5IWAO 4LF6O
chains in the Genus database with same CATH superfamily
5LGUA 4LF7B 3H9VA 5LYJA 2Q7GA 1Y6XA 2NNUA 5B1BB 4JYCA 3JD4A 4DV0B 5LOVB 1H2MA 3JASA 5C8YB 4G2KA 1S76D 1I0HA 3KG2A 1D2DA 1SQQH 2F95B 2ZXWC 5ITZA 5HFMA 2E5LO 2HFEC 4TV8A 5L3BA 5E79Z 3ZHTA 1H8HG 2WLNA 3OUFA 4JI2O 3B8NA 3FB5C 1BMFG 4IT5A 5LYJB 4QPKA 2GSMB 2E75B 1XHZA 1AJQA 3P30A 3JASB 4LH6A 1VQ8V 2RCVA 1FPOA 1NTKH 4TV8B 4O2AA 5B1AB 4U3JA 1NS1A 2M6YA 1NR7A 1Q3EA 2IJIA 4LP8A 2HEPA 3SYPA 1F51A 2LGWA 4JGSA 1GK9A 5JQGB 2YDEA 1AP5A 4C7UA 4LFBO 3J80N 2YXYA 2P7TC 1VQMV 5GTIZ 3ZMUA 2PYLA 3AK2A 5KAIZ 5IYCO 4U3JB 4NXMB 1N36O 1MSDA 3FAVA 3TJTA 1IDSA 3JD1A 4NTXA 5EZYB 3ZHRA 4K35A 4JI8O 4B3RB 4FLYA 3CCEV 4OX9B 1PPJH 3WG7C 2BTQB 4GX5A 2PYJA 3CXCU 3ZRSA 4J7KA 4OPAA 4WCEV 1KB9F 1OCCC 5GTHZ 5IJ9A 4LF9O 3G4SV 3W7WA 2L35A 4WFAV 1COWG 1HNXB 4I0XB 1W0KG 4GYCB 1JR9A 1XL6A 1SESA 2M7WA 5EBMC 2AZ2A 2Q73A 4I55A 1UJWB 3ETEA 1IBLO 1GM9A 4WFHA 3S3XA 5IJ9B 3SR2C 3MHHC 5IY5C 1M5IA 4KUMA 5JJJB 3APOA 1K73W 4FMTA 4QGPA 5L3FA 1OCOC 2X6BA 1QVGU 3IC9A 2ZXWB 4I55B 4DRXB 1PKXA 4RUFA 1H2SB 2AGAA 1ENVA 1AVMA 3CHXA 5H6RA 3TK1A 3CRCA 1AJNA 4W4KA 3OW2U 4DR6O 2WSSG 4HNAA 5KHKA 1PD3A 3P32A 1YSCA 1DK1A 1EM1A 3AG7A 4LF7O 5CBHA 4DV0O 4X64B 2B5UA 5KHGA 5LHGA 1YXBA 3SPCA 3QO7A 2ZDIA 1AI7A 4CH4A 4RUEA 2ZE6A 2NN4A 3C90A 3JAWA 4R50A 2Q8VA 3CS5A 4UCSA 4DXWA 3TCUA 2QWNB 1TAEA 1J95A 2CH7A 4IYHA 4ZKIA 2Q4PA 4CH6A 3NR7A 3ZMVA 1GM8A 1YVWA 1O9GA 1AR5A 1KBHA 2QKCA 3WG7B 2QA4V 1SETA 1N32B 2YUAA 1H2GA 2ILMA 4BWAA 3CCRV 3WU2Z 1OCCB 1XNQB 4NYKA 2QJ1A 4J7JA 1R3IC 3SPHA 2CH7B 1NBMG 1SF9A 1CPYA 4WBNA 4AI8A 2KG7B 4FFBA 4NXMO 1N4CA 3ZRWA 4F6RB 3IAYA 2YS8A 5IY5B 2XUMA 2QKAA 3CCSV 4WBNB 5KMGA 4GKKB 4YHHB 3E8BA 4HAMA 4UVAA 4FM2A 1OCOB 3OR7C 4FZ0A 4PDVA 1KU9A 2E3CA 3HPLC 2IH1C 5CA1B 2NLJC 1RPOA 3O65A 4DV4B 1R3LC 3F7YC 1HNXO 3OTFA 3B4SA 4MVSA 1VIBA 4PHZA 4H0LB 3SGIA 1TA8A 2FKXA 5KMGB 2CTPA 2Q0AA 3BCCH 4FLXA 2OCCC 2OIGA 4GX2A 3JAMN 2WLHA 4XDLA 2ZKOA 4D6TH 3F5TA 4K8ZA 5GONA 3RYIA 3FYEB 2YIBA 1KQSU 4UV8A 4DUYO 2ZNJA 2UXBO 1DTOA 1B04A 2B1GA 4DR1B 3CRMA 4MT8A 2ADPA 2XAGA 5GONB 3F5WC 3JD3A 3R66A 3TXQA 3OMAB 3RN4A 4J42A 4J10A 3K9AA 3B77A 3PN1A 2PI4A 1XQ8A 4KFMA 1I94B 4X64O 2GTAA 3ABLC 1IZ3A 4B7EA 1CXZB 2DWEC 1VF5B 1KYOF 1K34A 5LMUB 1YCIA 3D36C 4LH7A 4JF3A 3JCZA 2DN9A 2WLIA 1SQPH 4FM1A 4I50A 4EB6A 2JS5A 4ASUG 2PY5A 5K1PA 4I4TB 5LA6A 3SYOA 3ICXA 4DV2B 3JSNA 4DR2B 1IBKO 2Q69A 4UB8Z 4CS2A 2HR3A 1H2NA 4CC5A 2A9HA 3ML0A 1N32O 4B3MB 1FAFA 2WLIB 5IT9N 1XNQO 4YIPA 2UUCB 5LA6B 1PNMA 1M56C 1YIJV 3KCYA 4EFEA 3A0RA 1YEWA 1SKVA 4X1IA 3P3PA 2CGNA 2JEUA 2ZE7A 3B2EE 4JI5B 2B9ZA 4O4JA 3OEHG 3TGUH 4DYLA 5EC1C 1GKFA 2CE4A 3CJHA 4JI2B 3K0DA 4FPPA 1ROPA 2F43G 3THOA 3W7XA 1QLEC 3LSUA 4YHHO 1TVKA 1MMMA 5LXTB 1Q86W 3AEIA 4IIJA 4X62B 1E1QG 1YTFB 4O4JB 4GCZA 5B1BC 4DV4O 2Q9LA 1FJGB 3CJHB 2ZT9B 4OXSA 4GX1A 2UXCB 1OZ0A 4EKWA 2P4KA 2D3OW 2JK5C 3E35A 5AG2A 2QSAA 4JTAB 2P4VA 4QPJA 3D36A 2X0LA 1TUBB 2KB1A 2IH3C 4LWSB 2O57A 3KKYA 4LF6B 1Y74B 2W6JG 3ABLB 3QF7A 3I5DA 4WF9V 3T4DA 1VQOV 2JJ1G 5EYPA 3AG4C 3K79A 2PI5A 4JI7B 1EN6A 2HKOA 3JSLA 3UCSC 3SPIA 1US6A 4UCOA 1NH2D 3GWOA 2LQTA 5KHHA 3CB2A 1R6TA 3ASNC 1VQKV 4JYBA 2QTSA 3T1HB 1K92A 4DR1O 4O4IA 1RPRA 1Z5WA 3HKBA 3L73H 3EVKA 3HKDA 4Z2WA 1JJ2U 4PA3A 1AI6A 5KUMA 5EYPB 4TQDA 3ZMZA 3ETGA 1W2BU 1S0VA 2H3OA 4QIWF 3CMAV 2EX3A 3UQ8A 3ZHSA 1JJOA 2K9PA 1I94O 1MZFA 3AG1C 4O4IB 5JCOA 1PNLA 3HKBB 2X6AA 5DN6G 4I7ZB 4FLTA 3H1IH 4DR7B 5LGTA 3HKDB 2YEVA 4B7KA 1M56B 1HP8A 2OYQA 2HP8A 3X2QC 5IYZA 1NR1A 4PA7A 4BIZA 3K08A 4LFAB 3JATB 2UXDB 1YHQV 5TISZ 3D8CA 4DV2O 3CRQA 4QNHB 4UCRA 4DR2O 3BVOA 3CEIA 2A7WA 2Y4UA 4JAUA 3FB6C 2YEVB 4DR6B 5JJEB 2KKWA 4G28B 5JH7A 1QLEB 4J41A 1SRYA 2YI9A 3STZC 4BIUA 3OGIB 4B3MO 5BR8B 3ZS8C 3HKCA 1XDCA 5LL6Y 3JD2A 2UUCO 2QWRB 5FNVA 3CCJV 3B09A 1V55C 2F93B 2QWPB 3T4ZA 3UT5B 2ITCC 2WLJA 4K8XA 4JI5O 5D5PA 1YI2V 1PNKA 3OFNG 1SZXA 2EBOA 2GUZB 5B3SC 3HKCB 1F4NA 1OCZC 1P4RA 5FNVB 3DC5A 3OAAG 2VWKA 2Z5UA 1FD9A 1D5AA 2ZD9A 4GKJB 3OEEG 4Z1VA 4UCUA 5HFLA 4ZOLA 1V54C 3AG4B 4X62O 4YJ2A 5ITZB 1AI5A 3ASOB 3CCLV 1Q81W 1KUQA 4PA6A 3KCXA 1Y4MA 1FJGO 3ASNB 1Q43A 3BFRA 2HVJC 5DEDA 1YJ9V 4WFFA 2BOBC 4DR5B 2UXCO 1M9NA 2QM7A 1R3JC 2QWQB 1Y67A 4YXWG 3UM7A 3JD0A 1W59A 5JVDA 2W6IG 3VQXA 1F23A 2ZR3A 4J7ZA 4YJ2B 2JJ2G 2AHZA 3K59A 3G71V 4DV7B 1VMGA 3SYCA 4O2AB 2R9RB 4ZHQA 2RDCA 4LF6O 3FB7C 4X89A 2X7RB 2XAQA 3AG1B 4RQEA 3ETDA 2P5OA 4JI7O 2KQXA 4ZIBA 2ZDIC 1H2LA 5JVDB 1BE3H 1U97A 4DW1A 3X2QB 3T1HO 3G6EV 3NXSA 2IBZH 5D5QA 2X6CA 3UKMA 4ZHQB 2P90A 2JGUA 4F6EA 3E83A 2JGDA 4MVZA 3FAVB 5IYDO 1Q6UA 1R3KC 4O2BA 3W7UA 5B5EZ 4JYAB 4CC6A 3JALA 4DUZB 4QJFB 1QLNA 4JAAA 1K97A 2CUGA 5L3GA 1I08A 4HZ3A 1M93A 4FLWA 4DR7O 1OCRC 4O2BB 3T2MA 2RN9A 1V55B 3VBBA 3I55V 4DUYB 2QM8A 1XILA 2UXBB 1SQVH 4UFZA 1HW7A 4LFAO 3ETQA 4AQYB 2UXDO 2V1DA 5B3SB 3H1JH 4JV5B 1EFRG 4I9QA 1R1BA 1OCZB 1UPGA 4PDMA 4X9QA 5LGNA 1HNZB 4PA4A 5BR8O 5J2TA 1RM1C 1SQGA 2A79B 4PV1B 1V54B 2IJJA 2EZOA 1N0JA 1JVMA 1XOUA 2P6JA 2WA3A 1FFTB 1QR9A 5EIBC 1LR1A 2BSKA 3DTUB 1KKCA 1URFA 1XEQA 1P49A 4HNAB 5FL7G 3EXAA 3JCUZ 1KKDA 3BY6A 5J2TB 1F7YA 2EILB 3QNEA 2ZCEA 1BL8A 2AXTZ 2AW9A 3K03A 3M8AA 1DF5A 4X1YA 4GKJO 1T5EA 2F66C 2JVDA 1NVPB 4DR4B 1GM7A 1IBKB 4UCTA 1XUQA 1SA0A 5KAFZ 5F2VO 3AG3C 4PI0A 2GDSA 3E86A 5H5NA 5CBGA 3JAWB 5H2FZ 4PA9A 4LF4B 3K3WA 4DR5O 4TOIA 3RVYA 1OV9A 5B66Z 5IWAB 3AK1A 3LDEA 2EULA 3OR6C 2F4VO 4N21A 3LNNA 2W0XA 4L87A 4DK0A 1PL4A 3DXRA 2XHBA 5A9GA 2MK3A 4DV1B 3R65A 2XAJA 1JMKC 1SA0B 3QO5A 4DV7O 2WA4A 1JCHA 4X65B 1P84F 3STLC 4JI6B 4LF8B 1EZVH 1K33A 2IJHA 4E4EA 1S72V 2DOSA 2ITDC 2ATKC 1OCRB 5E1AC 1TGOA 3F7VC 4ZI7A 4I9WA 4BIOA 3CC2V 4L8JA 1BT8A 4FFBB 4KP4A 5FLXN 2R9IA 3CSXA 1QQCA 3ZRWB 3CC7V 3A8TA 2GV9A 2QWOB 3UO2A 2OTJV 5CMUA 1EBOA 2Q7HA 4JYAO 4B08A 4DUZO 1GH6A 3LSSA 2YIBD 3K04A 5CB4A 2Y69C 2N04A 1RM1B 1Y66A 5EK0A 2N05A 3BAAA 3E22A 4X66B 2DJVA 3U10A 4P9OA 3BEHA 1IX9A 1LUVA 4J11A 4R8CA 4JI0B 4JZ2A 1BQ0A 5B1OA 1WJZA 3E8HA 3P3NA 3SJCC 1G1XB 2OCHA 3JAKA 5JWPA 3OM3B 4DK1A 4UV9A 3A0HZ 4O4LA 2RNBA 1SQBH 4X88A 4DV6B 3Q4HA 3OD4A 4AQYO 3B8MA 1SQFA 3CD6V 1BSMA 3C3TA 4UCVA 2ADQB 3E22B 1KC8W 4JV5O 4MS2A 2B1IA 2IU3A 4O4HA 2JRIA 3RYIB 3S3WA 1HNZO 5FPRA 5A2QN 2LJ2A 3JAKB 3WB0A 3B40A 4UB6Z 2OWOA 1L8DA 3AG3B 3Q4HB 3OMNB 2NR5A 2CTQA 4IGGA 1Q7YW 3VQVA 2ZIOA 4HBNA 1VQPV 1N33B 2LP7A 1NZ6A 1AB3A 1VF6A 4O4HB 1BQZA 4FVMA 3HB3B 4PJ0Z 2ZE5A 1VEWA 2WAMA 2DE0X 1SQXH 2WWWA 3RBZA 1VQ7V 1ZX3A 2XOKG 2HHHB 1XMQB 2E74B 2UUAB 2WLKA 1KMIZ 1PL0A 4U3FH 2Q7EA 3RW0A 4DR4O 2BOCC 3BPZA 3E2EA 1XNRO 2CK3G 3K9SA 1YJNV 1RSOA 4CS3A 4P9PA 4WFGA 1YTFD 2A0LA 3QVNA 1ZAUA 4LF4O 4I50B 4EB6B 1VQ9V 5IWAO 1MSWD 3RGBA 2F1MA 1ZL8A 1NKDA 1X4TA 4DV1O 1VQNV 3SJAC 1GRJA 1MABG 3SPJA 2Y69B 4X65O 1B6QA 3RVZA 3CPWU 1YZBA 1XREA 1SZTA 5JCOC 3ZN0A 4JI6O 1FXVA 4LF8O 4JI1B 2UXNA 4J9YB 1NQTA 2Y0IA 3EHBB 5BY1A 3LNMB 4MW8A 1FKAO 4YY3B 1XL4A 1ORQC 1R73A 4X1IB 3UO3A 1P7BA 4B3TO 3ABTA 2W0FC 2CAZC 3WB2A 2R9AA 2EIMC 4MTGA 2F23A 1E79G 3ZHUA 5H9CA 5K1XA 3H1KH 5KHIA 3OGCC 2Q6AA 5KUKA 1N34B 5C93A 1GN4A 4TV9A 3J81N 1TVKB 4LBEC 2WLLA 1K8AW 2UXXA 1B06A 4IIJB 4TUYA 1XMOB 4X66O 2XAFA 5IE9A 3IC7A 4KHPB 1THZA 2BE3A 1QBZA 4JI0O 1FFXA 4AILC 3H1HH 5LP6A 2YIAA 4YIOA 4CH3A 3A0BZ 4TV9B 1K9MW 3ASOC 4DV6O 2WLLB 1GN2A 4TUYB 1WA8A 2FMLA 3RYHA 2ZM6B 3WB1A 2Y0PA 1SC5B 4IHJA 2CDYA 4FLVA 2PUSA 1FFXB 3O9OA 5KHJA 4DR3B 3GB7C 1JA8A 4GZRB 4X20A 1WPBA 2OT5A 4MSWC 1S77D 3VQYA 2GTSA 4R7CA 2HJDA 1YF2A 2AZ0A 1WA8B 1Q5OA 2DQ3A 2VS0A 1NJIW 4IHJB 1N33O 2HJFC 4PDRA 1LNQA 1NU1H 4B3SO 2IJKA 2UU9B 1Z5VA 2WPDG 2MW2B 2HHHO 4FLUA 1BS3A 1X59A 2EIJC 1XMQO 2UUAO 3K5LA 3ZMSA 4BR6A 2OTLV 1U96A 1CP9A 2XTAA 3M99B 2GBOA 2ZIMA 3GWKC 1JFFA 2YSUB 4JAVA 4MVRA 4TQFA 4NB5A 1P7GA 3ZN1A 4RAIA 5IDJA 5IYZB 1R6NA 2E76B 3RWRD 2DW4A 1K4CC 1XHXA 2IU0A 3RYFA 4JI4B 1I5XA 2EIMB 1Z2GA 3E8FA 5IYBO 5LOVA 3APQA 4A5UB 1VQ5V 3U0ZA 4R6ZA 5H6QA 1Q8IA 2QE7G 3TETA 2Q0OC 3CC4V 4LR3A 4X8AA 5JH7B 1R6KA 3ZRXA 3PJSK 1KP2A 4NR1A 1KP3A 3L70H 4LC1A 5KLVH 3CWBH 4JI1O 3RYFB 1PV0A 3RYCA 3E89A 2WLMA 1IVSA 2OIEA 4MTXA 2D2CB 1K5SA 4JYYA 4YY3O 1MNGA 3FFQA 5DM6V 3BRCA 3VOUA 4H44B 4TSFG 1MOFA 1JQ0A 2A06H 1I7FA 2HLDG 2DYRC 1H8EG 1G6UA 3MD0A 1EN4A 4CS4A 4H37A 3RYCB 2FL4A 1N34O 3ZMTA 2ZNIA 5JQGA 4NXNB 2F4VB 4JTDB 2EZPA 3K57A 1YITV 3BA9A 4ZOLB 3DC6A 2XASA 2EILC 1XMOO 3SJBC 4I5SA 4W4LA 2N74A 1IBMB 3TXSA 4KHPO 4CH5A 1NTZH 2Q67A 5EZYA 1G8MA 1W0JG 3QG5A 3G6BA 1MZEA 2BTQA 4X1KA 3EFFK 5BZBA 3BABA 1M90W 2ZM6O 4MVQA 4WFEA 4PI2A 2DQ0A 2EIJB 1AJPA 4ZBMA 4I0XA 2IM9A 1GN3A 4DR3O 3BA8A 1WN7A 2Q5ZA 4DV5B 4OPHA 4DW0A 1ZSPA 3H01A 4DV3O 3CCMV 4EEQA 4CBCA 3SYAA 5L3DA 2K1EA 4X1KB 3ZHVA 3CXHF 5LBQA 1LUWA 3ABUA 1FXKC 4ABMA 2QDOA 3SJQC 4LF5O 2YIDA 3G80A 2JGDB 1IURA 2L6LA 1HNWB 1I5YA 3L9DA 2UU9O 4FLZA 3JALB 4Q20A 1MG1A 3L74H 4DRXA 1M1KW 2VQEO 2LO1A 4QE9A 4XBFA 1QHTA 4ICGA 4TT3G 4PDLA 4F4LA 1PP9H 1KECA 4U7NA 3M7MX 3QO8A 3ZJZA 3N27A 3BHPA 2XAHA 1NVPD 2ZQMA 3CRRA 1WAZA 2EINC 1N8RW 5LHHA 2GHYA 2VRZA 4BAYA 1D5NA 3K5NA 4JI4O 3CYOA 2DYRB 3CP1A 4MW3A 3ABMC 1XI1A 4U7OA 4UUJC 5CBFA 3CRAA 1VARA 5FPOA 3ZRVA 4LFCO 3LDCA 3SDLA 1WB7A 3CX5F 3SYQA 3D3QA 1N0NA 2Q68A 1L0NH 1OJHA 1DF4A 2ODMA 1SS3A 1WLEA 1GN6A 2H94A 3ABKC 3L71H 3CE2A 2VWJA 2BSKB 1Q6HA 1NI8A 4UVBA 1JOYA 1QR8A 5CN0A 1WB8A 1KD1W 1XNRB 1JX9A 3IFXA 2P06A 3RFRA 4MVOA 5JJNB 3E8GA 3FKSG 1FXKA 4JPRA 4J9ZB 2XNDG 1S3JA 4NXNO 1WPXA 4X1YB 3K58A 1L0LH 4N23A 2KG7A 1ZTEA 2QGNA 1YJWV 4RQFA 1F4MA 1G4YB 2V4DA 3QTCA 3K06A 1IBMO 3OTOB 2VQFB 3ZCCA 3OE7G 3K0GA 4XDJA 4F6RA 3CCVV 1VF6C 2CTRA 2Z0AA 1NTMH 1FXKB 4FM0A 1Q6IA 4AHCA 5EIBD 4MTFA 1BGYH 2PF4E 1J5EB 3DXRB 4B3TB 3RT3C 5CA1A 5EC2C 3N2GA 2JDIG 2R70A 2V7QG 2QM4A 4DV5O 2A3QA 4B3RO 4OX9O 2RMKB 2BCCH 3K5OA 4FFKA 1QU7A 4GT1A 4JASA 5DECA 3LDDA 5B1NA 4LCUC 2Z3YA 1XBLA 3KZIZ 2YI8A 1ZLZA 2EINB 4G27B 1AI4A 4ZI7B 2YXLA 1DLBA 3N2GB 4RO2A 5L3EA 1GAXA 5KX5A 1PM9A 1MA1A 1HNWO 1AP6A 1S5HC 3J7AU 5EBWC 4WFBV 5L3CA 3ABMB 2LGQA 4JZGA 5CB4B 3IGAC 1YDXA 1AR4A 3FX7A 4JTCB 1IXBA 5LHIA 1SERA 2HVKC 1VQ6V 1EN5A 2CTWA 2ZINA 4OGQB 1HDJA 3GVMA 5EBLC 3G67A 4MVUA 4D7TA 5KX5B 2RQ6A 2UUBB 4J80A 3ABKB 4H13B 1S5LZ 4O4LB 1K5QA 1BCCH 1H2KA 5LMNB 4Z1MG 3T1YB 1M4UA 4B3SB 1O9HA 2P67A 1V9PA 1GTOA 2DWDC 4CZZA 2FTKA 1ZWIC 1AILA 5BMVA 1VQLV 4E2LA 3I56V 2FB5A 3ZIAG 2LW1A 4I4TA 2XT9A 1BZKA 3OMIB 1E1RG 2ETNA 4NTYA 4YJ3A 4MTOA 2Y4TA 4K0KB 5LP6C 1VF7A 2C2AA 2YXHA 1K7DA 1WP7A 1WNSA 3W7SA 1K3EA 5KA5A 4FZ1A 2HG5C 2JEXA 5BMVB 4IL6Z 4TWKA 2FYUH 4XDKA 2H8PC 4NVPA 1HR0B 1QCEA 3L75H 2IW5A 4YJ3B 3AG2C 1BHAA 1UFIA 4K3AA 1M57C 1K4DC 3CCUV 4FJCC 3MAQA 4GUNA 4JI3B 1TUEB 3OUSA 1H38A 1RSOB 4PELA 3OTOO 2VQFO 1ZUQA 2LFSA 4UVCA 4P30A 1GO3F 3K5MA 3MDSA 2YICA 3N2KA 3ZEDA 1J5EO 3FB8C 1ZL8B 2LW7A 4P2ZA 3WFVA 3ZHQA 3T1CA 5LXTA 1FYJA 1QVFU 2QR4A 2QKSA 3IJ4A 2E5LB 1VQ4V 4GLXA 2OCCB 2PZSA 5CA0A 1JPXA 2KSDA 4Q6GA 1IXMA 2EIKC 3N2KB 3JYCA 2LFRA 1DGSA 4GKKO 5KA6A 4BW9A 5J2UA 5J9PC 3ZX6A 2DYSC 2QEXV 1Y76A 2ZE8A 4H33A 2BTOA 1TUBA 4LWSA 1AR1B 3LSQA 2JIZG 4MVMA 5CA0B 1S5JA 1Y74A 1A32A 2P22C 4UXNA 1NT2B 2RJZA 5J2UB 1GMGA 4LFBB 3LUTB 5BXZA 1Y76B 5CA3A 2PGGA 3CCQV 3U11A 1VP7A 4FK5C 1N36B 1WP8A 3JARA 2UUBO 4PD4F 5LP6B 4GX0A 4JI8B 2JS3A 5GW7A 5B1AC 4DV3B 2ARHA 4LNUA 3DSQA 3ZBHA 5LMNO 1QNMA 4KXRA 3RYHB 2EJ7A 3T1YO 4LF9B 1RP3B 2ZR2A 3JARB 1FS0G 4LF5B 1RFYA 1CEZA 2QTOA 3L72H 3AG2B 4DO2A 2Y48A 1M57B 4X20B 1HWYA 3AK3A 4HYOA 1OHHG 3CMEV 3MHSC 4LNUB 3JATA 3D3IA 2VQEB 3HKEA 3SPGA 1IBLB 4K0KO 3A2FA 2AHYA 2EJRA 4FIPC 1B3QA 4D7SA 3HR0A 5LMUO 3OT7A 2G38A 4BW5A 3DGEA 5IJ0A 1NH2B 4IYIA 1AROP 2R72A 1EZJA 3FD9A 4QE7A 1L1FA 4NTWA 2YC0A 3VQWA 1HR0O 1FXHA 4RWUA 1Q82W 3FYIB 3HKEB 2CGOA 4EFBA 1Q90D 2PTMA 4NKGB 5C8YA 3UT5A 4JI3O 3W7TA 2EIKB 5IJ0B 3H1LH 4KL1A 1BHBA 4LFCB 1JFFB 3C3SA 2DMXA 2GUZA 2DYSB
chains in the Genus database with same CATH topology
3RT3C 2DJVA 4YHHO 5BXZA 4JI7O 4DV1O 1F7YA 3R66A 4DV2O 1N34O 1N33O 4DR2O 1D2DA 4DV5O 4X65O 4DV4O 4JI4O 4B3RO 1G1XB 1YZBA 4OX9O 1IBLO 3M8AA 3T1HO 4JI6O 2UUBO 1XMOO 4B3SO 4LF8O 2E5LO 4GKJO 2N74A 4B3MO 4AQYO 4KHPO 4JI2O 4X64O 5BY1A 4JV5O 2HHHO 5LL6Y 4LFCO 1FKAO 1X59A 3SDLA 1XMQO 2UUAO 2UUCO 4NXMO 2JRIA 5H5NA 5LMNO 4B3TO 3T1YO 4DR5O 1HNZO 1HNWO 5A2QN 3J7AU 3OTOO 2VQFO 2AGAA 2F4VO 4JI5O 2ZM6O 1NS1A 4DR7O 4DR6O 4DR3O 4DV7O 3J81N 1AB3A 1J5EO 1R6TA 1IBKO 2LW7A 3O65A 1FYJA 4OPHA 1HNXO 4K0KO 4DV3O 1DK1A 4DR1O 4X66O 4A5UB 4LF7O 4LFBO 3J80N 4LFAO 1N32O 2UXDO 4DV0O 2DOSA 4JI0O 4X62O 5LMUO 1XEQA 5IT9N 4NXNO 2FKXA 1KUQA 1XNQO 1R1BA 1FJGO 4LF5O 1N36O 3JAMN 1HR0O 4GKKO 4JI1O 2UXCO 2ZKOA 1IBMO 4DV6O 3F5TA 2UU9O 1I94O 4JI8O 5FLXN 5BR8O 4DR4O 1XNRO 2Z0AA 4YY3O 2VQEO 4JYAO 4DUYO 4DUZO 1AILA 4JI3O 2UXBO 1A32A 4OPAA 4LF4O 4LF9O 5IWAO 4LF6O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT3 C;  2DJV A;  4YHH O;  5BXZ A;  4JI7 O;  4DV1 O;  1F7Y A;  3R66 A;  4DV2 O;  1N34 O;  1N33 O;  4DR2 O;  1D2D A;  4DV5 O;  4X65 O;  4DV4 O;  4JI4 O;  4B3R O;  1G1X B;  1YZB A;  4OX9 O;  1IBL O;  3M8A A;  3T1H O;  4JI6 O;  2UUB O;  1XMO O;  4B3S O;  4LF8 O;  2E5L O;  4GKJ O;  2N74 A;  4B3M O;  4AQY O;  4KHP O;  4JI2 O;  4X64 O;  5BY1 A;  4JV5 O;  2HHH O;  5LL6 Y;  4LFC O;  1FKA O;  1X59 A;  3SDL A;  1XMQ O;  2UUA O;  2UUC O;  4NXM O;  2JRI A;  5H5N A;  5LMN O;  4B3T O;  3T1Y O;  4DR5 O;  1HNZ O;  1HNW O;  5A2Q N;  3J7A U;  3OTO O;  2VQF O;  2AGA A;  2F4V O;  4JI5 O;  2ZM6 O;  1NS1 A;  4DR7 O;  4DR6 O;  4DR3 O;  4DV7 O;  3J81 N;  1AB3 A;  1J5E O;  1R6T A;  1IBK O;  2LW7 A;  3O65 A;  1FYJ A;  4OPH A;  1HNX O;  4K0K O;  4DV3 O;  1DK1 A;  4DR1 O;  4X66 O;  4A5U B;  4LF7 O;  4LFB O;  3J80 N;  4LFA O;  1N32 O;  2UXD O;  4DV0 O;  2DOS A;  4JI0 O;  4X62 O;  5LMU O;  1XEQ A;  5IT9 N;  4NXN O;  2FKX A;  1KUQ A;  1XNQ O;  1R1B A;  1FJG O;  4LF5 O;  1N36 O;  3JAM N;  1HR0 O;  4GKK O;  4JI1 O;  2UXC O;  2ZKO A;  1IBM O;  4DV6 O;  3F5T A;  2UU9 O;  1I94 O;  4JI8 O;  5FLX N;  5BR8 O;  4DR4 O;  1XNR O;  2Z0A A;  4YY3 O;  2VQE O;  4JYA O;  4DUY O;  4DUZ O;  1AIL A;  4JI3 O;  2UXB O;  1A32 A;  4OPA A;  4LF4 O;  4LF9 O;  5IWA O;  4LF6 O; 
#chains in the Genus database with same CATH topology
 5LGU A;  4LF7 B;  3H9V A;  5LYJ A;  2Q7G A;  1Y6X A;  2NNU A;  5B1B B;  4JYC A;  3JD4 A;  4DV0 B;  5LOV B;  1H2M A;  3JAS A;  5C8Y B;  4G2K A;  1S76 D;  1I0H A;  3KG2 A;  1D2D A;  1SQQ H;  2F95 B;  2ZXW C;  5ITZ A;  5HFM A;  2E5L O;  2HFE C;  4TV8 A;  5L3B A;  5E79 Z;  3ZHT A;  1H8H G;  2WLN A;  3OUF A;  4JI2 O;  3B8N A;  3FB5 C;  1BMF G;  4IT5 A;  5LYJ B;  4QPK A;  2GSM B;  2E75 B;  1XHZ A;  1AJQ A;  3P30 A;  3JAS B;  4LH6 A;  1VQ8 V;  2RCV A;  1FPO A;  1NTK H;  4TV8 B;  4O2A A;  5B1A B;  4U3J A;  1NS1 A;  2M6Y A;  1NR7 A;  1Q3E A;  2IJI A;  4LP8 A;  2HEP A;  3SYP A;  1F51 A;  2LGW A;  4JGS A;  1GK9 A;  5JQG B;  2YDE A;  1AP5 A;  4C7U A;  4LFB O;  3J80 N;  2YXY A;  2P7T C;  1VQM V;  5GTI Z;  3ZMU A;  2PYL A;  3AK2 A;  5KAI Z;  5IYC O;  4U3J B;  4NXM B;  1N36 O;  1MSD A;  3FAV A;  3TJT A;  1IDS A;  3JD1 A;  4NTX A;  5EZY B;  3ZHR A;  4K35 A;  4JI8 O;  4B3R B;  4FLY A;  3CCE V;  4OX9 B;  1PPJ H;  3WG7 C;  2BTQ B;  4GX5 A;  2PYJ A;  3CXC U;  3ZRS A;  4J7K A;  4OPA A;  4WCE V;  1KB9 F;  1OCC C;  5GTH Z;  5IJ9 A;  4LF9 O;  3G4S V;  3W7W A;  2L35 A;  4WFA V;  1COW G;  1HNX B;  4I0X B;  1W0K G;  4GYC B;  1JR9 A;  1XL6 A;  1SES A;  2M7W A;  5EBM C;  2AZ2 A;  2Q73 A;  4I55 A;  1UJW B;  3ETE A;  1IBL O;  1GM9 A;  4WFH A;  3S3X A;  5IJ9 B;  3SR2 C;  3MHH C;  5IY5 C;  1M5I A;  4KUM A;  5JJJ B;  3APO A;  1K73 W;  4FMT A;  4QGP A;  5L3F A;  1OCO C;  2X6B A;  1QVG U;  3IC9 A;  2ZXW B;  4I55 B;  4DRX B;  1PKX A;  4RUF A;  1H2S B;  2AGA A;  1ENV A;  1AVM A;  3CHX A;  5H6R A;  3TK1 A;  3CRC A;  1AJN A;  4W4K A;  3OW2 U;  4DR6 O;  2WSS G;  4HNA A;  5KHK A;  1PD3 A;  3P32 A;  1YSC A;  1DK1 A;  1EM1 A;  3AG7 A;  4LF7 O;  5CBH A;  4DV0 O;  4X64 B;  2B5U A;  5KHG A;  5LHG A;  1YXB A;  3SPC A;  3QO7 A;  2ZDI A;  1AI7 A;  4CH4 A;  4RUE A;  2ZE6 A;  2NN4 A;  3C90 A;  3JAW A;  4R50 A;  2Q8V A;  3CS5 A;  4UCS A;  4DXW A;  3TCU A;  2QWN B;  1TAE A;  1J95 A;  2CH7 A;  4IYH A;  4ZKI A;  2Q4P A;  4CH6 A;  3NR7 A;  3ZMV A;  1GM8 A;  1YVW A;  1O9G A;  1AR5 A;  1KBH A;  2QKC A;  3WG7 B;  2QA4 V;  1SET A;  1N32 B;  2YUA A;  1H2G A;  2ILM A;  4BWA A;  3CCR V;  3WU2 Z;  1OCC B;  1XNQ B;  4NYK A;  2QJ1 A;  4J7J A;  1R3I C;  3SPH A;  2CH7 B;  1NBM G;  1SF9 A;  1CPY A;  4WBN A;  4AI8 A;  2KG7 B;  4FFB A;  4NXM O;  1N4C A;  3ZRW A;  4F6R B;  3IAY A;  2YS8 A;  5IY5 B;  2XUM A;  2QKA A;  3CCS V;  4WBN B;  5KMG A;  4GKK B;  4YHH B;  3E8B A;  4HAM A;  4UVA A;  4FM2 A;  1OCO B;  3OR7 C;  4FZ0 A;  4PDV A;  1KU9 A;  2E3C A;  3HPL C;  2IH1 C;  5CA1 B;  2NLJ C;  1RPO A;  3O65 A;  4DV4 B;  1R3L C;  3F7Y C;  1HNX O;  3OTF A;  3B4S A;  4MVS A;  1VIB A;  4PHZ A;  4H0L B;  3SGI A;  1TA8 A;  2FKX A;  5KMG B;  2CTP A;  2Q0A A;  3BCC H;  4FLX A;  2OCC C;  2OIG A;  4GX2 A;  3JAM N;  2WLH A;  4XDL A;  2ZKO A;  4D6T H;  3F5T A;  4K8Z A;  5GON A;  3RYI A;  3FYE B;  2YIB A;  1KQS U;  4UV8 A;  4DUY O;  2ZNJ A;  2UXB O;  1DTO A;  1B04 A;  2B1G A;  4DR1 B;  3CRM A;  4MT8 A;  2ADP A;  2XAG A;  5GON B;  3F5W C;  3JD3 A;  3R66 A;  3TXQ A;  3OMA B;  3RN4 A;  4J42 A;  4J10 A;  3K9A A;  3B77 A;  3PN1 A;  2PI4 A;  1XQ8 A;  4KFM A;  1I94 B;  4X64 O;  2GTA A;  3ABL C;  1IZ3 A;  4B7E A;  1CXZ B;  2DWE C;  1VF5 B;  1KYO F;  1K34 A;  5LMU B;  1YCI A;  3D36 C;  4LH7 A;  4JF3 A;  3JCZ A;  2DN9 A;  2WLI A;  1SQP H;  4FM1 A;  4I50 A;  4EB6 A;  2JS5 A;  4ASU G;  2PY5 A;  5K1P A;  4I4T B;  5LA6 A;  3SYO A;  3ICX A;  4DV2 B;  3JSN A;  4DR2 B;  1IBK O;  2Q69 A;  4UB8 Z;  4CS2 A;  2HR3 A;  1H2N A;  4CC5 A;  2A9H A;  3ML0 A;  1N32 O;  4B3M B;  1FAF A;  2WLI B;  5IT9 N;  1XNQ O;  4YIP A;  2UUC B;  5LA6 B;  1PNM A;  1M56 C;  1YIJ V;  3KCY A;  4EFE A;  3A0R A;  1YEW A;  1SKV A;  4X1I A;  3P3P A;  2CGN A;  2JEU A;  2ZE7 A;  3B2E E;  4JI5 B;  2B9Z A;  4O4J A;  3OEH G;  3TGU H;  4DYL A;  5EC1 C;  1GKF A;  2CE4 A;  3CJH A;  4JI2 B;  3K0D A;  4FPP A;  1ROP A;  2F43 G;  3THO A;  3W7X A;  1QLE C;  3LSU A;  4YHH O;  1TVK A;  1MMM A;  5LXT B;  1Q86 W;  3AEI A;  4IIJ A;  4X62 B;  1E1Q G;  1YTF B;  4O4J B;  4GCZ A;  5B1B C;  4DV4 O;  2Q9L A;  1FJG B;  3CJH B;  2ZT9 B;  4OXS A;  4GX1 A;  2UXC B;  1OZ0 A;  4EKW A;  2P4K A;  2D3O W;  2JK5 C;  3E35 A;  5AG2 A;  2QSA A;  4JTA B;  2P4V A;  4QPJ A;  3D36 A;  2X0L A;  1TUB B;  2KB1 A;  2IH3 C;  4LWS B;  2O57 A;  3KKY A;  4LF6 B;  1Y74 B;  2W6J G;  3ABL B;  3QF7 A;  3I5D A;  4WF9 V;  3T4D A;  1VQO V;  2JJ1 G;  5EYP A;  3AG4 C;  3K79 A;  2PI5 A;  4JI7 B;  1EN6 A;  2HKO A;  3JSL A;  3UCS C;  3SPI A;  1US6 A;  4UCO A;  1NH2 D;  3GWO A;  2LQT A;  5KHH A;  3CB2 A;  1R6T A;  3ASN C;  1VQK V;  4JYB A;  2QTS A;  3T1H B;  1K92 A;  4DR1 O;  4O4I A;  1RPR A;  1Z5W A;  3HKB A;  3L73 H;  3EVK A;  3HKD A;  4Z2W A;  1JJ2 U;  4PA3 A;  1AI6 A;  5KUM A;  5EYP B;  4TQD A;  3ZMZ A;  3ETG A;  1W2B U;  1S0V A;  2H3O A;  4QIW F;  3CMA V;  2EX3 A;  3UQ8 A;  3ZHS A;  1JJO A;  2K9P A;  1I94 O;  1MZF A;  3AG1 C;  4O4I B;  5JCO A;  1PNL A;  3HKB B;  2X6A A;  5DN6 G;  4I7Z B;  4FLT A;  3H1I H;  4DR7 B;  5LGT A;  3HKD B;  2YEV A;  4B7K A;  1M56 B;  1HP8 A;  2OYQ A;  2HP8 A;  3X2Q C;  5IYZ A;  1NR1 A;  4PA7 A;  4BIZ A;  3K08 A;  4LFA B;  3JAT B;  2UXD B;  1YHQ V;  5TIS Z;  3D8C A;  4DV2 O;  3CRQ A;  4QNH B;  4UCR A;  4DR2 O;  3BVO A;  3CEI A;  2A7W A;  2Y4U A;  4JAU A;  3FB6 C;  2YEV B;  4DR6 B;  5JJE B;  2KKW A;  4G28 B;  5JH7 A;  1QLE B;  4J41 A;  1SRY A;  2YI9 A;  3STZ C;  4BIU A;  3OGI B;  4B3M O;  5BR8 B;  3ZS8 C;  3HKC A;  1XDC A;  5LL6 Y;  3JD2 A;  2UUC O;  2QWR B;  5FNV A;  3CCJ V;  3B09 A;  1V55 C;  2F93 B;  2QWP B;  3T4Z A;  3UT5 B;  2ITC C;  2WLJ A;  4K8X A;  4JI5 O;  5D5P A;  1YI2 V;  1PNK A;  3OFN G;  1SZX A;  2EBO A;  2GUZ B;  5B3S C;  3HKC B;  1F4N A;  1OCZ C;  1P4R A;  5FNV B;  3DC5 A;  3OAA G;  2VWK A;  2Z5U A;  1FD9 A;  1D5A A;  2ZD9 A;  4GKJ B;  3OEE G;  4Z1V A;  4UCU A;  5HFL A;  4ZOL A;  1V54 C;  3AG4 B;  4X62 O;  4YJ2 A;  5ITZ B;  1AI5 A;  3ASO B;  3CCL V;  1Q81 W;  1KUQ A;  4PA6 A;  3KCX A;  1Y4M A;  1FJG O;  3ASN B;  1Q43 A;  3BFR A;  2HVJ C;  5DED A;  1YJ9 V;  4WFF A;  2BOB C;  4DR5 B;  2UXC O;  1M9N A;  2QM7 A;  1R3J C;  2QWQ B;  1Y67 A;  4YXW G;  3UM7 A;  3JD0 A;  1W59 A;  5JVD A;  2W6I G;  3VQX A;  1F23 A;  2ZR3 A;  4J7Z A;  4YJ2 B;  2JJ2 G;  2AHZ A;  3K59 A;  3G71 V;  4DV7 B;  1VMG A;  3SYC A;  4O2A B;  2R9R B;  4ZHQ A;  2RDC A;  4LF6 O;  3FB7 C;  4X89 A;  2X7R B;  2XAQ A;  3AG1 B;  4RQE A;  3ETD A;  2P5O A;  4JI7 O;  2KQX A;  4ZIB A;  2ZDI C;  1H2L A;  5JVD B;  1BE3 H;  1U97 A;  4DW1 A;  3X2Q B;  3T1H O;  3G6E V;  3NXS A;  2IBZ H;  5D5Q A;  2X6C A;  3UKM A;  4ZHQ B;  2P90 A;  2JGU A;  4F6E A;  3E83 A;  2JGD A;  4MVZ A;  3FAV B;  5IYD O;  1Q6U A;  1R3K C;  4O2B A;  3W7U A;  5B5E Z;  4JYA B;  4CC6 A;  3JAL A;  4DUZ B;  4QJF B;  1QLN A;  4JAA A;  1K97 A;  2CUG A;  5L3G A;  1I08 A;  4HZ3 A;  1M93 A;  4FLW A;  4DR7 O;  1OCR C;  4O2B B;  3T2M A;  2RN9 A;  1V55 B;  3VBB A;  3I55 V;  4DUY B;  2QM8 A;  1XIL A;  2UXB B;  1SQV H;  4UFZ A;  1HW7 A;  4LFA O;  3ETQ A;  4AQY B;  2UXD O;  2V1D A;  5B3S B;  3H1J H;  4JV5 B;  1EFR G;  4I9Q A;  1R1B A;  1OCZ B;  1UPG A;  4PDM A;  4X9Q A;  5LGN A;  1HNZ B;  4PA4 A;  5BR8 O;  5J2T A;  1RM1 C;  1SQG A;  2A79 B;  4PV1 B;  1V54 B;  2IJJ A;  2EZO A;  1N0J A;  1JVM A;  1XOU A;  2P6J A;  2WA3 A;  1FFT B;  1QR9 A;  5EIB C;  1LR1 A;  2BSK A;  3DTU B;  1KKC A;  1URF A;  1XEQ A;  1P49 A;  4HNA B;  5FL7 G;  3EXA A;  3JCU Z;  1KKD A;  3BY6 A;  5J2T B;  1F7Y A;  2EIL B;  3QNE A;  2ZCE A;  1BL8 A;  2AXT Z;  2AW9 A;  3K03 A;  3M8A A;  1DF5 A;  4X1Y A;  4GKJ O;  1T5E A;  2F66 C;  2JVD A;  1NVP B;  4DR4 B;  1GM7 A;  1IBK B;  4UCT A;  1XUQ A;  1SA0 A;  5KAF Z;  5F2V O;  3AG3 C;  4PI0 A;  2GDS A;  3E86 A;  5H5N A;  5CBG A;  3JAW B;  5H2F Z;  4PA9 A;  4LF4 B;  3K3W A;  4DR5 O;  4TOI A;  3RVY A;  1OV9 A;  5B66 Z;  5IWA B;  3AK1 A;  3LDE A;  2EUL A;  3OR6 C;  2F4V O;  4N21 A;  3LNN A;  2W0X A;  4L87 A;  4DK0 A;  1PL4 A;  3DXR A;  2XHB A;  5A9G A;  2MK3 A;  4DV1 B;  3R65 A;  2XAJ A;  1JMK C;  1SA0 B;  3QO5 A;  4DV7 O;  2WA4 A;  1JCH A;  4X65 B;  1P84 F;  3STL C;  4JI6 B;  4LF8 B;  1EZV H;  1K33 A;  2IJH A;  4E4E A;  1S72 V;  2DOS A;  2ITD C;  2ATK C;  1OCR B;  5E1A C;  1TGO A;  3F7V C;  4ZI7 A;  4I9W A;  4BIO A;  3CC2 V;  4L8J A;  1BT8 A;  4FFB B;  4KP4 A;  5FLX N;  2R9I A;  3CSX A;  1QQC A;  3ZRW B;  3CC7 V;  3A8T A;  2GV9 A;  2QWO B;  3UO2 A;  2OTJ V;  5CMU A;  1EBO A;  2Q7H A;  4JYA O;  4B08 A;  4DUZ O;  1GH6 A;  3LSS A;  2YIB D;  3K04 A;  5CB4 A;  2Y69 C;  2N04 A;  1RM1 B;  1Y66 A;  5EK0 A;  2N05 A;  3BAA A;  3E22 A;  4X66 B;  2DJV A;  3U10 A;  4P9O A;  3BEH A;  1IX9 A;  1LUV A;  4J11 A;  4R8C A;  4JI0 B;  4JZ2 A;  1BQ0 A;  5B1O A;  1WJZ A;  3E8H A;  3P3N A;  3SJC C;  1G1X B;  2OCH A;  3JAK A;  5JWP A;  3OM3 B;  4DK1 A;  4UV9 A;  3A0H Z;  4O4L A;  2RNB A;  1SQB H;  4X88 A;  4DV6 B;  3Q4H A;  3OD4 A;  4AQY O;  3B8M A;  1SQF A;  3CD6 V;  1BSM A;  3C3T A;  4UCV A;  2ADQ B;  3E22 B;  1KC8 W;  4JV5 O;  4MS2 A;  2B1I A;  2IU3 A;  4O4H A;  2JRI A;  3RYI B;  3S3W A;  1HNZ O;  5FPR A;  5A2Q N;  2LJ2 A;  3JAK B;  3WB0 A;  3B40 A;  4UB6 Z;  2OWO A;  1L8D A;  3AG3 B;  3Q4H B;  3OMN B;  2NR5 A;  2CTQ A;  4IGG A;  1Q7Y W;  3VQV A;  2ZIO A;  4HBN A;  1VQP V;  1N33 B;  2LP7 A;  1NZ6 A;  1AB3 A;  1VF6 A;  4O4H B;  1BQZ A;  4FVM A;  3HB3 B;  4PJ0 Z;  2ZE5 A;  1VEW A;  2WAM A;  2DE0 X;  1SQX H;  2WWW A;  3RBZ A;  1VQ7 V;  1ZX3 A;  2XOK G;  2HHH B;  1XMQ B;  2E74 B;  2UUA B;  2WLK A;  1KMI Z;  1PL0 A;  4U3F H;  2Q7E A;  3RW0 A;  4DR4 O;  2BOC C;  3BPZ A;  3E2E A;  1XNR O;  2CK3 G;  3K9S A;  1YJN V;  1RSO A;  4CS3 A;  4P9P A;  4WFG A;  1YTF D;  2A0L A;  3QVN A;  1ZAU A;  4LF4 O;  4I50 B;  4EB6 B;  1VQ9 V;  5IWA O;  1MSW D;  3RGB A;  2F1M A;  1ZL8 A;  1NKD A;  1X4T A;  4DV1 O;  1VQN V;  3SJA C;  1GRJ A;  1MAB G;  3SPJ A;  2Y69 B;  4X65 O;  1B6Q A;  3RVZ A;  3CPW U;  1YZB A;  1XRE A;  1SZT A;  5JCO C;  3ZN0 A;  4JI6 O;  1FXV A;  4LF8 O;  4JI1 B;  2UXN A;  4J9Y B;  1NQT A;  2Y0I A;  3EHB B;  5BY1 A;  3LNM B;  4MW8 A;  1FKA O;  4YY3 B;  1XL4 A;  1ORQ C;  1R73 A;  4X1I B;  3UO3 A;  1P7B A;  4B3T O;  3ABT A;  2W0F C;  2CAZ C;  3WB2 A;  2R9A A;  2EIM C;  4MTG A;  2F23 A;  1E79 G;  3ZHU A;  5H9C A;  5K1X A;  3H1K H;  5KHI A;  3OGC C;  2Q6A A;  5KUK A;  1N34 B;  5C93 A;  1GN4 A;  4TV9 A;  3J81 N;  1TVK B;  4LBE C;  2WLL A;  1K8A W;  2UXX A;  1B06 A;  4IIJ B;  4TUY A;  1XMO B;  4X66 O;  2XAF A;  5IE9 A;  3IC7 A;  4KHP B;  1THZ A;  2BE3 A;  1QBZ A;  4JI0 O;  1FFX A;  4AIL C;  3H1H H;  5LP6 A;  2YIA A;  4YIO A;  4CH3 A;  3A0B Z;  4TV9 B;  1K9M W;  3ASO C;  4DV6 O;  2WLL B;  1GN2 A;  4TUY B;  1WA8 A;  2FML A;  3RYH A;  2ZM6 B;  3WB1 A;  2Y0P A;  1SC5 B;  4IHJ A;  2CDY A;  4FLV A;  2PUS A;  1FFX B;  3O9O A;  5KHJ A;  4DR3 B;  3GB7 C;  1JA8 A;  4GZR B;  4X20 A;  1WPB A;  2OT5 A;  4MSW C;  1S77 D;  3VQY A;  2GTS A;  4R7C A;  2HJD A;  1YF2 A;  2AZ0 A;  1WA8 B;  1Q5O A;  2DQ3 A;  2VS0 A;  1NJI W;  4IHJ B;  1N33 O;  2HJF C;  4PDR A;  1LNQ A;  1NU1 H;  4B3S O;  2IJK A;  2UU9 B;  1Z5V A;  2WPD G;  2MW2 B;  2HHH O;  4FLU A;  1BS3 A;  1X59 A;  2EIJ C;  1XMQ O;  2UUA O;  3K5L A;  3ZMS A;  4BR6 A;  2OTL V;  1U96 A;  1CP9 A;  2XTA A;  3M99 B;  2GBO A;  2ZIM A;  3GWK C;  1JFF A;  2YSU B;  4JAV A;  4MVR A;  4TQF A;  4NB5 A;  1P7G A;  3ZN1 A;  4RAI A;  5IDJ A;  5IYZ B;  1R6N A;  2E76 B;  3RWR D;  2DW4 A;  1K4C C;  1XHX A;  2IU0 A;  3RYF A;  4JI4 B;  1I5X A;  2EIM B;  1Z2G A;  3E8F A;  5IYB O;  5LOV A;  3APQ A;  4A5U B;  1VQ5 V;  3U0Z A;  4R6Z A;  5H6Q A;  1Q8I A;  2QE7 G;  3TET A;  2Q0O C;  3CC4 V;  4LR3 A;  4X8A A;  5JH7 B;  1R6K A;  3ZRX A;  3PJS K;  1KP2 A;  4NR1 A;  1KP3 A;  3L70 H;  4LC1 A;  5KLV H;  3CWB H;  4JI1 O;  3RYF B;  1PV0 A;  3RYC A;  3E89 A;  2WLM A;  1IVS A;  2OIE A;  4MTX A;  2D2C B;  1K5S A;  4JYY A;  4YY3 O;  1MNG A;  3FFQ A;  5DM6 V;  3BRC A;  3VOU A;  4H44 B;  4TSF G;  1MOF A;  1JQ0 A;  2A06 H;  1I7F A;  2HLD G;  2DYR C;  1H8E G;  1G6U A;  3MD0 A;  1EN4 A;  4CS4 A;  4H37 A;  3RYC B;  2FL4 A;  1N34 O;  3ZMT A;  2ZNI A;  5JQG A;  4NXN B;  2F4V B;  4JTD B;  2EZP A;  3K57 A;  1YIT V;  3BA9 A;  4ZOL B;  3DC6 A;  2XAS A;  2EIL C;  1XMO O;  3SJB C;  4I5S A;  4W4L A;  2N74 A;  1IBM B;  3TXS A;  4KHP O;  4CH5 A;  1NTZ H;  2Q67 A;  5EZY A;  1G8M A;  1W0J G;  3QG5 A;  3G6B A;  1MZE A;  2BTQ A;  4X1K A;  3EFF K;  5BZB A;  3BAB A;  1M90 W;  2ZM6 O;  4MVQ A;  4WFE A;  4PI2 A;  2DQ0 A;  2EIJ B;  1AJP A;  4ZBM A;  4I0X A;  2IM9 A;  1GN3 A;  4DR3 O;  3BA8 A;  1WN7 A;  2Q5Z A;  4DV5 B;  4OPH A;  4DW0 A;  1ZSP A;  3H01 A;  4DV3 O;  3CCM V;  4EEQ A;  4CBC A;  3SYA A;  5L3D A;  2K1E A;  4X1K B;  3ZHV A;  3CXH F;  5LBQ A;  1LUW A;  3ABU A;  1FXK C;  4ABM A;  2QDO A;  3SJQ C;  4LF5 O;  2YID A;  3G80 A;  2JGD B;  1IUR A;  2L6L A;  1HNW B;  1I5Y A;  3L9D A;  2UU9 O;  4FLZ A;  3JAL B;  4Q20 A;  1MG1 A;  3L74 H;  4DRX A;  1M1K W;  2VQE O;  2LO1 A;  4QE9 A;  4XBF A;  1QHT A;  4ICG A;  4TT3 G;  4PDL A;  4F4L A;  1PP9 H;  1KEC A;  4U7N A;  3M7M X;  3QO8 A;  3ZJZ A;  3N27 A;  3BHP A;  2XAH A;  1NVP D;  2ZQM A;  3CRR A;  1WAZ A;  2EIN C;  1N8R W;  5LHH A;  2GHY A;  2VRZ A;  4BAY A;  1D5N A;  3K5N A;  4JI4 O;  3CYO A;  2DYR B;  3CP1 A;  4MW3 A;  3ABM C;  1XI1 A;  4U7O A;  4UUJ C;  5CBF A;  3CRA A;  1VAR A;  5FPO A;  3ZRV A;  4LFC O;  3LDC A;  3SDL A;  1WB7 A;  3CX5 F;  3SYQ A;  3D3Q A;  1N0N A;  2Q68 A;  1L0N H;  1OJH A;  1DF4 A;  2ODM A;  1SS3 A;  1WLE A;  1GN6 A;  2H94 A;  3ABK C;  3L71 H;  3CE2 A;  2VWJ A;  2BSK B;  1Q6H A;  1NI8 A;  4UVB A;  1JOY A;  1QR8 A;  5CN0 A;  1WB8 A;  1KD1 W;  1XNR B;  1JX9 A;  3IFX A;  2P06 A;  3RFR A;  4MVO A;  5JJN B;  3E8G A;  3FKS G;  1FXK A;  4JPR A;  4J9Z B;  2XND G;  1S3J A;  4NXN O;  1WPX A;  4X1Y B;  3K58 A;  1L0L H;  4N23 A;  2KG7 A;  1ZTE A;  2QGN A;  1YJW V;  4RQF A;  1F4M A;  1G4Y B;  2V4D A;  3QTC A;  3K06 A;  1IBM O;  3OTO B;  2VQF B;  3ZCC A;  3OE7 G;  3K0G A;  4XDJ A;  4F6R A;  3CCV V;  1VF6 C;  2CTR A;  2Z0A A;  1NTM H;  1FXK B;  4FM0 A;  1Q6I A;  4AHC A;  5EIB D;  4MTF A;  1BGY H;  2PF4 E;  1J5E B;  3DXR B;  4B3T B;  3RT3 C;  5CA1 A;  5EC2 C;  3N2G A;  2JDI G;  2R70 A;  2V7Q G;  2QM4 A;  4DV5 O;  2A3Q A;  4B3R O;  4OX9 O;  2RMK B;  2BCC H;  3K5O A;  4FFK A;  1QU7 A;  4GT1 A;  4JAS A;  5DEC A;  3LDD A;  5B1N A;  4LCU C;  2Z3Y A;  1XBL A;  3KZI Z;  2YI8 A;  1ZLZ A;  2EIN B;  4G27 B;  1AI4 A;  4ZI7 B;  2YXL A;  1DLB A;  3N2G B;  4RO2 A;  5L3E A;  1GAX A;  5KX5 A;  1PM9 A;  1MA1 A;  1HNW O;  1AP6 A;  1S5H C;  3J7A U;  5EBW C;  4WFB V;  5L3C A;  3ABM B;  2LGQ A;  4JZG A;  5CB4 B;  3IGA C;  1YDX A;  1AR4 A;  3FX7 A;  4JTC B;  1IXB A;  5LHI A;  1SER A;  2HVK C;  1VQ6 V;  1EN5 A;  2CTW A;  2ZIN A;  4OGQ B;  1HDJ A;  3GVM A;  5EBL C;  3G67 A;  4MVU A;  4D7T A;  5KX5 B;  2RQ6 A;  2UUB B;  4J80 A;  3ABK B;  4H13 B;  1S5L Z;  4O4L B;  1K5Q A;  1BCC H;  1H2K A;  5LMN B;  4Z1M G;  3T1Y B;  1M4U A;  4B3S B;  1O9H A;  2P67 A;  1V9P A;  1GTO A;  2DWD C;  4CZZ A;  2FTK A;  1ZWI C;  1AIL A;  5BMV A;  1VQL V;  4E2L A;  3I56 V;  2FB5 A;  3ZIA G;  2LW1 A;  4I4T A;  2XT9 A;  1BZK A;  3OMI B;  1E1R G;  2ETN A;  4NTY A;  4YJ3 A;  4MTO A;  2Y4T A;  4K0K B;  5LP6 C;  1VF7 A;  2C2A A;  2YXH A;  1K7D A;  1WP7 A;  1WNS A;  3W7S A;  1K3E A;  5KA5 A;  4FZ1 A;  2HG5 C;  2JEX A;  5BMV B;  4IL6 Z;  4TWK A;  2FYU H;  4XDK A;  2H8P C;  4NVP A;  1HR0 B;  1QCE A;  3L75 H;  2IW5 A;  4YJ3 B;  3AG2 C;  1BHA A;  1UFI A;  4K3A A;  1M57 C;  1K4D C;  3CCU V;  4FJC C;  3MAQ A;  4GUN A;  4JI3 B;  1TUE B;  3OUS A;  1H38 A;  1RSO B;  4PEL A;  3OTO O;  2VQF O;  1ZUQ A;  2LFS A;  4UVC A;  4P30 A;  1GO3 F;  3K5M A;  3MDS A;  2YIC A;  3N2K A;  3ZED A;  1J5E O;  3FB8 C;  1ZL8 B;  2LW7 A;  4P2Z A;  3WFV A;  3ZHQ A;  3T1C A;  5LXT A;  1FYJ A;  1QVF U;  2QR4 A;  2QKS A;  3IJ4 A;  2E5L B;  1VQ4 V;  4GLX A;  2OCC B;  2PZS A;  5CA0 A;  1JPX A;  2KSD A;  4Q6G A;  1IXM A;  2EIK C;  3N2K B;  3JYC A;  2LFR A;  1DGS A;  4GKK O;  5KA6 A;  4BW9 A;  5J2U A;  5J9P C;  3ZX6 A;  2DYS C;  2QEX V;  1Y76 A;  2ZE8 A;  4H33 A;  2BTO A;  1TUB A;  4LWS A;  1AR1 B;  3LSQ A;  2JIZ G;  4MVM A;  5CA0 B;  1S5J A;  1Y74 A;  1A32 A;  2P22 C;  4UXN A;  1NT2 B;  2RJZ A;  5J2U B;  1GMG A;  4LFB B;  3LUT B;  5BXZ A;  1Y76 B;  5CA3 A;  2PGG A;  3CCQ V;  3U11 A;  1VP7 A;  4FK5 C;  1N36 B;  1WP8 A;  3JAR A;  2UUB O;  4PD4 F;  5LP6 B;  4GX0 A;  4JI8 B;  2JS3 A;  5GW7 A;  5B1A C;  4DV3 B;  2ARH A;  4LNU A;  3DSQ A;  3ZBH A;  5LMN O;  1QNM A;  4KXR A;  3RYH B;  2EJ7 A;  3T1Y O;  4LF9 B;  1RP3 B;  2ZR2 A;  3JAR B;  1FS0 G;  4LF5 B;  1RFY A;  1CEZ A;  2QTO A;  3L72 H;  3AG2 B;  4DO2 A;  2Y48 A;  1M57 B;  4X20 B;  1HWY A;  3AK3 A;  4HYO A;  1OHH G;  3CME V;  3MHS C;  4LNU B;  3JAT A;  3D3I A;  2VQE B;  3HKE A;  3SPG A;  1IBL B;  4K0K O;  3A2F A;  2AHY A;  2EJR A;  4FIP C;  1B3Q A;  4D7S A;  3HR0 A;  5LMU O;  3OT7 A;  2G38 A;  4BW5 A;  3DGE A;  5IJ0 A;  1NH2 B;  4IYI A;  1ARO P;  2R72 A;  1EZJ A;  3FD9 A;  4QE7 A;  1L1F A;  4NTW A;  2YC0 A;  3VQW A;  1HR0 O;  1FXH A;  4RWU A;  1Q82 W;  3FYI B;  3HKE B;  2CGO A;  4EFB A;  1Q90 D;  2PTM A;  4NKG B;  5C8Y A;  3UT5 A;  4JI3 O;  3W7T A;  2EIK B;  5IJ0 B;  3H1L H;  4KL1 A;  1BHB A;  4LFC B;  1JFF B;  3C3S A;  2DMX A;  2GUZ A;  2DYS B; 
#chains in the Genus database with same CATH homology
 3RT3 C;  2DJV A;  4YHH O;  5BXZ A;  4JI7 O;  4DV1 O;  1F7Y A;  3R66 A;  4DV2 O;  1N34 O;  1N33 O;  4DR2 O;  1D2D A;  4DV5 O;  4X65 O;  4DV4 O;  4JI4 O;  4B3R O;  1G1X B;  1YZB A;  4OX9 O;  1IBL O;  3M8A A;  3T1H O;  4JI6 O;  2UUB O;  1XMO O;  4B3S O;  4LF8 O;  2E5L O;  4GKJ O;  2N74 A;  4B3M O;  4AQY O;  4KHP O;  4JI2 O;  4X64 O;  5BY1 A;  4JV5 O;  2HHH O;  5LL6 Y;  4LFC O;  1FKA O;  1X59 A;  3SDL A;  1XMQ O;  2UUA O;  2UUC O;  4NXM O;  2JRI A;  5H5N A;  5LMN O;  4B3T O;  3T1Y O;  4DR5 O;  1HNZ O;  1HNW O;  5A2Q N;  3J7A U;  3OTO O;  2VQF O;  2AGA A;  2F4V O;  4JI5 O;  2ZM6 O;  1NS1 A;  4DR7 O;  4DR6 O;  4DR3 O;  4DV7 O;  3J81 N;  1AB3 A;  1J5E O;  1R6T A;  1IBK O;  2LW7 A;  3O65 A;  1FYJ A;  4OPH A;  1HNX O;  4K0K O;  4DV3 O;  1DK1 A;  4DR1 O;  4X66 O;  4A5U B;  4LF7 O;  4LFB O;  3J80 N;  4LFA O;  1N32 O;  2UXD O;  4DV0 O;  2DOS A;  4JI0 O;  4X62 O;  5LMU O;  1XEQ A;  5IT9 N;  4NXN O;  2FKX A;  1KUQ A;  1XNQ O;  1R1B A;  1FJG O;  4LF5 O;  1N36 O;  3JAM N;  1HR0 O;  4GKK O;  4JI1 O;  2UXC O;  2ZKO A;  1IBM O;  4DV6 O;  3F5T A;  2UU9 O;  1I94 O;  4JI8 O;  5FLX N;  5BR8 O;  4DR4 O;  1XNR O;  2Z0A A;  4YY3 O;  2VQE O;  4JYA O;  4DUY O;  4DUZ O;  1AIL A;  4JI3 O;  2UXB O;  1A32 A;  4OPA A;  4LF4 O;  4LF9 O;  5IWA O;  4LF6 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...