4X65O

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 31
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4x65O00
3J81N 2UUAO 4JI8O 4DR6O 1R6TA 5IT9N 2UUCO 4B3MO 5BR8O 1XMOO 1F7YA 4DR3O 4DR4O 2UU9O 4JI6O 5FLXN 4DV4O 3O65A 3J7AU 2FKXA 3SDLA 4DV5O 1HR0O 4LF9O 2ZKOA 4NXMO 4DV2O 2DJVA 4LFAO 1X59A 4JI1O 4DUZO 4DV0O 3T1YO 3JAMN 1FKAO 5LMUO 1HNZO 1XNRO 1R1BA 4YHHO 4LF6O 4LF7O 2UXCO 4JI3O 3R66A 1AILA 5IWAO 1YZBA 5A2QN 4JV5O 4DV7O 4JI2O 4X65O 1FJGO 4DR2O 4LF8O 4LF4O 4LFCO 4GKJO 5LL6Y 4NXNO 2UXDO 4A5UB 4DR1O 4DR5O 1I94O 4OPHA 4DV6O 1XNQO 5BXZA 4JI5O 3F5TA 2DOSA 2N74A 3M8AA 2E5LO 4K0KO 1NS1A 4X66O 1G1XB 2VQEO 4DV3O 2F4VO 1A32A 2JRIA 4B3SO 1HNXO 4GKKO 4DUYO 2UUBO 3J80N 1IBLO 1AB3A 4JI7O 4JI4O 4X64O 1N33O 1XMQO 2HHHO 5LMNO 4OX9O 1HNWO 4B3TO 1IBMO 4JYAO 2Z0AA 4KHPO 3OTOO 2LW7A 4DR7O 1N36O 2VQFO 4B3RO 2UXBO 1KUQA 3T1HO 1DK1A 5H5NA 4OPAA 1FYJA 1N32O 4X62O 4YY3O 2ZM6O 1D2DA 2AGAA 4LFBO 1N34O 3RT3C 1XEQA 5BY1A 1J5EO 4DV1O 4AQYO 4JI0O 4LF5O 1IBKO
chains in the Genus database with same CATH superfamily
2MK3A 4CS2A 4DR1B 2Q7GA 1I94B 4LCUC 3TK1A 2WLIB 1ENVA 1DGSA 3OFNG 4JYBA 3JALB 4X1YA 3K5LA 4YJ3B 1BL8A 5IE9A 1K97A 3LSSA 4D7SA 2C2AA 4JTCB 5J2TA 3ICXA 1JFFA 4I50A 1OHHG 2ZKOA 4O2AB 5JH7B 4FFBB 1ZWIC 1M5IA 4LFAO 4FM0A 2F93B 1K34A 2ITDC 1JCHA 2BOCC 1ZX3A 1VQMV 1JX9A 4X66B 5EK0A 1JR9A 2W0FC 1Q7YW 4PDMA 5L3EA 4LFBB 3B09A 4FVMA 2Q0OC 2XASA 1M4UA 3APQA 1VF6A 1ZTEA 1M1KW 2ZDIA 3S3WA 1FXKB 3E22B 2PYJA 5GTHZ 1GAXA 2XAJA 2WLMA 4R8CA 4X1IA 4DR3B 2V4DA 1XHXA 3CHXA 4H33A 5TISZ 4LH6A 1UFIA 2KKWA 1VF7A 4ZOLA 3E35A 4B3SO 4DK0A 4GKKO 4P30A 2ZXWC 1I5XA 2DQ3A 4UCUA 3T4DA 3GB7C 3JCZA 5JQGB 1IBKB 4PI2A 1B06A 1QCEA 3CX5F 3RYFA 4DUZB 5IYCO 3OTOO 4DR7O 1N36O 4FLWA 3I56V 2F23A 3SYCA 3B77A 4J9YB 4X1YB 2ZXWB 1CEZA 1D2DA 1K8AW 3OUFA 3CXCU 2QEXV 5J2TB 2DWDC 4FIPC 1JFFB 1QVFU 4UCRA 4GKJB 4LF5O 1VF6C 2XAHA 1OCRC 2ZDIC 4WF9V 1R6TA 3CS5A 2X6AA 1W2BU 1QR9A 2VRZA 1IXMA 5CBFA 5CBHA 2IJKA 2IJJA 3CC2V 3CXHF 1RSOB 3T2MA 1RM1C 4W4KA 1E1QG 1XMQB 4X65B 1OCRB 4L8JA 4DV5O 1VQ9V 5F2VO 2QWPB 2IW5A 4J9ZB 4DW0A 2BCCH 2DJVA 1SESA 4ASUG 3K3WA 3JYCA 4X1IB 3CCRV 1VF5B 3VQYA 3A0HZ 3OD4A 1YCIA 2HP8A 5C93A 4ZOLB 2DWEC 5EIBD 5IDJA 1IX9A 4PDLA 4DUYB 1FXHA 3A0BZ 4LWSA 2QTOA 1FJGO 2IJIA 1U97A 5BMVA 2QDOA 1B3QA 2UXNA 3RYFB 1XQ8A 4JI8B 4FM1A 2WWWA 1WAZA 3THOA 1AI6A 3QTCA 2N74A 1I0HA 1XREA 2ZQMA 2QJ1A 4Z1VA 3ZHTA 3G4SV 1ZSPA 4HYOA 4HBNA 2BE3A 2LW7A 4DR6B 4B3RO 1V55C 3VBBA 4OPAA 2YIBD 1F4NA 2AHYA 1UPGA 4GCZA 3UM7A 4IYIA 4WFHA 4X8AA 5AG2A 2YI8A 3W7SA 1R3KC 1V55B 1NKDA 1XUQA 1Q6HA 1R3LC 3CD6V 4EEQA 2JS3A 2UU9O 2EIJB 1SRYA 1VMGA 4JI4B 4LWSB 3ZHQA 1AI4A 2V1DA 4B3TB 3T4ZA 4X9QA 5BMVB 3RYCA 4NXNB 5J9PC 2R9IA 1MMMA 3RVZA 2R72A 3T1HB 2EJRA 4K0KB 3JD4A 2ZE6A 1YTFB 1THZA 4PA4A 4AI8A 3W7UA 1QR8A 1VEWA 1R3IC 4G2KA 3ZEDA 1EFRG 1X4TA 4IIJA 5LBQA 1QBZA 5IYZA 1PM9A 1AILA 4I9WA 4JI0B 3ZRXA 1H2LA 3OEHG 1GN2A 2A3QA 2FMLA 2VWKA 2UUAB 2UXDO 3H1LH 4MVRA 1ZLZA 2PGGA 3OTFA 1KD1W 2UXBB 4JI5O 1QHTA 4X66O 2B1IA 3B8NA 5LXTA 3ASOB 2QSAA 2ZIMA 1MSDA 3J80N 2BSKA 5LOVA 2WLJA 3MDSA 1XOUA 2A9HA 3H9VA 4ZI7B 4UCTA 4QGPA 2P67A 3C3TA 4K3AA 2WLKA 3OMAB 4GX1A 3ZN1A 2ZM6O 2FTKA 3K06A 4F6EA 2AZ2A 4DR2B 2DQ0A 4CH4A 3RYCB 4DV1O 4LFCB 3SPCA 1GRJA 4KL1A 1IBKO 1O9GA 3RYHA 4CH6A 1AP5A 2CTPA 3AG3B 5BR8O 2RDCA 1BHBA 1DLBA 3ZHSA 1HNXB 2RJZA 4IIJB 2FB5A 5IYZB 4FFKA 2DYSC 5LMNB 1H38A 2LW1A 3CWBH 3E83A 4CBCA 2P5OA 3MHHC 2WA3A 4W4LA 4RUEA 1Q8IA 1S72V 4N23A 5EZYA 5H6RA 5LXTB 1M56C 3AG4C 4JAUA 4ZKIA 2O57A 5JWPA 1K4DC 2DYSB 5CA0A 1CP9A 4WFFA 1LNQA 4WCEV 1W59A 2BSKB 2QE7G 2QTSA 3A2FA 3R66A 5H2FZ 5LOVB 3VQVA 1SS3A 4X65O 1GM8A 3EXAA 3K79A 4FLUA 2UUCB 1M56B 2EILC 3AG4B 4QNHB 2HG5C 4WFAV 1GO3F 4RO2A 2EIKC 4CH5A 2Q7HA 1NQTA 1EN5A 1AI5A 4DUYO 1N34B 2ETNA 3BAAA 1TVKA 4X64O 2NR5A 2Y4UA 2M6YA 1M57C 1VIBA 3RYHB 4O2BA 1SETA 4RQEA 3P32A 1Y76A 5DEDA 3AG2C 1YITV 1FYJA 4MTGA 1XNRB 4YY3O 1MABG 1Q6UA 2XAGA 5KX5A 3HKBA 1KU9A 4MVMA 4LNUA 2IU0A 3J81N 1JMKC 3WG7B 3AG2B 1OCOC 3ZMZA 4DR6O 4F4LA 5EZYB 4MW3A 2X0LA 3ZCCA 1XMOO 1PP9H 2XHBA 2F4VB 2Z5UA 5CA0B 5KHKA 3OM3B 2GTAA 3M7MX 3O65A 2YUAA 5FPRA 3I5DA 4UCVA 2QM8A 1OCOB 2PYLA 2LGQA 4KHPB 2QKCA 4O4IA 5EC2C 4DK1A 1IXBA 1R6KA 4JI1O 3KCXA 4RQFA 2EINC 3AG7A 1K33A 5EYPA 3JSLA 5JJEB 3JD3A 3G6EV 4YHHO 1TVKB 3CCQV 3IJ4A 1SQFA 2ZE5A 4JV5O 4I9QA 1EZJA 4PA3A 1K7DA 4NXNO 4MVQA 3E2EA 2X7RB 1M9NA 1MZEA 2EINB 5BXZA 1KKDA 4K0KO 1Q86W 5B1NA 5K1PA 1LUVA 3FD9A 1FS0G 3QF7A 4DYLA 1A32A 3OAAG 3FB7C 2JJ2G 3D8CA 1FFTB 4HNAA 5EBWC 5L3GA 2RMKB 2F43G 3DGEA 1L8DA 3HKBB 4IHJA 3CCMV 4LNUB 4LF9B 3B2EE 2BOBC 4NXMB 4DO2A 2R9AA 4FMTA 3CCJV 2UXBO 2F66C 2HJFC 2XNDG 3IAYA 1YIJV 2OIEA 3MAQA 5LMUB 4EFEA 3ABLC 2Q73A 5DM6V 2GHYA 2UXCB 3E89A 3DC6A 4B7KA 1H2NA 3M99B 4PHZA 3D3QA 4TT3G 1BQ0A 3RYIA 4O4IB 3CRMA 2YEVA 2AW9A 4I0XA 2VWJA 4DV6B 1AJNA 4ZIBA 3I55V 2E5LB 2PI4A 1Q6IA 1ZAUA 1S3JA 2WLHA 1RFYA 3K9SA 5EYPB 2OCHA 3RFRA 2X6CA 3T1CA 4TWKA 3E8HA 3LDCA 5KUMA 4LBEC 1BZKA 1SA0B 3ML0A 4FLXA 3UQ8A 4Z2WA 2D2CB 2Q4PA 5IYBO 4TQDA 1V9PA 2OTLV 3BCCH 3F7YC 5LP6A 2CGOA 1BT8A 2WLNA 1FAFA 5CA1A 4P2ZA 4LP8A 4TOIA 3DSQA 1BGYH 4HNAB 4IGGA 3UO2A 3QG5A 3SJQC 3ZN0A 4IHJB 1VQOV 2GTSA 4PA9A 3IGAC 1PD3A 4WFGA 2WSSG 1IBMB 2OCCC 2BTQA 4PI0A 5GTIZ 4LF4O 4LF8O 2YI9A 3SYAA 2VQFB 1TAEA 5GONB 4DV3O 3CCVV 4JTDB 4NKGB 3HPLC 4JZ2A 2OCCB 2Q9LA 1NT2B 3RYIB 1AROP 2YEVB 4I0XB 4Z1MG 2H8PC 4JZGA 5LP6C 3E86A 2YIBA 5DN6G 4GX5A 4JI6B 5C8YA 3LUTB 3QO7A 2XAQA 2JK5C 1R3JC 2DMXA 4IYHA 4J10A 4WFEA 5EIBC 1N34O 1YXBA 2ZR2A 3JAWA 3A0RA 1EM1A 2CTWA 2IM9A 5CMUA 4D7TA 4G28B 2JGUA 4MS2A 2ADQB 1TUEB 2A79B 4F6RA 5CA1B 3TXSA 2WAMA 2YIAA 2JEUA 2FL4A 1XI1A 1QVGU 4FLTA 3N2GA 1IBLB 4Q20A 2JIZG 3CRQA 4OX9B 3EHBB 3CC4V 4I50B 2UXXA 4K8XA 3FYIB 3CMEV 3F7VC 4MVUA 4DV0O 1WNSA 1IDSA 2W6JG 1YJ9V 1VQ7V 2JVDA 1M90W 2E74B 1KKCA 1PKXA 2DN9A 4PDRA 1D5NA 5KA5A 1P7BA 1YVWA 4AQYB 3ETEA 2IH1C 4JI3B 4DXWA 1MZFA 2ZINA 2A06H 1L0NH 4DR5O 3PJSK 1XNQO 4QE7A 1Z5WA 1KQSU 4BR6A 1V54C 4DR4B 2B9ZA 2VQEO 5C8YB 1BQZA 3O9OA 1RM1B 3SYPA 3JAWB 2XAFA 3SJBC 3ZHUA 3MD0A 1HNWO 4DV2B 1F51A 1XILA 3CMAV 1V54B 3T1YB 4F6RB 4J42A 3RBZA 3KCYA 1GM7A 3ZX6A 4JYCA 4FZ0A 4X62O 4YXWG 1VQNV 2RQ6A 3JARA 4LF6B 1S76D 1J5EO 3R65A 1TUBA 3VQWA 4E4EA 2PF4E 3CYOA 2OT5A 3OR7C 2E76B 1OCCC 2DYRC 3SJAC 1AJPA 4FLVA 3AEIA 2PY5A 4TV9A 1F7YA 3CCSV 3QO5A 3ZJZA 5FLXN 3SYQA 1OCZC 1K5SA 3LNMB 2EBOA 4DV4O 3AK3A 4KUMA 2ZE8A 2DYRB 5D5QA 1NTZH 3CC7V 3GVMA 2ATKC 2EZPA 1SKVA 1Q43A 3H01A 3OEEG 5LGNA 4J80A 4C7UA 5B66Z 3L70H 1OCZB 1HNZO 2YXLA 3SR2C 4JTAB 1E79G 1ZL8A 1HWYA 4JI7B 3Q4HA 1N33B 5IWAO 1SZXA 3TJTA 4R7CA 1NVPD 3FB5C 4DR1O 1I94O 2EIMC 2XT9A 4UVAA 3RWRD 1F23A 3JARB 1SQGA 2AXTZ 3FB8C 3BA9A 1TUBB 4UVBA 1HR0B 3SGIA 3P30A 3JD1A 2PUSA 1IBMO 1Q90D 2EIMB 1Y67A 1N0JA 2W6IG 3U11A 2VQFO 4B3MB 2P06A 4MVOA 4ZHQA 3CCUV 1NH2D 3JAKA 2XUMA 4KFMA 5LA6A 4LF7B 1DF4A 2ZE7A 2W0XA 2AHZA 4TV8A 5H6QA 4LFBO 3L75H 5BY1A 3L74H 4H44B 5KHGA 4UFZA 5IY5C 2LQTA 1MA1A 5CB4A 3ASNC 4H13B 2CK3G 1AI7A 3FYEB 2EULA 3ZHVA 1CXZB 4ABMA 1Z2GA 4DR3O 1BHAA 2KG7A 3PN1A 2KQXA 4JI6O 3APOA 2ZCEA 3Q4HB 4FJCC 5IY5B 2NN4A 4DV7B 2CTQA 2WA4A 4JYAB 1URFA 3ASNB 1X59A 4D6TH 4DUZO 3OE7G 2Y69C 1OV9A 4XDKA 1YTFD 5JJJB 4N21A 2PZSA 2CAZC 2UUBB 5B3SC 3K5OA 4NYKA 2HHHB 2YICA 1K4CC 1VQKV 4GKJO 2ITCC 4YIOA 1S5JA 4LH7A 3JCUZ 3AG1C 3WFVA 3M8AA 1MSWD 4PA6A 1AJQA 2CDYA 1W0JG 5LA6B 1KB9F 4TV8B 4UB8Z 3HB3B 4X1KA 1SZTA 1HDJA 2DE0X 5LHGA 3TGUH 1XMQO 3QVNA 4GYCB 2ZNIA 4LFAB 5HFMA 1ROPA 1Y66A 5CB4B 3SPIA 1Y74A 3G80A 2ZT9B 1XL6A 1MOFA 4TQFA 2KG7B 4AHCA 1Q5OA 1SQVH 4R6ZA 4YIPA 2NNUA 5KHIA 4GZRB 1K73W 3KG2A 3CEIA 4J7JA 1BMFG 1Z5VA 2AGAA 2YXHA 1XEQA 1QLNA 4O4HA 1J95A 3FFQA 4JI8O 2EILB 2BTOA 1YDXA 3K5NA 1Y4MA 2EIKB 2JS5A 1NTMH 4GKKB 4BIZA 5LHIA 1YJNV 3WU2Z 4J11A 5B1OA 3CJHA 2ZIOA 1GTOA 1KBHA 2B1GA 1PV0A 4JI2B 1M57B 4MTXA 3L72H 4QE9A 3OTOB 3ZHRA 1Q3EA 4UB6Z 4DR7B 1N36B 5IJ0A 4BIUA 5L3DA 3D3IA 1MNGA 5BZBA 1AR4A 3DTUB 4PD4F 4MVZA 1FKAO 3LSUA 2ARHA 3W7WA 5LYJA 4CZZA 1YZBA 4LF5B 2OIGA 3NXSA 1KP3A 3X2QC 1Y74B 1GH6A 1KECA 1LUWA 1GK9A 2ZD9A 1G1XB 1N32B 1B6QA 3BABA 3G6BA 3ZMSA 4K8ZA 4JI7O 4JI4O 1N33O 4DV5B 4O4HB 4BW9A 4B3TO 3ZIAG 1PL0A 1R6NA 4L87A 4O2BB 3H1KH 1YJWV 1Y76B 2VS0A 4EFBA 2A0LA 4MTFA 3T1HO 2N04A 5H5NA 3WB1A 1T5EA 2IU3A 1S5LZ 2JGDA 5LGTA 5KAIZ 5KX5B 3W7XA 4FPPA 2Q0AA 1AR1B 4JI0O 3RW0A 3SPJA 3ABMC 5IJ0B 2UUAO 3OR6C 2HVKC 4B3MO 1AVMA 2WLIA 3BA8A 3TCUA 1NZ6A 1L1FA 1U96A 3EFFK 2DW4A 4PDVA 4U3JA 4YJ3A 4I55A 5LYJB 1XL4A 2XTAA 4IL6Z 4IT5A 4O4LA 3BRCA 2P22C 2Z3YA 4O2AA 5B1AC 4B3RB 3CRRA 2JDIG 1KYOF 1JOYA 2E3CA 1F4MA 3BEHA 3ABLB 1VQ8V 3L73H 1TA8A 3OMNB 2P6JA 2Y4TA 3L71H 2FYUH 3FKSG 4B08A 1SQBH 4DV7O 4X89A 4UCOA 4QPJA 4DR2O 2CTRA 4I4TA 2RNBA 4LFCO 3BFRA 2LJ2A 1GN6A 4PJ0Z 4GUNA 3E8GA 1YF2A 4UXNA 4MT8A 1NTKH 2P90A 1M93A 3LDDA 5EBMC 2UU9B 5A9GA 1EN4A 2YXYA 2PI5A 3JD0A 2QWQB 4HZ3A 4I7ZB 1HNXO 2A7WA 1D5AA 4WFBV 2UUBO 2R9RB 1IVSA 3ETDA 1H2SB 5IYDO 2Q68A 5JQGA 5EBLC 5LMNO 4MTOA 4E2LA 2HHHO 4UV8A 3E8BA 1H8HG 4JASA 3JASA 3KKYA 2HLDG 3QNEA 3K59A 5HFLA 1K5QA 3ZRSA 1Q82W 4MVSA 1DTOA 4NTYA 2ADPA 5JJNB 3BHPA 5EC1C 4U3JB 4I55B 4O4LB 5B1BC 4TUYA 4XDLA 1ORQC 2IH3C 1JJ2U 2JEXA 2UXDB 3K04A 3WB0A 1FXKC 2LO1A 4JI5B 5CBGA 2UUCO 2YDEA 3OW2U 4DW1A 3IC9A 2GSMB 4U7OA 2YC0A 3LDEA 2HEPA 4J7ZA 3K58A 5B1BB 3IFXA 1BCCH 1RSOA 4RAIA 1N8RW 2QKAA 5KUKA 4I4TB 1I7FA 5E79Z 2JJ1G 3VOUA 3ZRVA 3W7TA 1NI8A 5L3CA 2Y0IA 5LP6B 3JAMN 1PNKA 2QM7A 4PELA 4RUFA 5FL7G 4FLYA 2ZM6B 4LC1A 4CS3A 4J7KA 1XNRO 2EZOA 2Q69A 1JPXA 4HAMA 3DXRA 4DV1B 5A2QN 2V7QG 4JI2O 4BAYA 2BTQB 5IJ9A 4A5UB 3JASB 3G67A 2G38A 3EVKA 5BR8B 5KMGA 1P4RA 4O4JA 2QM4A 3U0ZA 1Q81W 2RN9A 3BVOA 2F4VO 1WB7A 1COWG 2JRIA 3FX7A 2OWOA 2B5UA 1G4YB 1OJHA 1AB3A 4TUYB 1SF9A 3MHSC 3B8MA 3A8TA 2Q8VA 2RCVA 2HJDA 4BIOA 5LGUA 3KZIZ 4Q6GA 3BPZA 4G27B 2GBOA 4FK5C 3RVYA 1K3EA 4KHPO 3OGIB 1K9MW 3N2KA 4CC6A 3BY6A 5ITZA 1N32O 3STLC 1IZ3A 3AK2A 3HKEA 3C3SA 1P7GA 1JQ0A 1PNMA 1SC5B 3K57A 3N27A 1WP8A 2GUZA 1GN3A 4CH3A 2CE4A 3UT5A 2WLLA 4EB6A 1FXVA 3N2GB 2CGNA 2XOKG 3DXRB 5JVDA 4X64B 3CSXA 1IURA 4H0LB 2FKXA 5IJ9B 4LF9O 1NVPB 4NXMO 1PL4A 5GW7A 1W0KG 2QA4V 1WB8A 5KMGB 4O4JB 1H8EG 3SPHA 2MW2B 5L3BA 4YY3B 5LMUO 4PA7A 2P4KA 3ZMTA 2UXCO 4U3FH 4X88A 3B4SA 1VQ5V 1OCCB 5LL6Y 2ZR3A 4P9OA 5LHHA 4DRXA 4DV6O 3N2KB 4QJFB 1XMOB 5ITZB 2DOSA 2LFSA 4H37A 2E5LO 1NH2B 1NR7A 5K1XA 2HR3A 1FFXA 2Q67A 2EIJC 1SERA 3HKEB 4P9PA 2P7TC 3FB6C 3ZRWA 3WB2A 2HFEC 3JATA 3G71V 1YI2V 5JCOA 3K08A 2D3OW 5KA6A 3IC7A 3CCLV 4JI1B 4ZI7A 4JYYA 2WPDG 2GUZB 3D36A 2ODMA 3UT5B 2WLLB 1P84F 2EX3A 2QKSA 2HKOA 4EB6B 3CRCA 3E8FA 1VQLV 1BE3H 4YHHB 5JVDB 4KXRA 1YHQV 1S0VA 1G6UA 1QLEC 4UV9A 1ZUQA 3RT3C 4ZBMA 4YJ2A 4JV5B 4X20A 3UO3A 1KP2A 4KP4A 4NVPA 4FZ1A 5KLVH 4B7EA 3GWKC 1KMIZ 2X6BA 4TV9B 1PNLA 1SQQH 4MW8A 3QO8A 1JA8A 1GMGA 1QLEB 3ASOC 2NLJC 5L3FA 2L6LA 2M7WA 3K5MA 1GM9A 3J7AU 3SDLA 4PV1B 4NB5A 5JCOC 4DRXB 2Y0PA 1MG1A 3D36C 3CB2A 2QWNB 1FFXB 4JAAA 1VQ6V 1GN4A 4JF3A 1ZL8B 2LFRA 1YSCA 3SYOA 3ZRWB 1L0LH 3K03A 1I5YA 3JATB 1R73A 1XHZA 3NR7A 1S5HC 4MSWC 1QNMA 2E75B 1KC8W 1H2MA 4OXSA 1VQ4V 2GV9A 2YIDA 3UCSC 4EKWA 2AZ0A 3AG3C 3ETGA 5KAFZ 5FNVA 4I5SA 2F95B 3P3PA 4JGSA 3HKCA 4YJ2B 1IBLO 1GKFA 4X20B 1N0NA 4GX2A 4JPRA 4OX9O 3H1IH 2OTJV 1SQPH 2PTMA 1VQPV 2Y69B 4QIWF 4UUJC 2CUGA 3L9DA 1KUQA 3CP1A 1H2KA 1WPXA 1DK1A 4ZHQB 3K0DA 1JVMA 1HW7A 3JAKB 5B3SB 1O9HA 2YS8A 4NTXA 3HR0A 4OGQB 4K35A 2OYQA 4UVCA 1RPOA 4LF8B 1YEWA 4LF4B 4NTWA 4AQYO 1WA8A 4U7NA 4JI3O 3UKMA 3AG1B 4AILC 1WN7A 3U10A 1EN6A 4R50A 5KHHA 1NBMG 3HKDA 4DV3B 1RPRA 3ABTA 1RP3B 4DR4O 3H1JH 1K92A 3CE2A 2QGNA 3B40A 2L35A 4J41A 3H1HH 2ILMA 1DF5A 2Q6AA 4GT1A 2CH7A 3K9AA 4DV2O 1S77D 3ZBHA 2F1MA 1CPYA 3T1YO 1WP7A 5FNVB 1N4CA 1BS3A 3P3NA 1JJOA 3TETA 4B3SB 3HKCB 3ZMVA 1R1BA 3SJCC 2K9PA 4UCSA 4LF6O 2N05A 1QQCA 3CRAA 2QR4A 2GDSA 1NR1A 1LR1A 3LNNA 3WG7C 4QPKA 4TSFG 4NR1A 4OPHA 1B04A 2P4VA 3AK1A 1NJIW 1Y6XA 3CPWU 4WBNA 2LGWA 1AR5A 1FPOA 1E1RG 2ZNJA 4X1KB 1FD9A 5FPOA 1QU7A 4CS4A 2Q7EA 1EBOA 4ICGA 3C90A 3SPGA 1WA8B 2H94A 1AP6A 3FAVA 1XBLA 4JAVA 2YSUB 4DV0B 1SQXH 1WJZA 5CA3A 3RN4A 3HKDB 5E1AC 3OMIB 1BSMA 5DECA 2QWRB 1HP8A 3ZMUA 1WPBA 5B5EZ 2CH7B 3X2QB 3JSNA 4DR5B 1XNQB 2Q5ZA 5IT9N 2KB1A 2R70A 3RGBA 2VQEB 2EJ7A 5J2UA 1WLEA 1XDCA 3DC5A 3S3XA 4FLZA 3OT7A 1TGOA 3LSQA 3CJHB 3CCEV 1SA0A 1HNWB 1FJGB 3ABKC 1OZ0A 1UJWB 1HR0O 3STZC 4RWUA 3ABUA 2HVJC 3GWOA 2IBZH 2H3OA 4WBNB 5H9CA 4X62B 3TXQA 3JALA 4LF7O 1VP7A 3ABKB 1J5EB 4BW5A 3ETQA 1US6A 3ABMB 3F5WC 4XDJA 3FAVB 5JH7A 1H2GA 4FFBA 3F5TA 1NS1A 4LR3A 5GONA 4FM2A 3VQXA 1VARA 3ZS8C 2LP7A 4DV4B 1G8MA 1EZVH 2IJHA 2KSDA 5B1AB 4XBFA 3OUSA 4JYAO 2Z0AA 2QWOB 3K0GA 1FXKA 3E22A 5J2UB 2K1EA 1PPJH 4GLXA 1HNZB 4GX0A 1NU1H 4BWAA 5CN0A 3OGCC 2Y48A 5KHJA 2JGDB 5IWAB 5D5PA 1I08A 4CC5A 3JD2A 1P49A
chains in the Genus database with same CATH topology
3J81N 2UUAO 4JI8O 4DR6O 1R6TA 5IT9N 2UUCO 4B3MO 5BR8O 1XMOO 1F7YA 4DR3O 4DR4O 2UU9O 4JI6O 5FLXN 4DV4O 3O65A 3J7AU 2FKXA 3SDLA 4DV5O 1HR0O 4LF9O 2ZKOA 4NXMO 4DV2O 2DJVA 4LFAO 1X59A 4JI1O 4DUZO 4DV0O 3T1YO 3JAMN 1FKAO 5LMUO 1HNZO 1XNRO 1R1BA 4YHHO 4LF6O 4LF7O 2UXCO 4JI3O 3R66A 1AILA 5IWAO 1YZBA 5A2QN 4JV5O 4DV7O 4JI2O 4X65O 1FJGO 4DR2O 4LF8O 4LF4O 4LFCO 4GKJO 5LL6Y 4NXNO 2UXDO 4A5UB 4DR1O 4DR5O 1I94O 4OPHA 4DV6O 1XNQO 5BXZA 4JI5O 3F5TA 2DOSA 2N74A 3M8AA 2E5LO 4K0KO 1NS1A 4X66O 1G1XB 2VQEO 4DV3O 2F4VO 1A32A 2JRIA 4B3SO 1HNXO 4GKKO 4DUYO 2UUBO 3J80N 1IBLO 1AB3A 4JI7O 4JI4O 4X64O 1N33O 1XMQO 2HHHO 5LMNO 4OX9O 1HNWO 4B3TO 1IBMO 4JYAO 2Z0AA 4KHPO 3OTOO 2LW7A 4DR7O 1N36O 2VQFO 4B3RO 2UXBO 1KUQA 3T1HO 1DK1A 5H5NA 4OPAA 1FYJA 1N32O 4X62O 4YY3O 2ZM6O 1D2DA 2AGAA 4LFBO 1N34O 3RT3C 1XEQA 5BY1A 1J5EO 4DV1O 4AQYO 4JI0O 4LF5O 1IBKO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 N;  2UUA O;  4JI8 O;  4DR6 O;  1R6T A;  5IT9 N;  2UUC O;  4B3M O;  5BR8 O;  1XMO O;  1F7Y A;  4DR3 O;  4DR4 O;  2UU9 O;  4JI6 O;  5FLX N;  4DV4 O;  3O65 A;  3J7A U;  2FKX A;  3SDL A;  4DV5 O;  1HR0 O;  4LF9 O;  2ZKO A;  4NXM O;  4DV2 O;  2DJV A;  4LFA O;  1X59 A;  4JI1 O;  4DUZ O;  4DV0 O;  3T1Y O;  3JAM N;  1FKA O;  5LMU O;  1HNZ O;  1XNR O;  1R1B A;  4YHH O;  4LF6 O;  4LF7 O;  2UXC O;  4JI3 O;  3R66 A;  1AIL A;  5IWA O;  1YZB A;  5A2Q N;  4JV5 O;  4DV7 O;  4JI2 O;  4X65 O;  1FJG O;  4DR2 O;  4LF8 O;  4LF4 O;  4LFC O;  4GKJ O;  5LL6 Y;  4NXN O;  2UXD O;  4A5U B;  4DR1 O;  4DR5 O;  1I94 O;  4OPH A;  4DV6 O;  1XNQ O;  5BXZ A;  4JI5 O;  3F5T A;  2DOS A;  2N74 A;  3M8A A;  2E5L O;  4K0K O;  1NS1 A;  4X66 O;  1G1X B;  2VQE O;  4DV3 O;  2F4V O;  1A32 A;  2JRI A;  4B3S O;  1HNX O;  4GKK O;  4DUY O;  2UUB O;  3J80 N;  1IBL O;  1AB3 A;  4JI7 O;  4JI4 O;  4X64 O;  1N33 O;  1XMQ O;  2HHH O;  5LMN O;  4OX9 O;  1HNW O;  4B3T O;  1IBM O;  4JYA O;  2Z0A A;  4KHP O;  3OTO O;  2LW7 A;  4DR7 O;  1N36 O;  2VQF O;  4B3R O;  2UXB O;  1KUQ A;  3T1H O;  1DK1 A;  5H5N A;  4OPA A;  1FYJ A;  1N32 O;  4X62 O;  4YY3 O;  2ZM6 O;  1D2D A;  2AGA A;  4LFB O;  1N34 O;  3RT3 C;  1XEQ A;  5BY1 A;  1J5E O;  4DV1 O;  4AQY O;  4JI0 O;  4LF5 O;  1IBK O; 
#chains in the Genus database with same CATH topology
 2MK3 A;  4CS2 A;  4DR1 B;  2Q7G A;  1I94 B;  4LCU C;  3TK1 A;  2WLI B;  1ENV A;  1DGS A;  3OFN G;  4JYB A;  3JAL B;  4X1Y A;  3K5L A;  4YJ3 B;  1BL8 A;  5IE9 A;  1K97 A;  3LSS A;  4D7S A;  2C2A A;  4JTC B;  5J2T A;  3ICX A;  1JFF A;  4I50 A;  1OHH G;  2ZKO A;  4O2A B;  5JH7 B;  4FFB B;  1ZWI C;  1M5I A;  4LFA O;  4FM0 A;  2F93 B;  1K34 A;  2ITD C;  1JCH A;  2BOC C;  1ZX3 A;  1VQM V;  1JX9 A;  4X66 B;  5EK0 A;  1JR9 A;  2W0F C;  1Q7Y W;  4PDM A;  5L3E A;  4LFB B;  3B09 A;  4FVM A;  2Q0O C;  2XAS A;  1M4U A;  3APQ A;  1VF6 A;  1ZTE A;  1M1K W;  2ZDI A;  3S3W A;  1FXK B;  3E22 B;  2PYJ A;  5GTH Z;  1GAX A;  2XAJ A;  2WLM A;  4R8C A;  4X1I A;  4DR3 B;  2V4D A;  1XHX A;  3CHX A;  4H33 A;  5TIS Z;  4LH6 A;  1UFI A;  2KKW A;  1VF7 A;  4ZOL A;  3E35 A;  4B3S O;  4DK0 A;  4GKK O;  4P30 A;  2ZXW C;  1I5X A;  2DQ3 A;  4UCU A;  3T4D A;  3GB7 C;  3JCZ A;  5JQG B;  1IBK B;  4PI2 A;  1B06 A;  1QCE A;  3CX5 F;  3RYF A;  4DUZ B;  5IYC O;  3OTO O;  4DR7 O;  1N36 O;  4FLW A;  3I56 V;  2F23 A;  3SYC A;  3B77 A;  4J9Y B;  4X1Y B;  2ZXW B;  1CEZ A;  1D2D A;  1K8A W;  3OUF A;  3CXC U;  2QEX V;  5J2T B;  2DWD C;  4FIP C;  1JFF B;  1QVF U;  4UCR A;  4GKJ B;  4LF5 O;  1VF6 C;  2XAH A;  1OCR C;  2ZDI C;  4WF9 V;  1R6T A;  3CS5 A;  2X6A A;  1W2B U;  1QR9 A;  2VRZ A;  1IXM A;  5CBF A;  5CBH A;  2IJK A;  2IJJ A;  3CC2 V;  3CXH F;  1RSO B;  3T2M A;  1RM1 C;  4W4K A;  1E1Q G;  1XMQ B;  4X65 B;  1OCR B;  4L8J A;  4DV5 O;  1VQ9 V;  5F2V O;  2QWP B;  2IW5 A;  4J9Z B;  4DW0 A;  2BCC H;  2DJV A;  1SES A;  4ASU G;  3K3W A;  3JYC A;  4X1I B;  3CCR V;  1VF5 B;  3VQY A;  3A0H Z;  3OD4 A;  1YCI A;  2HP8 A;  5C93 A;  4ZOL B;  2DWE C;  5EIB D;  5IDJ A;  1IX9 A;  4PDL A;  4DUY B;  1FXH A;  3A0B Z;  4LWS A;  2QTO A;  1FJG O;  2IJI A;  1U97 A;  5BMV A;  2QDO A;  1B3Q A;  2UXN A;  3RYF B;  1XQ8 A;  4JI8 B;  4FM1 A;  2WWW A;  1WAZ A;  3THO A;  1AI6 A;  3QTC A;  2N74 A;  1I0H A;  1XRE A;  2ZQM A;  2QJ1 A;  4Z1V A;  3ZHT A;  3G4S V;  1ZSP A;  4HYO A;  4HBN A;  2BE3 A;  2LW7 A;  4DR6 B;  4B3R O;  1V55 C;  3VBB A;  4OPA A;  2YIB D;  1F4N A;  2AHY A;  1UPG A;  4GCZ A;  3UM7 A;  4IYI A;  4WFH A;  4X8A A;  5AG2 A;  2YI8 A;  3W7S A;  1R3K C;  1V55 B;  1NKD A;  1XUQ A;  1Q6H A;  1R3L C;  3CD6 V;  4EEQ A;  2JS3 A;  2UU9 O;  2EIJ B;  1SRY A;  1VMG A;  4JI4 B;  4LWS B;  3ZHQ A;  1AI4 A;  2V1D A;  4B3T B;  3T4Z A;  4X9Q A;  5BMV B;  3RYC A;  4NXN B;  5J9P C;  2R9I A;  1MMM A;  3RVZ A;  2R72 A;  3T1H B;  2EJR A;  4K0K B;  3JD4 A;  2ZE6 A;  1YTF B;  1THZ A;  4PA4 A;  4AI8 A;  3W7U A;  1QR8 A;  1VEW A;  1R3I C;  4G2K A;  3ZED A;  1EFR G;  1X4T A;  4IIJ A;  5LBQ A;  1QBZ A;  5IYZ A;  1PM9 A;  1AIL A;  4I9W A;  4JI0 B;  3ZRX A;  1H2L A;  3OEH G;  1GN2 A;  2A3Q A;  2FML A;  2VWK A;  2UUA B;  2UXD O;  3H1L H;  4MVR A;  1ZLZ A;  2PGG A;  3OTF A;  1KD1 W;  2UXB B;  4JI5 O;  1QHT A;  4X66 O;  2B1I A;  3B8N A;  5LXT A;  3ASO B;  2QSA A;  2ZIM A;  1MSD A;  3J80 N;  2BSK A;  5LOV A;  2WLJ A;  3MDS A;  1XOU A;  2A9H A;  3H9V A;  4ZI7 B;  4UCT A;  4QGP A;  2P67 A;  3C3T A;  4K3A A;  2WLK A;  3OMA B;  4GX1 A;  3ZN1 A;  2ZM6 O;  2FTK A;  3K06 A;  4F6E A;  2AZ2 A;  4DR2 B;  2DQ0 A;  4CH4 A;  3RYC B;  4DV1 O;  4LFC B;  3SPC A;  1GRJ A;  4KL1 A;  1IBK O;  1O9G A;  3RYH A;  4CH6 A;  1AP5 A;  2CTP A;  3AG3 B;  5BR8 O;  2RDC A;  1BHB A;  1DLB A;  3ZHS A;  1HNX B;  2RJZ A;  4IIJ B;  2FB5 A;  5IYZ B;  4FFK A;  2DYS C;  5LMN B;  1H38 A;  2LW1 A;  3CWB H;  3E83 A;  4CBC A;  2P5O A;  3MHH C;  2WA3 A;  4W4L A;  4RUE A;  1Q8I A;  1S72 V;  4N23 A;  5EZY A;  5H6R A;  5LXT B;  1M56 C;  3AG4 C;  4JAU A;  4ZKI A;  2O57 A;  5JWP A;  1K4D C;  2DYS B;  5CA0 A;  1CP9 A;  4WFF A;  1LNQ A;  4WCE V;  1W59 A;  2BSK B;  2QE7 G;  2QTS A;  3A2F A;  3R66 A;  5H2F Z;  5LOV B;  3VQV A;  1SS3 A;  4X65 O;  1GM8 A;  3EXA A;  3K79 A;  4FLU A;  2UUC B;  1M56 B;  2EIL C;  3AG4 B;  4QNH B;  2HG5 C;  4WFA V;  1GO3 F;  4RO2 A;  2EIK C;  4CH5 A;  2Q7H A;  1NQT A;  1EN5 A;  1AI5 A;  4DUY O;  1N34 B;  2ETN A;  3BAA A;  1TVK A;  4X64 O;  2NR5 A;  2Y4U A;  2M6Y A;  1M57 C;  1VIB A;  3RYH B;  4O2B A;  1SET A;  4RQE A;  3P32 A;  1Y76 A;  5DED A;  3AG2 C;  1YIT V;  1FYJ A;  4MTG A;  1XNR B;  4YY3 O;  1MAB G;  1Q6U A;  2XAG A;  5KX5 A;  3HKB A;  1KU9 A;  4MVM A;  4LNU A;  2IU0 A;  3J81 N;  1JMK C;  3WG7 B;  3AG2 B;  1OCO C;  3ZMZ A;  4DR6 O;  4F4L A;  5EZY B;  4MW3 A;  2X0L A;  3ZCC A;  1XMO O;  1PP9 H;  2XHB A;  2F4V B;  2Z5U A;  5CA0 B;  5KHK A;  3OM3 B;  2GTA A;  3M7M X;  3O65 A;  2YUA A;  5FPR A;  3I5D A;  4UCV A;  2QM8 A;  1OCO B;  2PYL A;  2LGQ A;  4KHP B;  2QKC A;  4O4I A;  5EC2 C;  4DK1 A;  1IXB A;  1R6K A;  4JI1 O;  3KCX A;  4RQF A;  2EIN C;  3AG7 A;  1K33 A;  5EYP A;  3JSL A;  5JJE B;  3JD3 A;  3G6E V;  4YHH O;  1TVK B;  3CCQ V;  3IJ4 A;  1SQF A;  2ZE5 A;  4JV5 O;  4I9Q A;  1EZJ A;  4PA3 A;  1K7D A;  4NXN O;  4MVQ A;  3E2E A;  2X7R B;  1M9N A;  1MZE A;  2EIN B;  5BXZ A;  1KKD A;  4K0K O;  1Q86 W;  5B1N A;  5K1P A;  1LUV A;  3FD9 A;  1FS0 G;  3QF7 A;  4DYL A;  1A32 A;  3OAA G;  3FB7 C;  2JJ2 G;  3D8C A;  1FFT B;  4HNA A;  5EBW C;  5L3G A;  2RMK B;  2F43 G;  3DGE A;  1L8D A;  3HKB B;  4IHJ A;  3CCM V;  4LNU B;  4LF9 B;  3B2E E;  2BOB C;  4NXM B;  4DO2 A;  2R9A A;  4FMT A;  3CCJ V;  2UXB O;  2F66 C;  2HJF C;  2XND G;  3IAY A;  1YIJ V;  2OIE A;  3MAQ A;  5LMU B;  4EFE A;  3ABL C;  2Q73 A;  5DM6 V;  2GHY A;  2UXC B;  3E89 A;  3DC6 A;  4B7K A;  1H2N A;  3M99 B;  4PHZ A;  3D3Q A;  4TT3 G;  1BQ0 A;  3RYI A;  4O4I B;  3CRM A;  2YEV A;  2AW9 A;  4I0X A;  2VWJ A;  4DV6 B;  1AJN A;  4ZIB A;  3I55 V;  2E5L B;  2PI4 A;  1Q6I A;  1ZAU A;  1S3J A;  2WLH A;  1RFY A;  3K9S A;  5EYP B;  2OCH A;  3RFR A;  2X6C A;  3T1C A;  4TWK A;  3E8H A;  3LDC A;  5KUM A;  4LBE C;  1BZK A;  1SA0 B;  3ML0 A;  4FLX A;  3UQ8 A;  4Z2W A;  2D2C B;  2Q4P A;  5IYB O;  4TQD A;  1V9P A;  2OTL V;  3BCC H;  3F7Y C;  5LP6 A;  2CGO A;  1BT8 A;  2WLN A;  1FAF A;  5CA1 A;  4P2Z A;  4LP8 A;  4TOI A;  3DSQ A;  1BGY H;  4HNA B;  4IGG A;  3UO2 A;  3QG5 A;  3SJQ C;  3ZN0 A;  4IHJ B;  1VQO V;  2GTS A;  4PA9 A;  3IGA C;  1PD3 A;  4WFG A;  2WSS G;  1IBM B;  2OCC C;  2BTQ A;  4PI0 A;  5GTI Z;  4LF4 O;  4LF8 O;  2YI9 A;  3SYA A;  2VQF B;  1TAE A;  5GON B;  4DV3 O;  3CCV V;  4JTD B;  4NKG B;  3HPL C;  4JZ2 A;  2OCC B;  2Q9L A;  1NT2 B;  3RYI B;  1ARO P;  2YEV B;  4I0X B;  4Z1M G;  2H8P C;  4JZG A;  5LP6 C;  3E86 A;  2YIB A;  5DN6 G;  4GX5 A;  4JI6 B;  5C8Y A;  3LUT B;  3QO7 A;  2XAQ A;  2JK5 C;  1R3J C;  2DMX A;  4IYH A;  4J10 A;  4WFE A;  5EIB C;  1N34 O;  1YXB A;  2ZR2 A;  3JAW A;  3A0R A;  1EM1 A;  2CTW A;  2IM9 A;  5CMU A;  4D7T A;  4G28 B;  2JGU A;  4MS2 A;  2ADQ B;  1TUE B;  2A79 B;  4F6R A;  5CA1 B;  3TXS A;  2WAM A;  2YIA A;  2JEU A;  2FL4 A;  1XI1 A;  1QVG U;  4FLT A;  3N2G A;  1IBL B;  4Q20 A;  2JIZ G;  3CRQ A;  4OX9 B;  3EHB B;  3CC4 V;  4I50 B;  2UXX A;  4K8X A;  3FYI B;  3CME V;  3F7V C;  4MVU A;  4DV0 O;  1WNS A;  1IDS A;  2W6J G;  1YJ9 V;  1VQ7 V;  2JVD A;  1M90 W;  2E74 B;  1KKC A;  1PKX A;  2DN9 A;  4PDR A;  1D5N A;  5KA5 A;  1P7B A;  1YVW A;  4AQY B;  3ETE A;  2IH1 C;  4JI3 B;  4DXW A;  1MZF A;  2ZIN A;  2A06 H;  1L0N H;  4DR5 O;  3PJS K;  1XNQ O;  4QE7 A;  1Z5W A;  1KQS U;  4BR6 A;  1V54 C;  4DR4 B;  2B9Z A;  2VQE O;  5C8Y B;  1BQZ A;  3O9O A;  1RM1 B;  3SYP A;  3JAW B;  2XAF A;  3SJB C;  3ZHU A;  3MD0 A;  1HNW O;  4DV2 B;  1F51 A;  1XIL A;  3CMA V;  1V54 B;  3T1Y B;  4F6R B;  4J42 A;  3RBZ A;  3KCY A;  1GM7 A;  3ZX6 A;  4JYC A;  4FZ0 A;  4X62 O;  4YXW G;  1VQN V;  2RQ6 A;  3JAR A;  4LF6 B;  1S76 D;  1J5E O;  3R65 A;  1TUB A;  3VQW A;  4E4E A;  2PF4 E;  3CYO A;  2OT5 A;  3OR7 C;  2E76 B;  1OCC C;  2DYR C;  3SJA C;  1AJP A;  4FLV A;  3AEI A;  2PY5 A;  4TV9 A;  1F7Y A;  3CCS V;  3QO5 A;  3ZJZ A;  5FLX N;  3SYQ A;  1OCZ C;  1K5S A;  3LNM B;  2EBO A;  4DV4 O;  3AK3 A;  4KUM A;  2ZE8 A;  2DYR B;  5D5Q A;  1NTZ H;  3CC7 V;  3GVM A;  2ATK C;  2EZP A;  1SKV A;  1Q43 A;  3H01 A;  3OEE G;  5LGN A;  4J80 A;  4C7U A;  5B66 Z;  3L70 H;  1OCZ B;  1HNZ O;  2YXL A;  3SR2 C;  4JTA B;  1E79 G;  1ZL8 A;  1HWY A;  4JI7 B;  3Q4H A;  1N33 B;  5IWA O;  1SZX A;  3TJT A;  4R7C A;  1NVP D;  3FB5 C;  4DR1 O;  1I94 O;  2EIM C;  2XT9 A;  4UVA A;  3RWR D;  1F23 A;  3JAR B;  1SQG A;  2AXT Z;  3FB8 C;  3BA9 A;  1TUB B;  4UVB A;  1HR0 B;  3SGI A;  3P30 A;  3JD1 A;  2PUS A;  1IBM O;  1Q90 D;  2EIM B;  1Y67 A;  1N0J A;  2W6I G;  3U11 A;  2VQF O;  4B3M B;  2P06 A;  4MVO A;  4ZHQ A;  3CCU V;  1NH2 D;  3JAK A;  2XUM A;  4KFM A;  5LA6 A;  4LF7 B;  1DF4 A;  2ZE7 A;  2W0X A;  2AHZ A;  4TV8 A;  5H6Q A;  4LFB O;  3L75 H;  5BY1 A;  3L74 H;  4H44 B;  5KHG A;  4UFZ A;  5IY5 C;  2LQT A;  1MA1 A;  5CB4 A;  3ASN C;  4H13 B;  2CK3 G;  1AI7 A;  3FYE B;  2EUL A;  3ZHV A;  1CXZ B;  4ABM A;  1Z2G A;  4DR3 O;  1BHA A;  2KG7 A;  3PN1 A;  2KQX A;  4JI6 O;  3APO A;  2ZCE A;  3Q4H B;  4FJC C;  5IY5 B;  2NN4 A;  4DV7 B;  2CTQ A;  2WA4 A;  4JYA B;  1URF A;  3ASN B;  1X59 A;  4D6T H;  4DUZ O;  3OE7 G;  2Y69 C;  1OV9 A;  4XDK A;  1YTF D;  5JJJ B;  4N21 A;  2PZS A;  2CAZ C;  2UUB B;  5B3S C;  3K5O A;  4NYK A;  2HHH B;  2YIC A;  1K4C C;  1VQK V;  4GKJ O;  2ITC C;  4YIO A;  1S5J A;  4LH7 A;  3JCU Z;  3AG1 C;  3WFV A;  3M8A A;  1MSW D;  4PA6 A;  1AJQ A;  2CDY A;  1W0J G;  5LA6 B;  1KB9 F;  4TV8 B;  4UB8 Z;  3HB3 B;  4X1K A;  1SZT A;  1HDJ A;  2DE0 X;  5LHG A;  3TGU H;  1XMQ O;  3QVN A;  4GYC B;  2ZNI A;  4LFA B;  5HFM A;  1ROP A;  1Y66 A;  5CB4 B;  3SPI A;  1Y74 A;  3G80 A;  2ZT9 B;  1XL6 A;  1MOF A;  4TQF A;  2KG7 B;  4AHC A;  1Q5O A;  1SQV H;  4R6Z A;  4YIP A;  2NNU A;  5KHI A;  4GZR B;  1K73 W;  3KG2 A;  3CEI A;  4J7J A;  1BMF G;  1Z5V A;  2AGA A;  2YXH A;  1XEQ A;  1QLN A;  4O4H A;  1J95 A;  3FFQ A;  4JI8 O;  2EIL B;  2BTO A;  1YDX A;  3K5N A;  1Y4M A;  2EIK B;  2JS5 A;  1NTM H;  4GKK B;  4BIZ A;  5LHI A;  1YJN V;  3WU2 Z;  4J11 A;  5B1O A;  3CJH A;  2ZIO A;  1GTO A;  1KBH A;  2B1G A;  1PV0 A;  4JI2 B;  1M57 B;  4MTX A;  3L72 H;  4QE9 A;  3OTO B;  3ZHR A;  1Q3E A;  4UB6 Z;  4DR7 B;  1N36 B;  5IJ0 A;  4BIU A;  5L3D A;  3D3I A;  1MNG A;  5BZB A;  1AR4 A;  3DTU B;  4PD4 F;  4MVZ A;  1FKA O;  3LSU A;  2ARH A;  3W7W A;  5LYJ A;  4CZZ A;  1YZB A;  4LF5 B;  2OIG A;  3NXS A;  1KP3 A;  3X2Q C;  1Y74 B;  1GH6 A;  1KEC A;  1LUW A;  1GK9 A;  2ZD9 A;  1G1X B;  1N32 B;  1B6Q A;  3BAB A;  3G6B A;  3ZMS A;  4K8Z A;  4JI7 O;  4JI4 O;  1N33 O;  4DV5 B;  4O4H B;  4BW9 A;  4B3T O;  3ZIA G;  1PL0 A;  1R6N A;  4L87 A;  4O2B B;  3H1K H;  1YJW V;  1Y76 B;  2VS0 A;  4EFB A;  2A0L A;  4MTF A;  3T1H O;  2N04 A;  5H5N A;  3WB1 A;  1T5E A;  2IU3 A;  1S5L Z;  2JGD A;  5LGT A;  5KAI Z;  5KX5 B;  3W7X A;  4FPP A;  2Q0A A;  1AR1 B;  4JI0 O;  3RW0 A;  3SPJ A;  3ABM C;  5IJ0 B;  2UUA O;  3OR6 C;  2HVK C;  4B3M O;  1AVM A;  2WLI A;  3BA8 A;  3TCU A;  1NZ6 A;  1L1F A;  1U96 A;  3EFF K;  2DW4 A;  4PDV A;  4U3J A;  4YJ3 A;  4I55 A;  5LYJ B;  1XL4 A;  2XTA A;  4IL6 Z;  4IT5 A;  4O4L A;  3BRC A;  2P22 C;  2Z3Y A;  4O2A A;  5B1A C;  4B3R B;  3CRR A;  2JDI G;  1KYO F;  1JOY A;  2E3C A;  1F4M A;  3BEH A;  3ABL B;  1VQ8 V;  3L73 H;  1TA8 A;  3OMN B;  2P6J A;  2Y4T A;  3L71 H;  2FYU H;  3FKS G;  4B08 A;  1SQB H;  4DV7 O;  4X89 A;  4UCO A;  4QPJ A;  4DR2 O;  2CTR A;  4I4T A;  2RNB A;  4LFC O;  3BFR A;  2LJ2 A;  1GN6 A;  4PJ0 Z;  4GUN A;  3E8G A;  1YF2 A;  4UXN A;  4MT8 A;  1NTK H;  2P90 A;  1M93 A;  3LDD A;  5EBM C;  2UU9 B;  5A9G A;  1EN4 A;  2YXY A;  2PI5 A;  3JD0 A;  2QWQ B;  4HZ3 A;  4I7Z B;  1HNX O;  2A7W A;  1D5A A;  4WFB V;  2UUB O;  2R9R B;  1IVS A;  3ETD A;  1H2S B;  5IYD O;  2Q68 A;  5JQG A;  5EBL C;  5LMN O;  4MTO A;  4E2L A;  2HHH O;  4UV8 A;  3E8B A;  1H8H G;  4JAS A;  3JAS A;  3KKY A;  2HLD G;  3QNE A;  3K59 A;  5HFL A;  1K5Q A;  3ZRS A;  1Q82 W;  4MVS A;  1DTO A;  4NTY A;  2ADP A;  5JJN B;  3BHP A;  5EC1 C;  4U3J B;  4I55 B;  4O4L B;  5B1B C;  4TUY A;  4XDL A;  1ORQ C;  2IH3 C;  1JJ2 U;  2JEX A;  2UXD B;  3K04 A;  3WB0 A;  1FXK C;  2LO1 A;  4JI5 B;  5CBG A;  2UUC O;  2YDE A;  3OW2 U;  4DW1 A;  3IC9 A;  2GSM B;  4U7O A;  2YC0 A;  3LDE A;  2HEP A;  4J7Z A;  3K58 A;  5B1B B;  3IFX A;  1BCC H;  1RSO A;  4RAI A;  1N8R W;  2QKA A;  5KUK A;  4I4T B;  1I7F A;  5E79 Z;  2JJ1 G;  3VOU A;  3ZRV A;  3W7T A;  1NI8 A;  5L3C A;  2Y0I A;  5LP6 B;  3JAM N;  1PNK A;  2QM7 A;  4PEL A;  4RUF A;  5FL7 G;  4FLY A;  2ZM6 B;  4LC1 A;  4CS3 A;  4J7K A;  1XNR O;  2EZO A;  2Q69 A;  1JPX A;  4HAM A;  3DXR A;  4DV1 B;  5A2Q N;  2V7Q G;  4JI2 O;  4BAY A;  2BTQ B;  5IJ9 A;  4A5U B;  3JAS B;  3G67 A;  2G38 A;  3EVK A;  5BR8 B;  5KMG A;  1P4R A;  4O4J A;  2QM4 A;  3U0Z A;  1Q81 W;  2RN9 A;  3BVO A;  2F4V O;  1WB7 A;  1COW G;  2JRI A;  3FX7 A;  2OWO A;  2B5U A;  1G4Y B;  1OJH A;  1AB3 A;  4TUY B;  1SF9 A;  3MHS C;  3B8M A;  3A8T A;  2Q8V A;  2RCV A;  2HJD A;  4BIO A;  5LGU A;  3KZI Z;  4Q6G A;  3BPZ A;  4G27 B;  2GBO A;  4FK5 C;  3RVY A;  1K3E A;  4KHP O;  3OGI B;  1K9M W;  3N2K A;  4CC6 A;  3BY6 A;  5ITZ A;  1N32 O;  3STL C;  1IZ3 A;  3AK2 A;  3HKE A;  3C3S A;  1P7G A;  1JQ0 A;  1PNM A;  1SC5 B;  3K57 A;  3N27 A;  1WP8 A;  2GUZ A;  1GN3 A;  4CH3 A;  2CE4 A;  3UT5 A;  2WLL A;  4EB6 A;  1FXV A;  3N2G B;  2CGN A;  2XOK G;  3DXR B;  5JVD A;  4X64 B;  3CSX A;  1IUR A;  4H0L B;  2FKX A;  5IJ9 B;  4LF9 O;  1NVP B;  4NXM O;  1PL4 A;  5GW7 A;  1W0K G;  2QA4 V;  1WB8 A;  5KMG B;  4O4J B;  1H8E G;  3SPH A;  2MW2 B;  5L3B A;  4YY3 B;  5LMU O;  4PA7 A;  2P4K A;  3ZMT A;  2UXC O;  4U3F H;  4X88 A;  3B4S A;  1VQ5 V;  1OCC B;  5LL6 Y;  2ZR3 A;  4P9O A;  5LHH A;  4DRX A;  4DV6 O;  3N2K B;  4QJF B;  1XMO B;  5ITZ B;  2DOS A;  2LFS A;  4H37 A;  2E5L O;  1NH2 B;  1NR7 A;  5K1X A;  2HR3 A;  1FFX A;  2Q67 A;  2EIJ C;  1SER A;  3HKE B;  4P9P A;  2P7T C;  3FB6 C;  3ZRW A;  3WB2 A;  2HFE C;  3JAT A;  3G71 V;  1YI2 V;  5JCO A;  3K08 A;  2D3O W;  5KA6 A;  3IC7 A;  3CCL V;  4JI1 B;  4ZI7 A;  4JYY A;  2WPD G;  2GUZ B;  3D36 A;  2ODM A;  3UT5 B;  2WLL B;  1P84 F;  2EX3 A;  2QKS A;  2HKO A;  4EB6 B;  3CRC A;  3E8F A;  1VQL V;  1BE3 H;  4YHH B;  5JVD B;  4KXR A;  1YHQ V;  1S0V A;  1G6U A;  1QLE C;  4UV9 A;  1ZUQ A;  3RT3 C;  4ZBM A;  4YJ2 A;  4JV5 B;  4X20 A;  3UO3 A;  1KP2 A;  4KP4 A;  4NVP A;  4FZ1 A;  5KLV H;  4B7E A;  3GWK C;  1KMI Z;  2X6B A;  4TV9 B;  1PNL A;  1SQQ H;  4MW8 A;  3QO8 A;  1JA8 A;  1GMG A;  1QLE B;  3ASO C;  2NLJ C;  5L3F A;  2L6L A;  2M7W A;  3K5M A;  1GM9 A;  3J7A U;  3SDL A;  4PV1 B;  4NB5 A;  5JCO C;  4DRX B;  2Y0P A;  1MG1 A;  3D36 C;  3CB2 A;  2QWN B;  1FFX B;  4JAA A;  1VQ6 V;  1GN4 A;  4JF3 A;  1ZL8 B;  2LFR A;  1YSC A;  3SYO A;  3ZRW B;  1L0L H;  3K03 A;  1I5Y A;  3JAT B;  1R73 A;  1XHZ A;  3NR7 A;  1S5H C;  4MSW C;  1QNM A;  2E75 B;  1KC8 W;  1H2M A;  4OXS A;  1VQ4 V;  2GV9 A;  2YID A;  3UCS C;  4EKW A;  2AZ0 A;  3AG3 C;  3ETG A;  5KAF Z;  5FNV A;  4I5S A;  2F95 B;  3P3P A;  4JGS A;  3HKC A;  4YJ2 B;  1IBL O;  1GKF A;  4X20 B;  1N0N A;  4GX2 A;  4JPR A;  4OX9 O;  3H1I H;  2OTJ V;  1SQP H;  2PTM A;  1VQP V;  2Y69 B;  4QIW F;  4UUJ C;  2CUG A;  3L9D A;  1KUQ A;  3CP1 A;  1H2K A;  1WPX A;  1DK1 A;  4ZHQ B;  3K0D A;  1JVM A;  1HW7 A;  3JAK B;  5B3S B;  1O9H A;  2YS8 A;  4NTX A;  3HR0 A;  4OGQ B;  4K35 A;  2OYQ A;  4UVC A;  1RPO A;  4LF8 B;  1YEW A;  4LF4 B;  4NTW A;  4AQY O;  1WA8 A;  4U7N A;  4JI3 O;  3UKM A;  3AG1 B;  4AIL C;  1WN7 A;  3U10 A;  1EN6 A;  4R50 A;  5KHH A;  1NBM G;  3HKD A;  4DV3 B;  1RPR A;  3ABT A;  1RP3 B;  4DR4 O;  3H1J H;  1K92 A;  3CE2 A;  2QGN A;  3B40 A;  2L35 A;  4J41 A;  3H1H H;  2ILM A;  1DF5 A;  2Q6A A;  4GT1 A;  2CH7 A;  3K9A A;  4DV2 O;  1S77 D;  3ZBH A;  2F1M A;  1CPY A;  3T1Y O;  1WP7 A;  5FNV B;  1N4C A;  1BS3 A;  3P3N A;  1JJO A;  3TET A;  4B3S B;  3HKC B;  3ZMV A;  1R1B A;  3SJC C;  2K9P A;  4UCS A;  4LF6 O;  2N05 A;  1QQC A;  3CRA A;  2QR4 A;  2GDS A;  1NR1 A;  1LR1 A;  3LNN A;  3WG7 C;  4QPK A;  4TSF G;  4NR1 A;  4OPH A;  1B04 A;  2P4V A;  3AK1 A;  1NJI W;  1Y6X A;  3CPW U;  4WBN A;  2LGW A;  1AR5 A;  1FPO A;  1E1R G;  2ZNJ A;  4X1K B;  1FD9 A;  5FPO A;  1QU7 A;  4CS4 A;  2Q7E A;  1EBO A;  4ICG A;  3C90 A;  3SPG A;  1WA8 B;  2H94 A;  1AP6 A;  3FAV A;  1XBL A;  4JAV A;  2YSU B;  4DV0 B;  1SQX H;  1WJZ A;  5CA3 A;  3RN4 A;  3HKD B;  5E1A C;  3OMI B;  1BSM A;  5DEC A;  2QWR B;  1HP8 A;  3ZMU A;  1WPB A;  5B5E Z;  2CH7 B;  3X2Q B;  3JSN A;  4DR5 B;  1XNQ B;  2Q5Z A;  5IT9 N;  2KB1 A;  2R70 A;  3RGB A;  2VQE B;  2EJ7 A;  5J2U A;  1WLE A;  1XDC A;  3DC5 A;  3S3X A;  4FLZ A;  3OT7 A;  1TGO A;  3LSQ A;  3CJH B;  3CCE V;  1SA0 A;  1HNW B;  1FJG B;  3ABK C;  1OZ0 A;  1UJW B;  1HR0 O;  3STZ C;  4RWU A;  3ABU A;  2HVJ C;  3GWO A;  2IBZ H;  2H3O A;  4WBN B;  5H9C A;  4X62 B;  3TXQ A;  3JAL A;  4LF7 O;  1VP7 A;  3ABK B;  1J5E B;  4BW5 A;  3ETQ A;  1US6 A;  3ABM B;  3F5W C;  4XDJ A;  3FAV B;  5JH7 A;  1H2G A;  4FFB A;  3F5T A;  1NS1 A;  4LR3 A;  5GON A;  4FM2 A;  3VQX A;  1VAR A;  3ZS8 C;  2LP7 A;  4DV4 B;  1G8M A;  1EZV H;  2IJH A;  2KSD A;  5B1A B;  4XBF A;  3OUS A;  4JYA O;  2Z0A A;  2QWO B;  3K0G A;  1FXK A;  3E22 A;  5J2U B;  2K1E A;  1PPJ H;  4GLX A;  1HNZ B;  4GX0 A;  1NU1 H;  4BWA A;  5CN0 A;  3OGC C;  2Y48 A;  5KHJ A;  2JGD B;  5IWA B;  5D5P A;  1I08 A;  4CC5 A;  3JD2 A;  1P49 A; 
#chains in the Genus database with same CATH homology
 3J81 N;  2UUA O;  4JI8 O;  4DR6 O;  1R6T A;  5IT9 N;  2UUC O;  4B3M O;  5BR8 O;  1XMO O;  1F7Y A;  4DR3 O;  4DR4 O;  2UU9 O;  4JI6 O;  5FLX N;  4DV4 O;  3O65 A;  3J7A U;  2FKX A;  3SDL A;  4DV5 O;  1HR0 O;  4LF9 O;  2ZKO A;  4NXM O;  4DV2 O;  2DJV A;  4LFA O;  1X59 A;  4JI1 O;  4DUZ O;  4DV0 O;  3T1Y O;  3JAM N;  1FKA O;  5LMU O;  1HNZ O;  1XNR O;  1R1B A;  4YHH O;  4LF6 O;  4LF7 O;  2UXC O;  4JI3 O;  3R66 A;  1AIL A;  5IWA O;  1YZB A;  5A2Q N;  4JV5 O;  4DV7 O;  4JI2 O;  4X65 O;  1FJG O;  4DR2 O;  4LF8 O;  4LF4 O;  4LFC O;  4GKJ O;  5LL6 Y;  4NXN O;  2UXD O;  4A5U B;  4DR1 O;  4DR5 O;  1I94 O;  4OPH A;  4DV6 O;  1XNQ O;  5BXZ A;  4JI5 O;  3F5T A;  2DOS A;  2N74 A;  3M8A A;  2E5L O;  4K0K O;  1NS1 A;  4X66 O;  1G1X B;  2VQE O;  4DV3 O;  2F4V O;  1A32 A;  2JRI A;  4B3S O;  1HNX O;  4GKK O;  4DUY O;  2UUB O;  3J80 N;  1IBL O;  1AB3 A;  4JI7 O;  4JI4 O;  4X64 O;  1N33 O;  1XMQ O;  2HHH O;  5LMN O;  4OX9 O;  1HNW O;  4B3T O;  1IBM O;  4JYA O;  2Z0A A;  4KHP O;  3OTO O;  2LW7 A;  4DR7 O;  1N36 O;  2VQF O;  4B3R O;  2UXB O;  1KUQ A;  3T1H O;  1DK1 A;  5H5N A;  4OPA A;  1FYJ A;  1N32 O;  4X62 O;  4YY3 O;  2ZM6 O;  1D2D A;  2AGA A;  4LFB O;  1N34 O;  3RT3 C;  1XEQ A;  5BY1 A;  1J5E O;  4DV1 O;  4AQY O;  4JI0 O;  4LF5 O;  1IBK O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...