4X65T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4x65T00
4X65T 1XNQT 1FJGT 4KHPT 2UUBT 1I94T 4X66T 4JV5T 4DR7T 1XMOT 1IBKT 4LF4T 4JYAT 2E5LT 2UXBT 4LFCT 2ZM6T 4B3ST 4LF5T 4DV7T 2UXDT 4DV0T 4OX9T 3T1YT 4DV6T 1J5ET 2UXCT 1N32T 1N36T 4LF7T 4K0KT 4LFBT 4JI1T 5IWAT 1HNWT 2UU9T 2F4VT 4DR3T 2UUAT 1HNXT 1XMQT 4JI7T 5LMUT 4DR1T 4LF9T 1N34T 4JI0T 4DR4T 1IBMT 3T1HT 4LF8T 1HR0T 4NXNT 4NXMT 4DV2T 5BR8T 1N33T 4DR6T 4JI2T 2UUCT 4DV1T 4JI5T 4JI3T 4DV4T 4JI8T 4JI6T 4B3MT 4YHHT 4B3TT 4GKKT 4DUYT 4DR2T 4X62T 4GKJT 2HHHT 1IBLT 4B3RT 4X64T 4DUZT 2VQFT 3OTOT 4JI4T 4AQYT 2VQET 4YY3T 1HNZT 4DR5T 1XNRT 4LFAT 4LF6T 5LMNT 4DV5T 4DV3T
chains in the Genus database with same CATH superfamily
4WNKA 4DMWA 2HPLA 1XNQT 1FIOA 5JTGA 2JPFA 3AVRA 1J5WA 1M62A 2YDRA 4DIDB 3RQUA 5EK4A 1BR0A 5L3CB 2XSBA 3CQGB 3AA7B 2ZM6T 4LF5T 4O4JE 4DV7T 2Q9QC 2WZHA 5AQIB 1S94A 3RF1A 4H63H 4DMVA 3ZJ2A 4JEHB 1AJ3A 5AQVB 2Y48B 3O1HA 3OVUA 3UFEA 2DLRA 4X5TA 4LMLA 2WBLA 3MJXA 4PK5A 3UU5A 5FY1A 4JI0T 3L3PA 3LK42 4OYKA 3BQIA 4TWFA 2JQ9A 2ZLYA 3UTKA 2Y8DA 5L3EB 4JI2T 2CM0A 1MNEA 2WB5A 1JNZA 3AE3A 5F8PA 2M67A 4B6XA 4HWCA 3RYCE 2LM2A 4GKKT 1ZP0A 4L0RA 4YXDA 4EEDA 5LYJE 2XTLA 2BG9C 4J2CA 3GN5B 5GONE 2YU2A 4QHOA 4ZI2C 5FXVA 1IJ5A 5AQHB 4P09A 4DV3T 4PAGA 5FVLA 1WYCA 3PUQA 3B57A 4YTPA 2WP9A 2V26A 1B7TA 2VVSA 1YD8G 2EHOD 4AXPA 2N1GA 2I0MA 3ZMSB 2QYWA 3CK6A 4H9RC 2V7LA 5H6RB 2X66A 2CCQA 1H7CA 5LG4A 1D1BA 2A9UA 3TLWA 4TWHA 4NUUA 3C64A 3UUNA 2JQHA 2OV9A 3J7Yq 1VOMA 2E9XD 3N9OA 5J1GA 1XDPA 4YHJA 4PJJA 2C5JA 2W4XA 3RRWA 1HFAA 4FI5A 1HX8A 3UU8A 4TV8E 4EZ4A 5F5WA 3NBXX 2JJ9A 5HWYA 3FZHB 1KEYA 3ZMVB 4DR2T 3JADA 3RLFF 2J1DG 3BQKA 1T72A 2YEVC 3P4QA 3LBXB 3OTOT 4HWFA 4PW8A 3QK6A 3LJCA 2MOZA 3T8OA 5L3DB 2FUPA 2JMHA 3ETVA 2V5DA 3WAJA 2W67A 5LJNA 1D1AA 2HPJA 3RKGA 3KBTA 4DV5T 1WR6A 3AEFA 4ASKA 4PFOA 1I94T 5LXTE 4DR7T 2XJ7A 2YKSA 2W66A 2V1DB 3V5UA 5C2TA 5JR9A 5FYMA 3SRZA 2VKDA 2UXXB 1MIWA 2X9WA 3ZYMA 2UXCT 5AQMB 2PTFA 4IGUA 3JCFA 4CN1A 4YSZA 4PJNA 5LG3A 2FJBA 3UUMA 3ZT5A 1FMVA 2BBJA 3I0QA 3SFDA 4IL9A 4ILBA 1YQ3A 4OYJA 2VK9A 2OLTA 4Q25A 5ADXL 3L8RA 3AVSA 2Z6EA 2HH7A 3CPZA 3RIFA 3UUBA 2YU1A 1Y01A 2VKJA 2WDRA 3TLSA 4B3RT 2RA1A 3U3IA 2Q9QB 3P4SA 2WDQA 3RI5A 3ZSTA 4CI2B 4YY3T 3ZC1A 5M4YA 4AIUA 2BS3A 3VKGA 3E0ZA 4UVBB 1QSDA 5LNKA 1I6ZA 4ILAA 3IF8B 2ZMAA 5FL1A 4MALA 3FZLB 5ABGA 1W9RA 4ERRA 3JC6D 3HL6A 3NKZA 3JAEA 2E5VA 5L3BB 4DBQA 1KFYA 2QRXA 3RQWA 1BR2A 2XQYA 3MKDA 3PV0F 4EZHA 5L47A 3ZCJA 1YQ4A 2UUAT 4YSYA 5DQVA 2IIUA 5AQNB 2V8SV 3QUJA 1T8BA 3T1HT 4IIJE 1HR0T 3ZEFB 4NXMT 5HEOA 3QB5A 3PU3A 2PFVA 5J2UE 2CPTA 2Q9QA 3RC8A 2W2UA 3ETUA 2XAJB 3SOLA 5EK2A 5IHYA 1IBLT 4ISSA 4L9IA 3ZYKA 4WW0A 3PU8A 2XQ7A 2D2SA 5LGNB 2L3LA 4KI0F 1WCRA 4F6RC 2LEHA 2XASB 5FXZA 3VKHA 2YN6A 3UU4A 2MBGA 3TKLB 5HAXA 1BR1A 4CN6A 5KXJA 1UGOA 5HEJA 2UXBT 3E08A 4U33A 4LFCT 3RHWA 2BG9A 4UEMA 3C4ZA 2ZM8A 1XDOA 3RIUC 3VHLA 2KMFA 4QXCB 4K0KT 3PTRB 5IWAT 3LK3B 2UU9T 4QX8B 4U72A 2F4VT 2WY2A 3FBLA 5LMUT 4YFSA 3AEGA 3N2KE 4AKHA 2WWUA 4LF8T 3N9QA 2QGSA 4ZXLA 1YKHB 2LT3A 1MIYA 5FXWA 2XM1A 2H88A 5LHGB 4M1PA 3NRYA 4DO0A 3ONLC 2N2NA 3C4WA 5HCMA 3VR9A 4CQIA 2LSKA 2XAFB 4YLHA 2HHHT 3ZKRA 4X64T 3RPUA 3LK2B 2WZIA 3RYIE 2B1EA 4IE6A 2PJQA 4EAHA 4YJ3E 3KV4A 3KINB 3KV9A 1KNZA 3EDVA 2JQQA 3PUGA 4U3CA 2LSGA 1FJGT 2CHOA 3ZT6A 2E2AA 3MACA 3RH3A 2XAGB 3N9NA 1VRBA 1NAFA 1MNDA 4LF4T 3P8CD 4Z8XA 4MHCA 2D9DA 2JMKA 3X1DA 2NW8A 1UX5A 1ZV4X 2ODUA 4HFDA 4X1IE 5AQLB 3EVYA 2KLQA 1MMAA 4TN7B 3Q9DA 4CN4A 5CA0E 4P0BA 4GK0E 4ISTA 4DR1T 2SPCA 5CJ5A 5LB7B 1W09A 2WMOA 3KVAA 3AXJB 4U2ZA 1YXRA 2IW5B 4CXWA 2VL8A 2D5UA 2K48A 3VRBA 5JDNA 2WQYA 5JRCB 4B3TT 4EB6E 3HKDE 2X9XA 3IEEA 3L09A 4UV8B 3IA3A 4HFBA 3DJBA 4GIWA 3PUXF 3VRAA 1LVKA 2W0GA 4EXTA 1VCSA 2CEAA 1WRDA 5LCYA 3F57A 1HNZT 3AE8A 3AEBA 5HWXA 5AQTB 4ZOLE 2V6XA 2L9QA 2K9AA 5A1LA 3QOFA 2BKPA 3ZMUB 2BZBA 4I43B 4HN9A 4GOUA 5HXEA 5HEGA 2H89A 1UK5A 4LMKA 3AE6A 2BDEA 2E5LT 3UFGA 5LBMA 2UXNB 2DCFA 4JEUB 5HEHA 3QB5K 4I0UA 3HA4A 4QXBB 4ZS2A 3B5MA 4HWDA 4EYYR 1SHZC 3AXJA 3AE5A 1N36T 3N2GE 5F3JA 1HNWT 3AAEB 2L8KA 2PBIA 2HN2A 5FP3A 5JRCA 3UU3A 2WU5A 2K24A 4DR4T 3ZJ1A 2FBWA 4E7SA 2WM9A 1HTJF 3KVBA 3P50A 2PG8A 2FJEA 2M6BA 3AAAB 4DV1T 4O4HE 4IDPA 4JI3T 1D1CA 4BA9A 2OA5A 5JR9B 3KV6A 2CLYC 5HXRA 5CA1E 2MPKA 2GK9A 1WFDA 3AE7A 3E22E 1FMWA 2LRLA 2MAWA 3AECA 5EZYE 2EHOC 1OXZA 4BAYB 3DTOA 2AE9A 1MIVA 3C4XA 4NUVA 4H63V 3WAKA 2DWGA 3N5LA 1KNPA 2ZM2A 2MYSA 1EZ3A 3UULA 5L4EA 1IAPA 3F2EA 3UT5E 2WCAA 4K0UA 3CX8B 4QX7B 2W62A 1Y64B 3ZPOA 3AEDA 5AQRB 4KP3C 5KX5E 5JDHA 4A56A 1LRZA 2BKOA 3BQLA 4FJOA 4GYSA 3JAFA 3PUAA 3AA6B 5AQPB 3A5XA 5JREA 4I55E 5ABEA 5KMGP 4JI7T 3ZN0B 5EK3A 1N34T 2YDQA 4I4TE 5AQKB 2XQ5A 5FNVE 2C5IT 1GQEA 4DV4T 3LSVA 4HFCA 1WLXA 3ZMTB 4PJMA 3RIUA 4ZI3D 4H9PC 1OEDE 4DUYT 4HKAA 5FY0A 3N2OA 3AAIA 4UXNB 1V9DA 4X20E 2X9YA 3D0TA 4QH1A 4AKLA 2YDSA 4G63A 3G06A 3FXEB 2X0HA 4ILCA 1SA0E 2X68A 5J0ZA 4ADZA 3CX7B 4A5XA 5FXXA 4KBMB 2LKGA 4HWHA 2XUEA 4CI1B 3EDUA 3UU6A 3QC9A 4AISA 3O9XA 1Z0PA 3O4XE 1BR4A 2IDOB 4LMJA 4JI1T 1W0BA 1UUSA 2XHEB 4ZZBA 2QA7A 2NW7A 2J62A 4EOZB 2E8IA 4QH5A 1XMQT 5HXHA 2H3RA 2JRKA 3AA1B 5FY7A 4AI6A 3PE0A 1IBMT 5LGUB 3H3AA 1X79A 3O1IA 4WBOA 3TLUA 2D0TA 5CGMA 3PUSA 4IDOA 4JI5T 2BG9B 3P7IA 2BBHA 3N9LA 2LKHA 5AQUB 2WU2A 2XPKA 4X62T 4GKJT 5C3JA 2YK0A 4EV6A 2NTXA 3AE4A 2XQAA 3I1AA 5JDGA 2J47A 4O2BE 4U31A 1MMDA 4V1Av 4DBRA 1WYBA 5IUXA 2KXPB 3CKDA 1DU2A 5FL0A 2VASA 4F8HA 2WMNA 3LDQB 1XMOT 2W61A 3UQ7A 4JYAT 3NWIA 3SFEA 5AQOB 5HXCA 3H3MA 1JNRA 2V7MA 4OX9T 4AKRB 3T1YT 2CLYB 3FZFB 2ES0A 4IE0A 4KMCA 5E0OA 4E7ZA 3GWHA 2XM2A 3J9X1 1HG2A 2C5KT 2RPAA 2B76A 3PUYF 1O3XA 2EHOB 2NOXA 2VKOA 2VWAA 5HYAA 4IE5A 2YINA 4NXNT 1ZOYA 5BR8T 2G0UA 4HGAA 5DABA 3EAMA 4YJ2E 4JI8T 4B3MT 4YHHT 3Q5WA 1NWMX 3C50A 2CHNA 2VL0A 3ZT7A 4DUZT 1LKXA 4A98A 3PUWF 3ZCIA 4HFHA 3CWZB 4HFEA 4U7YA 2NR4A 5JDQA 3HKBE 3HKCE 4LFAT 2KNDA 4IT4A 3ZN1B 5LHIB 1HS7A 5HEUA 2X0LB 4KUMB 3RYFE 4YTNA 2W00A 4EGWA 2CMRA 3KFWX 2JQKA 2K5BB 2LRKA 1ZKEA 2EHOA 4G2AA 1D0XA 2VB6A 2WWVA 3GA8A 1HNXT 4H9NC 3P4WA 2HN1A 2Q9QD 1E2AA 2ODVA 2X0YA 4OK0A 2UUCT 2VURA 3R84B 3I9YA 4ZI7E 3CQXC 2LSIA 1LVFA 4H9OC 2W63A 3AA0B 1OWAA 2WS3A 1YKEB 4C90A 4UELA 4PK4A 5HXSA 4UR9A 1US7B 2V6YA 1KF6A 4HWIB 4LF6T 4UF0B 3A7MA 3L39A 2BKNA 4NIQA 3Q5EA 3N9PA 5FKYA 4KHPT 2XAHB 5FVKA 3AEEA 4I50E 4X66T 4KX6A 4JV5T 3K3QC 4TV9E 3H37A 2C0SA 2AXDS 1R8IA 4OFZA 2MTQA 2VKHA 4ZI2D 1G8XA 3RIAA 1HX1B 4O4IE 3ZSSA 4EYUA 5JDMA 2KSRA 2KWIB 5LBQB 5TAOA 3PUZF 3RKOA 2KT9A 4TNWA 3EABA 4LFBT 3HKEE 2WSSV 4JUYA 3ZC0A 4AKIA 3LG7A 4UV9B 3RYHE 2XY8B 4P0AA 3AE1A 3NZPA 3SS1A 5JDFA 2FJDA 4QWNB 4YSXA 2KINB 3M65A 3ESLA 3FZMB 2M6IA 3I9WA 4AQFC 2V5CA 2LHNA 4YT0A 4JI6T 3TLVA 4ILUA 3ZLIA 1CUNA 4CXYA 2V7JA 1KNRA 3AB3B 2X9HA 1T7SA 3CIRA 4UF0A 1M7KA 5DJQC 5DQWA 2CBJA 3FHNA 5LA6E 4ZS3A 4H9SE 3B13A 4U74A 3DP7A 3PJAJ 4O2AE 3K1SA 5AQSB 5JQGE 1XNRT 1D0ZA 1OEDC 2BS2A 1CHUA 5LJMA 5LMNT 2RP4A 4O8SA 3MK7C 2FJAA 5L3FB 2ACZA 1J1JA 2X67A 4TX5A 4EEBA 2IAKA 5AQQB 4H9QC 3F31A 3U78A 3PUVF 3S4UA 3P4PA 4JBWF 2J4GA 4CXXA 2ACXA 1MMNA 4TNVA 2CWOA 1N32T 3O1JA 3OKQA 3GN5A 4DR3T 2IUBA 1XZYA 2E9XC 2KZ7B 1IJ6A 3ANWB 2LOSA 4DR6T 3CQCB 5ETWA 4BJMA 2BG9E 5FMNA 3ABVA 1UURA 1KK7A 2IC9A 2H7OA 2IC6A 2Y6XA 5LP6E 1Z8UA 2NWBA 1QLBA 4TWDA 3GMIA 1HG5A 2NW9A 2XQ4A 2XQ9A 3EUHA 5ABFB 3ZMZB 2XSAA 4WZXA 2IMLA 4DR5T 2XAQB 2LSYA 2LJLA 3IBPA 4HEAA 5KDMC 2WDVA 2BS4A 4X65T 4DVDA 2UUBT 3FXDB 1MMGA 1WR0A 1L0VA 1QUUA 1U5PA 2A2FX 3PDYA 1E1HB 4HFIA 5C8YE 2P9BA 3RC3A 5AQFB 3M3ZB 4ZEYA 2VVNA 2XZEA 3C98B 4IDNA 2UXDT 2N9DA 4JLEA 2DL1A 2H7VC 4DV6T 3RX6A 3ANWA 3OBVE 3LBXA 2CXFA 3WI3A 2XQ6A 5CB4E 4ZI3C 4C91A 1NEKA 5ABHA 4LF9T 4O4LE 2XQ8A 4MFRA 3OPCA 5JH7E 1T98A 3R6NA 2LM9A 3UUXB 5ABFA 4COFA 2I6HA 3AEAA 3VR8A 3ZYLA 3KDSE 4HE8A 5IYZE 3I0OA 3NVOA 2BVMA 2CBIA 3AE9A 3LFMA 2VQFT 4JI4T 2CXLA 1NENA 2LOPA 2LSJA 1U4QA 3P4RA 1HF8A 3ONJA 2CXDA 1ZHCA 5JDLA 2R6GF 4MLKA 3NRXA 5AFUL 4AKGA 3K3NA 5L2LA 3UQ4A 2I59A 4X1YE 4XZCA 4IDQA 1XWMA 2XQ3A 1SUMB 3JC6C 5AQGB 3K8PC 3Q5XA 4Z90A 3CVRA 3C51A 4L5GA 5L4HA 4HFVA 1UX4A 4DV0T 2NTYA 2V7KA 1YW0A 4MBQA 3IHRA 2KWHA 3OYZA 4HTEA 4A97A 4N78D 3RRCA 1UCUA 2BVLA 5J2TE 4GYRA 4LF7T 2V7IA 2X51A 4IE7A 3MA9A 4U2YA 4CI3B 3N9MA 5CFBA 2A72A 4AQGA 5LGTB 1OEDB 1N33T 3VU7H 3MZKB 5JVDE 2DHRA 3W15B 2WAUA 4QXHB 4PFPA 4DNDA 3ONXA 3QNUA 5HCJA 4PJLA 3A8YC 4NPPA 4U7IA 5LOVE 3K3OA 2JIWA 5JR9C 4CZZB 2DNXA 4WYVA 3Q2MA 2K3WA 4KHZF 4X1KE 3FZKB 1S35A 2VQET 4IREA 3CX6B 2LE8A 4ZHQE 1D0YA 4UVCB 4P1NA 4TUYE 4BJNA 3HI2A 2ZM0A 3V5SA 5L3GB 2QVAA 4GK5E 1HCIA 3FBZA 4AQFA 1FEWA 1W0AA 2NP9A 2E9XB 1SE7A 4QKNA 4IL4A 3HR0A 2LLYA 4EIWA 3KV5A 1IBKT 3BK9A 3MXZA 3OJAA 3PURA 4B3ST 3EHZA 2CWYA 5AQJB 4ANJA 2CRBA 3AE2A 3SWHA 1ZEEA 2DI4A 1J5ET 4UIGA 1OEDA 1X9BA 4XAXB 2V6YB 4IE4A 4UVAB 3OYXA 2LHRA 4Z91A 1IZNB 4PNIA 4WBNE 5LHHB 4DV2T 4XBFB 5H6QB 3RGLA 3EI0A 3PJAA 4PK6A 1VCTA 3CMLA 4OHFA 4QH4A 4IDZA 1G73A 2YOEA 1E7PA 3TLTA 2A3DA 2IHR1 2CE7A 4IHJE 5BMVE 4YTMA 4ZZCA 3KBUA 3NZQA 4AQYT 2DWKA 2E9XA 2D0UA 3FB2A 4TZ4C 2CA5A 3Q5DA
chains in the Genus database with same CATH topology
4X65T 1XNQT 1FJGT 4KHPT 2UUBT 1I94T 4X66T 4JV5T 4DR7T 1XMOT 1IBKT 4LF4T 4JYAT 2E5LT 2UXBT 4LFCT 2ZM6T 4B3ST 4LF5T 4DV7T 2UXDT 4DV0T 4OX9T 3T1YT 4DV6T 1J5ET 2UXCT 1N32T 1N36T 4LF7T 4K0KT 4LFBT 4JI1T 5IWAT 1HNWT 2UU9T 2F4VT 4DR3T 2UUAT 1HNXT 1XMQT 4JI7T 5LMUT 4DR1T 4LF9T 1N34T 4JI0T 4DR4T 1IBMT 3T1HT 4LF8T 1HR0T 4NXNT 4NXMT 4DV2T 5BR8T 1N33T 4DR6T 4JI2T 2UUCT 4DV1T 4JI5T 4JI3T 4DV4T 4JI8T 4JI6T 4B3MT 4YHHT 4B3TT 4GKKT 4DUYT 4DR2T 4X62T 4GKJT 2HHHT 1IBLT 4B3RT 4X64T 4DUZT 2VQFT 3OTOT 4JI4T 4AQYT 2VQET 4YY3T 1HNZT 4DR5T 1XNRT 4LFAT 4LF6T 5LMNT 4DV5T 4DV3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 T;  1XNQ T;  1FJG T;  4KHP T;  2UUB T;  1I94 T;  4X66 T;  4JV5 T;  4DR7 T;  1XMO T;  1IBK T;  4LF4 T;  4JYA T;  2E5L T;  2UXB T;  4LFC T;  2ZM6 T;  4B3S T;  4LF5 T;  4DV7 T;  2UXD T;  4DV0 T;  4OX9 T;  3T1Y T;  4DV6 T;  1J5E T;  2UXC T;  1N32 T;  1N36 T;  4LF7 T;  4K0K T;  4LFB T;  4JI1 T;  5IWA T;  1HNW T;  2UU9 T;  2F4V T;  4DR3 T;  2UUA T;  1HNX T;  1XMQ T;  4JI7 T;  5LMU T;  4DR1 T;  4LF9 T;  1N34 T;  4JI0 T;  4DR4 T;  1IBM T;  3T1H T;  4LF8 T;  1HR0 T;  4NXN T;  4NXM T;  4DV2 T;  5BR8 T;  1N33 T;  4DR6 T;  4JI2 T;  2UUC T;  4DV1 T;  4JI5 T;  4JI3 T;  4DV4 T;  4JI8 T;  4JI6 T;  4B3M T;  4YHH T;  4B3T T;  4GKK T;  4DUY T;  4DR2 T;  4X62 T;  4GKJ T;  2HHH T;  1IBL T;  4B3R T;  4X64 T;  4DUZ T;  2VQF T;  3OTO T;  4JI4 T;  4AQY T;  2VQE T;  4YY3 T;  1HNZ T;  4DR5 T;  1XNR T;  4LFA T;  4LF6 T;  5LMN T;  4DV5 T;  4DV3 T; 
#chains in the Genus database with same CATH topology
 4WNK A;  4DMW A;  2HPL A;  1XNQ T;  1FIO A;  5JTG A;  2JPF A;  3AVR A;  1J5W A;  1M62 A;  2YDR A;  4DID B;  3RQU A;  5EK4 A;  1BR0 A;  5L3C B;  2XSB A;  3CQG B;  3AA7 B;  2ZM6 T;  4LF5 T;  4O4J E;  4DV7 T;  2Q9Q C;  2WZH A;  5AQI B;  1S94 A;  3RF1 A;  4H63 H;  4DMV A;  3ZJ2 A;  4JEH B;  1AJ3 A;  5AQV B;  2Y48 B;  3O1H A;  3OVU A;  3UFE A;  2DLR A;  4X5T A;  4LML A;  2WBL A;  3MJX A;  4PK5 A;  3UU5 A;  5FY1 A;  4JI0 T;  3L3P A;  3LK4 2;  4OYK A;  3BQI A;  4TWF A;  2JQ9 A;  2ZLY A;  3UTK A;  2Y8D A;  5L3E B;  4JI2 T;  2CM0 A;  1MNE A;  2WB5 A;  1JNZ A;  3AE3 A;  5F8P A;  2M67 A;  4B6X A;  4HWC A;  3RYC E;  2LM2 A;  4GKK T;  1ZP0 A;  4L0R A;  4YXD A;  4EED A;  5LYJ E;  2XTL A;  2BG9 C;  4J2C A;  3GN5 B;  5GON E;  2YU2 A;  4QHO A;  4ZI2 C;  5FXV A;  1IJ5 A;  5AQH B;  4P09 A;  4DV3 T;  4PAG A;  5FVL A;  1WYC A;  3PUQ A;  3B57 A;  4YTP A;  2WP9 A;  2V26 A;  1B7T A;  2VVS A;  1YD8 G;  2EHO D;  4AXP A;  2N1G A;  2I0M A;  3ZMS B;  2QYW A;  3CK6 A;  4H9R C;  2V7L A;  5H6R B;  2X66 A;  2CCQ A;  1H7C A;  5LG4 A;  1D1B A;  2A9U A;  3TLW A;  4TWH A;  4NUU A;  3C64 A;  3UUN A;  2JQH A;  2OV9 A;  3J7Y q;  1VOM A;  2E9X D;  3N9O A;  5J1G A;  1XDP A;  4YHJ A;  4PJJ A;  2C5J A;  2W4X A;  3RRW A;  1HFA A;  4FI5 A;  1HX8 A;  3UU8 A;  4TV8 E;  4EZ4 A;  5F5W A;  3NBX X;  2JJ9 A;  5HWY A;  3FZH B;  1KEY A;  3ZMV B;  4DR2 T;  3JAD A;  3RLF F;  2J1D G;  3BQK A;  1T72 A;  2YEV C;  3P4Q A;  3LBX B;  3OTO T;  4HWF A;  4PW8 A;  3QK6 A;  3LJC A;  2MOZ A;  3T8O A;  5L3D B;  2FUP A;  2JMH A;  3ETV A;  2V5D A;  3WAJ A;  2W67 A;  5LJN A;  1D1A A;  2HPJ A;  3RKG A;  3KBT A;  4DV5 T;  1WR6 A;  3AEF A;  4ASK A;  4PFO A;  1I94 T;  5LXT E;  4DR7 T;  2XJ7 A;  2YKS A;  2W66 A;  2V1D B;  3V5U A;  5C2T A;  5JR9 A;  5FYM A;  3SRZ A;  2VKD A;  2UXX B;  1MIW A;  2X9W A;  3ZYM A;  2UXC T;  5AQM B;  2PTF A;  4IGU A;  3JCF A;  4CN1 A;  4YSZ A;  4PJN A;  5LG3 A;  2FJB A;  3UUM A;  3ZT5 A;  1FMV A;  2BBJ A;  3I0Q A;  3SFD A;  4IL9 A;  4ILB A;  1YQ3 A;  4OYJ A;  2VK9 A;  2OLT A;  4Q25 A;  5ADX L;  3L8R A;  3AVS A;  2Z6E A;  2HH7 A;  3CPZ A;  3RIF A;  3UUB A;  2YU1 A;  1Y01 A;  2VKJ A;  2WDR A;  3TLS A;  4B3R T;  2RA1 A;  3U3I A;  2Q9Q B;  3P4S A;  2WDQ A;  3RI5 A;  3ZST A;  4CI2 B;  4YY3 T;  3ZC1 A;  5M4Y A;  4AIU A;  2BS3 A;  3VKG A;  3E0Z A;  4UVB B;  1QSD A;  5LNK A;  1I6Z A;  4ILA A;  3IF8 B;  2ZMA A;  5FL1 A;  4MAL A;  3FZL B;  5ABG A;  1W9R A;  4ERR A;  3JC6 D;  3HL6 A;  3NKZ A;  3JAE A;  2E5V A;  5L3B B;  4DBQ A;  1KFY A;  2QRX A;  3RQW A;  1BR2 A;  2XQY A;  3MKD A;  3PV0 F;  4EZH A;  5L47 A;  3ZCJ A;  1YQ4 A;  2UUA T;  4YSY A;  5DQV A;  2IIU A;  5AQN B;  2V8S V;  3QUJ A;  1T8B A;  3T1H T;  4IIJ E;  1HR0 T;  3ZEF B;  4NXM T;  5HEO A;  3QB5 A;  3PU3 A;  2PFV A;  5J2U E;  2CPT A;  2Q9Q A;  3RC8 A;  2W2U A;  3ETU A;  2XAJ B;  3SOL A;  5EK2 A;  5IHY A;  1IBL T;  4ISS A;  4L9I A;  3ZYK A;  4WW0 A;  3PU8 A;  2XQ7 A;  2D2S A;  5LGN B;  2L3L A;  4KI0 F;  1WCR A;  4F6R C;  2LEH A;  2XAS B;  5FXZ A;  3VKH A;  2YN6 A;  3UU4 A;  2MBG A;  3TKL B;  5HAX A;  1BR1 A;  4CN6 A;  5KXJ A;  1UGO A;  5HEJ A;  2UXB T;  3E08 A;  4U33 A;  4LFC T;  3RHW A;  2BG9 A;  4UEM A;  3C4Z A;  2ZM8 A;  1XDO A;  3RIU C;  3VHL A;  2KMF A;  4QXC B;  4K0K T;  3PTR B;  5IWA T;  3LK3 B;  2UU9 T;  4QX8 B;  4U72 A;  2F4V T;  2WY2 A;  3FBL A;  5LMU T;  4YFS A;  3AEG A;  3N2K E;  4AKH A;  2WWU A;  4LF8 T;  3N9Q A;  2QGS A;  4ZXL A;  1YKH B;  2LT3 A;  1MIY A;  5FXW A;  2XM1 A;  2H88 A;  5LHG B;  4M1P A;  3NRY A;  4DO0 A;  3ONL C;  2N2N A;  3C4W A;  5HCM A;  3VR9 A;  4CQI A;  2LSK A;  2XAF B;  4YLH A;  2HHH T;  3ZKR A;  4X64 T;  3RPU A;  3LK2 B;  2WZI A;  3RYI E;  2B1E A;  4IE6 A;  2PJQ A;  4EAH A;  4YJ3 E;  3KV4 A;  3KIN B;  3KV9 A;  1KNZ A;  3EDV A;  2JQQ A;  3PUG A;  4U3C A;  2LSG A;  1FJG T;  2CHO A;  3ZT6 A;  2E2A A;  3MAC A;  3RH3 A;  2XAG B;  3N9N A;  1VRB A;  1NAF A;  1MND A;  4LF4 T;  3P8C D;  4Z8X A;  4MHC A;  2D9D A;  2JMK A;  3X1D A;  2NW8 A;  1UX5 A;  1ZV4 X;  2ODU A;  4HFD A;  4X1I E;  5AQL B;  3EVY A;  2KLQ A;  1MMA A;  4TN7 B;  3Q9D A;  4CN4 A;  5CA0 E;  4P0B A;  4GK0 E;  4IST A;  4DR1 T;  2SPC A;  5CJ5 A;  5LB7 B;  1W09 A;  2WMO A;  3KVA A;  3AXJ B;  4U2Z A;  1YXR A;  2IW5 B;  4CXW A;  2VL8 A;  2D5U A;  2K48 A;  3VRB A;  5JDN A;  2WQY A;  5JRC B;  4B3T T;  4EB6 E;  3HKD E;  2X9X A;  3IEE A;  3L09 A;  4UV8 B;  3IA3 A;  4HFB A;  3DJB A;  4GIW A;  3PUX F;  3VRA A;  1LVK A;  2W0G A;  4EXT A;  1VCS A;  2CEA A;  1WRD A;  5LCY A;  3F57 A;  1HNZ T;  3AE8 A;  3AEB A;  5HWX A;  5AQT B;  4ZOL E;  2V6X A;  2L9Q A;  2K9A A;  5A1L A;  3QOF A;  2BKP A;  3ZMU B;  2BZB A;  4I43 B;  4HN9 A;  4GOU A;  5HXE A;  5HEG A;  2H89 A;  1UK5 A;  4LMK A;  3AE6 A;  2BDE A;  2E5L T;  3UFG A;  5LBM A;  2UXN B;  2DCF A;  4JEU B;  5HEH A;  3QB5 K;  4I0U A;  3HA4 A;  4QXB B;  4ZS2 A;  3B5M A;  4HWD A;  4EYY R;  1SHZ C;  3AXJ A;  3AE5 A;  1N36 T;  3N2G E;  5F3J A;  1HNW T;  3AAE B;  2L8K A;  2PBI A;  2HN2 A;  5FP3 A;  5JRC A;  3UU3 A;  2WU5 A;  2K24 A;  4DR4 T;  3ZJ1 A;  2FBW A;  4E7S A;  2WM9 A;  1HTJ F;  3KVB A;  3P50 A;  2PG8 A;  2FJE A;  2M6B A;  3AAA B;  4DV1 T;  4O4H E;  4IDP A;  4JI3 T;  1D1C A;  4BA9 A;  2OA5 A;  5JR9 B;  3KV6 A;  2CLY C;  5HXR A;  5CA1 E;  2MPK A;  2GK9 A;  1WFD A;  3AE7 A;  3E22 E;  1FMW A;  2LRL A;  2MAW A;  3AEC A;  5EZY E;  2EHO C;  1OXZ A;  4BAY B;  3DTO A;  2AE9 A;  1MIV A;  3C4X A;  4NUV A;  4H63 V;  3WAK A;  2DWG A;  3N5L A;  1KNP A;  2ZM2 A;  2MYS A;  1EZ3 A;  3UUL A;  5L4E A;  1IAP A;  3F2E A;  3UT5 E;  2WCA A;  4K0U A;  3CX8 B;  4QX7 B;  2W62 A;  1Y64 B;  3ZPO A;  3AED A;  5AQR B;  4KP3 C;  5KX5 E;  5JDH A;  4A56 A;  1LRZ A;  2BKO A;  3BQL A;  4FJO A;  4GYS A;  3JAF A;  3PUA A;  3AA6 B;  5AQP B;  3A5X A;  5JRE A;  4I55 E;  5ABE A;  5KMG P;  4JI7 T;  3ZN0 B;  5EK3 A;  1N34 T;  2YDQ A;  4I4T E;  5AQK B;  2XQ5 A;  5FNV E;  2C5I T;  1GQE A;  4DV4 T;  3LSV A;  4HFC A;  1WLX A;  3ZMT B;  4PJM A;  3RIU A;  4ZI3 D;  4H9P C;  1OED E;  4DUY T;  4HKA A;  5FY0 A;  3N2O A;  3AAI A;  4UXN B;  1V9D A;  4X20 E;  2X9Y A;  3D0T A;  4QH1 A;  4AKL A;  2YDS A;  4G63 A;  3G06 A;  3FXE B;  2X0H A;  4ILC A;  1SA0 E;  2X68 A;  5J0Z A;  4ADZ A;  3CX7 B;  4A5X A;  5FXX A;  4KBM B;  2LKG A;  4HWH A;  2XUE A;  4CI1 B;  3EDU A;  3UU6 A;  3QC9 A;  4AIS A;  3O9X A;  1Z0P A;  3O4X E;  1BR4 A;  2IDO B;  4LMJ A;  4JI1 T;  1W0B A;  1UUS A;  2XHE B;  4ZZB A;  2QA7 A;  2NW7 A;  2J62 A;  4EOZ B;  2E8I A;  4QH5 A;  1XMQ T;  5HXH A;  2H3R A;  2JRK A;  3AA1 B;  5FY7 A;  4AI6 A;  3PE0 A;  1IBM T;  5LGU B;  3H3A A;  1X79 A;  3O1I A;  4WBO A;  3TLU A;  2D0T A;  5CGM A;  3PUS A;  4IDO A;  4JI5 T;  2BG9 B;  3P7I A;  2BBH A;  3N9L A;  2LKH A;  5AQU B;  2WU2 A;  2XPK A;  4X62 T;  4GKJ T;  5C3J A;  2YK0 A;  4EV6 A;  2NTX A;  3AE4 A;  2XQA A;  3I1A A;  5JDG A;  2J47 A;  4O2B E;  4U31 A;  1MMD A;  4V1A v;  4DBR A;  1WYB A;  5IUX A;  2KXP B;  3CKD A;  1DU2 A;  5FL0 A;  2VAS A;  4F8H A;  2WMN A;  3LDQ B;  1XMO T;  2W61 A;  3UQ7 A;  4JYA T;  3NWI A;  3SFE A;  5AQO B;  5HXC A;  3H3M A;  1JNR A;  2V7M A;  4OX9 T;  4AKR B;  3T1Y T;  2CLY B;  3FZF B;  2ES0 A;  4IE0 A;  4KMC A;  5E0O A;  4E7Z A;  3GWH A;  2XM2 A;  3J9X 1;  1HG2 A;  2C5K T;  2RPA A;  2B76 A;  3PUY F;  1O3X A;  2EHO B;  2NOX A;  2VKO A;  2VWA A;  5HYA A;  4IE5 A;  2YIN A;  4NXN T;  1ZOY A;  5BR8 T;  2G0U A;  4HGA A;  5DAB A;  3EAM A;  4YJ2 E;  4JI8 T;  4B3M T;  4YHH T;  3Q5W A;  1NWM X;  3C50 A;  2CHN A;  2VL0 A;  3ZT7 A;  4DUZ T;  1LKX A;  4A98 A;  3PUW F;  3ZCI A;  4HFH A;  3CWZ B;  4HFE A;  4U7Y A;  2NR4 A;  5JDQ A;  3HKB E;  3HKC E;  4LFA T;  2KND A;  4IT4 A;  3ZN1 B;  5LHI B;  1HS7 A;  5HEU A;  2X0L B;  4KUM B;  3RYF E;  4YTN A;  2W00 A;  4EGW A;  2CMR A;  3KFW X;  2JQK A;  2K5B B;  2LRK A;  1ZKE A;  2EHO A;  4G2A A;  1D0X A;  2VB6 A;  2WWV A;  3GA8 A;  1HNX T;  4H9N C;  3P4W A;  2HN1 A;  2Q9Q D;  1E2A A;  2ODV A;  2X0Y A;  4OK0 A;  2UUC T;  2VUR A;  3R84 B;  3I9Y A;  4ZI7 E;  3CQX C;  2LSI A;  1LVF A;  4H9O C;  2W63 A;  3AA0 B;  1OWA A;  2WS3 A;  1YKE B;  4C90 A;  4UEL A;  4PK4 A;  5HXS A;  4UR9 A;  1US7 B;  2V6Y A;  1KF6 A;  4HWI B;  4LF6 T;  4UF0 B;  3A7M A;  3L39 A;  2BKN A;  4NIQ A;  3Q5E A;  3N9P A;  5FKY A;  4KHP T;  2XAH B;  5FVK A;  3AEE A;  4I50 E;  4X66 T;  4KX6 A;  4JV5 T;  3K3Q C;  4TV9 E;  3H37 A;  2C0S A;  2AXD S;  1R8I A;  4OFZ A;  2MTQ A;  2VKH A;  4ZI2 D;  1G8X A;  3RIA A;  1HX1 B;  4O4I E;  3ZSS A;  4EYU A;  5JDM A;  2KSR A;  2KWI B;  5LBQ B;  5TAO A;  3PUZ F;  3RKO A;  2KT9 A;  4TNW A;  3EAB A;  4LFB T;  3HKE E;  2WSS V;  4JUY A;  3ZC0 A;  4AKI A;  3LG7 A;  4UV9 B;  3RYH E;  2XY8 B;  4P0A A;  3AE1 A;  3NZP A;  3SS1 A;  5JDF A;  2FJD A;  4QWN B;  4YSX A;  2KIN B;  3M65 A;  3ESL A;  3FZM B;  2M6I A;  3I9W A;  4AQF C;  2V5C A;  2LHN A;  4YT0 A;  4JI6 T;  3TLV A;  4ILU A;  3ZLI A;  1CUN A;  4CXY A;  2V7J A;  1KNR A;  3AB3 B;  2X9H A;  1T7S A;  3CIR A;  4UF0 A;  1M7K A;  5DJQ C;  5DQW A;  2CBJ A;  3FHN A;  5LA6 E;  4ZS3 A;  4H9S E;  3B13 A;  4U74 A;  3DP7 A;  3PJA J;  4O2A E;  3K1S A;  5AQS B;  5JQG E;  1XNR T;  1D0Z A;  1OED C;  2BS2 A;  1CHU A;  5LJM A;  5LMN T;  2RP4 A;  4O8S A;  3MK7 C;  2FJA A;  5L3F B;  2ACZ A;  1J1J A;  2X67 A;  4TX5 A;  4EEB A;  2IAK A;  5AQQ B;  4H9Q C;  3F31 A;  3U78 A;  3PUV F;  3S4U A;  3P4P A;  4JBW F;  2J4G A;  4CXX A;  2ACX A;  1MMN A;  4TNV A;  2CWO A;  1N32 T;  3O1J A;  3OKQ A;  3GN5 A;  4DR3 T;  2IUB A;  1XZY A;  2E9X C;  2KZ7 B;  1IJ6 A;  3ANW B;  2LOS A;  4DR6 T;  3CQC B;  5ETW A;  4BJM A;  2BG9 E;  5FMN A;  3ABV A;  1UUR A;  1KK7 A;  2IC9 A;  2H7O A;  2IC6 A;  2Y6X A;  5LP6 E;  1Z8U A;  2NWB A;  1QLB A;  4TWD A;  3GMI A;  1HG5 A;  2NW9 A;  2XQ4 A;  2XQ9 A;  3EUH A;  5ABF B;  3ZMZ B;  2XSA A;  4WZX A;  2IML A;  4DR5 T;  2XAQ B;  2LSY A;  2LJL A;  3IBP A;  4HEA A;  5KDM C;  2WDV A;  2BS4 A;  4X65 T;  4DVD A;  2UUB T;  3FXD B;  1MMG A;  1WR0 A;  1L0V A;  1QUU A;  1U5P A;  2A2F X;  3PDY A;  1E1H B;  4HFI A;  5C8Y E;  2P9B A;  3RC3 A;  5AQF B;  3M3Z B;  4ZEY A;  2VVN A;  2XZE A;  3C98 B;  4IDN A;  2UXD T;  2N9D A;  4JLE A;  2DL1 A;  2H7V C;  4DV6 T;  3RX6 A;  3ANW A;  3OBV E;  3LBX A;  2CXF A;  3WI3 A;  2XQ6 A;  5CB4 E;  4ZI3 C;  4C91 A;  1NEK A;  5ABH A;  4LF9 T;  4O4L E;  2XQ8 A;  4MFR A;  3OPC A;  5JH7 E;  1T98 A;  3R6N A;  2LM9 A;  3UUX B;  5ABF A;  4COF A;  2I6H A;  3AEA A;  3VR8 A;  3ZYL A;  3KDS E;  4HE8 A;  5IYZ E;  3I0O A;  3NVO A;  2BVM A;  2CBI A;  3AE9 A;  3LFM A;  2VQF T;  4JI4 T;  2CXL A;  1NEN A;  2LOP A;  2LSJ A;  1U4Q A;  3P4R A;  1HF8 A;  3ONJ A;  2CXD A;  1ZHC A;  5JDL A;  2R6G F;  4MLK A;  3NRX A;  5AFU L;  4AKG A;  3K3N A;  5L2L A;  3UQ4 A;  2I59 A;  4X1Y E;  4XZC A;  4IDQ A;  1XWM A;  2XQ3 A;  1SUM B;  3JC6 C;  5AQG B;  3K8P C;  3Q5X A;  4Z90 A;  3CVR A;  3C51 A;  4L5G A;  5L4H A;  4HFV A;  1UX4 A;  4DV0 T;  2NTY A;  2V7K A;  1YW0 A;  4MBQ A;  3IHR A;  2KWH A;  3OYZ A;  4HTE A;  4A97 A;  4N78 D;  3RRC A;  1UCU A;  2BVL A;  5J2T E;  4GYR A;  4LF7 T;  2V7I A;  2X51 A;  4IE7 A;  3MA9 A;  4U2Y A;  4CI3 B;  3N9M A;  5CFB A;  2A72 A;  4AQG A;  5LGT B;  1OED B;  1N33 T;  3VU7 H;  3MZK B;  5JVD E;  2DHR A;  3W15 B;  2WAU A;  4QXH B;  4PFP A;  4DND A;  3ONX A;  3QNU A;  5HCJ A;  4PJL A;  3A8Y C;  4NPP A;  4U7I A;  5LOV E;  3K3O A;  2JIW A;  5JR9 C;  4CZZ B;  2DNX A;  4WYV A;  3Q2M A;  2K3W A;  4KHZ F;  4X1K E;  3FZK B;  1S35 A;  2VQE T;  4IRE A;  3CX6 B;  2LE8 A;  4ZHQ E;  1D0Y A;  4UVC B;  4P1N A;  4TUY E;  4BJN A;  3HI2 A;  2ZM0 A;  3V5S A;  5L3G B;  2QVA A;  4GK5 E;  1HCI A;  3FBZ A;  4AQF A;  1FEW A;  1W0A A;  2NP9 A;  2E9X B;  1SE7 A;  4QKN A;  4IL4 A;  3HR0 A;  2LLY A;  4EIW A;  3KV5 A;  1IBK T;  3BK9 A;  3MXZ A;  3OJA A;  3PUR A;  4B3S T;  3EHZ A;  2CWY A;  5AQJ B;  4ANJ A;  2CRB A;  3AE2 A;  3SWH A;  1ZEE A;  2DI4 A;  1J5E T;  4UIG A;  1OED A;  1X9B A;  4XAX B;  2V6Y B;  4IE4 A;  4UVA B;  3OYX A;  2LHR A;  4Z91 A;  1IZN B;  4PNI A;  4WBN E;  5LHH B;  4DV2 T;  4XBF B;  5H6Q B;  3RGL A;  3EI0 A;  3PJA A;  4PK6 A;  1VCT A;  3CML A;  4OHF A;  4QH4 A;  4IDZ A;  1G73 A;  2YOE A;  1E7P A;  3TLT A;  2A3D A;  2IHR 1;  2CE7 A;  4IHJ E;  5BMV E;  4YTM A;  4ZZC A;  3KBU A;  3NZQ A;  4AQY T;  2DWK A;  2E9X A;  2D0U A;  3FB2 A;  4TZ4 C;  2CA5 A;  3Q5D A; 
#chains in the Genus database with same CATH homology
 4X65 T;  1XNQ T;  1FJG T;  4KHP T;  2UUB T;  1I94 T;  4X66 T;  4JV5 T;  4DR7 T;  1XMO T;  1IBK T;  4LF4 T;  4JYA T;  2E5L T;  2UXB T;  4LFC T;  2ZM6 T;  4B3S T;  4LF5 T;  4DV7 T;  2UXD T;  4DV0 T;  4OX9 T;  3T1Y T;  4DV6 T;  1J5E T;  2UXC T;  1N32 T;  1N36 T;  4LF7 T;  4K0K T;  4LFB T;  4JI1 T;  5IWA T;  1HNW T;  2UU9 T;  2F4V T;  4DR3 T;  2UUA T;  1HNX T;  1XMQ T;  4JI7 T;  5LMU T;  4DR1 T;  4LF9 T;  1N34 T;  4JI0 T;  4DR4 T;  1IBM T;  3T1H T;  4LF8 T;  1HR0 T;  4NXN T;  4NXM T;  4DV2 T;  5BR8 T;  1N33 T;  4DR6 T;  4JI2 T;  2UUC T;  4DV1 T;  4JI5 T;  4JI3 T;  4DV4 T;  4JI8 T;  4JI6 T;  4B3M T;  4YHH T;  4B3T T;  4GKK T;  4DUY T;  4DR2 T;  4X62 T;  4GKJ T;  2HHH T;  1IBL T;  4B3R T;  4X64 T;  4DUZ T;  2VQF T;  3OTO T;  4JI4 T;  4AQY T;  2VQE T;  4YY3 T;  1HNZ T;  4DR5 T;  1XNR T;  4LFA T;  4LF6 T;  5LMN T;  4DV5 T;  4DV3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...