4X65T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4x65T00
4GKJT 4JI6T 4NXMT 2UUAT 4LFAT 4LF6T 1IBKT 4NXNT 3T1YT 4DR4T 4JV5T 2UXCT 1XNRT 4JI5T 5LMUT 4DV7T 4JI7T 2HHHT 2UUBT 4DV1T 4X66T 4DV4T 3T1HT 4DR2T 4JI1T 4DV3T 4DUYT 4X64T 4DUZT 2VQFT 1XMOT 1FJGT 4LF7T 2UUCT 4JI2T 4DR7T 4X62T 4DR1T 4K0KT 2UXDT 4YHHT 4DV0T 1IBLT 1N34T 4DV6T 1HNWT 5BR8T 4AQYT 4GKKT 4X65T 4LF8T 4JI3T 4DR3T 4KHPT 1J5ET 2VQET 1XNQT 4B3RT 1IBMT 1HNXT 1HR0T 4LFCT 4B3TT 1N32T 4DR6T 4JI0T 4LF5T 1HNZT 4DV2T 4LF9T 4JI8T 4B3MT 5IWAT 4LFBT 1N36T 4DR5T 3OTOT 4JYAT 2UXBT 4B3ST 4DV5T 2ZM6T 1XMQT 1N33T 1I94T 4JI4T 4OX9T 4YY3T 2F4VT 4LF4T 2E5LT 2UU9T 5LMNT
chains in the Genus database with same CATH superfamily
4HGAA 1UX5A 5AQIB 5EZYE 3PUSA 5AQMB 1CHUA 1LRZA 4KMCA 3E0ZA 2VKJA 3N9OA 1U4QA 2X9WA 4AIUA 2ZM8A 3HKDE 4I4TE 5LG4A 2V1DB 2X9YA 1IBKT 4TV8E 3RYCE 4AI6A 3N9QA 2ZLYA 4YLHA 3A7MA 3K8PC 4KI0F 4PJNA 3T1YT 4DR4T 4WYVA 3N2OA 3LFMA 3ONJA 3P4RA 2LOSA 2Q9QA 1FEWA 3IA3A 5FYMA 4GYSA 3ZCIA 1V9DA 4CI1B 4AKGA 1G8XA 2JJ9A 4O8SA 2D2SA 5JR9B 5L2LA 4YJ3E 3ETUA 2DHRA 2I59A 3AE3A 3Q2MA 5HWYA 5AQHB 3ANWA 1L0VA 2KNDA 1X9BA 1ZV4X 2V5CA 5BMVE 3NRXA 4OK0A 2WB5A 4QWNB 2VKHA 2WMNA 2YEVC 3QNUA 4NUVA 2WWVA 2VL0A 2BS4A 4IE5A 3VR8A 5ABFA 2HHHT 2BG9A 4AQFC 3EI0A 4DV1T 3LK3B 3C4ZA 4IT4A 3JCFA 3KV4A 3RIUA 3CVRA 4BJMA 4ZZBA 1KEYA 4I50E 2KWHA 5HEOA 4JI1T 4JLEA 4UXNB 2QA7A 2JRKA 3PUXF 2YOEA 1IJ6A 1ZP0A 5AQGB 4CN6A 4DV3T 3ZT7A 2V6YB 2Z6EA 2K5BB 4TWHA 3J7Yq 4ZS2A 4YTNA 5CA0E 2WU5A 4DUZT 3B57A 4I0UA 3ZJ2A 1JNRA 4WZXA 3OYZA 2CWYA 4EIWA 1YKHB 3FZHB 3BQIA 1XMOT 2CA5A 2HPJA 2QYWA 3O4XE 3EDVA 5J1GA 5CFBA 4LF7T 5JRCA 4IE4A 3VU7H 2V7IA 1GQEA 2XQ7A 2UUCT 3AE1A 2XQ5A 4AQFA 4IL9A 4JI2T 3WI3A 3AXJB 3B5MA 3SFEA 1SHZC 4AKLA 2XASB 1WCRA 4DVDA 2BBJA 3OBVE 4F8HA 2KMFA 2B1EA 2W0GA 2BKOA 3MA9A 4TX5A 4KBMB 2YDRA 3Q9DA 3KVAA 1IJ5A 2YDSA 3UULA 4U3CA 3UFGA 2WMOA 5HEGA 2CHNA 5KDMC 1YQ4A 4KX6A 2XSBA 3NRYA 3Q5DA 5FY0A 3ABVA 1KNZA 2XZEA 3EABA 1WYBA 2W67A 4PW8A 3FXEB 3ZLIA 2YU1A 3JAEA 4JI3T 4O4JE 4MHCA 2QVAA 5HXHA 5L4HA 3UQ7A 4IREA 1LKXA 4PK4A 3KINB 5AQVB 3FB2A 2BG9E 4CN1A 4QH1A 4ZI2D 4WW0A 3RX6A 5H6RB 5HCJA 3I9WA 2H3RA 1HNXT 1HR0T 3VKHA 2VVSA 4LFCT 3CX6B 3QK6A 1T8BA 2DNXA 3D0TA 3P7IA 2L9QA 1D1AA 2QRXA 4YFSA 4QH5A 1T72A 3JC6D 2C5KT 2N9DA 2XUEA 4H9NC 3MKDA 5DABA 5AFUL 2CLYB 2BDEA 1MNEA 2FBWA 3MJXA 1HNZT 3F57A 3CX8B 1VRBA 3FBZA 4IDNA 4YSYA 2VK9A 1XDOA 4DV2T 5ETWA 4ADZA 2VKDA 5IWAT 2CWOA 4QXCB 4ZI3C 5LGTB 4B3MT 1N36T 4AKHA 2NP9A 3KV6A 5CGMA 3RRWA 3WAKA 3AE4A 3E22E 5JDHA 3RPUA 3N2GE 1ZKEA 2K24A 1US7B 2KXPB 4UF0A 2LJLA 4HFIA 4UVCB 4X5TA 2RA1A 3ZEFB 2BG9B 3AAIA 4LMKA 4DV5T 5HWXA 5JDMA 4HWFA 3H3MA 4HEAA 2Q9QC 3S4UA 1S94A 3MK7C 2NW9A 3AEGA 2NTYA 3K1SA 2SPCA 3P4PA 5HEJA 1X79A 4JI4T 2B76A 2MTQA 2LT3A 4YY3T 3N5LA 4LF4T 3NZPA 4MBQA 1JNZA 2EHOD 1OEDB 4QHOA 4DMVA 4UIGA 2UU9T 5LHHB 2PBIA 2VWAA 3P8CD 5LNKA 1ZHCA 2IW5B 2BS3A 2X0LB 3EHZA 3JC6C 3PUYF 3AE2A 2L3LA 3PUZF 2BG9C 5FMNA 3SS1A 5AQFB 1O3XA 2XPKA 4YJ2E 2XAJB 5JH7E 4YT0A 4LFAT 1I6ZA 2WWUA 3KV5A 4LF6T 4TNVA 3LG7A 3RKGA 2XAQB 2YINA 1YXRA 3GN5A 5LJMA 3N9MA 2HN1A 1FMWA 2A72A 2LRLA 5FXXA 3ZMVB 3K3OA 2WP9A 4IDOA 4PFPA 1XNRT 2H7VC 3HL6A 4J2CA 2M6IA 1HX8A 2VKOA 4AQGA 4AKIA 4UVBB 2A3DA 4ISSA 3C50A 2JQ9A 2W62A 3AEFA 3DP7A 1NAFA 2NR4A 4L9IA 4U2ZA 4HWHA 5C2TA 1J1JA 4PJLA 5HAXA 5HYAA 4DV7T 2Q9QD 4JI7T 1WFDA 3UFEA 5J2UE 2IDOB 3DTOA 2A2FX 2R6GF 4HTEA 4H63V 3AAAB 1IZNB 2WQYA 3SWHA 4WBNE 4X66T 4DV4T 2AXDS 4CI3B 1Y64B 4TZ4C 4DR2T 2HH7A 5JREA 3LJCA 2N2NA 3ZMTB 1ZEEA 2KINB 5KXJA 2IC9A 2IIUA 4GK5E 5IUXA 2E9XA 1YD8G 3HKBE 4DUYT 1MIYA 2K3WA 3RC8A 3PU3A 5A1LA 1QUUA 4EOZB 1UCUA 3P4WA 5HEHA 3AA1B 2VQFT 3F2EA 1NWMX 2MPKA 3OVUA 3VHLA 3MZKB 3PU8A 2ES0A 3CX7B 2KSRA 3RQWA 1FJGT 2ZMAA 2LKGA 2WY2A 4Z90A 3CIRA 2JMKA 1WRDA 4YSXA 1T98A 2V6XA 4O4IE 5TAOA 2LE8A 5JTGA 3OKQA 5LP6E 2XM2A 4DR7T 2DL1A 2MOZA 2XQ4A 3GWHA 3VR9A 1YW0A 2NOXA 2XQYA 3AB3B 4DBQA 5J2TE 2XAFB 4UV8B 4QKNA 2BS2A 5AQNB 2ZM2A 1H7CA 1WYCA 2Y48B 5DQVA 2XQAA 4COFA 2CXDA 3K3QC 4GK0E 1QSDA 1NENA 3IHRA 4ILUA 4X20E 2EHOA 2XQ9A 1MMGA 4A98A 4GKKT 3ONXA 2NW7A 3P4SA 2WZIA 5FVLA 3RYHE 4X65T 2DWGA 2V5DA 2BVLA 4GOUA 1BR2A 1UGOA 3KBTA 4Z91A 3PDYA 3CQGB 2C0SA 2XSAA 2YU2A 3P4QA 3PUGA 5ABGA 4P09A 5L3GB 3NZQA 3RQUA 5L3FB 2J1DG 2WDVA 2FJAA 4H9SE 1OEDE 4DBRA 3LK42 4H9QC 4ANJA 3CWZB 3WAJA 2X68A 3UUXB 3AEDA 3IEEA 4U7YA 2V7JA 5LBQB 2CCQA 2J62A 4XBFB 2NTXA 3UUMA 4F6RC 5L3DB 1XDPA 4DR6T 3GMIA 4QX8B 1NEKA 4E7ZA 1Y01A 2LM2A 3KBUA 5JDLA 4UV9B 1E2AA 1HG5A 2OA5A 4TUYE 5L4EA 3TLUA 5FL0A 3I0QA 4G63A 4LF9T 3ZCJA 3FZMB 4LFBT 4HFHA 4CQIA 2Y8DA 3X1DA 4HFVA 3ANWB 4DR5T 4JYAT 2X9HA 1KK7A 5JR9A 4ZOLE 2FJDA 4IL4A 2LHRA 4ILBA 1QLBA 4U31A 3ZSSA 2L8KA 4Q25A 5FL1A 1KNRA 3JADA 1BR0A 4G2AA 2PG8A 1IBMT 2M67A 5FXZA 5C8YE 4CXYA 3AA0B 5LGUB 1W9RA 5AQRB 2FJBA 3EVYA 3RC3A 2C5IT 3AE9A 4IHJE 5FXWA 1XMQT 4EGWA 4HWDA 2PJQA 4OX9T 2IC6A 2F4VT 2PTFA 1U5PA 3CQCB 3TLTA 2UXBT 1SE7A 2MBGA 2WAUA 3R6NA 3LBXA 4ERRA 4YHJA 3RF1A 2BZBA 3QB5A 3ZC0A 2E9XB 3OJAA 2YN6A 2LSGA 2XQ8A 4CI2B 4GKJT 3C51A 4O2AE 4JEHB 4N78D 2ODVA 2X0YA 2XJ7A 2JQKA 5JR9C 2IHR1 5JDNA 5M4YA 2VL8A 4X1YE 4ZXLA 2X66A 3N9LA 3F31A 4IDPA 3ZYMA 3QB5K 2E9XC 1HF8A 3C98B 3HKEE 2JMHA 5IHYA 4C90A 3BQKA 4O2BE 3UT5E 4CN4A 3ONLC 4I55E 1W09A 2W63A 2UXCT 4QH4A 5LBMA 4YXDA 5LOVE 4YSZA 4MALA 2NW8A 3I1AA 1T7SA 4PAGA 4EYYR 4CXXA 3AE7A 2LHNA 2IMLA 1D1CA 2QGSA 2XTLA 3N9PA 5LG3A 3V5SA 3AXJA 3UUBA 4C91A 4YTMA 2LM9A 3NVOA 5L3EB 2HPLA 2V7MA 3PUAA 3CPZA 4FI5A 4U7IA 2CEAA 4TN7B 2D0UA 2GK9A 5AQOB 2J4GA 5FY1A 5HXRA 2V6YA 1M62A 2KWIB 3RIAA 5EK4A 3RYIE 4DMWA 2I6HA 4DO0A 1ZOYA 2W61A 3AEEA 2XAHB 3ETVA 3ZJ1A 2LLYA 2W2UA 3IBPA 2WCAA 2G0UA 4DNDA 2K9AA 3RYFE 2X67A 3QUJA 3SRZA 4BA9A 1MMAA 5FY7A 1SA0E 2WSSV 3G06A 3L3PA 4JUYA 3N2KE 3W15B 3VKGA 3EUHA 1OXZA 3AA7B 1W0AA 3FZKB 3NBXX 3UUNA 5L47A 3U3IA 4O4LE 4H9RC 2YK0A 3J9X1 4HE8A 3RLFF 2ACXA 4U2YA 5HEUA 4UF0B 2LOPA 1HCIA 2WBLA 5CB4E 2JPFA 3ZSTA 5GONE 4TWDA 3OYXA 2AE9A 4P0BA 4WNKA 2UXDT 4YHHT 1IAPA 1OEDC 3LBXB 3DJBA 5KMGP 1WLXA 3E08A 3KV9A 3KVBA 1YQ3A 2YDQA 3H37A 4V1Av 3QC9A 4A5XA 4AISA 3GA8A 4DV6T 1HNWT 3UU3A 2WM9A 4ZHQE 2CRBA 3TLSA 4U74A 5JDQA 1VOMA 4ASKA 1CUNA 3AECA 5F5WA 4BAYB 4JV5T 1D1BA 1MMNA 4XZCA 4X1KE 1BR4A 4HWCA 3A8YC 3NWIA 4A97A 4KHPT 1FIOA 2D9DA 4TV9E 5E0OA 2VQET 4B3RT 4GYRA 2Y6XA 3N9NA 3O1IA 3ZMSB 2WDRA 4LMJA 4EAHA 3ZC1A 5DQWA 5LXTE 1G73A 1KNPA 3C4XA 3I9YA 4EB6E 5FP3A 4EEBA 5LYJE 2VB6A 5IYZE 4LMLA 4X1IE 3VRBA 4CZZB 1HTJF 1UURA 4BJNA 4P1NA 2N1GA 1OWAA 2WDQA 3UQ4A 4JI0T 1UX4A 2CXLA 3LK2B 4PNIA 3RGLA 3FZFB 3V5UA 3PTRB 3BQLA 4HFCA 3FXDB 2ODUA 5F8PA 1B7TA 4OHFA 4A56A 5ABEA 3NKZA 3O9XA 2JIWA 2XQ3A 1D0XA 2H88A 2MAWA 4IDQA 5CJ5A 2DLRA 3HKCE 3AA6B 1MNDA 4EEDA 5JVDE 4NUUA 2LEHA 5JRCB 3C64A 3AAEB 4IE7A 4HFEA 3TKLB 3CK6A 5AQLB 3LSVA 3UU4A 4ZI2C 5KX5E 4OFZA 5AQKB 5AQQB 3HR0A 2CMRA 4EYUA 4KHZF 3P50A 4HKAA 2UXNB 4IIJE 4EXTA 3SFDA 5LMNT 5L3BB 3U78A 5ADXL 2W4XA 3M65A 5JDFA 4JI6T 4P0AA 4NXMT 2KLQA 5FVKA 3ZPOA 2UUAT 5EK2A 5HXSA 2XY8B 2ZM0A 3AVSA 2V7KA 2CHOA 2V7LA 4NXNT 1WR0A 4HWIB 1D0YA 3KDSE 2DI4A 3I0OA 4ZI3D 4IDZA 2H7OA 2JQHA 2BKNA 3GN5B 5LHIB 2IAKA 1LVKA 2WS3A 2YKSA 3UU5A 2M6BA 3R84B 4AKRB 4U72A 1UK5A 1HX1B 2W00A 4JI5T 1EZ3A 3UTKA 3TLVA 5LMUT 4PK6A 4EZ4A 1W0BA 1R8IA 2FJEA 4DIDB 2Q9QB 3IF8B 5LB7B 5LJNA 3TLWA 3ZYLA 4E7SA 3AE6A 3L39A 2BBHA 1OEDA 3UU8A 4CXWA 4PJMA 5AQSB 2XAGB 5J0ZA 2BKPA 2UUBT 5ABHA 4L0RA 2V8SV 2VASA 5LCYA 3T1HT 4JEUB 2EHOC 3HA4A 3JAFA 2K48A 3PUVF 3AVRA 3RI5A 4IE6A 2LSKA 2NWBA 5L3CB 4K0UA 4TWFA 3PURA 3Q5EA 1LVFA 2LSIA 4X64T 3K3NA 3MACA 1SUMB 4PJJA 3ESLA 2KZ7B 2W66A 4NIQA 5HCMA 4ZI7E 2CLYC 3RH3A 2E5VA 3Q5XA 4B6XA 4PK5A 3CQXC 4MFRA 2RP4A 3AEAA 3Q5WA 4TNWA 4UVAB 3PJAA 4Z8XA 5EK3A 5AQPB 4OYJA 4UR9A 2WZHA 5HXCA 5CA1E 3SOLA 2MYSA 3ZT5A 3BK9A 4EZHA 2XHEB 2RPAA 2XQ6A 1KFYA 2E8IA 3RIUC 5JDGA 4QXHB 5H6QB 4X62T 2H89A 3AE8A 3QOFA 5LHGB 1S35A 2UXXB 4ISTA 2BVMA 4DR1T 1DU2A 4IGUA 3CMLA 1KF6A 3HI2A 4YTPA 2CXFA 1VCSA 4K0KT 2VVNA 4HN9A 4KUMB 4DV0T 1XZYA 4EV6A 1IBLT 4MLKA 4U33A 3ZT6A 5HXEA 1N34T 2VURA 2LSJA 2P9BA 2KT9A 4PFOA 1MMDA 4H9OC 5BR8T 2D0TA 2EHOB 3VRAA 1FMVA 4WBOA 1XWMA 3MXZA 3H3AA 4QXBB 3T8OA 3B13A 4ZEYA 2V26A 3RHWA 2CE7A 3LDQB 4L5GA 3EAMA 4LF8T 3UU6A 1J5WA 1Z0PA 2C5JA 2CPTA 2LSYA 3EDUA 4FJOA 1UUSA 2E9XD 4DR3T 5JQGE 3L09A 1J5ET 3O1JA 5FKYA 2PFVA 3FHNA 2I0MA 2XM1A 5AQJB 3KFWX 5DJQC 4ZZCA 1MIVA 4H9PC 3PV0F 4B3TT 2E2AA 3OPCA 2LKHA 3PE0A 2A9UA 4NPPA 3A5XA 4UELA 2J47A 1M7KA 3AE5A 4M1PA 2X9XA 2JQQA 4OYKA 3ZN1B 1N32T 4QX7B 1XNQT 5AQTB 2CM0A 1YKEB 4H63H 4HFDA 4XAXB 3ZN0B 4LF5T 3RKOA 4ZS3A 4AXPA 4JBWF 4ILAA 3O1HA 1E7PA 3C4WA 3CKDA 4IE0A 2ACZA 3PUWF 1E1HB 3PUQA 5AQUB 3AEBA 3RRCA 2LRKA 4O4HE 4JI8T 2DCFA 1BR1A 3M3ZB 3L8RA 3OTOT 1HG2A 2IUBA 1HFAA 3RIFA 4GIWA 3ZYKA 4AQYT 1D0ZA 2FUPA 2HN2A 4ILCA 2CBIA 2OV9A 2CBJA 2WU2A 2D5UA 5FXVA 3ZKRA 4B3ST 3FZLB 2X0HA 1Z8UA 4HFBA 2OLTA 2ZM6T 5FNVE 2X51A 5LGNB 1N33T 1I94T 3ZMUB 5F3JA 1HS7A 3ZMZB 3FBLA 1VCTA 4KP3C 5C3JA 1AJ3A 4UEMA 2E5LT 2DWKA 4I43B 3PJAJ 1MIWA 5ABFB 1WR6A 5LA6E
chains in the Genus database with same CATH topology
4GKJT 4JI6T 4NXMT 2UUAT 4LFAT 4LF6T 1IBKT 4NXNT 3T1YT 4DR4T 4JV5T 2UXCT 1XNRT 4JI5T 5LMUT 4DV7T 4JI7T 2HHHT 2UUBT 4DV1T 4X66T 4DV4T 3T1HT 4DR2T 4JI1T 4DV3T 4DUYT 4X64T 4DUZT 2VQFT 1XMOT 1FJGT 4LF7T 2UUCT 4JI2T 4DR7T 4X62T 4DR1T 4K0KT 2UXDT 4YHHT 4DV0T 1IBLT 1N34T 4DV6T 1HNWT 5BR8T 4AQYT 4GKKT 4X65T 4LF8T 4JI3T 4DR3T 4KHPT 1J5ET 2VQET 1XNQT 4B3RT 1IBMT 1HNXT 1HR0T 4LFCT 4B3TT 1N32T 4DR6T 4JI0T 4LF5T 1HNZT 4DV2T 4LF9T 4JI8T 4B3MT 5IWAT 4LFBT 1N36T 4DR5T 3OTOT 4JYAT 2UXBT 4B3ST 4DV5T 2ZM6T 1XMQT 1N33T 1I94T 4JI4T 4OX9T 4YY3T 2F4VT 4LF4T 2E5LT 2UU9T 5LMNT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ T;  4JI6 T;  4NXM T;  2UUA T;  4LFA T;  4LF6 T;  1IBK T;  4NXN T;  3T1Y T;  4DR4 T;  4JV5 T;  2UXC T;  1XNR T;  4JI5 T;  5LMU T;  4DV7 T;  4JI7 T;  2HHH T;  2UUB T;  4DV1 T;  4X66 T;  4DV4 T;  3T1H T;  4DR2 T;  4JI1 T;  4DV3 T;  4DUY T;  4X64 T;  4DUZ T;  2VQF T;  1XMO T;  1FJG T;  4LF7 T;  2UUC T;  4JI2 T;  4DR7 T;  4X62 T;  4DR1 T;  4K0K T;  2UXD T;  4YHH T;  4DV0 T;  1IBL T;  1N34 T;  4DV6 T;  1HNW T;  5BR8 T;  4AQY T;  4GKK T;  4X65 T;  4LF8 T;  4JI3 T;  4DR3 T;  4KHP T;  1J5E T;  2VQE T;  1XNQ T;  4B3R T;  1IBM T;  1HNX T;  1HR0 T;  4LFC T;  4B3T T;  1N32 T;  4DR6 T;  4JI0 T;  4LF5 T;  1HNZ T;  4DV2 T;  4LF9 T;  4JI8 T;  4B3M T;  5IWA T;  4LFB T;  1N36 T;  4DR5 T;  3OTO T;  4JYA T;  2UXB T;  4B3S T;  4DV5 T;  2ZM6 T;  1XMQ T;  1N33 T;  1I94 T;  4JI4 T;  4OX9 T;  4YY3 T;  2F4V T;  4LF4 T;  2E5L T;  2UU9 T;  5LMN T; 
#chains in the Genus database with same CATH topology
 4HGA A;  1UX5 A;  5AQI B;  5EZY E;  3PUS A;  5AQM B;  1CHU A;  1LRZ A;  4KMC A;  3E0Z A;  2VKJ A;  3N9O A;  1U4Q A;  2X9W A;  4AIU A;  2ZM8 A;  3HKD E;  4I4T E;  5LG4 A;  2V1D B;  2X9Y A;  1IBK T;  4TV8 E;  3RYC E;  4AI6 A;  3N9Q A;  2ZLY A;  4YLH A;  3A7M A;  3K8P C;  4KI0 F;  4PJN A;  3T1Y T;  4DR4 T;  4WYV A;  3N2O A;  3LFM A;  3ONJ A;  3P4R A;  2LOS A;  2Q9Q A;  1FEW A;  3IA3 A;  5FYM A;  4GYS A;  3ZCI A;  1V9D A;  4CI1 B;  4AKG A;  1G8X A;  2JJ9 A;  4O8S A;  2D2S A;  5JR9 B;  5L2L A;  4YJ3 E;  3ETU A;  2DHR A;  2I59 A;  3AE3 A;  3Q2M A;  5HWY A;  5AQH B;  3ANW A;  1L0V A;  2KND A;  1X9B A;  1ZV4 X;  2V5C A;  5BMV E;  3NRX A;  4OK0 A;  2WB5 A;  4QWN B;  2VKH A;  2WMN A;  2YEV C;  3QNU A;  4NUV A;  2WWV A;  2VL0 A;  2BS4 A;  4IE5 A;  3VR8 A;  5ABF A;  2HHH T;  2BG9 A;  4AQF C;  3EI0 A;  4DV1 T;  3LK3 B;  3C4Z A;  4IT4 A;  3JCF A;  3KV4 A;  3RIU A;  3CVR A;  4BJM A;  4ZZB A;  1KEY A;  4I50 E;  2KWH A;  5HEO A;  4JI1 T;  4JLE A;  4UXN B;  2QA7 A;  2JRK A;  3PUX F;  2YOE A;  1IJ6 A;  1ZP0 A;  5AQG B;  4CN6 A;  4DV3 T;  3ZT7 A;  2V6Y B;  2Z6E A;  2K5B B;  4TWH A;  3J7Y q;  4ZS2 A;  4YTN A;  5CA0 E;  2WU5 A;  4DUZ T;  3B57 A;  4I0U A;  3ZJ2 A;  1JNR A;  4WZX A;  3OYZ A;  2CWY A;  4EIW A;  1YKH B;  3FZH B;  3BQI A;  1XMO T;  2CA5 A;  2HPJ A;  2QYW A;  3O4X E;  3EDV A;  5J1G A;  5CFB A;  4LF7 T;  5JRC A;  4IE4 A;  3VU7 H;  2V7I A;  1GQE A;  2XQ7 A;  2UUC T;  3AE1 A;  2XQ5 A;  4AQF A;  4IL9 A;  4JI2 T;  3WI3 A;  3AXJ B;  3B5M A;  3SFE A;  1SHZ C;  4AKL A;  2XAS B;  1WCR A;  4DVD A;  2BBJ A;  3OBV E;  4F8H A;  2KMF A;  2B1E A;  2W0G A;  2BKO A;  3MA9 A;  4TX5 A;  4KBM B;  2YDR A;  3Q9D A;  3KVA A;  1IJ5 A;  2YDS A;  3UUL A;  4U3C A;  3UFG A;  2WMO A;  5HEG A;  2CHN A;  5KDM C;  1YQ4 A;  4KX6 A;  2XSB A;  3NRY A;  3Q5D A;  5FY0 A;  3ABV A;  1KNZ A;  2XZE A;  3EAB A;  1WYB A;  2W67 A;  4PW8 A;  3FXE B;  3ZLI A;  2YU1 A;  3JAE A;  4JI3 T;  4O4J E;  4MHC A;  2QVA A;  5HXH A;  5L4H A;  3UQ7 A;  4IRE A;  1LKX A;  4PK4 A;  3KIN B;  5AQV B;  3FB2 A;  2BG9 E;  4CN1 A;  4QH1 A;  4ZI2 D;  4WW0 A;  3RX6 A;  5H6R B;  5HCJ A;  3I9W A;  2H3R A;  1HNX T;  1HR0 T;  3VKH A;  2VVS A;  4LFC T;  3CX6 B;  3QK6 A;  1T8B A;  2DNX A;  3D0T A;  3P7I A;  2L9Q A;  1D1A A;  2QRX A;  4YFS A;  4QH5 A;  1T72 A;  3JC6 D;  2C5K T;  2N9D A;  2XUE A;  4H9N C;  3MKD A;  5DAB A;  5AFU L;  2CLY B;  2BDE A;  1MNE A;  2FBW A;  3MJX A;  1HNZ T;  3F57 A;  3CX8 B;  1VRB A;  3FBZ A;  4IDN A;  4YSY A;  2VK9 A;  1XDO A;  4DV2 T;  5ETW A;  4ADZ A;  2VKD A;  5IWA T;  2CWO A;  4QXC B;  4ZI3 C;  5LGT B;  4B3M T;  1N36 T;  4AKH A;  2NP9 A;  3KV6 A;  5CGM A;  3RRW A;  3WAK A;  3AE4 A;  3E22 E;  5JDH A;  3RPU A;  3N2G E;  1ZKE A;  2K24 A;  1US7 B;  2KXP B;  4UF0 A;  2LJL A;  4HFI A;  4UVC B;  4X5T A;  2RA1 A;  3ZEF B;  2BG9 B;  3AAI A;  4LMK A;  4DV5 T;  5HWX A;  5JDM A;  4HWF A;  3H3M A;  4HEA A;  2Q9Q C;  3S4U A;  1S94 A;  3MK7 C;  2NW9 A;  3AEG A;  2NTY A;  3K1S A;  2SPC A;  3P4P A;  5HEJ A;  1X79 A;  4JI4 T;  2B76 A;  2MTQ A;  2LT3 A;  4YY3 T;  3N5L A;  4LF4 T;  3NZP A;  4MBQ A;  1JNZ A;  2EHO D;  1OED B;  4QHO A;  4DMV A;  4UIG A;  2UU9 T;  5LHH B;  2PBI A;  2VWA A;  3P8C D;  5LNK A;  1ZHC A;  2IW5 B;  2BS3 A;  2X0L B;  3EHZ A;  3JC6 C;  3PUY F;  3AE2 A;  2L3L A;  3PUZ F;  2BG9 C;  5FMN A;  3SS1 A;  5AQF B;  1O3X A;  2XPK A;  4YJ2 E;  2XAJ B;  5JH7 E;  4YT0 A;  4LFA T;  1I6Z A;  2WWU A;  3KV5 A;  4LF6 T;  4TNV A;  3LG7 A;  3RKG A;  2XAQ B;  2YIN A;  1YXR A;  3GN5 A;  5LJM A;  3N9M A;  2HN1 A;  1FMW A;  2A72 A;  2LRL A;  5FXX A;  3ZMV B;  3K3O A;  2WP9 A;  4IDO A;  4PFP A;  1XNR T;  2H7V C;  3HL6 A;  4J2C A;  2M6I A;  1HX8 A;  2VKO A;  4AQG A;  4AKI A;  4UVB B;  2A3D A;  4ISS A;  3C50 A;  2JQ9 A;  2W62 A;  3AEF A;  3DP7 A;  1NAF A;  2NR4 A;  4L9I A;  4U2Z A;  4HWH A;  5C2T A;  1J1J A;  4PJL A;  5HAX A;  5HYA A;  4DV7 T;  2Q9Q D;  4JI7 T;  1WFD A;  3UFE A;  5J2U E;  2IDO B;  3DTO A;  2A2F X;  2R6G F;  4HTE A;  4H63 V;  3AAA B;  1IZN B;  2WQY A;  3SWH A;  4WBN E;  4X66 T;  4DV4 T;  2AXD S;  4CI3 B;  1Y64 B;  4TZ4 C;  4DR2 T;  2HH7 A;  5JRE A;  3LJC A;  2N2N A;  3ZMT B;  1ZEE A;  2KIN B;  5KXJ A;  2IC9 A;  2IIU A;  4GK5 E;  5IUX A;  2E9X A;  1YD8 G;  3HKB E;  4DUY T;  1MIY A;  2K3W A;  3RC8 A;  3PU3 A;  5A1L A;  1QUU A;  4EOZ B;  1UCU A;  3P4W A;  5HEH A;  3AA1 B;  2VQF T;  3F2E A;  1NWM X;  2MPK A;  3OVU A;  3VHL A;  3MZK B;  3PU8 A;  2ES0 A;  3CX7 B;  2KSR A;  3RQW A;  1FJG T;  2ZMA A;  2LKG A;  2WY2 A;  4Z90 A;  3CIR A;  2JMK A;  1WRD A;  4YSX A;  1T98 A;  2V6X A;  4O4I E;  5TAO A;  2LE8 A;  5JTG A;  3OKQ A;  5LP6 E;  2XM2 A;  4DR7 T;  2DL1 A;  2MOZ A;  2XQ4 A;  3GWH A;  3VR9 A;  1YW0 A;  2NOX A;  2XQY A;  3AB3 B;  4DBQ A;  5J2T E;  2XAF B;  4UV8 B;  4QKN A;  2BS2 A;  5AQN B;  2ZM2 A;  1H7C A;  1WYC A;  2Y48 B;  5DQV A;  2XQA A;  4COF A;  2CXD A;  3K3Q C;  4GK0 E;  1QSD A;  1NEN A;  3IHR A;  4ILU A;  4X20 E;  2EHO A;  2XQ9 A;  1MMG A;  4A98 A;  4GKK T;  3ONX A;  2NW7 A;  3P4S A;  2WZI A;  5FVL A;  3RYH E;  4X65 T;  2DWG A;  2V5D A;  2BVL A;  4GOU A;  1BR2 A;  1UGO A;  3KBT A;  4Z91 A;  3PDY A;  3CQG B;  2C0S A;  2XSA A;  2YU2 A;  3P4Q A;  3PUG A;  5ABG A;  4P09 A;  5L3G B;  3NZQ A;  3RQU A;  5L3F B;  2J1D G;  2WDV A;  2FJA A;  4H9S E;  1OED E;  4DBR A;  3LK4 2;  4H9Q C;  4ANJ A;  3CWZ B;  3WAJ A;  2X68 A;  3UUX B;  3AED A;  3IEE A;  4U7Y A;  2V7J A;  5LBQ B;  2CCQ A;  2J62 A;  4XBF B;  2NTX A;  3UUM A;  4F6R C;  5L3D B;  1XDP A;  4DR6 T;  3GMI A;  4QX8 B;  1NEK A;  4E7Z A;  1Y01 A;  2LM2 A;  3KBU A;  5JDL A;  4UV9 B;  1E2A A;  1HG5 A;  2OA5 A;  4TUY E;  5L4E A;  3TLU A;  5FL0 A;  3I0Q A;  4G63 A;  4LF9 T;  3ZCJ A;  3FZM B;  4LFB T;  4HFH A;  4CQI A;  2Y8D A;  3X1D A;  4HFV A;  3ANW B;  4DR5 T;  4JYA T;  2X9H A;  1KK7 A;  5JR9 A;  4ZOL E;  2FJD A;  4IL4 A;  2LHR A;  4ILB A;  1QLB A;  4U31 A;  3ZSS A;  2L8K A;  4Q25 A;  5FL1 A;  1KNR A;  3JAD A;  1BR0 A;  4G2A A;  2PG8 A;  1IBM T;  2M67 A;  5FXZ A;  5C8Y E;  4CXY A;  3AA0 B;  5LGU B;  1W9R A;  5AQR B;  2FJB A;  3EVY A;  3RC3 A;  2C5I T;  3AE9 A;  4IHJ E;  5FXW A;  1XMQ T;  4EGW A;  4HWD A;  2PJQ A;  4OX9 T;  2IC6 A;  2F4V T;  2PTF A;  1U5P A;  3CQC B;  3TLT A;  2UXB T;  1SE7 A;  2MBG A;  2WAU A;  3R6N A;  3LBX A;  4ERR A;  4YHJ A;  3RF1 A;  2BZB A;  3QB5 A;  3ZC0 A;  2E9X B;  3OJA A;  2YN6 A;  2LSG A;  2XQ8 A;  4CI2 B;  4GKJ T;  3C51 A;  4O2A E;  4JEH B;  4N78 D;  2ODV A;  2X0Y A;  2XJ7 A;  2JQK A;  5JR9 C;  2IHR 1;  5JDN A;  5M4Y A;  2VL8 A;  4X1Y E;  4ZXL A;  2X66 A;  3N9L A;  3F31 A;  4IDP A;  3ZYM A;  3QB5 K;  2E9X C;  1HF8 A;  3C98 B;  3HKE E;  2JMH A;  5IHY A;  4C90 A;  3BQK A;  4O2B E;  3UT5 E;  4CN4 A;  3ONL C;  4I55 E;  1W09 A;  2W63 A;  2UXC T;  4QH4 A;  5LBM A;  4YXD A;  5LOV E;  4YSZ A;  4MAL A;  2NW8 A;  3I1A A;  1T7S A;  4PAG A;  4EYY R;  4CXX A;  3AE7 A;  2LHN A;  2IML A;  1D1C A;  2QGS A;  2XTL A;  3N9P A;  5LG3 A;  3V5S A;  3AXJ A;  3UUB A;  4C91 A;  4YTM A;  2LM9 A;  3NVO A;  5L3E B;  2HPL A;  2V7M A;  3PUA A;  3CPZ A;  4FI5 A;  4U7I A;  2CEA A;  4TN7 B;  2D0U A;  2GK9 A;  5AQO B;  2J4G A;  5FY1 A;  5HXR A;  2V6Y A;  1M62 A;  2KWI B;  3RIA A;  5EK4 A;  3RYI E;  4DMW A;  2I6H A;  4DO0 A;  1ZOY A;  2W61 A;  3AEE A;  2XAH B;  3ETV A;  3ZJ1 A;  2LLY A;  2W2U A;  3IBP A;  2WCA A;  2G0U A;  4DND A;  2K9A A;  3RYF E;  2X67 A;  3QUJ A;  3SRZ A;  4BA9 A;  1MMA A;  5FY7 A;  1SA0 E;  2WSS V;  3G06 A;  3L3P A;  4JUY A;  3N2K E;  3W15 B;  3VKG A;  3EUH A;  1OXZ A;  3AA7 B;  1W0A A;  3FZK B;  3NBX X;  3UUN A;  5L47 A;  3U3I A;  4O4L E;  4H9R C;  2YK0 A;  3J9X 1;  4HE8 A;  3RLF F;  2ACX A;  4U2Y A;  5HEU A;  4UF0 B;  2LOP A;  1HCI A;  2WBL A;  5CB4 E;  2JPF A;  3ZST A;  5GON E;  4TWD A;  3OYX A;  2AE9 A;  4P0B A;  4WNK A;  2UXD T;  4YHH T;  1IAP A;  1OED C;  3LBX B;  3DJB A;  5KMG P;  1WLX A;  3E08 A;  3KV9 A;  3KVB A;  1YQ3 A;  2YDQ A;  3H37 A;  4V1A v;  3QC9 A;  4A5X A;  4AIS A;  3GA8 A;  4DV6 T;  1HNW T;  3UU3 A;  2WM9 A;  4ZHQ E;  2CRB A;  3TLS A;  4U74 A;  5JDQ A;  1VOM A;  4ASK A;  1CUN A;  3AEC A;  5F5W A;  4BAY B;  4JV5 T;  1D1B A;  1MMN A;  4XZC A;  4X1K E;  1BR4 A;  4HWC A;  3A8Y C;  3NWI A;  4A97 A;  4KHP T;  1FIO A;  2D9D A;  4TV9 E;  5E0O A;  2VQE T;  4B3R T;  4GYR A;  2Y6X A;  3N9N A;  3O1I A;  3ZMS B;  2WDR A;  4LMJ A;  4EAH A;  3ZC1 A;  5DQW A;  5LXT E;  1G73 A;  1KNP A;  3C4X A;  3I9Y A;  4EB6 E;  5FP3 A;  4EEB A;  5LYJ E;  2VB6 A;  5IYZ E;  4LML A;  4X1I E;  3VRB A;  4CZZ B;  1HTJ F;  1UUR A;  4BJN A;  4P1N A;  2N1G A;  1OWA A;  2WDQ A;  3UQ4 A;  4JI0 T;  1UX4 A;  2CXL A;  3LK2 B;  4PNI A;  3RGL A;  3FZF B;  3V5U A;  3PTR B;  3BQL A;  4HFC A;  3FXD B;  2ODU A;  5F8P A;  1B7T A;  4OHF A;  4A56 A;  5ABE A;  3NKZ A;  3O9X A;  2JIW A;  2XQ3 A;  1D0X A;  2H88 A;  2MAW A;  4IDQ A;  5CJ5 A;  2DLR A;  3HKC E;  3AA6 B;  1MND A;  4EED A;  5JVD E;  4NUU A;  2LEH A;  5JRC B;  3C64 A;  3AAE B;  4IE7 A;  4HFE A;  3TKL B;  3CK6 A;  5AQL B;  3LSV A;  3UU4 A;  4ZI2 C;  5KX5 E;  4OFZ A;  5AQK B;  5AQQ B;  3HR0 A;  2CMR A;  4EYU A;  4KHZ F;  3P50 A;  4HKA A;  2UXN B;  4IIJ E;  4EXT A;  3SFD A;  5LMN T;  5L3B B;  3U78 A;  5ADX L;  2W4X A;  3M65 A;  5JDF A;  4JI6 T;  4P0A A;  4NXM T;  2KLQ A;  5FVK A;  3ZPO A;  2UUA T;  5EK2 A;  5HXS A;  2XY8 B;  2ZM0 A;  3AVS A;  2V7K A;  2CHO A;  2V7L A;  4NXN T;  1WR0 A;  4HWI B;  1D0Y A;  3KDS E;  2DI4 A;  3I0O A;  4ZI3 D;  4IDZ A;  2H7O A;  2JQH A;  2BKN A;  3GN5 B;  5LHI B;  2IAK A;  1LVK A;  2WS3 A;  2YKS A;  3UU5 A;  2M6B A;  3R84 B;  4AKR B;  4U72 A;  1UK5 A;  1HX1 B;  2W00 A;  4JI5 T;  1EZ3 A;  3UTK A;  3TLV A;  5LMU T;  4PK6 A;  4EZ4 A;  1W0B A;  1R8I A;  2FJE A;  4DID B;  2Q9Q B;  3IF8 B;  5LB7 B;  5LJN A;  3TLW A;  3ZYL A;  4E7S A;  3AE6 A;  3L39 A;  2BBH A;  1OED A;  3UU8 A;  4CXW A;  4PJM A;  5AQS B;  2XAG B;  5J0Z A;  2BKP A;  2UUB T;  5ABH A;  4L0R A;  2V8S V;  2VAS A;  5LCY A;  3T1H T;  4JEU B;  2EHO C;  3HA4 A;  3JAF A;  2K48 A;  3PUV F;  3AVR A;  3RI5 A;  4IE6 A;  2LSK A;  2NWB A;  5L3C B;  4K0U A;  4TWF A;  3PUR A;  3Q5E A;  1LVF A;  2LSI A;  4X64 T;  3K3N A;  3MAC A;  1SUM B;  4PJJ A;  3ESL A;  2KZ7 B;  2W66 A;  4NIQ A;  5HCM A;  4ZI7 E;  2CLY C;  3RH3 A;  2E5V A;  3Q5X A;  4B6X A;  4PK5 A;  3CQX C;  4MFR A;  2RP4 A;  3AEA A;  3Q5W A;  4TNW A;  4UVA B;  3PJA A;  4Z8X A;  5EK3 A;  5AQP B;  4OYJ A;  4UR9 A;  2WZH A;  5HXC A;  5CA1 E;  3SOL A;  2MYS A;  3ZT5 A;  3BK9 A;  4EZH A;  2XHE B;  2RPA A;  2XQ6 A;  1KFY A;  2E8I A;  3RIU C;  5JDG A;  4QXH B;  5H6Q B;  4X62 T;  2H89 A;  3AE8 A;  3QOF A;  5LHG B;  1S35 A;  2UXX B;  4IST A;  2BVM A;  4DR1 T;  1DU2 A;  4IGU A;  3CML A;  1KF6 A;  3HI2 A;  4YTP A;  2CXF A;  1VCS A;  4K0K T;  2VVN A;  4HN9 A;  4KUM B;  4DV0 T;  1XZY A;  4EV6 A;  1IBL T;  4MLK A;  4U33 A;  3ZT6 A;  5HXE A;  1N34 T;  2VUR A;  2LSJ A;  2P9B A;  2KT9 A;  4PFO A;  1MMD A;  4H9O C;  5BR8 T;  2D0T A;  2EHO B;  3VRA A;  1FMV A;  4WBO A;  1XWM A;  3MXZ A;  3H3A A;  4QXB B;  3T8O A;  3B13 A;  4ZEY A;  2V26 A;  3RHW A;  2CE7 A;  3LDQ B;  4L5G A;  3EAM A;  4LF8 T;  3UU6 A;  1J5W A;  1Z0P A;  2C5J A;  2CPT A;  2LSY A;  3EDU A;  4FJO A;  1UUS A;  2E9X D;  4DR3 T;  5JQG E;  3L09 A;  1J5E T;  3O1J A;  5FKY A;  2PFV A;  3FHN A;  2I0M A;  2XM1 A;  5AQJ B;  3KFW X;  5DJQ C;  4ZZC A;  1MIV A;  4H9P C;  3PV0 F;  4B3T T;  2E2A A;  3OPC A;  2LKH A;  3PE0 A;  2A9U A;  4NPP A;  3A5X A;  4UEL A;  2J47 A;  1M7K A;  3AE5 A;  4M1P A;  2X9X A;  2JQQ A;  4OYK A;  3ZN1 B;  1N32 T;  4QX7 B;  1XNQ T;  5AQT B;  2CM0 A;  1YKE B;  4H63 H;  4HFD A;  4XAX B;  3ZN0 B;  4LF5 T;  3RKO A;  4ZS3 A;  4AXP A;  4JBW F;  4ILA A;  3O1H A;  1E7P A;  3C4W A;  3CKD A;  4IE0 A;  2ACZ A;  3PUW F;  1E1H B;  3PUQ A;  5AQU B;  3AEB A;  3RRC A;  2LRK A;  4O4H E;  4JI8 T;  2DCF A;  1BR1 A;  3M3Z B;  3L8R A;  3OTO T;  1HG2 A;  2IUB A;  1HFA A;  3RIF A;  4GIW A;  3ZYK A;  4AQY T;  1D0Z A;  2FUP A;  2HN2 A;  4ILC A;  2CBI A;  2OV9 A;  2CBJ A;  2WU2 A;  2D5U A;  5FXV A;  3ZKR A;  4B3S T;  3FZL B;  2X0H A;  1Z8U A;  4HFB A;  2OLT A;  2ZM6 T;  5FNV E;  2X51 A;  5LGN B;  1N33 T;  1I94 T;  3ZMU B;  5F3J A;  1HS7 A;  3ZMZ B;  3FBL A;  1VCT A;  4KP3 C;  5C3J A;  1AJ3 A;  4UEM A;  2E5L T;  2DWK A;  4I43 B;  3PJA J;  1MIW A;  5ABF B;  1WR6 A;  5LA6 E; 
#chains in the Genus database with same CATH homology
 4GKJ T;  4JI6 T;  4NXM T;  2UUA T;  4LFA T;  4LF6 T;  1IBK T;  4NXN T;  3T1Y T;  4DR4 T;  4JV5 T;  2UXC T;  1XNR T;  4JI5 T;  5LMU T;  4DV7 T;  4JI7 T;  2HHH T;  2UUB T;  4DV1 T;  4X66 T;  4DV4 T;  3T1H T;  4DR2 T;  4JI1 T;  4DV3 T;  4DUY T;  4X64 T;  4DUZ T;  2VQF T;  1XMO T;  1FJG T;  4LF7 T;  2UUC T;  4JI2 T;  4DR7 T;  4X62 T;  4DR1 T;  4K0K T;  2UXD T;  4YHH T;  4DV0 T;  1IBL T;  1N34 T;  4DV6 T;  1HNW T;  5BR8 T;  4AQY T;  4GKK T;  4X65 T;  4LF8 T;  4JI3 T;  4DR3 T;  4KHP T;  1J5E T;  2VQE T;  1XNQ T;  4B3R T;  1IBM T;  1HNX T;  1HR0 T;  4LFC T;  4B3T T;  1N32 T;  4DR6 T;  4JI0 T;  4LF5 T;  1HNZ T;  4DV2 T;  4LF9 T;  4JI8 T;  4B3M T;  5IWA T;  4LFB T;  1N36 T;  4DR5 T;  3OTO T;  4JYA T;  2UXB T;  4B3S T;  4DV5 T;  2ZM6 T;  1XMQ T;  1N33 T;  1I94 T;  4JI4 T;  4OX9 T;  4YY3 T;  2F4V T;  4LF4 T;  2E5L T;  2UU9 T;  5LMN T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...