4X65T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4x65T00
4JI0T 4LF5T 1HNWT 4NXNT 1IBKT 4LF9T 1HNZT 4DV0T 4DUYT 4K0KT 1N32T 2VQET 4B3TT 4JYAT 1FJGT 5LMNT 4JI1T 4OX9T 1J5ET 1IBMT 2HHHT 4YY3T 4DV7T 4DR5T 3T1YT 4JI8T 4GKKT 1XNQT 4JI4T 2UXDT 1N33T 4DR4T 5LMUT 4DV2T 1XNRT 2UUCT 2UUBT 4JI6T 4DV1T 2E5LT 4KHPT 1N34T 1N36T 2ZM6T 4JI3T 1IBLT 5IWAT 5BR8T 2UU9T 2VQFT 1I94T 4B3ST 3OTOT 4LFCT 4X65T 4LF7T 4YHHT 4X62T 4DR2T 4JI7T 1XMOT 4DR6T 1HNXT 1XMQT 3T1HT 4DR3T 4DR7T 4B3MT 4X64T 4DV6T 4DV3T 2UUAT 4JV5T 2F4VT 4LF4T 4B3RT 4LFAT 4DR1T 4DV4T 4LF6T 4LF8T 4X66T 4JI2T 1HR0T 4DV5T 4GKJT 4NXMT 2UXCT 4AQYT 4JI5T 2UXBT 4DUZT 4LFBT
chains in the Genus database with same CATH superfamily
3ZYMA 4LF5T 3TLUA 3L8RA 3B13A 2FJAA 3UFGA 2DWGA 4TUYE 4AQGA 2KWHA 3FZFB 4NUVA 4P09A 4UF0A 1V9DA 3J7Yq 3P4WA 2FBWA 2W00A 3ONLC 2V8SV 3JADA 3O1HA 2WP9A 4CI1B 3AEBA 3MKDA 2ACXA 4P0BA 5ABGA 3NRYA 5L4HA 1WLXA 4KBMB 3AE3A 4EOZB 5CA1E 5M4YA 3NZPA 2K5BB 4LF7T 1VRBA 4WNKA 2KWIB 3QUJA 1HX8A 1KNPA 5IYZE 5EK4A 5ABFB 2VASA 4DR7T 3E08A 2M6IA 4WYVA 4B3RT 3P4PA 4QKNA 1H7CA 4HTEA 5FXVA 2Q9QD 3ZC1A 2XM1A 3IHRA 2WDRA 2CHOA 3LBXA 3AVRA 3UU5A 5FY7A 2V6XA 2YU2A 5EZYE 3FZHB 2ZMAA 3NRXA 3K8PC 4LF9T 1UGOA 2BG9E 2W61A 3OVUA 4DUYT 3RC3A 3P4QA 2H3RA 2WZIA 1WYBA 4MALA 3CMLA 3VR9A 4BA9A 2N9DA 5LMNT 3KV4A 2X9XA 5FY0A 3AEAA 1OWAA 2H88A 2MOZA 4O2BE 2FJDA 4O4JE 3K3OA 4ZS3A 4B6XA 5ABFA 3IEEA 1Z8UA 1IJ5A 2YDSA 1N34T 1KFYA 2RP4A 1WR0A 1CUNA 2FUPA 2L9QA 4J2CA 4QX8B 5HEUA 1X79A 2CLYB 4IE6A 5DQWA 2Q9QC 2LJLA 4IE0A 3AE9A 3EDUA 3C4XA 4PJLA 4L0RA 4YLHA 4ZXLA 1SHZC 3T1HT 2NW7A 3CKDA 5AQQB 4IGUA 2H89A 2SPCA 2IC9A 3ZKRA 4O8SA 4ZHQE 3P7IA 4LF8T 3ZMTB 1G73A 1YKHB 3PUZF 1D1BA 3K1SA 1BR2A 1YXRA 4NXMT 5C3JA 4ZI3D 5HCJA 3I0OA 5LHGB 2NWBA 4AKHA 3PUSA 3ABVA 5HXCA 3JC6D 2JIWA 4K0UA 3GN5B 4AQFC 4OFZA 1XDOA 2V26A 2QVAA 2VB6A 1UX5A 1OEDE 3UUMA 4AISA 1N33T 5JDFA 2V5DA 4QHOA 4WW0A 3A7MA 3EDVA 3EHZA 5HXHA 4DV1T 3RYFE 1FMWA 4QXHB 5HXEA 5L3DB 3PU8A 2XTLA 4KUMB 3C4ZA 4DBRA 1US7B 4YHJA 1MMDA 3TLWA 2DCFA 4GK5E 4M1PA 1T98A 3QNUA 3KFWX 5LB7B 4WBNE 4H9NC 3UQ4A 2WM9A 3Q5XA 4ZI3C 1SE7A 4DIDB 5AQLB 4HFEA 4UV8B 4ISTA 4PJJA 5JR9B 2V7JA 3RHWA 2D0UA 2Y48B 1DU2A 3FXDB 2IW5B 1W0AA 1LKXA 4DNDA 2HN2A 3GN5A 2M67A 1NENA 3SFEA 1JNRA 4IHJE 3FHNA 5HEGA 2UXBT 2JQHA 2X67A 1HTJF 1UUSA 2NTYA 4I4TE 1LRZA 1HG5A 2BKNA 3TLTA 3PV0F 1YW0A 3CK6A 4GYSA 5LNKA 4H9SE 3AEGA 4HKAA 4Q25A 5FXWA 3RYCE 4CI3B 4Z91A 5LA6E 4H9PC 2ES0A 3AA1B 5ABHA 3L39A 3BQKA 2NW8A 2VL8A 3PTRB 4HWFA 4ERRA 3MK7C 5AQUB 3AAAB 3SWHA 4U3CA 2ZM6T 1QSDA 4P1NA 4JI3T 5FP3A 2CE7A 4ZOLE 1KNRA 4IDZA 5JR9A 3CPZA 2AXDS 5HEJA 4TWHA 3ONXA 3H3MA 5CJ5A 2H7OA 2V5CA 1HX1B 5TAOA 2VKOA 4ZEYA 2LHNA 2CBIA 3CVRA 3AE8A 2XQ9A 4IL9A 5AQJB 2N1GA 4AXPA 2MTQA 4O4IE 4X66T 2LKHA 3RRCA 2X0HA 4BJNA 5A1LA 3HKDE 2JRKA 2QYWA 3AXJB 3LK42 4QX7B 4Z8XA 5LG4A 1HF8A 5CA0E 2YINA 4JI0T 4EV6A 1IBKT 5LBMA 2CBJA 4N78D 3C51A 2C0SA 2YDRA 4I43B 2VKHA 3K3QC 3EABA 1ZEEA 4ISSA 2XZEA 4BAYB 4TWDA 5JDHA 2BDEA 3PU3A 2UXDT 5KXJA 3S4UA 3AAEB 2VL0A 2LSGA 1FEWA 4I0UA 2D2SA 2B1EA 4CXYA 5F3JA 1D0ZA 5KX5E 2JQ9A 3DJBA 4MBQA 3B5MA 2FJBA 4HEAA 4PK5A 3TLVA 2V1DB 4IL4A 2W67A 4ILUA 1HCIA 2CA5A 5BR8T 2VK9A 1E7PA 4LFCT 3BK9A 1SUMB 4PJNA 2ODVA 4E7ZA 2KSRA 4HFCA 5LOVE 3AXJA 4GIWA 2XAJB 3V5UA 2E5VA 3X1DA 3AA7B 4AKLA 2F4VT 3ZT7A 1J5WA 3W15B 3EI0A 3ETUA 3PJAJ 5LBQB 4Z90A 2M6BA 3N9PA 4DV5T 1KNZA 1B7TA 4CZZB 3CWZB 4BJMA 4HFHA 2X9WA 4NIQA 3RKOA 1BR4A 3UUXB 2IMLA 2DWKA 3ZLIA 3I9YA 3SFDA 4O4LE 4YSZA 2K24A 3OYZA 4A98A 3F57A 4YTMA 2WAUA 3DP7A 5J2TE 2D9DA 2L8KA 2ODUA 2XAFB 3T1YT 2NP9A 4CN4A 2ZM2A 2XQ7A 2CLYC 3N2GE 4MHCA 3UUBA 3PURA 2PFVA 3UU3A 4ZI2D 4MLKA 3KINB 4WZXA 3QOFA 2LRKA 2UU9T 3LBXB 4B3ST 4PAGA 3ZCIA 1ZHCA 4YJ2E 2E8IA 4X62T 3FXEB 2LM2A 3KV6A 3CIRA 4I55E 4JEHB 4UV9B 1OXZA 5FXZA 3PUVF 3RIUA 4CI2B 2CMRA 2WMOA 1D0YA 1YD8G 3H37A 3N9OA 5JRCB 2XAHB 4CXXA 2BVMA 4PFPA 4DV6T 5JDMA 3ZSSA 4E7SA 3AE1A 3KVBA 2WCAA 2XM2A 1UCUA 2X9YA 2X9HA 3ZCJA 4GKJT 5L3CB 1E1HB 1SA0E 3NZQA 2BKPA 4ZI2C 3FB2A 4KI0F 3Q5EA 5HWXA 2HN1A 1J5ET 5LCYA 4HGAA 2DHRA 4HWDA 5JVDE 3ZMSB 3UU8A 2A2FX 4JI4T 2I59A 4AKRB 2W62A 4C90A 1U4QA 2L3LA 1VCSA 5JRCA 1IBLT 2YK0A 5FNVE 4ILAA 4U2YA 2WMNA 4IREA 2LEHA 5JR9C 2J4GA 2W2UA 3ZYKA 3PE0A 2XAQB 3DTOA 4XAXB 4COFA 3ZPOA 4C91A 4U72A 1M62A 2GK9A 1XMQT 2P9BA 3O1IA 1WRDA 2C5KT 5ETWA 2QA7A 4HFVA 5HWYA 3AA6B 3AB3B 3KDSE 5DJQC 3L3PA 1T7SA 1LVFA 5AQRB 2VURA 4EB6E 2W66A 1JNZA 2ACZA 2PJQA 3RC8A 5CGMA 2LE8A 5JH7E 2WDQA 4NPPA 3P4RA 5ABEA 2KXPB 2I0MA 4F6RC 4GOUA 2JQKA 2XAGB 4LMJA 2BZBA 4OX9T 2CXFA 5AQPB 4IDOA 3U78A 2X0YA 3KBUA 2CM0A 5LXTE 4TWFA 4DR4T 2XQ3A 4PNIA 2KZ7B 2LSJA 3M3ZB 2WS3A 4JLEA 3NKZA 4AIUA 2BG9B 2I6HA 4GYRA 3C4WA 2BBJA 2X0LB 4ZZCA 1XDPA 3KBTA 3AE6A 3P50A 2V7KA 3SS1A 4IDQA 4X20E 4QH4A 3KV5A 5AQNB 2WU5A 5CFBA 5FL1A 2PG8A 5FKYA 4TV8E 2YN6A 3RYHE 3PUAA 4DV3T 2FJEA 2CRBA 1D1AA 2BVLA 2LSKA 3LFMA 2YKSA 4LF6T 2WZHA 1IAPA 1CHUA 5LJMA 5HAXA 4ZZBA 3MXZA 5FY1A 1FIOA 4A5XA 1KF6A 4MFRA 1R8IA 1HS7A 4OHFA 2XQ5A 4HWIB 2BG9A 2J1DG 3OBVE 4YJ3E 4DVDA 3T8OA 2IDOB 2CXLA 4HFIA 4B3TT 2XSBA 1FJGT 3MZKB 2WY2A 2HHHT 3AEFA 3ANWB 5J2UE 5AQTB 5JDNA 3N9LA 4ILCA 4G2AA 2E9XB 3ESLA 1ZV4X 4DV2T 3C98B 2UUBT 4AKIA 3RX6A 3K3NA 2J62A 4EEDA 3R6NA 3VU7H 5FYMA 5BMVE 2MBGA 3C50A 3IA3A 4U33A 2K3WA 1OEDB 5IHYA 3P4SA 2LM9A 3AE7A 4DMWA 3AE4A 3RPUA 4PK6A 4QXCB 3RIUC 3PUYF 5L3BB 4U7YA 2AE9A 1G8XA 4LFAT 1O3XA 4H63H 1AJ3A 2EHOB 3VRBA 3R84B 2D5UA 2VWAA 4TNWA 4X5TA 2XQ6A 3AE2A 2UXCT 5LHIB 3ANWA 3FBZA 2VKJA 2E9XA 1WR6A 2JJ9A 5FXXA 1YKEB 4QH1A 3N9QA 2HPLA 2KINB 1GQEA 4JEUB 4UR9A 2X51A 3HKBE 4JYAT 2ZM8A 1KEYA 1WFDA 4YY3T 4UVAB 4DR5T 1XNQT 1OEDA 2BBHA 5AQKB 4CN6A 4OK0A 1D0XA 2BS3A 2CWOA 1S94A 3N9MA 1W0BA 2XQ4A 2BS2A 2HH7A 3ZMZB 4X1YE 2IAKA 2LRLA 3I1AA 2WB5A 2NW9A 1Y64B 3ZJ2A 3KV9A 4X1KE 2EHOA 2RA1A 3P8CD 3QB5K 3ZSTA 3LG7A 4LMKA 3PJAA 4JI7T 3RI5A 1MIWA 3O4XE 5H6RB 2XQ8A 3AAIA 3H3AA 4YTPA 5LGUB 3J9X1 2NR4A 2UUAT 4QXBB 4DR1T 4HE8A 2LKGA 4UEMA 1MNDA 2MYSA 5KMGP 2XQYA 3ZN0B 1LVKA 4LFBT 4DO0A 3UT5E 3ETVA 2Y8DA 3KVAA 3NVOA 4V1Av 4G63A 3UTKA 2VQET 1Z0PA 4H9OC 5JDGA 2A3DA 4QH5A 2RPAA 5JREA 4GKKT 4H9RC 3A5XA 2QRXA 1W9RA 3CX8B 1W09A 3RIAA 2OV9A 5LMUT 3EAMA 2YEVC 2V6YB 4PFOA 2BKOA 2E5LT 2J47A 3NWIA 3AEDA 3HI2A 1NWMX 2KNDA 2XPKA 3C64A 2X68A 5CB4E 3I0QA 5HXRA 4IT4A 2X66A 3UUNA 2CCQA 2YU1A 2LSIA 4HFBA 3VR8A 3IF8B 2CWYA 2LOPA 3HL6A 3F2EA 1HNXT 4DBQA 4HWHA 5EK2A 2V7LA 4HWCA 4F8HA 3JCFA 2CEAA 4ASKA 4PK4A 4U31A 2WWVA 2KT9A 5F8PA 1EZ3A 3UULA 3RRWA 1QUUA 5LJNA 3BQIA 4JI5T 4ZI7E 2K9AA 2A72A 2PTFA 2Y6XA 3Q2MA 4NXNT 2NTXA 4DV0T 2V6YA 3ZJ1A 2WBLA 2BG9C 3CQXC 3N2KE 4WBOA 5L3EB 1BR0A 3LDQB 4DMVA 4NUUA 5HEOA 3PUGA 4H9QC 2UUCT 3QB5A 3TKLB 2E9XD 5GONE 2DI4A 2LOSA 1NAFA 2XSAA 2JMHA 4UELA 2ZM0A 5FL0A 4YHHT 3WAJA 2V7IA 4L5GA 2KLQA 3CX7B 1NEKA 3OPCA 3OJAA 3ZYLA 2B76A 3RQUA 4TZ4C 5C8YE 2Z6EA 5E0OA 1MMAA 4B3MT 1XZYA 4IDNA 4EIWA 2DLRA 4CN1A 2UXNB 2JPFA 3VKGA 2NOXA 2MPKA 3OKQA 4UXNB 1HR0T 4TNVA 3UQ7A 5L3GB 2D0TA 2EHOD 4I50E 4ANJA 2DL1A 5AQVB 2A9UA 2E9XC 1HNWT 4YTNA 4U74A 5L2LA 3O1JA 1N32T 3GMIA 4JI1T 4PW8A 5JQGE 2N2NA 4JI8T 2QGSA 2WDVA 4IDPA 4AI6A 3VHLA 1OEDC 3JAFA 1XNRT 3ZMUB 3LSVA 1YQ3A 3G06A 1UK5A 3Q5DA 3N5LA 3WI3A 5AQSB 2C5JA 1XWMA 2XQAA 3OTOT 5HEHA 2E2AA 4L9IA 3IBPA 3HKEE 2EHOC 1YQ4A 3WAKA 4FI5A 5AQGB 5AQOB 4YXDA 5LG3A 5JTGA 3L09A 4UIGA 4EYYR 3LK3B 3TLSA 1WCRA 1ZP0A 3AEEA 4LF4T 1MIYA 2YOEA 2ZLYA 3N9NA 5L47A 2XASB 3BQLA 2H7VC 4JI2T 1MMNA 5AQFB 4X1IE 2WU2A 5AFUL 5LYJE 4A56A 3RIFA 2IUBA 3I9WA 5J1GA 3UU6A 3Q5WA 3CQCB 1L0VA 5AQHB 4XBFB 1ZKEA 3E22E 4YSYA 1X9BA 4HFDA 5LHHB 3ZC0A 5LGTB 2CXDA 4YT0A 4DV7T 1U5PA 4KMCA 3RYIE 4JBWF 4U7IA 1I6ZA 3ZT6A 3OYXA 3O9XA 2IC6A 3FBLA 2K48A 3GA8A 1MNEA 3ZMVB 4H63V 3RQWA 1N36T 2VVNA 5KDMC 5IWAT 1QLBA 1E2AA 2VQFT 2KMFA 3JC6C 1T8BA 4KP3C 3D0TA 1ZOYA 4ILBA 4OYJA 5LGNB 4EAHA 5HCMA 1D1CA 1IJ6A 1Y01A 5L4EA 4EZHA 4AKGA 3RLFF 4IIJE 5F5WA 3ZEFB 4JV5T 4EEBA 1VOMA 2Q9QB 3GWHA 2W4XA 1M7KA 1J1JA 3HA4A 5HYAA 4YFSA 3ONJA 1HFAA 2UXXB 5FVLA 3A8YC 4DUZT 5ADXL 2DNXA 2OLTA 4O4HE 5FMNA 2LT3A 3CQGB 2IIUA 4PJMA 4IE4A 5L3FB 4EXTA 5AQIB 2HPJA 3MACA 5AQMB 2XY8B 3PDYA 2LLYA 4CQIA 5J0ZA 3V5SA 5DQVA 1S35A 4X65T 4QWNB 2Q9QA 4LMLA 3HR0A 3F31A 4XZCA 3CX6B 4DR2T 3VRAA 2CHNA 5JDLA 1MMGA 3UU4A 1T72A 5C2TA 3UFEA 3SRZA 3AA0B 2XUEA 4DR3T 4A97A 4X64T 3FZMB 3PUWF 4EGWA 1HG2A 4EYUA 3FZKB 2W0GA 3LK2B 4DV4T 5JDQA 3JAEA 3AE5A 4TN7B 3PUXF 3NBXX 1UURA 5FVKA 2C5IT 1UX4A 3B57A 2PBIA 5LP6E 3VKHA 4IE5A 3N2OA 4OYKA 1HNZT 2MAWA 2JQQA 4K0KT 3ZT5A 4KX6A 4UVBB 4AQFA 5DABA 1IBMT 2XHEB 3QK6A 3EUHA 1IZNB 4O2AE 4TX5A 1MIVA 4EZ4A 4ZS2A 4HN9A 2CPTA 4JI6T 2VVSA 4FJOA 2R6GF 3FZLB 3RF1A 4KHPT 3ZN1B 4UVCB 2LHRA 1BR1A 2WWUA 1VCTA 1WYCA 1I94T 4UF0B 2BS4A 3RH3A 2G0UA 3QC9A 5IUXA 3RGLA 4CXWA 4P0AA 2LSYA 2XJ7A 1XMOT 5HXSA 4DR6T 3U3IA 2WQYA 2OA5A 3HKCE 4JUYA 3MJXA 2WSSV 2JMKA 2YDQA 4GK0E 3AVSA 4U2ZA 3SOLA 5H6QB 4ADZA 3EVYA 2IHR1 1KK7A 1FMVA 3M65A 3LJCA 2VKDA 3AECA 3RKGA 2W63A 3MA9A 4AQYT 3E0ZA 3Q9DA 4IE7A 4KHZF 3PUQA 5EK3A 4YSXA 2V7MA 4TV9E
chains in the Genus database with same CATH topology
4JI0T 4LF5T 1HNWT 4NXNT 1IBKT 4LF9T 1HNZT 4DV0T 4DUYT 4K0KT 1N32T 2VQET 4B3TT 4JYAT 1FJGT 5LMNT 4JI1T 4OX9T 1J5ET 1IBMT 2HHHT 4YY3T 4DV7T 4DR5T 3T1YT 4JI8T 4GKKT 1XNQT 4JI4T 2UXDT 1N33T 4DR4T 5LMUT 4DV2T 1XNRT 2UUCT 2UUBT 4JI6T 4DV1T 2E5LT 4KHPT 1N34T 1N36T 2ZM6T 4JI3T 1IBLT 5IWAT 5BR8T 2UU9T 2VQFT 1I94T 4B3ST 3OTOT 4LFCT 4X65T 4LF7T 4YHHT 4X62T 4DR2T 4JI7T 1XMOT 4DR6T 1HNXT 1XMQT 3T1HT 4DR3T 4DR7T 4B3MT 4X64T 4DV6T 4DV3T 2UUAT 4JV5T 2F4VT 4LF4T 4B3RT 4LFAT 4DR1T 4DV4T 4LF6T 4LF8T 4X66T 4JI2T 1HR0T 4DV5T 4GKJT 4NXMT 2UXCT 4AQYT 4JI5T 2UXBT 4DUZT 4LFBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 T;  4LF5 T;  1HNW T;  4NXN T;  1IBK T;  4LF9 T;  1HNZ T;  4DV0 T;  4DUY T;  4K0K T;  1N32 T;  2VQE T;  4B3T T;  4JYA T;  1FJG T;  5LMN T;  4JI1 T;  4OX9 T;  1J5E T;  1IBM T;  2HHH T;  4YY3 T;  4DV7 T;  4DR5 T;  3T1Y T;  4JI8 T;  4GKK T;  1XNQ T;  4JI4 T;  2UXD T;  1N33 T;  4DR4 T;  5LMU T;  4DV2 T;  1XNR T;  2UUC T;  2UUB T;  4JI6 T;  4DV1 T;  2E5L T;  4KHP T;  1N34 T;  1N36 T;  2ZM6 T;  4JI3 T;  1IBL T;  5IWA T;  5BR8 T;  2UU9 T;  2VQF T;  1I94 T;  4B3S T;  3OTO T;  4LFC T;  4X65 T;  4LF7 T;  4YHH T;  4X62 T;  4DR2 T;  4JI7 T;  1XMO T;  4DR6 T;  1HNX T;  1XMQ T;  3T1H T;  4DR3 T;  4DR7 T;  4B3M T;  4X64 T;  4DV6 T;  4DV3 T;  2UUA T;  4JV5 T;  2F4V T;  4LF4 T;  4B3R T;  4LFA T;  4DR1 T;  4DV4 T;  4LF6 T;  4LF8 T;  4X66 T;  4JI2 T;  1HR0 T;  4DV5 T;  4GKJ T;  4NXM T;  2UXC T;  4AQY T;  4JI5 T;  2UXB T;  4DUZ T;  4LFB T; 
#chains in the Genus database with same CATH topology
 3ZYM A;  4LF5 T;  3TLU A;  3L8R A;  3B13 A;  2FJA A;  3UFG A;  2DWG A;  4TUY E;  4AQG A;  2KWH A;  3FZF B;  4NUV A;  4P09 A;  4UF0 A;  1V9D A;  3J7Y q;  3P4W A;  2FBW A;  2W00 A;  3ONL C;  2V8S V;  3JAD A;  3O1H A;  2WP9 A;  4CI1 B;  3AEB A;  3MKD A;  2ACX A;  4P0B A;  5ABG A;  3NRY A;  5L4H A;  1WLX A;  4KBM B;  3AE3 A;  4EOZ B;  5CA1 E;  5M4Y A;  3NZP A;  2K5B B;  4LF7 T;  1VRB A;  4WNK A;  2KWI B;  3QUJ A;  1HX8 A;  1KNP A;  5IYZ E;  5EK4 A;  5ABF B;  2VAS A;  4DR7 T;  3E08 A;  2M6I A;  4WYV A;  4B3R T;  3P4P A;  4QKN A;  1H7C A;  4HTE A;  5FXV A;  2Q9Q D;  3ZC1 A;  2XM1 A;  3IHR A;  2WDR A;  2CHO A;  3LBX A;  3AVR A;  3UU5 A;  5FY7 A;  2V6X A;  2YU2 A;  5EZY E;  3FZH B;  2ZMA A;  3NRX A;  3K8P C;  4LF9 T;  1UGO A;  2BG9 E;  2W61 A;  3OVU A;  4DUY T;  3RC3 A;  3P4Q A;  2H3R A;  2WZI A;  1WYB A;  4MAL A;  3CML A;  3VR9 A;  4BA9 A;  2N9D A;  5LMN T;  3KV4 A;  2X9X A;  5FY0 A;  3AEA A;  1OWA A;  2H88 A;  2MOZ A;  4O2B E;  2FJD A;  4O4J E;  3K3O A;  4ZS3 A;  4B6X A;  5ABF A;  3IEE A;  1Z8U A;  1IJ5 A;  2YDS A;  1N34 T;  1KFY A;  2RP4 A;  1WR0 A;  1CUN A;  2FUP A;  2L9Q A;  4J2C A;  4QX8 B;  5HEU A;  1X79 A;  2CLY B;  4IE6 A;  5DQW A;  2Q9Q C;  2LJL A;  4IE0 A;  3AE9 A;  3EDU A;  3C4X A;  4PJL A;  4L0R A;  4YLH A;  4ZXL A;  1SHZ C;  3T1H T;  2NW7 A;  3CKD A;  5AQQ B;  4IGU A;  2H89 A;  2SPC A;  2IC9 A;  3ZKR A;  4O8S A;  4ZHQ E;  3P7I A;  4LF8 T;  3ZMT B;  1G73 A;  1YKH B;  3PUZ F;  1D1B A;  3K1S A;  1BR2 A;  1YXR A;  4NXM T;  5C3J A;  4ZI3 D;  5HCJ A;  3I0O A;  5LHG B;  2NWB A;  4AKH A;  3PUS A;  3ABV A;  5HXC A;  3JC6 D;  2JIW A;  4K0U A;  3GN5 B;  4AQF C;  4OFZ A;  1XDO A;  2V26 A;  2QVA A;  2VB6 A;  1UX5 A;  1OED E;  3UUM A;  4AIS A;  1N33 T;  5JDF A;  2V5D A;  4QHO A;  4WW0 A;  3A7M A;  3EDV A;  3EHZ A;  5HXH A;  4DV1 T;  3RYF E;  1FMW A;  4QXH B;  5HXE A;  5L3D B;  3PU8 A;  2XTL A;  4KUM B;  3C4Z A;  4DBR A;  1US7 B;  4YHJ A;  1MMD A;  3TLW A;  2DCF A;  4GK5 E;  4M1P A;  1T98 A;  3QNU A;  3KFW X;  5LB7 B;  4WBN E;  4H9N C;  3UQ4 A;  2WM9 A;  3Q5X A;  4ZI3 C;  1SE7 A;  4DID B;  5AQL B;  4HFE A;  4UV8 B;  4IST A;  4PJJ A;  5JR9 B;  2V7J A;  3RHW A;  2D0U A;  2Y48 B;  1DU2 A;  3FXD B;  2IW5 B;  1W0A A;  1LKX A;  4DND A;  2HN2 A;  3GN5 A;  2M67 A;  1NEN A;  3SFE A;  1JNR A;  4IHJ E;  3FHN A;  5HEG A;  2UXB T;  2JQH A;  2X67 A;  1HTJ F;  1UUS A;  2NTY A;  4I4T E;  1LRZ A;  1HG5 A;  2BKN A;  3TLT A;  3PV0 F;  1YW0 A;  3CK6 A;  4GYS A;  5LNK A;  4H9S E;  3AEG A;  4HKA A;  4Q25 A;  5FXW A;  3RYC E;  4CI3 B;  4Z91 A;  5LA6 E;  4H9P C;  2ES0 A;  3AA1 B;  5ABH A;  3L39 A;  3BQK A;  2NW8 A;  2VL8 A;  3PTR B;  4HWF A;  4ERR A;  3MK7 C;  5AQU B;  3AAA B;  3SWH A;  4U3C A;  2ZM6 T;  1QSD A;  4P1N A;  4JI3 T;  5FP3 A;  2CE7 A;  4ZOL E;  1KNR A;  4IDZ A;  5JR9 A;  3CPZ A;  2AXD S;  5HEJ A;  4TWH A;  3ONX A;  3H3M A;  5CJ5 A;  2H7O A;  2V5C A;  1HX1 B;  5TAO A;  2VKO A;  4ZEY A;  2LHN A;  2CBI A;  3CVR A;  3AE8 A;  2XQ9 A;  4IL9 A;  5AQJ B;  2N1G A;  4AXP A;  2MTQ A;  4O4I E;  4X66 T;  2LKH A;  3RRC A;  2X0H A;  4BJN A;  5A1L A;  3HKD E;  2JRK A;  2QYW A;  3AXJ B;  3LK4 2;  4QX7 B;  4Z8X A;  5LG4 A;  1HF8 A;  5CA0 E;  2YIN A;  4JI0 T;  4EV6 A;  1IBK T;  5LBM A;  2CBJ A;  4N78 D;  3C51 A;  2C0S A;  2YDR A;  4I43 B;  2VKH A;  3K3Q C;  3EAB A;  1ZEE A;  4ISS A;  2XZE A;  4BAY B;  4TWD A;  5JDH A;  2BDE A;  3PU3 A;  2UXD T;  5KXJ A;  3S4U A;  3AAE B;  2VL0 A;  2LSG A;  1FEW A;  4I0U A;  2D2S A;  2B1E A;  4CXY A;  5F3J A;  1D0Z A;  5KX5 E;  2JQ9 A;  3DJB A;  4MBQ A;  3B5M A;  2FJB A;  4HEA A;  4PK5 A;  3TLV A;  2V1D B;  4IL4 A;  2W67 A;  4ILU A;  1HCI A;  2CA5 A;  5BR8 T;  2VK9 A;  1E7P A;  4LFC T;  3BK9 A;  1SUM B;  4PJN A;  2ODV A;  4E7Z A;  2KSR A;  4HFC A;  5LOV E;  3AXJ A;  4GIW A;  2XAJ B;  3V5U A;  2E5V A;  3X1D A;  3AA7 B;  4AKL A;  2F4V T;  3ZT7 A;  1J5W A;  3W15 B;  3EI0 A;  3ETU A;  3PJA J;  5LBQ B;  4Z90 A;  2M6B A;  3N9P A;  4DV5 T;  1KNZ A;  1B7T A;  4CZZ B;  3CWZ B;  4BJM A;  4HFH A;  2X9W A;  4NIQ A;  3RKO A;  1BR4 A;  3UUX B;  2IML A;  2DWK A;  3ZLI A;  3I9Y A;  3SFD A;  4O4L E;  4YSZ A;  2K24 A;  3OYZ A;  4A98 A;  3F57 A;  4YTM A;  2WAU A;  3DP7 A;  5J2T E;  2D9D A;  2L8K A;  2ODU A;  2XAF B;  3T1Y T;  2NP9 A;  4CN4 A;  2ZM2 A;  2XQ7 A;  2CLY C;  3N2G E;  4MHC A;  3UUB A;  3PUR A;  2PFV A;  3UU3 A;  4ZI2 D;  4MLK A;  3KIN B;  4WZX A;  3QOF A;  2LRK A;  2UU9 T;  3LBX B;  4B3S T;  4PAG A;  3ZCI A;  1ZHC A;  4YJ2 E;  2E8I A;  4X62 T;  3FXE B;  2LM2 A;  3KV6 A;  3CIR A;  4I55 E;  4JEH B;  4UV9 B;  1OXZ A;  5FXZ A;  3PUV F;  3RIU A;  4CI2 B;  2CMR A;  2WMO A;  1D0Y A;  1YD8 G;  3H37 A;  3N9O A;  5JRC B;  2XAH B;  4CXX A;  2BVM A;  4PFP A;  4DV6 T;  5JDM A;  3ZSS A;  4E7S A;  3AE1 A;  3KVB A;  2WCA A;  2XM2 A;  1UCU A;  2X9Y A;  2X9H A;  3ZCJ A;  4GKJ T;  5L3C B;  1E1H B;  1SA0 E;  3NZQ A;  2BKP A;  4ZI2 C;  3FB2 A;  4KI0 F;  3Q5E A;  5HWX A;  2HN1 A;  1J5E T;  5LCY A;  4HGA A;  2DHR A;  4HWD A;  5JVD E;  3ZMS B;  3UU8 A;  2A2F X;  4JI4 T;  2I59 A;  4AKR B;  2W62 A;  4C90 A;  1U4Q A;  2L3L A;  1VCS A;  5JRC A;  1IBL T;  2YK0 A;  5FNV E;  4ILA A;  4U2Y A;  2WMN A;  4IRE A;  2LEH A;  5JR9 C;  2J4G A;  2W2U A;  3ZYK A;  3PE0 A;  2XAQ B;  3DTO A;  4XAX B;  4COF A;  3ZPO A;  4C91 A;  4U72 A;  1M62 A;  2GK9 A;  1XMQ T;  2P9B A;  3O1I A;  1WRD A;  2C5K T;  5ETW A;  2QA7 A;  4HFV A;  5HWY A;  3AA6 B;  3AB3 B;  3KDS E;  5DJQ C;  3L3P A;  1T7S A;  1LVF A;  5AQR B;  2VUR A;  4EB6 E;  2W66 A;  1JNZ A;  2ACZ A;  2PJQ A;  3RC8 A;  5CGM A;  2LE8 A;  5JH7 E;  2WDQ A;  4NPP A;  3P4R A;  5ABE A;  2KXP B;  2I0M A;  4F6R C;  4GOU A;  2JQK A;  2XAG B;  4LMJ A;  2BZB A;  4OX9 T;  2CXF A;  5AQP B;  4IDO A;  3U78 A;  2X0Y A;  3KBU A;  2CM0 A;  5LXT E;  4TWF A;  4DR4 T;  2XQ3 A;  4PNI A;  2KZ7 B;  2LSJ A;  3M3Z B;  2WS3 A;  4JLE A;  3NKZ A;  4AIU A;  2BG9 B;  2I6H A;  4GYR A;  3C4W A;  2BBJ A;  2X0L B;  4ZZC A;  1XDP A;  3KBT A;  3AE6 A;  3P50 A;  2V7K A;  3SS1 A;  4IDQ A;  4X20 E;  4QH4 A;  3KV5 A;  5AQN B;  2WU5 A;  5CFB A;  5FL1 A;  2PG8 A;  5FKY A;  4TV8 E;  2YN6 A;  3RYH E;  3PUA A;  4DV3 T;  2FJE A;  2CRB A;  1D1A A;  2BVL A;  2LSK A;  3LFM A;  2YKS A;  4LF6 T;  2WZH A;  1IAP A;  1CHU A;  5LJM A;  5HAX A;  4ZZB A;  3MXZ A;  5FY1 A;  1FIO A;  4A5X A;  1KF6 A;  4MFR A;  1R8I A;  1HS7 A;  4OHF A;  2XQ5 A;  4HWI B;  2BG9 A;  2J1D G;  3OBV E;  4YJ3 E;  4DVD A;  3T8O A;  2IDO B;  2CXL A;  4HFI A;  4B3T T;  2XSB A;  1FJG T;  3MZK B;  2WY2 A;  2HHH T;  3AEF A;  3ANW B;  5J2U E;  5AQT B;  5JDN A;  3N9L A;  4ILC A;  4G2A A;  2E9X B;  3ESL A;  1ZV4 X;  4DV2 T;  3C98 B;  2UUB T;  4AKI A;  3RX6 A;  3K3N A;  2J62 A;  4EED A;  3R6N A;  3VU7 H;  5FYM A;  5BMV E;  2MBG A;  3C50 A;  3IA3 A;  4U33 A;  2K3W A;  1OED B;  5IHY A;  3P4S A;  2LM9 A;  3AE7 A;  4DMW A;  3AE4 A;  3RPU A;  4PK6 A;  4QXC B;  3RIU C;  3PUY F;  5L3B B;  4U7Y A;  2AE9 A;  1G8X A;  4LFA T;  1O3X A;  4H63 H;  1AJ3 A;  2EHO B;  3VRB A;  3R84 B;  2D5U A;  2VWA A;  4TNW A;  4X5T A;  2XQ6 A;  3AE2 A;  2UXC T;  5LHI B;  3ANW A;  3FBZ A;  2VKJ A;  2E9X A;  1WR6 A;  2JJ9 A;  5FXX A;  1YKE B;  4QH1 A;  3N9Q A;  2HPL A;  2KIN B;  1GQE A;  4JEU B;  4UR9 A;  2X51 A;  3HKB E;  4JYA T;  2ZM8 A;  1KEY A;  1WFD A;  4YY3 T;  4UVA B;  4DR5 T;  1XNQ T;  1OED A;  2BBH A;  5AQK B;  4CN6 A;  4OK0 A;  1D0X A;  2BS3 A;  2CWO A;  1S94 A;  3N9M A;  1W0B A;  2XQ4 A;  2BS2 A;  2HH7 A;  3ZMZ B;  4X1Y E;  2IAK A;  2LRL A;  3I1A A;  2WB5 A;  2NW9 A;  1Y64 B;  3ZJ2 A;  3KV9 A;  4X1K E;  2EHO A;  2RA1 A;  3P8C D;  3QB5 K;  3ZST A;  3LG7 A;  4LMK A;  3PJA A;  4JI7 T;  3RI5 A;  1MIW A;  3O4X E;  5H6R B;  2XQ8 A;  3AAI A;  3H3A A;  4YTP A;  5LGU B;  3J9X 1;  2NR4 A;  2UUA T;  4QXB B;  4DR1 T;  4HE8 A;  2LKG A;  4UEM A;  1MND A;  2MYS A;  5KMG P;  2XQY A;  3ZN0 B;  1LVK A;  4LFB T;  4DO0 A;  3UT5 E;  3ETV A;  2Y8D A;  3KVA A;  3NVO A;  4V1A v;  4G63 A;  3UTK A;  2VQE T;  1Z0P A;  4H9O C;  5JDG A;  2A3D A;  4QH5 A;  2RPA A;  5JRE A;  4GKK T;  4H9R C;  3A5X A;  2QRX A;  1W9R A;  3CX8 B;  1W09 A;  3RIA A;  2OV9 A;  5LMU T;  3EAM A;  2YEV C;  2V6Y B;  4PFO A;  2BKO A;  2E5L T;  2J47 A;  3NWI A;  3AED A;  3HI2 A;  1NWM X;  2KND A;  2XPK A;  3C64 A;  2X68 A;  5CB4 E;  3I0Q A;  5HXR A;  4IT4 A;  2X66 A;  3UUN A;  2CCQ A;  2YU1 A;  2LSI A;  4HFB A;  3VR8 A;  3IF8 B;  2CWY A;  2LOP A;  3HL6 A;  3F2E A;  1HNX T;  4DBQ A;  4HWH A;  5EK2 A;  2V7L A;  4HWC A;  4F8H A;  3JCF A;  2CEA A;  4ASK A;  4PK4 A;  4U31 A;  2WWV A;  2KT9 A;  5F8P A;  1EZ3 A;  3UUL A;  3RRW A;  1QUU A;  5LJN A;  3BQI A;  4JI5 T;  4ZI7 E;  2K9A A;  2A72 A;  2PTF A;  2Y6X A;  3Q2M A;  4NXN T;  2NTX A;  4DV0 T;  2V6Y A;  3ZJ1 A;  2WBL A;  2BG9 C;  3CQX C;  3N2K E;  4WBO A;  5L3E B;  1BR0 A;  3LDQ B;  4DMV A;  4NUU A;  5HEO A;  3PUG A;  4H9Q C;  2UUC T;  3QB5 A;  3TKL B;  2E9X D;  5GON E;  2DI4 A;  2LOS A;  1NAF A;  2XSA A;  2JMH A;  4UEL A;  2ZM0 A;  5FL0 A;  4YHH T;  3WAJ A;  2V7I A;  4L5G A;  2KLQ A;  3CX7 B;  1NEK A;  3OPC A;  3OJA A;  3ZYL A;  2B76 A;  3RQU A;  4TZ4 C;  5C8Y E;  2Z6E A;  5E0O A;  1MMA A;  4B3M T;  1XZY A;  4IDN A;  4EIW A;  2DLR A;  4CN1 A;  2UXN B;  2JPF A;  3VKG A;  2NOX A;  2MPK A;  3OKQ A;  4UXN B;  1HR0 T;  4TNV A;  3UQ7 A;  5L3G B;  2D0T A;  2EHO D;  4I50 E;  4ANJ A;  2DL1 A;  5AQV B;  2A9U A;  2E9X C;  1HNW T;  4YTN A;  4U74 A;  5L2L A;  3O1J A;  1N32 T;  3GMI A;  4JI1 T;  4PW8 A;  5JQG E;  2N2N A;  4JI8 T;  2QGS A;  2WDV A;  4IDP A;  4AI6 A;  3VHL A;  1OED C;  3JAF A;  1XNR T;  3ZMU B;  3LSV A;  1YQ3 A;  3G06 A;  1UK5 A;  3Q5D A;  3N5L A;  3WI3 A;  5AQS B;  2C5J A;  1XWM A;  2XQA A;  3OTO T;  5HEH A;  2E2A A;  4L9I A;  3IBP A;  3HKE E;  2EHO C;  1YQ4 A;  3WAK A;  4FI5 A;  5AQG B;  5AQO B;  4YXD A;  5LG3 A;  5JTG A;  3L09 A;  4UIG A;  4EYY R;  3LK3 B;  3TLS A;  1WCR A;  1ZP0 A;  3AEE A;  4LF4 T;  1MIY A;  2YOE A;  2ZLY A;  3N9N A;  5L47 A;  2XAS B;  3BQL A;  2H7V C;  4JI2 T;  1MMN A;  5AQF B;  4X1I E;  2WU2 A;  5AFU L;  5LYJ E;  4A56 A;  3RIF A;  2IUB A;  3I9W A;  5J1G A;  3UU6 A;  3Q5W A;  3CQC B;  1L0V A;  5AQH B;  4XBF B;  1ZKE A;  3E22 E;  4YSY A;  1X9B A;  4HFD A;  5LHH B;  3ZC0 A;  5LGT B;  2CXD A;  4YT0 A;  4DV7 T;  1U5P A;  4KMC A;  3RYI E;  4JBW F;  4U7I A;  1I6Z A;  3ZT6 A;  3OYX A;  3O9X A;  2IC6 A;  3FBL A;  2K48 A;  3GA8 A;  1MNE A;  3ZMV B;  4H63 V;  3RQW A;  1N36 T;  2VVN A;  5KDM C;  5IWA T;  1QLB A;  1E2A A;  2VQF T;  2KMF A;  3JC6 C;  1T8B A;  4KP3 C;  3D0T A;  1ZOY A;  4ILB A;  4OYJ A;  5LGN B;  4EAH A;  5HCM A;  1D1C A;  1IJ6 A;  1Y01 A;  5L4E A;  4EZH A;  4AKG A;  3RLF F;  4IIJ E;  5F5W A;  3ZEF B;  4JV5 T;  4EEB A;  1VOM A;  2Q9Q B;  3GWH A;  2W4X A;  1M7K A;  1J1J A;  3HA4 A;  5HYA A;  4YFS A;  3ONJ A;  1HFA A;  2UXX B;  5FVL A;  3A8Y C;  4DUZ T;  5ADX L;  2DNX A;  2OLT A;  4O4H E;  5FMN A;  2LT3 A;  3CQG B;  2IIU A;  4PJM A;  4IE4 A;  5L3F B;  4EXT A;  5AQI B;  2HPJ A;  3MAC A;  5AQM B;  2XY8 B;  3PDY A;  2LLY A;  4CQI A;  5J0Z A;  3V5S A;  5DQV A;  1S35 A;  4X65 T;  4QWN B;  2Q9Q A;  4LML A;  3HR0 A;  3F31 A;  4XZC A;  3CX6 B;  4DR2 T;  3VRA A;  2CHN A;  5JDL A;  1MMG A;  3UU4 A;  1T72 A;  5C2T A;  3UFE A;  3SRZ A;  3AA0 B;  2XUE A;  4DR3 T;  4A97 A;  4X64 T;  3FZM B;  3PUW F;  4EGW A;  1HG2 A;  4EYU A;  3FZK B;  2W0G A;  3LK2 B;  4DV4 T;  5JDQ A;  3JAE A;  3AE5 A;  4TN7 B;  3PUX F;  3NBX X;  1UUR A;  5FVK A;  2C5I T;  1UX4 A;  3B57 A;  2PBI A;  5LP6 E;  3VKH A;  4IE5 A;  3N2O A;  4OYK A;  1HNZ T;  2MAW A;  2JQQ A;  4K0K T;  3ZT5 A;  4KX6 A;  4UVB B;  4AQF A;  5DAB A;  1IBM T;  2XHE B;  3QK6 A;  3EUH A;  1IZN B;  4O2A E;  4TX5 A;  1MIV A;  4EZ4 A;  4ZS2 A;  4HN9 A;  2CPT A;  4JI6 T;  2VVS A;  4FJO A;  2R6G F;  3FZL B;  3RF1 A;  4KHP T;  3ZN1 B;  4UVC B;  2LHR A;  1BR1 A;  2WWU A;  1VCT A;  1WYC A;  1I94 T;  4UF0 B;  2BS4 A;  3RH3 A;  2G0U A;  3QC9 A;  5IUX A;  3RGL A;  4CXW A;  4P0A A;  2LSY A;  2XJ7 A;  1XMO T;  5HXS A;  4DR6 T;  3U3I A;  2WQY A;  2OA5 A;  3HKC E;  4JUY A;  3MJX A;  2WSS V;  2JMK A;  2YDQ A;  4GK0 E;  3AVS A;  4U2Z A;  3SOL A;  5H6Q B;  4ADZ A;  3EVY A;  2IHR 1;  1KK7 A;  1FMV A;  3M65 A;  3LJC A;  2VKD A;  3AEC A;  3RKG A;  2W63 A;  3MA9 A;  4AQY T;  3E0Z A;  3Q9D A;  4IE7 A;  4KHZ F;  3PUQ A;  5EK3 A;  4YSX A;  2V7M A;  4TV9 E; 
#chains in the Genus database with same CATH homology
 4JI0 T;  4LF5 T;  1HNW T;  4NXN T;  1IBK T;  4LF9 T;  1HNZ T;  4DV0 T;  4DUY T;  4K0K T;  1N32 T;  2VQE T;  4B3T T;  4JYA T;  1FJG T;  5LMN T;  4JI1 T;  4OX9 T;  1J5E T;  1IBM T;  2HHH T;  4YY3 T;  4DV7 T;  4DR5 T;  3T1Y T;  4JI8 T;  4GKK T;  1XNQ T;  4JI4 T;  2UXD T;  1N33 T;  4DR4 T;  5LMU T;  4DV2 T;  1XNR T;  2UUC T;  2UUB T;  4JI6 T;  4DV1 T;  2E5L T;  4KHP T;  1N34 T;  1N36 T;  2ZM6 T;  4JI3 T;  1IBL T;  5IWA T;  5BR8 T;  2UU9 T;  2VQF T;  1I94 T;  4B3S T;  3OTO T;  4LFC T;  4X65 T;  4LF7 T;  4YHH T;  4X62 T;  4DR2 T;  4JI7 T;  1XMO T;  4DR6 T;  1HNX T;  1XMQ T;  3T1H T;  4DR3 T;  4DR7 T;  4B3M T;  4X64 T;  4DV6 T;  4DV3 T;  2UUA T;  4JV5 T;  2F4V T;  4LF4 T;  4B3R T;  4LFA T;  4DR1 T;  4DV4 T;  4LF6 T;  4LF8 T;  4X66 T;  4JI2 T;  1HR0 T;  4DV5 T;  4GKJ T;  4NXM T;  2UXC T;  4AQY T;  4JI5 T;  2UXB T;  4DUZ T;  4LFB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...