4X66I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x66I00
4DUYI 4LFAE 3QT7A 4DV3I 1NHIA 1MX0A 2R42A 2V2QA 1H74A 4P52A 3V2UC 4DV4E 1ZM9A 1ZXMA 4JI0I 3QT5A 5LMNI 1H7SA 5GMDA 2F4VE 2VQFE 3ZKBA 4Z7CA 1MU5A 4DV7I 1FWLA 3QT6A 1N32I 1A6FA 1UEKA 3T1HI 2A2DA 4JI3I 4USMA 2DEIA 2GS8A 4LF6I 1EA6A 4X62I 1B62A 4B3SI 4B3ME 2X7IA 4LF8I 1Z0TA 3J81C 4LF5E 2Q2EB 4JI5E 4FW9A 5LMUI 4JYAE 3ZZ0A 1HNZE 4UTGA 4LF9I 4JI8E 4K0KI 4LF7E 4DR1I 4AQYE 4DUYE 5IT9C 2HHHE 4WUCA 4DV5I 4B3TE 1D6TA 3J7AM 4JI4I 3JAMC 4KQVA 4DV0I 4JI0E 5LMNE 3K1JA 4M1KA 3B8HA 4Z7YA 1XNRI 5IT9Q 1ZXNA 2E1RA 2OI2A 4YY3I 2AJ4A 3JAMQ 1FNMA 4NXNI 1FWKA 2BM0A 2J7KA 4B3RE 4DV2I 2DEJA 4LF6E 3Q1QA 4GKKE 1H72C 4B3SE 4P7AA 1XMQE 1K47A 4DR6E 4DXLA 4LF4I 4LF8E 1Z5AA 4DR7E 1MG7A 1U2RA 1DARA 4FWHA 4NXMI 3ZM7A 1Z0WA 3B82A 2UXCI 1XNQI 4DV1I 2UXDI 4LF9E 1H73A 4DPUA 4HYMA 2BM1A 4DR1E 3LNUA 4OX9I 1EI1A 4DV5E 1VISA 2VF3A 4JG4A 3T1YE 2HKJA 4JI4E 2UXBI 4R1FA 3H4LA 2A2CA 1NHHA 4X66I 2V34A 4DV0E 4FWDA 2UUBI 4JI2I 4X64E 4DUZI 1Z5BA 1Z0CA 4DPXA 1J5EI 1RREA 1XNRE 1B63A 3D4JA 4PRXA 3CWVA 3WU4A 1FJGI 2V2VA 4YY3E 1Z5CA 1Z59A 4LFBI 4JI1I 4NXNE 4DPWA 2CZ9A 4PU9A 4DV2E 4DV6I 1IBMI 2E5LI 2ZITA 5FLXC 2UUAI 1ZM4A 4JI7I 1IBKI 4DR3I 2VQEI 3OTOE 4DR5E 4HXZA 1BKNA 1HR0E 2HK2A 4NXME 1Z0BA 2XEXA 1HNXI 1N33I 4DV3E 1XNQE 5BR8I 4DV1E 2ZM6I 3J81Q 5FLXQ 1PIEA 1I94I 4LFAI 4X65I 4LFCI 1KVKA 3HULA 3ZZTA 2LJPA 2EFGA 4DV7E 3J80C 4JI6I 4HACB 4X66E 1N32E 4KHPI 2UUBE 3WU3A 3M6AA 5A2QC 2HFSA 3T1HE 2VQFI 4WUBA 1J5EE 4JI3E 3WU6A 4MYUA 1FJGE 4X62E 2R3VA 2V2ZA 4RPFA 1IBLI 4ED4A 3J80Q 2X36A 5A2QQ 4DV6E 1IBME 1S16A 2E5LE 2UUAE 4JI7E 4B3MI 1IBKE 3LTOA 4MYTA 4DR3E 5LMUE 3ZZUA 1NZ0A 4YHHI 4LF5I 3PYFA 4K0KE 1HNXE 1N33E 3K17A 5BR8E 2UU9I 4JV5I 1N34I 4XTJA 4AQYI 4DR2I 4URLA 2HHHI 4B3TI 1PVGA 1N0UA 4X65E 1N36I 4LFCE 1ZM2A 4GKJI 1XHKA 3WU5A 5L3JA 1XMOI 3PYDA 2ZBKB 2V8PA 4JI6E 1ZM3A 4KHPE 4DU7A 1ELOA 1Z0GA 1WUUA 3GONA 1PKPA 3PYEA 2UUCI 1HNWI 2BV3A 2HKEA 1IBLE 4UT4A 1H7UA 4USKA 4B3RI 1KKHA 4LF4E 5IWAI 3ZKDA 4DU8A 1N0VC 1OJ4A 2HK3A 4GKKI 4DR4I 2HFUA 4DPYA 3PYGA 1QZRA 1XMQI 4DR6I 2UXCE 4YHHE 4DR7I 2UXDE 4HY1A 3QT8A 1RR9A 4OX9E 5GMEA 2UU9E 1FI4A 3V5RA 4JV5E 1N34E 3F0NA 4DR2E 2UXBE 4FWGA 4I3HA 4DV4I 1N36E 4EMDA 4WUDA 3T1YI 4JI2E 4DUZE 1KIJA 4GKJE 1NHJA 2F4VI 1XMOE 4X64I 4ZVIA 4LFBE 4JI1E 4PRVA 3B78A 1Z0VA 1KTVA 1Z0EA 4HACA 2UUCE 1HNWE 4FN5A 2VQEE 5LL6R 5IWAE 4DPTA 4JI5I 4DR4E 4JYAI 1FKAE 1HNZI 2WW4A 1S4EA 3J7AG 3OTOI 4DR5I 3LPSA 4JI8I 2ZM6E 2NPFA 1HR0I 4LF7I 1I94E
chains in the Genus database with same CATH superfamily
4DUYI 4LFAE 3QT7A 4DV3I 1NHIA 1Y4SA 3CDIA 1MX0A 2R42A 2V2QA 1H74A 4P52A 2IOQA 3V2UC 4DV4E 1ZM9A 5K36A 5K36F 1ZXMA 4JI0I 3QT5A 5LMNI 2BA1G 1H7SA 5GMDA 2F4VE 3B4TA 2VQFE 3ZKBA 4Z7CA 1MU5A 4DV7I 1FWLA 3QT6A 1N32I 2J65A 2PO0A 5DRPA 1A6FA 1UEKA 3T1HI 2IOPA 2A2DA 3NZKA 4JI3I 4OKGA 4USMA 2DEIA 2JE6A 2Z5CA 1R6LA 2F1DA 2GS8A 2C39A 5JEAE 4LF6I 1EA6A 2AE8A 4X62I 4IFDD 1B62A 4B3SI 4B3ME 2X7IA 4LF8I 1Z0TA 3J81C 4LF5E 5EKWA 2Q2EB 2O1TA 4JI5E 4FW9A 2JEAA 5LMUI 4JYAE 3ZZ0A 5DNLA 1HNZE 4UTGA 1VI7A 5C0XB 4LF9I 1UDNA 4JI8E 5C0XD 2BR2A 4K0KI 4MU3A 4LF7E 4DR1I 4AQYE 4DUYE 2NN6E 5IT9C 4QNKA 2HHHE 4WUCA 4DV5I 1Y60A 4B3TE 1D6TA 3J7AM 4BA1B 4JI4I 3DD6A 3JAMC 4KQVA 1OYPA 1UDQA 5JEAC 4DV0I 4JI0E 5LMNE 3K1JA 2WP8A 4M1KA 3B8HA 4Z7YA 1XNRI 5IT9Q 1ZXNA 4FW6A 2E1RA 2JT2A 2IESA 2OI2A 4YY3I 2AJ4A 3L7ZB 3JAMQ 1FNMA 4NXNI 1OYSA 1FWKA 2BM0A 2CG9A 2J7KA 4B3RE 4DV2I 2DEJA 1YHCA 2PO2A 4LF6E 1I94E 3Q1QA 1P42A 2NN6C 4GKKE 1H72C 5FWKA 4B3SE 4P7AA 3H1CA 1XMQE 1K47A 4DR6E 5JEAA 4DXLA 5JEAF 4LF4I 4LF8E 1Z5AA 2PO1B 4DR7E 1MG7A 1U2RA 1DARA 4FWHA 4NXMI 3U1YA 3ZM7A 1Z0WA 3B82A 2GQ0A 2UXCI 1XNQI 4DV1I 2BA0G 2UXDI 4LF9E 3PS3A 1H73A 3P76A 4DPUA 4HYMA 3Q6MA 2BM1A 4NBQA 4DR1E 3LNUA 5C0XE 4OX9I 4IZJB 2IERA 1EI1A 4IZJD 4DV5E 1VISA 2VF3A 4JG4A 3T1YE 2HKJA 4JI4E 2UXBI 2NN6A 2NN6F 4J3DA 4R1FA 3H4LA 2A2CA 1NHHA 2BA1D 4X66I 2V34A 4DV0E 4FWDA 2UUBI 4JI2I 4X64E 4DUZI 2O1WA 1Z5BA 1Z0CA 4DPXA 1J5EI 4IFDC 1RREA 2GO3A 2O3ZA 1XNRE 1B63A 3D4JA 4OZEA 4PRXA 3CWVA 4OO1C 3WU4A 1FJGI 2V2VA 4YY3E 1USVA 1Z5CA 3HKMA 1Z59A 2CVEA 4LFBI 4IFDB 3PS2A 4JI1I 4NXNE 4MDTA 3K85A 4OO1B 4DPWA 4OO1D 2CZ9A 4PU9A 4DV2E 4DV6I 1IBMI 2E5LI 1Y6ZA 2ZITA 4LOMA 5FLXC 5DNXA 5C0XC 2UUAI 1ZM4A 4JI7I 1IBKI 4DR3I 5DRRA 2VQEI 3OTOE 4DR5E 2C37B 4HXZA 4QNJA 1BKNA 4MQYA 4LCGA 1HR0E 2HK2A 4NXME 1Z0BA 2XEXA 1HNXI 1N33I 4DV3E 1XNQE 5BR8I 1YH8A 4DV1E 2ZM6I 3J81Q 5FLXQ 4LCFA 1PIEA 1I94I 4LFAI 4LCHA 4X65I 4LFCI 1KVKA 3HULA 3ZZTA 2LJPA 2C38B 2EFGA 5C0XA 1USUA 5C0XF 4DV7E 2Z5BB 3J80C 4JI6I 4HACB 4X66E 1N32E 4KHPI 2UUBE 3WU3A 3M6AA 5A2QC 2HFSA 3T1HE 4BA1A 2VQFI 4U3BA 4FW3A 4WUBA 1J5EE 4JI3E 1UDOA 2WNRB 1HK7A 4LPFA 3WU6A 4IZKB 2PNZB 4MYUA 1FJGE 4X62E 2R3VA 2V2ZA 4RPFA 4BA2B 1IBLI 4MU0A 4AIMA 4IFDE 2Z5EA 4ED4A 3J80Q 1R6MA 2X36A 2JEBB 5A2QQ 4DV6E 1IBME 1S16A 2E5LE 4OO1E 1UDSA 2UUAE 3L7ZA 4JI7E 4B3MI 3LTOA 1IBKE 4MYTA 4DR3E 5LMUE 4AM3A 3ZZUA 1NZ0A 4YHHI 4LF5I 3PYFA 4K0KE 3GCMA 5K36B 4MU1A 5K36D 1HNXE 2CGEA 2BA0D 1N33E 3K17A 5BR8E 2UU9I 4JV5I 1N34I 4AQYI 4DR2I 2PO1A 5EL9A 4URLA 2HHHI 2PO0B 4B3TI 1PVGA 1N0UA 4X65E 1N36I 4LFCE 1ZM2A 5DRQA 3P3EA 3P3CA 4GKJI 1XHKA 4N3OA 2JE6B 2Z5CB 3WU5A 2C39B 5L3JA 1XMOI 3CDJA 3PYDA 4IZJA 2ZBKB 2V8PA 4JI6E 1ZM3A 4FW5A 4KHPE 4DU7A 1ELOA 1Z0GA 1WUUA 3HJCA 1RHYA 3GONA 1PKPA 1OYRA 3PYEA 2JEAB 2UUCI 1HNWI 2BV3A 2HKEA 1IBLE 2PNLA 3U1KA 4UT4A 1H7UA 4USKA 4B3RI 2GO4A 2BR2B 1KKHA 4LF4E 5IWAI 3ZKDA 4DU8A 3M85G 1N0VC 1OJ4A 2HK3A 4GKKI 4DR4I 2HFUA 4DPYA 3PYGA 4IFDA 4IFDF 1QZRA 1XMQI 4GQUA 4DR6I 2UXCE 4YHHE 3M85D 4OO1A 4OO1F 4DR7I 2UXDE 2VESA 4HY1A 3QT8A 1XXEA 3UHMA 1RR9A 4OX9E 2WP8B 5K36E 5DROA 5GMEA 2UU9E 1FI4A 3V5RA 2C37A 1N34E 4JV5E 3F0NA 4DR2E 2UXBE 4FWGA 4I3HA 3P06A 4DV4I 1N36E 3PRYA 4FW4A 4EMDA 4WUDA 3T1YI 3P3GA 4JI2E 4DUZE 1KIJA 4GKJE 3PS1A 1NHJA 2F4VI 2PNMA 4AIDA 1E3HA 1E3PA 2PO2B 1XMOE 2O1VA 5ELWA 4X64I 4ZVIA 4FW7A 4LFBE 3Q6NA 3M7NG 2O1UA 1Y4UA 2C38A 5JEAD 5JEAB 4JI1E 4PRVA 4ISAA 4U3DA 3B78A 1Z0VA 1KTVA 2Z5BA 1Z0EA 4HACA 4IS9A 3GLLA 3M7ND 2UUCE 1HNWE 4FN5A 4MU4A 5K36C 2VQEE 2WNRA 5LL6R 5IWAE 4DPTA 1Y5YA 4IZKA 4JI5I 2PNZA 3GMEA 4DR4E 4JYAI 3KRNA 4BA2A 1FKAE 1HNZI 2WW4A 1S4EA 3J7AG 3OTOI 4DR5I 3LPSA 2NN6B 4JI8I 2NN6D 2ZM6E 2NPFA 2JEBA 1HR0I 4LF7I 4XTJA
chains in the Genus database with same CATH topology
4DUYI 4LFAE 3QT7A 4DV3I 1NHIA 1Y4SA 1MX0A 2R42A 2V2QA 1H74A 4P52A 2IOQA 3V2UC 4DV4E 1ZM9A 1ZXMA 4JI0I 3QT5A 5LMNI 1H7SA 5GMDA 2F4VE 2VQFE 3ZKBA 4Z7CA 1MU5A 4DV7I 1FWLA 3QT6A 1N32I 1A6FA 1UEKA 3T1HI 2IOPA 2A2DA 4JI3I 4USMA 2DEIA 2Z5CA 2GS8A 4LF6I 1EA6A 4X62I 1B62A 4B3SI 4B3ME 2X7IA 4LF8I 1Z0TA 3J81C 4LF5E 2Q2EB 2O1TA 4JI5E 4FW9A 5LMUI 4JYAE 3ZZ0A 1HNZE 4UTGA 4LF9I 4JI8E 4K0KI 4LF7E 4DR1I 4AQYE 4DUYE 5IT9C 2HHHE 4WUCA 4DV5I 4B3TE 1D6TA 3J7AM 4JI4I 3JAMC 4KQVA 4DV0I 4JI0E 5LMNE 3K1JA 4M1KA 3B8HA 4Z7YA 1XNRI 5IT9Q 1ZXNA 2E1RA 2OI2A 4YY3I 2AJ4A 3JAMQ 1FNMA 4NXNI 1FWKA 2BM0A 2CG9A 2J7KA 4B3RE 4DV2I 2DEJA 4LF6E 1I94E 3Q1QA 4GKKE 1H72C 5FWKA 4B3SE 4P7AA 1XMQE 1K47A 4DR6E 4DXLA 4LF4I 4LF8E 1Z5AA 4DR7E 1MG7A 1U2RA 1DARA 4FWHA 4NXMI 3ZM7A 1Z0WA 3B82A 2GQ0A 2UXCI 1XNQI 4DV1I 2UXDI 4LF9E 1H73A 4DPUA 4HYMA 3Q6MA 2BM1A 4DR1E 3LNUA 4OX9I 4IZJB 1EI1A 4IZJD 4DV5E 1VISA 2VF3A 4JG4A 3T1YE 2HKJA 4JI4E 2UXBI 4R1FA 3H4LA 2A2CA 1NHHA 4X66I 2V34A 4DV0E 4FWDA 2UUBI 4JI2I 4X64E 4DUZI 2O1WA 1Z5BA 1Z0CA 4DPXA 1J5EI 1RREA 1XNRE 1B63A 3D4JA 4PRXA 3CWVA 3WU4A 1FJGI 2V2VA 4YY3E 1USVA 1Z5CA 1Z59A 4LFBI 4JI1I 4NXNE 3K85A 4DPWA 2CZ9A 4PU9A 4DV2E 4DV6I 1IBMI 2E5LI 1Y6ZA 2ZITA 5FLXC 2UUAI 1ZM4A 4JI7I 1IBKI 4DR3I 2VQEI 3OTOE 4DR5E 4HXZA 1BKNA 1HR0E 2HK2A 4NXME 1Z0BA 2XEXA 1HNXI 1N33I 4DV3E 1XNQE 5BR8I 4DV1E 2ZM6I 3J81Q 5FLXQ 1PIEA 1I94I 4LFAI 4X65I 4LFCI 1KVKA 3HULA 3ZZTA 2LJPA 2EFGA 1USUA 4DV7E 2Z5BB 3J80C 4JI6I 4HACB 4X66E 1N32E 4KHPI 2UUBE 3WU3A 3M6AA 5A2QC 2HFSA 3T1HE 2VQFI 4WUBA 1J5EE 4JI3E 1HK7A 3WU6A 4IZKB 4MYUA 1FJGE 4X62E 2R3VA 2V2ZA 4RPFA 1IBLI 2Z5EA 4ED4A 3J80Q 2X36A 5A2QQ 4DV6E 1IBME 1S16A 2E5LE 2UUAE 4JI7E 4B3MI 3LTOA 1IBKE 4MYTA 4DR3E 5LMUE 3ZZUA 1NZ0A 4YHHI 4LF5I 3PYFA 4K0KE 1HNXE 2CGEA 1N33E 3K17A 5BR8E 2UU9I 4JV5I 1N34I 4AQYI 4DR2I 4URLA 2HHHI 4B3TI 1PVGA 1N0UA 4X65E 1N36I 4LFCE 1ZM2A 4GKJI 1XHKA 4N3OA 2Z5CB 3WU5A 5L3JA 1XMOI 3PYDA 4IZJA 2ZBKB 2V8PA 4JI6E 1ZM3A 4KHPE 4DU7A 1ELOA 1Z0GA 1WUUA 3HJCA 3GONA 1PKPA 3PYEA 2UUCI 1HNWI 2BV3A 2HKEA 1IBLE 2PNLA 4UT4A 1H7UA 4USKA 4B3RI 1KKHA 4LF4E 5IWAI 3ZKDA 4DU8A 1N0VC 1OJ4A 2HK3A 4GKKI 4DR4I 2HFUA 4DPYA 3PYGA 1QZRA 1XMQI 4DR6I 2UXCE 4YHHE 4DR7I 2UXDE 4HY1A 3QT8A 1RR9A 4OX9E 5GMEA 2UU9E 1FI4A 3V5RA 4JV5E 1N34E 3F0NA 4DR2E 2UXBE 4FWGA 4I3HA 3P06A 4DV4I 1N36E 3PRYA 4EMDA 4WUDA 3T1YI 4JI2E 4DUZE 1KIJA 4GKJE 1NHJA 2F4VI 2PNMA 1XMOE 2O1VA 4X64I 4ZVIA 4LFBE 3Q6NA 2O1UA 1Y4UA 4JI1E 4PRVA 3B78A 1Z0VA 1KTVA 2Z5BA 1Z0EA 4HACA 2UUCE 1HNWE 4FN5A 2VQEE 5LL6R 5IWAE 4DPTA 4IZKA 4JI5I 4DR4E 4JYAI 1FKAE 1HNZI 2WW4A 1S4EA 3J7AG 3OTOI 4DR5I 3LPSA 4JI8I 2ZM6E 2NPFA 1HR0I 4LF7I 4XTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY I;  4LFA E;  3QT7 A;  4DV3 I;  1NHI A;  1MX0 A;  2R42 A;  2V2Q A;  1H74 A;  4P52 A;  3V2U C;  4DV4 E;  1ZM9 A;  1ZXM A;  4JI0 I;  3QT5 A;  5LMN I;  1H7S A;  5GMD A;  2F4V E;  2VQF E;  3ZKB A;  4Z7C A;  1MU5 A;  4DV7 I;  1FWL A;  3QT6 A;  1N32 I;  1A6F A;  1UEK A;  3T1H I;  2A2D A;  4JI3 I;  4USM A;  2DEI A;  2GS8 A;  4LF6 I;  1EA6 A;  4X62 I;  1B62 A;  4B3S I;  4B3M E;  2X7I A;  4LF8 I;  1Z0T A;  3J81 C;  4LF5 E;  2Q2E B;  4JI5 E;  4FW9 A;  5LMU I;  4JYA E;  3ZZ0 A;  1HNZ E;  4UTG A;  4LF9 I;  4JI8 E;  4K0K I;  4LF7 E;  4DR1 I;  4AQY E;  4DUY E;  5IT9 C;  2HHH E;  4WUC A;  4DV5 I;  4B3T E;  1D6T A;  3J7A M;  4JI4 I;  3JAM C;  4KQV A;  4DV0 I;  4JI0 E;  5LMN E;  3K1J A;  4M1K A;  3B8H A;  4Z7Y A;  1XNR I;  5IT9 Q;  1ZXN A;  2E1R A;  2OI2 A;  4YY3 I;  2AJ4 A;  3JAM Q;  1FNM A;  4NXN I;  1FWK A;  2BM0 A;  2J7K A;  4B3R E;  4DV2 I;  2DEJ A;  4LF6 E;  3Q1Q A;  4GKK E;  1H72 C;  4B3S E;  4P7A A;  1XMQ E;  1K47 A;  4DR6 E;  4DXL A;  4LF4 I;  4LF8 E;  1Z5A A;  4DR7 E;  1MG7 A;  1U2R A;  1DAR A;  4FWH A;  4NXM I;  3ZM7 A;  1Z0W A;  3B82 A;  2UXC I;  1XNQ I;  4DV1 I;  2UXD I;  4LF9 E;  1H73 A;  4DPU A;  4HYM A;  2BM1 A;  4DR1 E;  3LNU A;  4OX9 I;  1EI1 A;  4DV5 E;  1VIS A;  2VF3 A;  4JG4 A;  3T1Y E;  2HKJ A;  4JI4 E;  2UXB I;  4R1F A;  3H4L A;  2A2C A;  1NHH A;  4X66 I;  2V34 A;  4DV0 E;  4FWD A;  2UUB I;  4JI2 I;  4X64 E;  4DUZ I;  1Z5B A;  1Z0C A;  4DPX A;  1J5E I;  1RRE A;  1XNR E;  1B63 A;  3D4J A;  4PRX A;  3CWV A;  3WU4 A;  1FJG I;  2V2V A;  4YY3 E;  1Z5C A;  1Z59 A;  4LFB I;  4JI1 I;  4NXN E;  4DPW A;  2CZ9 A;  4PU9 A;  4DV2 E;  4DV6 I;  1IBM I;  2E5L I;  2ZIT A;  5FLX C;  2UUA I;  1ZM4 A;  4JI7 I;  1IBK I;  4DR3 I;  2VQE I;  3OTO E;  4DR5 E;  4HXZ A;  1BKN A;  1HR0 E;  2HK2 A;  4NXM E;  1Z0B A;  2XEX A;  1HNX I;  1N33 I;  4DV3 E;  1XNQ E;  5BR8 I;  4DV1 E;  2ZM6 I;  3J81 Q;  5FLX Q;  1PIE A;  1I94 I;  4LFA I;  4X65 I;  4LFC I;  1KVK A;  3HUL A;  3ZZT A;  2LJP A;  2EFG A;  4DV7 E;  3J80 C;  4JI6 I;  4HAC B;  4X66 E;  1N32 E;  4KHP I;  2UUB E;  3WU3 A;  3M6A A;  5A2Q C;  2HFS A;  3T1H E;  2VQF I;  4WUB A;  1J5E E;  4JI3 E;  3WU6 A;  4MYU A;  1FJG E;  4X62 E;  2R3V A;  2V2Z A;  4RPF A;  1IBL I;  4ED4 A;  3J80 Q;  2X36 A;  5A2Q Q;  4DV6 E;  1IBM E;  1S16 A;  2E5L E;  2UUA E;  4JI7 E;  4B3M I;  1IBK E;  3LTO A;  4MYT A;  4DR3 E;  5LMU E;  3ZZU A;  1NZ0 A;  4YHH I;  4LF5 I;  3PYF A;  4K0K E;  1HNX E;  1N33 E;  3K17 A;  5BR8 E;  2UU9 I;  4JV5 I;  1N34 I;  4XTJ A;  4AQY I;  4DR2 I;  4URL A;  2HHH I;  4B3T I;  1PVG A;  1N0U A;  4X65 E;  1N36 I;  4LFC E;  1ZM2 A;  4GKJ I;  1XHK A;  3WU5 A;  5L3J A;  1XMO I;  3PYD A;  2ZBK B;  2V8P A;  4JI6 E;  1ZM3 A;  4KHP E;  4DU7 A;  1ELO A;  1Z0G A;  1WUU A;  3GON A;  1PKP A;  3PYE A;  2UUC I;  1HNW I;  2BV3 A;  2HKE A;  1IBL E;  4UT4 A;  1H7U A;  4USK A;  4B3R I;  1KKH A;  4LF4 E;  5IWA I;  3ZKD A;  4DU8 A;  1N0V C;  1OJ4 A;  2HK3 A;  4GKK I;  4DR4 I;  2HFU A;  4DPY A;  3PYG A;  1QZR A;  1XMQ I;  4DR6 I;  2UXC E;  4YHH E;  4DR7 I;  2UXD E;  4HY1 A;  3QT8 A;  1RR9 A;  4OX9 E;  5GME A;  2UU9 E;  1FI4 A;  3V5R A;  4JV5 E;  1N34 E;  3F0N A;  4DR2 E;  2UXB E;  4FWG A;  4I3H A;  4DV4 I;  1N36 E;  4EMD A;  4WUD A;  3T1Y I;  4JI2 E;  4DUZ E;  1KIJ A;  4GKJ E;  1NHJ A;  2F4V I;  1XMO E;  4X64 I;  4ZVI A;  4LFB E;  4JI1 E;  4PRV A;  3B78 A;  1Z0V A;  1KTV A;  1Z0E A;  4HAC A;  2UUC E;  1HNW E;  4FN5 A;  2VQE E;  5LL6 R;  5IWA E;  4DPT A;  4JI5 I;  4DR4 E;  4JYA I;  1FKA E;  1HNZ I;  2WW4 A;  1S4E A;  3J7A G;  3OTO I;  4DR5 I;  3LPS A;  4JI8 I;  2ZM6 E;  2NPF A;  1HR0 I;  4LF7 I;  1I94 E; 
#chains in the Genus database with same CATH topology
 4DUY I;  4LFA E;  3QT7 A;  4DV3 I;  1NHI A;  1Y4S A;  3CDI A;  1MX0 A;  2R42 A;  2V2Q A;  1H74 A;  4P52 A;  2IOQ A;  3V2U C;  4DV4 E;  1ZM9 A;  5K36 A;  5K36 F;  1ZXM A;  4JI0 I;  3QT5 A;  5LMN I;  2BA1 G;  1H7S A;  5GMD A;  2F4V E;  3B4T A;  2VQF E;  3ZKB A;  4Z7C A;  1MU5 A;  4DV7 I;  1FWL A;  3QT6 A;  1N32 I;  2J65 A;  2PO0 A;  5DRP A;  1A6F A;  1UEK A;  3T1H I;  2IOP A;  2A2D A;  3NZK A;  4JI3 I;  4OKG A;  4USM A;  2DEI A;  2JE6 A;  2Z5C A;  1R6L A;  2F1D A;  2GS8 A;  2C39 A;  5JEA E;  4LF6 I;  1EA6 A;  2AE8 A;  4X62 I;  4IFD D;  1B62 A;  4B3S I;  4B3M E;  2X7I A;  4LF8 I;  1Z0T A;  3J81 C;  4LF5 E;  5EKW A;  2Q2E B;  2O1T A;  4JI5 E;  4FW9 A;  2JEA A;  5LMU I;  4JYA E;  3ZZ0 A;  5DNL A;  1HNZ E;  4UTG A;  1VI7 A;  5C0X B;  4LF9 I;  1UDN A;  4JI8 E;  5C0X D;  2BR2 A;  4K0K I;  4MU3 A;  4LF7 E;  4DR1 I;  4AQY E;  4DUY E;  2NN6 E;  5IT9 C;  4QNK A;  2HHH E;  4WUC A;  4DV5 I;  1Y60 A;  4B3T E;  1D6T A;  3J7A M;  4BA1 B;  4JI4 I;  3DD6 A;  3JAM C;  4KQV A;  1OYP A;  1UDQ A;  5JEA C;  4DV0 I;  4JI0 E;  5LMN E;  3K1J A;  2WP8 A;  4M1K A;  3B8H A;  4Z7Y A;  1XNR I;  5IT9 Q;  1ZXN A;  4FW6 A;  2E1R A;  2JT2 A;  2IES A;  2OI2 A;  4YY3 I;  2AJ4 A;  3L7Z B;  3JAM Q;  1FNM A;  4NXN I;  1OYS A;  1FWK A;  2BM0 A;  2CG9 A;  2J7K A;  4B3R E;  4DV2 I;  2DEJ A;  1YHC A;  2PO2 A;  4LF6 E;  1I94 E;  3Q1Q A;  1P42 A;  2NN6 C;  4GKK E;  1H72 C;  5FWK A;  4B3S E;  4P7A A;  3H1C A;  1XMQ E;  1K47 A;  4DR6 E;  5JEA A;  4DXL A;  5JEA F;  4LF4 I;  4LF8 E;  1Z5A A;  2PO1 B;  4DR7 E;  1MG7 A;  1U2R A;  1DAR A;  4FWH A;  4NXM I;  3U1Y A;  3ZM7 A;  1Z0W A;  3B82 A;  2GQ0 A;  2UXC I;  1XNQ I;  4DV1 I;  2BA0 G;  2UXD I;  4LF9 E;  3PS3 A;  1H73 A;  3P76 A;  4DPU A;  4HYM A;  3Q6M A;  2BM1 A;  4NBQ A;  4DR1 E;  3LNU A;  5C0X E;  4OX9 I;  4IZJ B;  2IER A;  1EI1 A;  4IZJ D;  4DV5 E;  1VIS A;  2VF3 A;  4JG4 A;  3T1Y E;  2HKJ A;  4JI4 E;  2UXB I;  2NN6 A;  2NN6 F;  4J3D A;  4R1F A;  3H4L A;  2A2C A;  1NHH A;  2BA1 D;  4X66 I;  2V34 A;  4DV0 E;  4FWD A;  2UUB I;  4JI2 I;  4X64 E;  4DUZ I;  2O1W A;  1Z5B A;  1Z0C A;  4DPX A;  1J5E I;  4IFD C;  1RRE A;  2GO3 A;  2O3Z A;  1XNR E;  1B63 A;  3D4J A;  4OZE A;  4PRX A;  3CWV A;  4OO1 C;  3WU4 A;  1FJG I;  2V2V A;  4YY3 E;  1USV A;  1Z5C A;  3HKM A;  1Z59 A;  2CVE A;  4LFB I;  4IFD B;  3PS2 A;  4JI1 I;  4NXN E;  4MDT A;  3K85 A;  4OO1 B;  4DPW A;  4OO1 D;  2CZ9 A;  4PU9 A;  4DV2 E;  4DV6 I;  1IBM I;  2E5L I;  1Y6Z A;  2ZIT A;  4LOM A;  5FLX C;  5DNX A;  5C0X C;  2UUA I;  1ZM4 A;  4JI7 I;  1IBK I;  4DR3 I;  5DRR A;  2VQE I;  3OTO E;  4DR5 E;  2C37 B;  4HXZ A;  4QNJ A;  1BKN A;  4MQY A;  4LCG A;  1HR0 E;  2HK2 A;  4NXM E;  1Z0B A;  2XEX A;  1HNX I;  1N33 I;  4DV3 E;  1XNQ E;  5BR8 I;  1YH8 A;  4DV1 E;  2ZM6 I;  3J81 Q;  5FLX Q;  4LCF A;  1PIE A;  1I94 I;  4LFA I;  4LCH A;  4X65 I;  4LFC I;  1KVK A;  3HUL A;  3ZZT A;  2LJP A;  2C38 B;  2EFG A;  5C0X A;  1USU A;  5C0X F;  4DV7 E;  2Z5B B;  3J80 C;  4JI6 I;  4HAC B;  4X66 E;  1N32 E;  4KHP I;  2UUB E;  3WU3 A;  3M6A A;  5A2Q C;  2HFS A;  3T1H E;  4BA1 A;  2VQF I;  4U3B A;  4FW3 A;  4WUB A;  1J5E E;  4JI3 E;  1UDO A;  2WNR B;  1HK7 A;  4LPF A;  3WU6 A;  4IZK B;  2PNZ B;  4MYU A;  1FJG E;  4X62 E;  2R3V A;  2V2Z A;  4RPF A;  4BA2 B;  1IBL I;  4MU0 A;  4AIM A;  4IFD E;  2Z5E A;  4ED4 A;  3J80 Q;  1R6M A;  2X36 A;  2JEB B;  5A2Q Q;  4DV6 E;  1IBM E;  1S16 A;  2E5L E;  4OO1 E;  1UDS A;  2UUA E;  3L7Z A;  4JI7 E;  4B3M I;  3LTO A;  1IBK E;  4MYT A;  4DR3 E;  5LMU E;  4AM3 A;  3ZZU A;  1NZ0 A;  4YHH I;  4LF5 I;  3PYF A;  4K0K E;  3GCM A;  5K36 B;  4MU1 A;  5K36 D;  1HNX E;  2CGE A;  2BA0 D;  1N33 E;  3K17 A;  5BR8 E;  2UU9 I;  4JV5 I;  1N34 I;  4AQY I;  4DR2 I;  2PO1 A;  5EL9 A;  4URL A;  2HHH I;  2PO0 B;  4B3T I;  1PVG A;  1N0U A;  4X65 E;  1N36 I;  4LFC E;  1ZM2 A;  5DRQ A;  3P3E A;  3P3C A;  4GKJ I;  1XHK A;  4N3O A;  2JE6 B;  2Z5C B;  3WU5 A;  2C39 B;  5L3J A;  1XMO I;  3CDJ A;  3PYD A;  4IZJ A;  2ZBK B;  2V8P A;  4JI6 E;  1ZM3 A;  4FW5 A;  4KHP E;  4DU7 A;  1ELO A;  1Z0G A;  1WUU A;  3HJC A;  1RHY A;  3GON A;  1PKP A;  1OYR A;  3PYE A;  2JEA B;  2UUC I;  1HNW I;  2BV3 A;  2HKE A;  1IBL E;  2PNL A;  3U1K A;  4UT4 A;  1H7U A;  4USK A;  4B3R I;  2GO4 A;  2BR2 B;  1KKH A;  4LF4 E;  5IWA I;  3ZKD A;  4DU8 A;  3M85 G;  1N0V C;  1OJ4 A;  2HK3 A;  4GKK I;  4DR4 I;  2HFU A;  4DPY A;  3PYG A;  4IFD A;  4IFD F;  1QZR A;  1XMQ I;  4GQU A;  4DR6 I;  2UXC E;  4YHH E;  3M85 D;  4OO1 A;  4OO1 F;  4DR7 I;  2UXD E;  2VES A;  4HY1 A;  3QT8 A;  1XXE A;  3UHM A;  1RR9 A;  4OX9 E;  2WP8 B;  5K36 E;  5DRO A;  5GME A;  2UU9 E;  1FI4 A;  3V5R A;  2C37 A;  1N34 E;  4JV5 E;  3F0N A;  4DR2 E;  2UXB E;  4FWG A;  4I3H A;  3P06 A;  4DV4 I;  1N36 E;  3PRY A;  4FW4 A;  4EMD A;  4WUD A;  3T1Y I;  3P3G A;  4JI2 E;  4DUZ E;  1KIJ A;  4GKJ E;  3PS1 A;  1NHJ A;  2F4V I;  2PNM A;  4AID A;  1E3H A;  1E3P A;  2PO2 B;  1XMO E;  2O1V A;  5ELW A;  4X64 I;  4ZVI A;  4FW7 A;  4LFB E;  3Q6N A;  3M7N G;  2O1U A;  1Y4U A;  2C38 A;  5JEA D;  5JEA B;  4JI1 E;  4PRV A;  4ISA A;  4U3D A;  3B78 A;  1Z0V A;  1KTV A;  2Z5B A;  1Z0E A;  4HAC A;  4IS9 A;  3GLL A;  3M7N D;  2UUC E;  1HNW E;  4FN5 A;  4MU4 A;  5K36 C;  2VQE E;  2WNR A;  5LL6 R;  5IWA E;  4DPT A;  1Y5Y A;  4IZK A;  4JI5 I;  2PNZ A;  3GME A;  4DR4 E;  4JYA I;  3KRN A;  4BA2 A;  1FKA E;  1HNZ I;  2WW4 A;  1S4E A;  3J7A G;  3OTO I;  4DR5 I;  3LPS A;  2NN6 B;  4JI8 I;  2NN6 D;  2ZM6 E;  2NPF A;  2JEB A;  1HR0 I;  4LF7 I;  4XTJ A; 
#chains in the Genus database with same CATH homology
 4DUY I;  4LFA E;  3QT7 A;  4DV3 I;  1NHI A;  1Y4S A;  1MX0 A;  2R42 A;  2V2Q A;  1H74 A;  4P52 A;  2IOQ A;  3V2U C;  4DV4 E;  1ZM9 A;  1ZXM A;  4JI0 I;  3QT5 A;  5LMN I;  1H7S A;  5GMD A;  2F4V E;  2VQF E;  3ZKB A;  4Z7C A;  1MU5 A;  4DV7 I;  1FWL A;  3QT6 A;  1N32 I;  1A6F A;  1UEK A;  3T1H I;  2IOP A;  2A2D A;  4JI3 I;  4USM A;  2DEI A;  2Z5C A;  2GS8 A;  4LF6 I;  1EA6 A;  4X62 I;  1B62 A;  4B3S I;  4B3M E;  2X7I A;  4LF8 I;  1Z0T A;  3J81 C;  4LF5 E;  2Q2E B;  2O1T A;  4JI5 E;  4FW9 A;  5LMU I;  4JYA E;  3ZZ0 A;  1HNZ E;  4UTG A;  4LF9 I;  4JI8 E;  4K0K I;  4LF7 E;  4DR1 I;  4AQY E;  4DUY E;  5IT9 C;  2HHH E;  4WUC A;  4DV5 I;  4B3T E;  1D6T A;  3J7A M;  4JI4 I;  3JAM C;  4KQV A;  4DV0 I;  4JI0 E;  5LMN E;  3K1J A;  4M1K A;  3B8H A;  4Z7Y A;  1XNR I;  5IT9 Q;  1ZXN A;  2E1R A;  2OI2 A;  4YY3 I;  2AJ4 A;  3JAM Q;  1FNM A;  4NXN I;  1FWK A;  2BM0 A;  2CG9 A;  2J7K A;  4B3R E;  4DV2 I;  2DEJ A;  4LF6 E;  1I94 E;  3Q1Q A;  4GKK E;  1H72 C;  5FWK A;  4B3S E;  4P7A A;  1XMQ E;  1K47 A;  4DR6 E;  4DXL A;  4LF4 I;  4LF8 E;  1Z5A A;  4DR7 E;  1MG7 A;  1U2R A;  1DAR A;  4FWH A;  4NXM I;  3ZM7 A;  1Z0W A;  3B82 A;  2GQ0 A;  2UXC I;  1XNQ I;  4DV1 I;  2UXD I;  4LF9 E;  1H73 A;  4DPU A;  4HYM A;  3Q6M A;  2BM1 A;  4DR1 E;  3LNU A;  4OX9 I;  4IZJ B;  1EI1 A;  4IZJ D;  4DV5 E;  1VIS A;  2VF3 A;  4JG4 A;  3T1Y E;  2HKJ A;  4JI4 E;  2UXB I;  4R1F A;  3H4L A;  2A2C A;  1NHH A;  4X66 I;  2V34 A;  4DV0 E;  4FWD A;  2UUB I;  4JI2 I;  4X64 E;  4DUZ I;  2O1W A;  1Z5B A;  1Z0C A;  4DPX A;  1J5E I;  1RRE A;  1XNR E;  1B63 A;  3D4J A;  4PRX A;  3CWV A;  3WU4 A;  1FJG I;  2V2V A;  4YY3 E;  1USV A;  1Z5C A;  1Z59 A;  4LFB I;  4JI1 I;  4NXN E;  3K85 A;  4DPW A;  2CZ9 A;  4PU9 A;  4DV2 E;  4DV6 I;  1IBM I;  2E5L I;  1Y6Z A;  2ZIT A;  5FLX C;  2UUA I;  1ZM4 A;  4JI7 I;  1IBK I;  4DR3 I;  2VQE I;  3OTO E;  4DR5 E;  4HXZ A;  1BKN A;  1HR0 E;  2HK2 A;  4NXM E;  1Z0B A;  2XEX A;  1HNX I;  1N33 I;  4DV3 E;  1XNQ E;  5BR8 I;  4DV1 E;  2ZM6 I;  3J81 Q;  5FLX Q;  1PIE A;  1I94 I;  4LFA I;  4X65 I;  4LFC I;  1KVK A;  3HUL A;  3ZZT A;  2LJP A;  2EFG A;  1USU A;  4DV7 E;  2Z5B B;  3J80 C;  4JI6 I;  4HAC B;  4X66 E;  1N32 E;  4KHP I;  2UUB E;  3WU3 A;  3M6A A;  5A2Q C;  2HFS A;  3T1H E;  2VQF I;  4WUB A;  1J5E E;  4JI3 E;  1HK7 A;  3WU6 A;  4IZK B;  4MYU A;  1FJG E;  4X62 E;  2R3V A;  2V2Z A;  4RPF A;  1IBL I;  2Z5E A;  4ED4 A;  3J80 Q;  2X36 A;  5A2Q Q;  4DV6 E;  1IBM E;  1S16 A;  2E5L E;  2UUA E;  4JI7 E;  4B3M I;  3LTO A;  1IBK E;  4MYT A;  4DR3 E;  5LMU E;  3ZZU A;  1NZ0 A;  4YHH I;  4LF5 I;  3PYF A;  4K0K E;  1HNX E;  2CGE A;  1N33 E;  3K17 A;  5BR8 E;  2UU9 I;  4JV5 I;  1N34 I;  4AQY I;  4DR2 I;  4URL A;  2HHH I;  4B3T I;  1PVG A;  1N0U A;  4X65 E;  1N36 I;  4LFC E;  1ZM2 A;  4GKJ I;  1XHK A;  4N3O A;  2Z5C B;  3WU5 A;  5L3J A;  1XMO I;  3PYD A;  4IZJ A;  2ZBK B;  2V8P A;  4JI6 E;  1ZM3 A;  4KHP E;  4DU7 A;  1ELO A;  1Z0G A;  1WUU A;  3HJC A;  3GON A;  1PKP A;  3PYE A;  2UUC I;  1HNW I;  2BV3 A;  2HKE A;  1IBL E;  2PNL A;  4UT4 A;  1H7U A;  4USK A;  4B3R I;  1KKH A;  4LF4 E;  5IWA I;  3ZKD A;  4DU8 A;  1N0V C;  1OJ4 A;  2HK3 A;  4GKK I;  4DR4 I;  2HFU A;  4DPY A;  3PYG A;  1QZR A;  1XMQ I;  4DR6 I;  2UXC E;  4YHH E;  4DR7 I;  2UXD E;  4HY1 A;  3QT8 A;  1RR9 A;  4OX9 E;  5GME A;  2UU9 E;  1FI4 A;  3V5R A;  4JV5 E;  1N34 E;  3F0N A;  4DR2 E;  2UXB E;  4FWG A;  4I3H A;  3P06 A;  4DV4 I;  1N36 E;  3PRY A;  4EMD A;  4WUD A;  3T1Y I;  4JI2 E;  4DUZ E;  1KIJ A;  4GKJ E;  1NHJ A;  2F4V I;  2PNM A;  1XMO E;  2O1V A;  4X64 I;  4ZVI A;  4LFB E;  3Q6N A;  2O1U A;  1Y4U A;  4JI1 E;  4PRV A;  3B78 A;  1Z0V A;  1KTV A;  2Z5B A;  1Z0E A;  4HAC A;  2UUC E;  1HNW E;  4FN5 A;  2VQE E;  5LL6 R;  5IWA E;  4DPT A;  4IZK A;  4JI5 I;  4DR4 E;  4JYA I;  1FKA E;  1HNZ I;  2WW4 A;  1S4E A;  3J7A G;  3OTO I;  4DR5 I;  3LPS A;  4JI8 I;  2ZM6 E;  2NPF A;  1HR0 I;  4LF7 I;  4XTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...