4X66I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x66I00
1I94I 4JI2I 3JAMC 3T1HE 4KHPI 2HKEA 3WU6A 4HACA 1FKAE 2HFSA 4KQVA 4HY1A 4X62I 3LPSA 1MG7A 1DARA 2ZM6I 2E5LE 1Z5BA 1B62A 4FW9A 2ZBKB 4JI0I 2UUAI 4P52A 4LFAE 3CWVA 3ZKBA 4YHHE 2VQEI 2UUBI 3B8HA 1BKNA 4DPTA 4GKJI 4LFBI 4X66E 1HR0I 1XNRE 2NPFA 4FWHA 2UXCE 1UEKA 4PRVA 5A2QC 4USMA 4LF6E 4DR6I 1PVGA 1HNZE 1Z5AA 2R42A 3K17A 2R3VA 1IBLI 3PYGA 4DV7E 3J80C 4LF8E 2EFGA 1S16A 4JI6E 1H73A 3OTOI 3GONA 3QT7A 4XTJA 2A2CA 2GS8A 4AQYI 3T1YI 2V2ZA 1N34E 4JI4E 4B3RI 1WUUA 5GMEA 1Z0TA 4JG4A 4DUYE 4FWGA 4B3TI 2UUCE 1XMOI 4DV5I 4DR1I 1NHJA 2WW4A 1N36E 4X64I 1MU5A 1QZRA 5LMUE 3ZM7A 5BR8E 2F4VE 1IBME 1Z5CA 2UU9E 3M6AA 4JV5E 4LFAI 1XMQE 4DXLA 1OJ4A 1Z0VA 4DR7I 4GKKI 2AJ4A 2OI2A 4DR3I 3PYFA 2HK2A 5IWAI 4X66I 1XNRI 4FN5A 1HNZI 3F0NA 3WU4A 4DV0E 1ZM9A 4LF4E 1N0VC 2HKJA 4OX9I 5FLXQ 4DPUA 4K0KE 2HFUA 2VQFE 4DV3I 4EMDA 4JI1E 2VF3A 1Z0WA 1U2RA 4LF9E 5IT9Q 4UTGA 3QT6A 1J5EI 4FWDA 1XNQE 2UXBI 2J7KA 5LMUI 4JI8I 2F4VI 2A2DA 1NHIA 2HHHI 4B3SE 3LTOA 1HNXE 4LF7I 4NXME 4DR2E 4I3HA 4JYAE 4DV1I 1HNWI 2CZ9A 1FWLA 3K1JA 1FJGE 4X65E 1N32E 4DV6I 2DEJA 2V34A 5FLXC 4PRXA 4B3ME 4YY3E 4LF4I 2Q2EB 1Z0EA 2BM0A 1N0UA 1ELOA 3ZZ0A 3V2UC 1IBKI 1H74A 4K0KI 1N33E 4JI1I 2UXDI 1ZXMA 4LFCE 1Z0CA 3LNUA 3QT5A 3T1HI 5LL6R 4PU9A 4JI3E 4LF9I 4USKA 4DUZE 1NZ0A 4P7AA 3J7AG 1K47A 2E5LI 1I94E 4JI2E 4KHPE 4MYTA 1PKPA 4YHHI 1PIEA 2ZM6E 2E1RA 1RR9A 5LMNE 1MX0A 3J81Q 1KVKA 4NXMI 2DEIA 1ZM2A 2UUAE 4DR2I 4DU7A 4DR4E 2UXCI 4LF6I 1KKHA 2VQEE 2UUBE 3QT8A 3B82A 4DV7I 4GKJE 4LFBE 2HK3A 1HR0E 4DPYA 4LF8I 4JI6I 4DV4E 3HULA 1Z0GA 1ZXNA 2V2VA 1IBLE 3WU5A 1N34I 3H4LA 4JI4I 1H7SA 3OTOE 3WU3A 4DUYI 5GMDA 2UUCI 3T1YE 1S4EA 4DUZI 4WUCA 1Z59A 4DV2E 4B3RE 1N36I 4JI5E 5BR8I 4NXNE 1IBMI 4B3TE 4DPXA 2UU9I 1XMOE 4DV5E 4JV5I 3J81C 4DR1E 1XMQI 1NHHA 2BM1A 4HACB 4DR5E 4Z7CA 4X64E 3PYEA 5LMNI 2BV3A 3PYDA 1ZM3A 2LJPA 4ED4A 4Z7YA 4DR4I 4DR7E 4GKKE 4DR3E 1A6FA 4WUBA 4DU8A 5IWAE 4RPFA 1EA6A 4DV0I 2X7IA 4LF5E 1EI1A 4DPWA 2VQFI 4DV4I 4URLA 5IT9C 4HXZA 1FI4A 3J7AM 4OX9E 4DV3E 2ZITA 4JI7E 2V2QA 1XNQI 4DV2I 4JI5I 2V8PA 4M1KA 4NXNI 4X62E 4B3SI 3JAMQ 1J5EE 1HNXI 3V5RA 3ZZTA 2UXBE 4MYUA 2X36A 4DR5I 1XHKA 4JI0E 4JI8E 1KTVA 4JYAI 1KIJA 1RREA 2HHHE 4R1FA 1FJGI 4X65I 1N32I 1D6TA 4WUDA 1B63A 4LF7E 5L3JA 4B3MI 4YY3I 3ZKDA 4ZVIA 3ZZUA 4LF5I 4DV1E 1HNWE 4DR6E 4DV6E 3B78A 1FNMA 2XEXA 1ZM4A 1N33I 5A2QQ 1VISA 4LFCI 1FWKA 4AQYE 1H72C 4UT4A 4JI3I 1Z0BA 3J80Q 1IBKE 1H7UA 4HYMA 3D4JA 2UXDE 4JI7I 3Q1QA
chains in the Genus database with same CATH superfamily
1I94I 4JI2I 1XXEA 5ELWA 3JAMC 3T1HE 4KHPI 2HKEA 3WU6A 4HACA 4FW5A 4NBQA 2BA1D 1FKAE 4MDTA 2HFSA 4KQVA 1P42A 4HY1A 2Z5CA 2VESA 4X62I 3HKMA 3LPSA 1MG7A 1DARA 2ZM6I 5DRPA 2E5LE 2BR2B 1Z5BA 1B62A 4AM3A 5K36F 1RHYA 2IESA 4FW9A 4MU4A 2JEAA 2ZBKB 4N3OA 4JI0I 2UUAI 4P52A 4LFAE 3CWVA 4FW4A 2JEBA 3ZKBA 4MU1A 4YHHE 2VQEI 2UUBI 3B8HA 1BKNA 2C39B 4DPTA 4GKJI 4LFBI 5K36B 4X66E 1HR0I 1XNRE 2NPFA 4FWHA 2UXCE 1UEKA 4PRVA 5A2QC 4USMA 4LF6E 4DR6I 1PVGA 1UDNA 1HNZE 3GCMA 1Z5AA 2R42A 4BA1B 3K17A 2R3VA 1IBLI 3PYGA 4DV7E 3J80C 4AIDA 4IZJB 4LF8E 1S16A 2EFGA 4JI6E 1H73A 3GONA 3QT7A 4OKGA 4XTJA 3OTOI 2A2CA 2GS8A 4AQYI 2AE8A 3T1YI 4IFDB 2BA0D 4AIMA 2C37A 2CVEA 2PO2A 2V2ZA 2IOPA 1N34E 4JI4E 4B3RI 4OZEA 1WUUA 4LCHA 2GO4A 5C0XC 5DRRA 5GMEA 1Z0TA 4JG4A 4DUYE 4FWGA 4B3TI 2UUCE 4LOMA 1XMOI 4DV5I 4DR1I 1NHJA 2WW4A 2Z5BB 4X64I 1N36E 1MU5A 1QZRA 5LMUE 3ZM7A 5BR8E 2PNMA 2F4VE 1IBME 2PO0B 3K85A 3PS3A 1Z5CA 5K36E 3U1YA 2UU9E 3M6AA 4JV5E 4LFAI 1XMQE 4DXLA 1OJ4A 1Z0VA 4DR7I 4GKKI 2AJ4A 2OI2A 4DR3I 3PYFA 2HK2A 5IWAI 3M7ND 2JE6A 4X66I 1XNRI 1UDQA 4FN5A 3P3EA 5K36D 2PNZA 2NN6B 1HNZI 3F0NA 4IFDE 3Q6MA 3WU4A 4DV0E 1ZM9A 4LF4E 4LCGA 1N0VC 2HKJA 3CDJA 4OX9I 5FLXQ 4OO1E 4DPUA 3GLLA 4K0KE 2HFUA 2VQFE 4DV3I 4IZJD 4EMDA 2O1WA 1OYSA 4JI1E 2VF3A 4BA2B 1Z0WA 1U2RA 1E3PA 4MQYA 4LF9E 2BR2A 5IT9Q 4UTGA 1YH8A 3QT6A 3H1CA 1J5EI 4FWDA 1XNQE 3M85D 5JEAB 2UXBI 2J7KA 1Y5YA 5LMUI 4JI8I 2O1UA 2F4VI 2C39A 2A2DA 5K36A 2BA1G 1NHIA 2HHHI 4B3SE 3PRYA 3LTOA 1HNXE 2WP8B 4LF7I 4NXME 2NN6E 5DRQA 2CG9A 4DR2E 4BA1A 4I3HA 4JYAE 4DV1I 4IFDF 2CZ9A 1HNWI 2PNLA 4IZJA 1FWLA 3K1JA 1FJGE 4X65E 1N32E 4DV6I 2DEJA 2V34A 4OO1F 5FLXC 5DNLA 4FW7A 4PRXA 4IFDA 4B3ME 3Q6NA 4YY3E 5DNXA 4MU0A 3P06A 4LF4I 2Q2EB 3PS1A 1Z0EA 4IS9A 2BM0A 1N0UA 1OYPA 1ELOA 3ZZ0A 3V2UC 1IBKI 4LPFA 1USUA 3KRNA 1H74A 1R6MA 4K0KI 4IZKB 4OO1B 1N33E 3P3GA 4JI1I 2UXDI 1ZXMA 4LFCE 1Z0CA 3LNUA 3U1KA 3QT5A 3T1HI 5LL6R 4PU9A 5JEAE 4JI3E 2Z5BA 4GQUA 4LF9I 4FW6A 2PO0A 3L7ZB 4USKA 4DUZE 1NZ0A 2BA0G 4P7AA 3J7AG 3GMEA 1K47A 2E5LI 1I94E 4JI2E 4KHPE 4MYTA 4QNJA 1PKPA 2NN6F 5EKWA 4YHHI 4QNKA 1PIEA 2ZM6E 2E1RA 1RR9A 5LMNE 1MX0A 3J81Q 2O1VA 1KVKA 2NN6A 2IERA 4NXMI 2DEIA 1ZM2A 2UUAE 4DR2I 2PO1B 4DU7A 4DR4E 2UXCI 4LF6I 3P3CA 1KKHA 2VQEE 2UUBE 3QT8A 3B82A 4J3DA 4DV7I 4GKJE 2O1TA 5C0XF 4LFBE 2HK3A 1HR0E 5K36C 3HJCA 3NZKA 4DPYA 1VI7A 4LF8I 1HK7A 4JI6I 4BA2A 4U3BA 4DV4E 3HULA 1Z0GA 2GQ0A 1ZXNA 2V2VA 5JEAF 1IBLE 4LCFA 3WU5A 1N34I 3H4LA 4IFDD 4JI4I 1H7SA 5C0XB 3OTOE 3WU3A 5JEAA 4DUYI 5GMDA 4OO1D 2UUCI 3T1YE 2O3ZA 4IFDC 3DD6A 1S4EA 2C38B 4DUZI 4WUCA 5DROA 4OO1C 1Z59A 4DV2E 4B3RE 1N36I 4JI5E 2WP8A 5BR8I 4NXNE 1IBMI 2GO3A 4DPXA 2WNRB 4B3TE 2UU9I 3UHMA 4DV5E 1XMOE 3J81C 4JV5I 4DR1E 1XMQI 1NHHA 1Y6ZA 1Y4UA 2BM1A 4HACB 4DR5E 1UDSA 4Z7CA 4X64E 4FW3A 3PYEA 3M85G 5LMNI 5FWKA 2BV3A 2Z5CB 3PYDA 1ZM3A 2LJPA 4ED4A 4Z7YA 4DR4I 4DR7E 4GKKE 4DR3E 1A6FA 2JEAB 2J65A 4WUBA 2Z5EA 4DU8A 5IWAE 4RPFA 1EA6A 4DV0I 2X7IA 4U3DA 2JEBB 4LF5E 4IZKA 2NN6D 4OO1A 5C0XE 1EI1A 4DPWA 2VQFI 4DV4I 4URLA 2NN6C 5IT9C 3L7ZA 4HXZA 1OYRA 1FI4A 3J7AM 4OX9E 4DV3E 5C0XD 2ZITA 5EL9A 2F1DA 4JI7E 1YHCA 2V2QA 2JT2A 3B4TA 1XNQI 4DV2I 4JI5I 2V8PA 4M1KA 2C37B 2PO2B 4NXNI 3P76A 5JEAD 4X62E 4B3SI 3JAMQ 2PO1A 1J5EE 1USVA 1HNXI 4ISAA 3PS2A 3V5RA 3ZZTA 2UXBE 4MYUA 2X36A 5JEAC 4DR5I 1UDOA 1XHKA 4JI0E 4JI8E 1KTVA 4JYAI 1KIJA 1R6LA 1Y60A 1RREA 2HHHE 4R1FA 1FJGI 4X65I 1N32I 1D6TA 4WUDA 1Y4SA 1B63A 4LF7E 2CGEA 5L3JA 3M7NG 4B3MI 4YY3I 3ZKDA 4ZVIA 3ZZUA 4LF5I 4DV1E 1HNWE 1E3HA 4DR6E 5C0XA 4DV6E 3B78A 3CDIA 1FNMA 2XEXA 2IOQA 1ZM4A 2JE6B 1N33I 5A2QQ 1VISA 4LFCI 1FWKA 2C38A 4AQYE 1H72C 4UT4A 2PNZB 4JI3I 1Z0BA 3J80Q 1IBKE 2WNRA 1H7UA 4HYMA 3D4JA 2UXDE 4JI7I 3Q1QA 4MU3A
chains in the Genus database with same CATH topology
1I94I 4JI2I 3JAMC 3T1HE 4KHPI 2HKEA 3WU6A 4HACA 1FKAE 2HFSA 4KQVA 4HY1A 2Z5CA 4X62I 3LPSA 1MG7A 1DARA 2ZM6I 2E5LE 1Z5BA 1B62A 4FW9A 2ZBKB 4N3OA 4JI0I 2UUAI 4P52A 4LFAE 3CWVA 3ZKBA 4YHHE 2VQEI 2UUBI 3B8HA 1BKNA 4DPTA 4GKJI 4LFBI 4X66E 1HR0I 1XNRE 2NPFA 4FWHA 2UXCE 1UEKA 4PRVA 5A2QC 4USMA 4LF6E 4DR6I 1PVGA 1HNZE 1Z5AA 2R42A 3K17A 2R3VA 1IBLI 3PYGA 4DV7E 3J80C 4IZJB 4LF8E 1S16A 2EFGA 4JI6E 1H73A 3OTOI 3GONA 3QT7A 4XTJA 2A2CA 2GS8A 4AQYI 3T1YI 2V2ZA 2IOPA 1N34E 4JI4E 4B3RI 1WUUA 5GMEA 1Z0TA 4JG4A 4DUYE 4FWGA 4B3TI 2UUCE 1XMOI 4DV5I 4DR1I 1NHJA 2WW4A 2Z5BB 1N36E 4X64I 1MU5A 5LMUE 1QZRA 3ZM7A 5BR8E 2PNMA 2F4VE 1IBME 3K85A 1Z5CA 2UU9E 3M6AA 4JV5E 4LFAI 1XMQE 4DXLA 1OJ4A 1Z0VA 4DR7I 4GKKI 2AJ4A 2OI2A 4DR3I 3PYFA 2HK2A 5IWAI 4X66I 1XNRI 4FN5A 1HNZI 3F0NA 3Q6MA 3WU4A 4DV0E 1ZM9A 4LF4E 1N0VC 2HKJA 4OX9I 5FLXQ 4DPUA 4K0KE 2HFUA 2VQFE 4DV3I 4IZJD 4EMDA 2O1WA 4JI1E 2VF3A 1Z0WA 1U2RA 4LF9E 5IT9Q 4UTGA 3QT6A 1J5EI 4FWDA 1XNQE 2UXBI 2J7KA 5LMUI 4JI8I 2O1UA 2F4VI 2A2DA 1NHIA 2HHHI 4B3SE 3PRYA 3LTOA 1HNXE 4LF7I 4NXME 2CG9A 4DR2E 4I3HA 4JYAE 4DV1I 1HNWI 2CZ9A 2PNLA 4IZJA 1FWLA 3K1JA 1FJGE 4X65E 1N32E 4DV6I 2DEJA 2V34A 5FLXC 4PRXA 4B3ME 3Q6NA 4YY3E 3P06A 4LF4I 2Q2EB 1Z0EA 2BM0A 1N0UA 1ELOA 3ZZ0A 3V2UC 1IBKI 1USUA 1H74A 4K0KI 4IZKB 1N33E 4JI1I 2UXDI 1ZXMA 4LFCE 1Z0CA 3LNUA 3QT5A 3T1HI 5LL6R 4PU9A 4JI3E 2Z5BA 4LF9I 4USKA 4DUZE 1NZ0A 4P7AA 3J7AG 1K47A 2E5LI 1I94E 4JI2E 4KHPE 4MYTA 1PKPA 4YHHI 1PIEA 2ZM6E 2E1RA 1RR9A 5LMNE 1MX0A 3J81Q 2O1VA 1KVKA 4NXMI 2DEIA 1ZM2A 2UUAE 4DR2I 4DU7A 4DR4E 2UXCI 4LF6I 1KKHA 2VQEE 2UUBE 3QT8A 3B82A 4DV7I 4GKJE 2O1TA 4LFBE 2HK3A 1HR0E 3HJCA 4DPYA 4LF8I 1HK7A 4JI6I 4DV4E 3HULA 1Z0GA 2GQ0A 1ZXNA 2V2VA 1IBLE 3WU5A 1N34I 3H4LA 4JI4I 1H7SA 3OTOE 3WU3A 4DUYI 5GMDA 2UUCI 3T1YE 1S4EA 4DUZI 4WUCA 1Z59A 4DV2E 4B3RE 1N36I 4JI5E 5BR8I 4NXNE 1IBMI 4B3TE 4DPXA 2UU9I 1XMOE 4DV5E 4JV5I 3J81C 4DR1E 1XMQI 1NHHA 1Y6ZA 1Y4UA 2BM1A 4HACB 4DR5E 4Z7CA 4X64E 3PYEA 5LMNI 5FWKA 2BV3A 2Z5CB 3PYDA 1ZM3A 2LJPA 4ED4A 4Z7YA 4DR4I 4DR7E 4GKKE 4DR3E 1A6FA 4WUBA 2Z5EA 4DU8A 5IWAE 4RPFA 1EA6A 4DV0I 2X7IA 4LF5E 4IZKA 1EI1A 4DPWA 2VQFI 4DV4I 4URLA 5IT9C 4HXZA 1FI4A 3J7AM 4OX9E 4DV3E 2ZITA 4JI7E 2V2QA 1XNQI 4DV2I 4JI5I 2V8PA 4M1KA 4NXNI 4X62E 4B3SI 3JAMQ 1J5EE 1USVA 1HNXI 3V5RA 3ZZTA 2UXBE 4MYUA 2X36A 4DR5I 1XHKA 4JI0E 4JI8E 1KTVA 4JYAI 1KIJA 1RREA 2HHHE 4R1FA 1FJGI 4X65I 1N32I 1D6TA 4WUDA 1Y4SA 1B63A 4LF7E 2CGEA 5L3JA 4B3MI 4YY3I 3ZKDA 4ZVIA 3ZZUA 4LF5I 4DV1E 1HNWE 4DR6E 4DV6E 3B78A 1FNMA 2XEXA 2IOQA 1ZM4A 1N33I 5A2QQ 1VISA 4LFCI 1FWKA 4AQYE 1H72C 4UT4A 4JI3I 1Z0BA 3J80Q 1IBKE 1H7UA 4HYMA 3D4JA 2UXDE 4JI7I 3Q1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 I;  4JI2 I;  3JAM C;  3T1H E;  4KHP I;  2HKE A;  3WU6 A;  4HAC A;  1FKA E;  2HFS A;  4KQV A;  4HY1 A;  4X62 I;  3LPS A;  1MG7 A;  1DAR A;  2ZM6 I;  2E5L E;  1Z5B A;  1B62 A;  4FW9 A;  2ZBK B;  4JI0 I;  2UUA I;  4P52 A;  4LFA E;  3CWV A;  3ZKB A;  4YHH E;  2VQE I;  2UUB I;  3B8H A;  1BKN A;  4DPT A;  4GKJ I;  4LFB I;  4X66 E;  1HR0 I;  1XNR E;  2NPF A;  4FWH A;  2UXC E;  1UEK A;  4PRV A;  5A2Q C;  4USM A;  4LF6 E;  4DR6 I;  1PVG A;  1HNZ E;  1Z5A A;  2R42 A;  3K17 A;  2R3V A;  1IBL I;  3PYG A;  4DV7 E;  3J80 C;  4LF8 E;  2EFG A;  1S16 A;  4JI6 E;  1H73 A;  3OTO I;  3GON A;  3QT7 A;  4XTJ A;  2A2C A;  2GS8 A;  4AQY I;  3T1Y I;  2V2Z A;  1N34 E;  4JI4 E;  4B3R I;  1WUU A;  5GME A;  1Z0T A;  4JG4 A;  4DUY E;  4FWG A;  4B3T I;  2UUC E;  1XMO I;  4DV5 I;  4DR1 I;  1NHJ A;  2WW4 A;  1N36 E;  4X64 I;  1MU5 A;  1QZR A;  5LMU E;  3ZM7 A;  5BR8 E;  2F4V E;  1IBM E;  1Z5C A;  2UU9 E;  3M6A A;  4JV5 E;  4LFA I;  1XMQ E;  4DXL A;  1OJ4 A;  1Z0V A;  4DR7 I;  4GKK I;  2AJ4 A;  2OI2 A;  4DR3 I;  3PYF A;  2HK2 A;  5IWA I;  4X66 I;  1XNR I;  4FN5 A;  1HNZ I;  3F0N A;  3WU4 A;  4DV0 E;  1ZM9 A;  4LF4 E;  1N0V C;  2HKJ A;  4OX9 I;  5FLX Q;  4DPU A;  4K0K E;  2HFU A;  2VQF E;  4DV3 I;  4EMD A;  4JI1 E;  2VF3 A;  1Z0W A;  1U2R A;  4LF9 E;  5IT9 Q;  4UTG A;  3QT6 A;  1J5E I;  4FWD A;  1XNQ E;  2UXB I;  2J7K A;  5LMU I;  4JI8 I;  2F4V I;  2A2D A;  1NHI A;  2HHH I;  4B3S E;  3LTO A;  1HNX E;  4LF7 I;  4NXM E;  4DR2 E;  4I3H A;  4JYA E;  4DV1 I;  1HNW I;  2CZ9 A;  1FWL A;  3K1J A;  1FJG E;  4X65 E;  1N32 E;  4DV6 I;  2DEJ A;  2V34 A;  5FLX C;  4PRX A;  4B3M E;  4YY3 E;  4LF4 I;  2Q2E B;  1Z0E A;  2BM0 A;  1N0U A;  1ELO A;  3ZZ0 A;  3V2U C;  1IBK I;  1H74 A;  4K0K I;  1N33 E;  4JI1 I;  2UXD I;  1ZXM A;  4LFC E;  1Z0C A;  3LNU A;  3QT5 A;  3T1H I;  5LL6 R;  4PU9 A;  4JI3 E;  4LF9 I;  4USK A;  4DUZ E;  1NZ0 A;  4P7A A;  3J7A G;  1K47 A;  2E5L I;  1I94 E;  4JI2 E;  4KHP E;  4MYT A;  1PKP A;  4YHH I;  1PIE A;  2ZM6 E;  2E1R A;  1RR9 A;  5LMN E;  1MX0 A;  3J81 Q;  1KVK A;  4NXM I;  2DEI A;  1ZM2 A;  2UUA E;  4DR2 I;  4DU7 A;  4DR4 E;  2UXC I;  4LF6 I;  1KKH A;  2VQE E;  2UUB E;  3QT8 A;  3B82 A;  4DV7 I;  4GKJ E;  4LFB E;  2HK3 A;  1HR0 E;  4DPY A;  4LF8 I;  4JI6 I;  4DV4 E;  3HUL A;  1Z0G A;  1ZXN A;  2V2V A;  1IBL E;  3WU5 A;  1N34 I;  3H4L A;  4JI4 I;  1H7S A;  3OTO E;  3WU3 A;  4DUY I;  5GMD A;  2UUC I;  3T1Y E;  1S4E A;  4DUZ I;  4WUC A;  1Z59 A;  4DV2 E;  4B3R E;  1N36 I;  4JI5 E;  5BR8 I;  4NXN E;  1IBM I;  4B3T E;  4DPX A;  2UU9 I;  1XMO E;  4DV5 E;  4JV5 I;  3J81 C;  4DR1 E;  1XMQ I;  1NHH A;  2BM1 A;  4HAC B;  4DR5 E;  4Z7C A;  4X64 E;  3PYE A;  5LMN I;  2BV3 A;  3PYD A;  1ZM3 A;  2LJP A;  4ED4 A;  4Z7Y A;  4DR4 I;  4DR7 E;  4GKK E;  4DR3 E;  1A6F A;  4WUB A;  4DU8 A;  5IWA E;  4RPF A;  1EA6 A;  4DV0 I;  2X7I A;  4LF5 E;  1EI1 A;  4DPW A;  2VQF I;  4DV4 I;  4URL A;  5IT9 C;  4HXZ A;  1FI4 A;  3J7A M;  4OX9 E;  4DV3 E;  2ZIT A;  4JI7 E;  2V2Q A;  1XNQ I;  4DV2 I;  4JI5 I;  2V8P A;  4M1K A;  4NXN I;  4X62 E;  4B3S I;  3JAM Q;  1J5E E;  1HNX I;  3V5R A;  3ZZT A;  2UXB E;  4MYU A;  2X36 A;  4DR5 I;  1XHK A;  4JI0 E;  4JI8 E;  1KTV A;  4JYA I;  1KIJ A;  1RRE A;  2HHH E;  4R1F A;  1FJG I;  4X65 I;  1N32 I;  1D6T A;  4WUD A;  1B63 A;  4LF7 E;  5L3J A;  4B3M I;  4YY3 I;  3ZKD A;  4ZVI A;  3ZZU A;  4LF5 I;  4DV1 E;  1HNW E;  4DR6 E;  4DV6 E;  3B78 A;  1FNM A;  2XEX A;  1ZM4 A;  1N33 I;  5A2Q Q;  1VIS A;  4LFC I;  1FWK A;  4AQY E;  1H72 C;  4UT4 A;  4JI3 I;  1Z0B A;  3J80 Q;  1IBK E;  1H7U A;  4HYM A;  3D4J A;  2UXD E;  4JI7 I;  3Q1Q A; 
#chains in the Genus database with same CATH topology
 1I94 I;  4JI2 I;  1XXE A;  5ELW A;  3JAM C;  3T1H E;  4KHP I;  2HKE A;  3WU6 A;  4HAC A;  4FW5 A;  4NBQ A;  2BA1 D;  1FKA E;  4MDT A;  2HFS A;  4KQV A;  1P42 A;  4HY1 A;  2Z5C A;  2VES A;  4X62 I;  3HKM A;  3LPS A;  1MG7 A;  1DAR A;  2ZM6 I;  5DRP A;  2E5L E;  2BR2 B;  1Z5B A;  1B62 A;  4AM3 A;  5K36 F;  1RHY A;  2IES A;  4FW9 A;  4MU4 A;  2JEA A;  2ZBK B;  4N3O A;  4JI0 I;  2UUA I;  4P52 A;  4LFA E;  3CWV A;  4FW4 A;  2JEB A;  3ZKB A;  4MU1 A;  4YHH E;  2VQE I;  2UUB I;  3B8H A;  1BKN A;  2C39 B;  4DPT A;  4GKJ I;  4LFB I;  5K36 B;  4X66 E;  1HR0 I;  1XNR E;  2NPF A;  4FWH A;  2UXC E;  1UEK A;  4PRV A;  5A2Q C;  4USM A;  4LF6 E;  4DR6 I;  1PVG A;  1UDN A;  1HNZ E;  3GCM A;  1Z5A A;  2R42 A;  4BA1 B;  3K17 A;  2R3V A;  1IBL I;  3PYG A;  4DV7 E;  3J80 C;  4AID A;  4IZJ B;  4LF8 E;  1S16 A;  2EFG A;  4JI6 E;  1H73 A;  3GON A;  3QT7 A;  4OKG A;  4XTJ A;  3OTO I;  2A2C A;  2GS8 A;  4AQY I;  2AE8 A;  3T1Y I;  4IFD B;  2BA0 D;  4AIM A;  2C37 A;  2CVE A;  2PO2 A;  2V2Z A;  2IOP A;  1N34 E;  4JI4 E;  4B3R I;  4OZE A;  1WUU A;  4LCH A;  2GO4 A;  5C0X C;  5DRR A;  5GME A;  1Z0T A;  4JG4 A;  4DUY E;  4FWG A;  4B3T I;  2UUC E;  4LOM A;  1XMO I;  4DV5 I;  4DR1 I;  1NHJ A;  2WW4 A;  2Z5B B;  4X64 I;  1N36 E;  1MU5 A;  1QZR A;  5LMU E;  3ZM7 A;  5BR8 E;  2PNM A;  2F4V E;  1IBM E;  2PO0 B;  3K85 A;  3PS3 A;  1Z5C A;  5K36 E;  3U1Y A;  2UU9 E;  3M6A A;  4JV5 E;  4LFA I;  1XMQ E;  4DXL A;  1OJ4 A;  1Z0V A;  4DR7 I;  4GKK I;  2AJ4 A;  2OI2 A;  4DR3 I;  3PYF A;  2HK2 A;  5IWA I;  3M7N D;  2JE6 A;  4X66 I;  1XNR I;  1UDQ A;  4FN5 A;  3P3E A;  5K36 D;  2PNZ A;  2NN6 B;  1HNZ I;  3F0N A;  4IFD E;  3Q6M A;  3WU4 A;  4DV0 E;  1ZM9 A;  4LF4 E;  4LCG A;  1N0V C;  2HKJ A;  3CDJ A;  4OX9 I;  5FLX Q;  4OO1 E;  4DPU A;  3GLL A;  4K0K E;  2HFU A;  2VQF E;  4DV3 I;  4IZJ D;  4EMD A;  2O1W A;  1OYS A;  4JI1 E;  2VF3 A;  4BA2 B;  1Z0W A;  1U2R A;  1E3P A;  4MQY A;  4LF9 E;  2BR2 A;  5IT9 Q;  4UTG A;  1YH8 A;  3QT6 A;  3H1C A;  1J5E I;  4FWD A;  1XNQ E;  3M85 D;  5JEA B;  2UXB I;  2J7K A;  1Y5Y A;  5LMU I;  4JI8 I;  2O1U A;  2F4V I;  2C39 A;  2A2D A;  5K36 A;  2BA1 G;  1NHI A;  2HHH I;  4B3S E;  3PRY A;  3LTO A;  1HNX E;  2WP8 B;  4LF7 I;  4NXM E;  2NN6 E;  5DRQ A;  2CG9 A;  4DR2 E;  4BA1 A;  4I3H A;  4JYA E;  4DV1 I;  4IFD F;  2CZ9 A;  1HNW I;  2PNL A;  4IZJ A;  1FWL A;  3K1J A;  1FJG E;  4X65 E;  1N32 E;  4DV6 I;  2DEJ A;  2V34 A;  4OO1 F;  5FLX C;  5DNL A;  4FW7 A;  4PRX A;  4IFD A;  4B3M E;  3Q6N A;  4YY3 E;  5DNX A;  4MU0 A;  3P06 A;  4LF4 I;  2Q2E B;  3PS1 A;  1Z0E A;  4IS9 A;  2BM0 A;  1N0U A;  1OYP A;  1ELO A;  3ZZ0 A;  3V2U C;  1IBK I;  4LPF A;  1USU A;  3KRN A;  1H74 A;  1R6M A;  4K0K I;  4IZK B;  4OO1 B;  1N33 E;  3P3G A;  4JI1 I;  2UXD I;  1ZXM A;  4LFC E;  1Z0C A;  3LNU A;  3U1K A;  3QT5 A;  3T1H I;  5LL6 R;  4PU9 A;  5JEA E;  4JI3 E;  2Z5B A;  4GQU A;  4LF9 I;  4FW6 A;  2PO0 A;  3L7Z B;  4USK A;  4DUZ E;  1NZ0 A;  2BA0 G;  4P7A A;  3J7A G;  3GME A;  1K47 A;  2E5L I;  1I94 E;  4JI2 E;  4KHP E;  4MYT A;  4QNJ A;  1PKP A;  2NN6 F;  5EKW A;  4YHH I;  4QNK A;  1PIE A;  2ZM6 E;  2E1R A;  1RR9 A;  5LMN E;  1MX0 A;  3J81 Q;  2O1V A;  1KVK A;  2NN6 A;  2IER A;  4NXM I;  2DEI A;  1ZM2 A;  2UUA E;  4DR2 I;  2PO1 B;  4DU7 A;  4DR4 E;  2UXC I;  4LF6 I;  3P3C A;  1KKH A;  2VQE E;  2UUB E;  3QT8 A;  3B82 A;  4J3D A;  4DV7 I;  4GKJ E;  2O1T A;  5C0X F;  4LFB E;  2HK3 A;  1HR0 E;  5K36 C;  3HJC A;  3NZK A;  4DPY A;  1VI7 A;  4LF8 I;  1HK7 A;  4JI6 I;  4BA2 A;  4U3B A;  4DV4 E;  3HUL A;  1Z0G A;  2GQ0 A;  1ZXN A;  2V2V A;  5JEA F;  1IBL E;  4LCF A;  3WU5 A;  1N34 I;  3H4L A;  4IFD D;  4JI4 I;  1H7S A;  5C0X B;  3OTO E;  3WU3 A;  5JEA A;  4DUY I;  5GMD A;  4OO1 D;  2UUC I;  3T1Y E;  2O3Z A;  4IFD C;  3DD6 A;  1S4E A;  2C38 B;  4DUZ I;  4WUC A;  5DRO A;  4OO1 C;  1Z59 A;  4DV2 E;  4B3R E;  1N36 I;  4JI5 E;  2WP8 A;  5BR8 I;  4NXN E;  1IBM I;  2GO3 A;  4DPX A;  2WNR B;  4B3T E;  2UU9 I;  3UHM A;  4DV5 E;  1XMO E;  3J81 C;  4JV5 I;  4DR1 E;  1XMQ I;  1NHH A;  1Y6Z A;  1Y4U A;  2BM1 A;  4HAC B;  4DR5 E;  1UDS A;  4Z7C A;  4X64 E;  4FW3 A;  3PYE A;  3M85 G;  5LMN I;  5FWK A;  2BV3 A;  2Z5C B;  3PYD A;  1ZM3 A;  2LJP A;  4ED4 A;  4Z7Y A;  4DR4 I;  4DR7 E;  4GKK E;  4DR3 E;  1A6F A;  2JEA B;  2J65 A;  4WUB A;  2Z5E A;  4DU8 A;  5IWA E;  4RPF A;  1EA6 A;  4DV0 I;  2X7I A;  4U3D A;  2JEB B;  4LF5 E;  4IZK A;  2NN6 D;  4OO1 A;  5C0X E;  1EI1 A;  4DPW A;  2VQF I;  4DV4 I;  4URL A;  2NN6 C;  5IT9 C;  3L7Z A;  4HXZ A;  1OYR A;  1FI4 A;  3J7A M;  4OX9 E;  4DV3 E;  5C0X D;  2ZIT A;  5EL9 A;  2F1D A;  4JI7 E;  1YHC A;  2V2Q A;  2JT2 A;  3B4T A;  1XNQ I;  4DV2 I;  4JI5 I;  2V8P A;  4M1K A;  2C37 B;  2PO2 B;  4NXN I;  3P76 A;  5JEA D;  4X62 E;  4B3S I;  3JAM Q;  2PO1 A;  1J5E E;  1USV A;  1HNX I;  4ISA A;  3PS2 A;  3V5R A;  3ZZT A;  2UXB E;  4MYU A;  2X36 A;  5JEA C;  4DR5 I;  1UDO A;  1XHK A;  4JI0 E;  4JI8 E;  1KTV A;  4JYA I;  1KIJ A;  1R6L A;  1Y60 A;  1RRE A;  2HHH E;  4R1F A;  1FJG I;  4X65 I;  1N32 I;  1D6T A;  4WUD A;  1Y4S A;  1B63 A;  4LF7 E;  2CGE A;  5L3J A;  3M7N G;  4B3M I;  4YY3 I;  3ZKD A;  4ZVI A;  3ZZU A;  4LF5 I;  4DV1 E;  1HNW E;  1E3H A;  4DR6 E;  5C0X A;  4DV6 E;  3B78 A;  3CDI A;  1FNM A;  2XEX A;  2IOQ A;  1ZM4 A;  2JE6 B;  1N33 I;  5A2Q Q;  1VIS A;  4LFC I;  1FWK A;  2C38 A;  4AQY E;  1H72 C;  4UT4 A;  2PNZ B;  4JI3 I;  1Z0B A;  3J80 Q;  1IBK E;  2WNR A;  1H7U A;  4HYM A;  3D4J A;  2UXD E;  4JI7 I;  3Q1Q A;  4MU3 A; 
#chains in the Genus database with same CATH homology
 1I94 I;  4JI2 I;  3JAM C;  3T1H E;  4KHP I;  2HKE A;  3WU6 A;  4HAC A;  1FKA E;  2HFS A;  4KQV A;  4HY1 A;  2Z5C A;  4X62 I;  3LPS A;  1MG7 A;  1DAR A;  2ZM6 I;  2E5L E;  1Z5B A;  1B62 A;  4FW9 A;  2ZBK B;  4N3O A;  4JI0 I;  2UUA I;  4P52 A;  4LFA E;  3CWV A;  3ZKB A;  4YHH E;  2VQE I;  2UUB I;  3B8H A;  1BKN A;  4DPT A;  4GKJ I;  4LFB I;  4X66 E;  1HR0 I;  1XNR E;  2NPF A;  4FWH A;  2UXC E;  1UEK A;  4PRV A;  5A2Q C;  4USM A;  4LF6 E;  4DR6 I;  1PVG A;  1HNZ E;  1Z5A A;  2R42 A;  3K17 A;  2R3V A;  1IBL I;  3PYG A;  4DV7 E;  3J80 C;  4IZJ B;  4LF8 E;  1S16 A;  2EFG A;  4JI6 E;  1H73 A;  3OTO I;  3GON A;  3QT7 A;  4XTJ A;  2A2C A;  2GS8 A;  4AQY I;  3T1Y I;  2V2Z A;  2IOP A;  1N34 E;  4JI4 E;  4B3R I;  1WUU A;  5GME A;  1Z0T A;  4JG4 A;  4DUY E;  4FWG A;  4B3T I;  2UUC E;  1XMO I;  4DV5 I;  4DR1 I;  1NHJ A;  2WW4 A;  2Z5B B;  1N36 E;  4X64 I;  1MU5 A;  5LMU E;  1QZR A;  3ZM7 A;  5BR8 E;  2PNM A;  2F4V E;  1IBM E;  3K85 A;  1Z5C A;  2UU9 E;  3M6A A;  4JV5 E;  4LFA I;  1XMQ E;  4DXL A;  1OJ4 A;  1Z0V A;  4DR7 I;  4GKK I;  2AJ4 A;  2OI2 A;  4DR3 I;  3PYF A;  2HK2 A;  5IWA I;  4X66 I;  1XNR I;  4FN5 A;  1HNZ I;  3F0N A;  3Q6M A;  3WU4 A;  4DV0 E;  1ZM9 A;  4LF4 E;  1N0V C;  2HKJ A;  4OX9 I;  5FLX Q;  4DPU A;  4K0K E;  2HFU A;  2VQF E;  4DV3 I;  4IZJ D;  4EMD A;  2O1W A;  4JI1 E;  2VF3 A;  1Z0W A;  1U2R A;  4LF9 E;  5IT9 Q;  4UTG A;  3QT6 A;  1J5E I;  4FWD A;  1XNQ E;  2UXB I;  2J7K A;  5LMU I;  4JI8 I;  2O1U A;  2F4V I;  2A2D A;  1NHI A;  2HHH I;  4B3S E;  3PRY A;  3LTO A;  1HNX E;  4LF7 I;  4NXM E;  2CG9 A;  4DR2 E;  4I3H A;  4JYA E;  4DV1 I;  1HNW I;  2CZ9 A;  2PNL A;  4IZJ A;  1FWL A;  3K1J A;  1FJG E;  4X65 E;  1N32 E;  4DV6 I;  2DEJ A;  2V34 A;  5FLX C;  4PRX A;  4B3M E;  3Q6N A;  4YY3 E;  3P06 A;  4LF4 I;  2Q2E B;  1Z0E A;  2BM0 A;  1N0U A;  1ELO A;  3ZZ0 A;  3V2U C;  1IBK I;  1USU A;  1H74 A;  4K0K I;  4IZK B;  1N33 E;  4JI1 I;  2UXD I;  1ZXM A;  4LFC E;  1Z0C A;  3LNU A;  3QT5 A;  3T1H I;  5LL6 R;  4PU9 A;  4JI3 E;  2Z5B A;  4LF9 I;  4USK A;  4DUZ E;  1NZ0 A;  4P7A A;  3J7A G;  1K47 A;  2E5L I;  1I94 E;  4JI2 E;  4KHP E;  4MYT A;  1PKP A;  4YHH I;  1PIE A;  2ZM6 E;  2E1R A;  1RR9 A;  5LMN E;  1MX0 A;  3J81 Q;  2O1V A;  1KVK A;  4NXM I;  2DEI A;  1ZM2 A;  2UUA E;  4DR2 I;  4DU7 A;  4DR4 E;  2UXC I;  4LF6 I;  1KKH A;  2VQE E;  2UUB E;  3QT8 A;  3B82 A;  4DV7 I;  4GKJ E;  2O1T A;  4LFB E;  2HK3 A;  1HR0 E;  3HJC A;  4DPY A;  4LF8 I;  1HK7 A;  4JI6 I;  4DV4 E;  3HUL A;  1Z0G A;  2GQ0 A;  1ZXN A;  2V2V A;  1IBL E;  3WU5 A;  1N34 I;  3H4L A;  4JI4 I;  1H7S A;  3OTO E;  3WU3 A;  4DUY I;  5GMD A;  2UUC I;  3T1Y E;  1S4E A;  4DUZ I;  4WUC A;  1Z59 A;  4DV2 E;  4B3R E;  1N36 I;  4JI5 E;  5BR8 I;  4NXN E;  1IBM I;  4B3T E;  4DPX A;  2UU9 I;  1XMO E;  4DV5 E;  4JV5 I;  3J81 C;  4DR1 E;  1XMQ I;  1NHH A;  1Y6Z A;  1Y4U A;  2BM1 A;  4HAC B;  4DR5 E;  4Z7C A;  4X64 E;  3PYE A;  5LMN I;  5FWK A;  2BV3 A;  2Z5C B;  3PYD A;  1ZM3 A;  2LJP A;  4ED4 A;  4Z7Y A;  4DR4 I;  4DR7 E;  4GKK E;  4DR3 E;  1A6F A;  4WUB A;  2Z5E A;  4DU8 A;  5IWA E;  4RPF A;  1EA6 A;  4DV0 I;  2X7I A;  4LF5 E;  4IZK A;  1EI1 A;  4DPW A;  2VQF I;  4DV4 I;  4URL A;  5IT9 C;  4HXZ A;  1FI4 A;  3J7A M;  4OX9 E;  4DV3 E;  2ZIT A;  4JI7 E;  2V2Q A;  1XNQ I;  4DV2 I;  4JI5 I;  2V8P A;  4M1K A;  4NXN I;  4X62 E;  4B3S I;  3JAM Q;  1J5E E;  1USV A;  1HNX I;  3V5R A;  3ZZT A;  2UXB E;  4MYU A;  2X36 A;  4DR5 I;  1XHK A;  4JI0 E;  4JI8 E;  1KTV A;  4JYA I;  1KIJ A;  1RRE A;  2HHH E;  4R1F A;  1FJG I;  4X65 I;  1N32 I;  1D6T A;  4WUD A;  1Y4S A;  1B63 A;  4LF7 E;  2CGE A;  5L3J A;  4B3M I;  4YY3 I;  3ZKD A;  4ZVI A;  3ZZU A;  4LF5 I;  4DV1 E;  1HNW E;  4DR6 E;  4DV6 E;  3B78 A;  1FNM A;  2XEX A;  2IOQ A;  1ZM4 A;  1N33 I;  5A2Q Q;  1VIS A;  4LFC I;  1FWK A;  4AQY E;  1H72 C;  4UT4 A;  4JI3 I;  1Z0B A;  3J80 Q;  1IBK E;  1H7U A;  4HYM A;  3D4J A;  2UXD E;  4JI7 I;  3Q1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...