4X66I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x66I00
3J80Q 4GKJI 1PIEA 4DV3E 1ZM3A 3H4LA 3OTOE 1XHKA 1HR0E 4X62E 4X65I 4NXMI 1N0UA 1XMOI 3LNUA 2V2VA 2V2ZA 4JI4E 4JI6E 1ZM2A 4DR6E 3J80C 5FLXQ 4FW9A 4WUBA 4LFAE 3LTOA 1RREA 1MU5A 1HNXE 4LF7I 1IBLI 1S16A 4M1KA 5BR8I 4DPYA 4I3HA 4WUDA 4LF4I 4ED4A 4HACA 4LFBI 2UU9E 4DR1E 1B63A 1H73A 4JI3I 4R1FA 1ELOA 1H7SA 4DV5I 4X66I 2BM1A 4DPTA 4DR7E 2UUBI 1FJGE 2R3VA 1NHJA 4PU9A 2UUAI 2VQEI 2F4VI 2ZM6I 1KKHA 1NZ0A 3PYGA 4JI5I 2OI2A 4X64E 5IWAE 3V2UC 4YY3I 1HNWI 2VF3A 4LF5E 4B3RI 4GKKI 1KVKA 2R42A 4JYAI 4DR3I 2UUCI 1XMQE 3LPSA 4DV4I 5GMEA 2XEXA 4DUZI 4OX9E 2HFSA 5GMDA 2UXDE 1FNMA 1N32I 2ZBKB 4AQYE 1RR9A 2LJPA 3QT5A 1N36E 1FWKA 4DV4E 4LFCI 3K17A 3ZZ0A 1IBKE 4DR4E 4WUCA 1NHIA 3WU5A 2BV3A 5IT9C 1N36I 1DARA 4DUYE 3K1JA 2HHHE 1XNRI 1XNQE 4HY1A 2E1RA 1IBLE 4DUZE 2HK2A 2HFUA 2V34A 2UUAE 1H7UA 4DR6I 1XNQI 4FWGA 4LF9E 4DUYI 1MG7A 4DV5E 1B62A 3J81C 5IWAI 1Z5AA 3B8HA 4DPXA 3PYFA 4LFCE 1J5EE 3WU3A 2ZM6E 2F4VE 4OX9I 4JI2E 3T1HI 1J5EI 4HACB 4GKJE 3ZZTA 3J7AM 4B3SI 2CZ9A 4JI3E 3QT7A 4DR4I 4LF9I 4GKKE 4LF5I 4B3RE 4JI5E 1ZXMA 4B3SE 3JAMC 4AQYI 3D4JA 1N32E 3J7AG 1Z0TA 1XNRE 3T1HE 2HHHI 4X66E 4LFAI 4X62I 4JI2I 2X36A 3ZKBA 1FJGI 4JG4A 2UUBE 2UUCE 3WU4A 1Z0VA 1IBKI 1QZRA 4DR3E 5LL6R 2HK3A 4P7AA 4URLA 4USMA 2AJ4A 2BM0A 4LF4E 3PYEA 4P52A 2UU9I 1I94I 4X64I 3ZZUA 3JAMQ 4X65E 2NPFA 1Z5BA 1HNXI 4FWHA 2WW4A 4DU7A 4JYAE 1EA6A 1PKPA 4DV0I 1KIJA 4YY3E 1N34I 4DR1I 4JI4I 1A6FA 4DPWA 3PYDA 1Z0CA 4DV2I 1XMOE 1HR0I 4PRVA 5BR8E 4DR7I 3V5RA 2UXDI 2UXBE 4B3MI 2A2CA 4MYUA 1NHHA 1Z0GA 1XMQI 4DV3I 2J7KA 1ZM9A 4JI1I 1EI1A 4LF6I 1N33E 2VQFE 5A2QQ 1HNZE 4DV7I 3B78A 3HULA 1HNWE 4KQVA 4YHHI 3CWVA 2UXCE 4DR2I 4UTGA 4LF7E 2EFGA 3QT6A 4JI8I 4DPUA 3T1YI 2VQEE 1FI4A 4PRXA 1IBME 2DEIA 1VISA 4XTJA 4Z7YA 5LMNE 2X7IA 4JI7E 2V2QA 4USKA 3GONA 4ZVIA 1OJ4A 4LFBE 1S4EA 2E5LE 4MYTA 4FN5A 3M6AA 1Z0EA 4HYMA 4DV6I 4K0KI 2Q2EB 3OTOI 1MX0A 3Q1QA 3WU6A 1Z59A 4JV5I 1Z0WA 3ZKDA 4KHPE 1FWLA 1UEKA 4LF8E 4B3TE 4RPFA 4DXLA 1N34E 2V8PA 4DV1E 4JI7I 2HKEA 4UT4A 3J81Q 5A2QC 4JI6I 1K47A 4LF8I 4KHPI 5FLXC 2A2DA 1ZXNA 4JI1E 5IT9Q 1N0VC 4B3TI 3B82A 3T1YE 4EMDA 4NXME 1D6TA 2UXBI 1H74A 1BKNA 4DU8A 1FKAE 4DR5I 2GS8A 1I94E 4NXNE 4DV6E 4K0KE 4Z7CA 3ZM7A 3F0NA 4DV7E 1HNZI 4DV2E 2VQFI 1N33I 4LF6E 4JI0I 1H72C 2ZITA 3QT8A 5LMNI 1PVGA 4DV1I 4NXNI 1U2RA 4DR5E 4B3ME 2DEJA 4FWDA 4JI8E 1ZM4A 4DV0E 5LMUE 1KTVA 1IBMI 4JV5E 1WUUA 2HKJA 1Z5CA 1Z0BA 4YHHE 5LMUI 4DR2E 2E5LI 2UXCI 4HXZA 5L3JA 4JI0E
chains in the Genus database with same CATH superfamily
3J80Q 1OYRA 1Y5YA 4GKJI 1PIEA 3M7ND 4DV3E 1ZM3A 4IZJB 2CVEA 4LOMA 3H4LA 3OTOE 1XHKA 1RHYA 1HR0E 4X62E 4X65I 4NXMI 3Q6MA 1N0UA 5DRQA 2CG9A 1XMOI 3LNUA 2V2VA 4IFDF 4IFDD 2V2ZA 5FWKA 4JI4E 4JI6E 2BR2B 5JEAE 5JEAD 4DR6E 3J80C 5FLXQ 3KRNA 4FW9A 4WUBA 4LFAE 3LTOA 1RREA 1MU5A 1HNXE 4IZKA 4BA2B 2Z5CB 4LF7I 4AIDA 1IBLI 1S16A 4M1KA 3B4TA 5BR8I 4MU1A 4DPYA 4I3HA 4WUDA 2PO0A 4LF4I 4ED4A 2JEBB 4HACA 4LFBI 5C0XE 2UU9E 2CGEA 4DR1E 5C0XF 1B63A 1H73A 5K36C 3HJCA 4JI3I 4R1FA 1ELOA 1Y60A 1H7SA 4DV5I 3Q6NA 3P3GA 4X66I 2BM1A 4DPTA 4DR7E 4MDTA 2UUBI 1FJGE 2R3VA 1NHJA 4PU9A 2UUAI 2VQEI 2F4VI 2ZM6I 1KKHA 1NZ0A 1P42A 3PYGA 2BA0G 2WNRA 4JI5I 4OO1C 2OI2A 4BA1A 4IZKB 4BA2A 4X64E 5IWAE 3V2UC 4YY3I 5C0XC 1HNWI 4IFDE 4IFDA 2VF3A 4LF5E 4B3RI 4GKKI 5C0XD 1KVKA 2BR2A 2R42A 5L3JA 4JYAI 4DR3I 2UUCI 1XMQE 3LPSA 4DV4I 5GMEA 4FW3A 2XEXA 3U1KA 4DUZI 4OX9E 2HFSA 2NN6C 2C38B 5GMDA 2UXDE 3UHMA 1FNMA 4QNJA 1N32I 3L7ZA 2ZBKB 4AQYE 1RR9A 2LJPA 3QT5A 1N36E 1FWKA 4DV4E 4LFCI 3M85G 3K17A 1UDSA 3ZZ0A 1IBKE 1OYSA 4DR4E 4WUCA 1NHIA 3WU5A 2BV3A 5IT9C 1N36I 1DARA 4DUYE 3K1JA 3M7NG 2HHHE 4IFDB 1Y6ZA 1XNRI 1XNQE 2PO2A 1UDQA 2JEAA 1OYPA 2NN6A 4HY1A 2E1RA 1IBLE 4DUZE 2HK2A 2HFUA 2V34A 1Y4SA 2UUAE 3GCMA 1H7UA 4DR6I 1XNQI 2WNRB 4FWGA 5DRRA 4LF9E 4OO1A 4DUYI 1MG7A 1E3PA 4DV5E 1B62A 1YH8A 3J81C 2PO1A 5K36F 5IWAI 1Z5AA 3B8HA 4DPXA 3PYFA 2O3ZA 4IFDC 3H1CA 2PNMA 4LFCE 4U3BA 1J5EE 3WU3A 4ISAA 2ZM6E 1Y4UA 2F4VE 4OX9I 4JI2E 3L7ZB 5ELWA 3T1HI 1J5EI 2C38A 4IZJA 4HACB 4GKJE 3ZZTA 2PO1B 3M85D 4LCHA 1R6LA 1VI7A 4LPFA 3J7AM 4B3SI 2CZ9A 4JI3E 2WP8B 2IOQA 2Z5EA 3QT7A 4DR4I 4LF9I 4BA1B 4GKKE 4NBQA 4MU3A 4LF5I 4B3RE 2O1WA 3NZKA 2Z5BB 4JI5E 1ZXMA 4MQYA 4MU4A 4OZEA 2BA1G 2NN6B 3P3EA 4B3SE 2NN6E 3JAMC 4AQYI 3D4JA 4IZJD 1N32E 3J7AG 2NN6F 1Z0TA 1XNRE 3T1HE 2HHHI 4X66E 4LFAI 4X62I 2PNLA 5DROA 4JI2I 2X36A 3ZKBA 4AM3A 1FJGI 4JG4A 2UUBE 2UUCE 5C0XB 3WU4A 1XXEA 1Z0VA 1IBKI 1QZRA 4DR3E 4QNKA 2J65A 5LL6R 4U3DA 2PO0B 2HK3A 4P7AA 4URLA 4USMA 2AJ4A 2BM0A 4LF4E 3PYEA 4P52A 1E3HA 2UU9I 1I94I 4OO1D 4X64I 3ZZUA 3JAMQ 4X65E 2NPFA 1Z5BA 2O1VA 2PNZB 4AIMA 1HNXI 4FWHA 2WW4A 2F1DA 4DU7A 2NN6D 4JYAE 5EKWA 5K36B 3DD6A 4J3DA 1EA6A 1PKPA 4DV0I 2BA0D 2C37B 5K36A 5K36E 1KIJA 3PRYA 2C37A 2WP8A 4YY3E 1N34I 2PNZA 4DR1I 4JI4I 5DRPA 1A6FA 4DPWA 3PYDA 1Z0CA 4DV2I 1R6MA 2GQ0A 1XMOE 1HR0I 1UDOA 4PRVA 5BR8E 4DR7I 3V5RA 2UXDI 2UXBE 4MU0A 4B3MI 2A2CA 4MYUA 1NHHA 1Z0GA 1XMQI 1YHCA 2J7KA 5JEAC 4DV3I 1ZM9A 5C0XA 4JI1I 1EI1A 4LF6I 1N33E 2JEBA 5A2QQ 2VQFE 4DV7I 1HNZE 3B78A 3HULA 1HNWE 3CDIA 4KQVA 5JEAB 4YHHI 3CWVA 2UXCE 5DNXA 4DR2I 4FW4A 3PS2A 4UTGA 4LF7E 2EFGA 3QT6A 4JI8I 4DPUA 3T1YI 2VQEE 1FI4A 2IOPA 4PRXA 1IBME 2O1UA 2JEAB 2DEIA 1VISA 3CDJA 4XTJA 2C39B 4Z7YA 5LMNE 4FW7A 2X7IA 1HK7A 4JI7E 2V2QA 3HKMA 4USKA 3GLLA 3GONA 4ZVIA 1OJ4A 4LFBE 1S4EA 2JE6A 2E5LE 5DNLA 4MYTA 2IERA 4FN5A 3M6AA 1Z0EA 2C39A 4HYMA 4DV6I 4K0KI 2Q2EB 3OTOI 1MX0A 3Q1QA 4OO1E 3WU6A 1Z59A 4JV5I 1Z0WA 2IESA 3ZKDA 4KHPE 1FWLA 1UEKA 4LF8E 4B3TE 4RPFA 4DXLA 1N34E 2V8PA 2PO2B 4DV1E 4JI7I 2HKEA 3K85A 5JEAA 4UT4A 3J81Q 5A2QC 4JI6I 4IS9A 4N3OA 1K47A 5K36D 4LF8I 4KHPI 5FLXC 2A2DA 1ZXNA 4JI1E 5IT9Q 1N0VC 1USVA 5EL9A 2BA1D 4B3TI 3B82A 3T1YE 4EMDA 2O1TA 4NXME 1D6TA 4LCGA 2UXBI 1H74A 1BKNA 4DU8A 1FKAE 4DR5I 2GS8A 4OKGA 1I94E 3PS1A 4NXNE 4DV6E 4K0KE 3P06A 4Z7CA 3P76A 3ZM7A 2GO3A 3P3CA 3F0NA 4DV7E 1HNZI 4FW6A 2VQFI 4DV2E 1N33I 4LF6E 4GQUA 4JI0I 1H72C 2ZITA 1USUA 3PS3A 3QT8A 2JE6B 2JT2A 5LMNI 4OO1B 1PVGA 3U1YA 4DV1I 4NXNI 1U2RA 1UDNA 4DR5E 4B3ME 2DEJA 2GO4A 4FWDA 2Z5CA 4JI8E 2AE8A 1ZM4A 4DV0E 5LMUE 2VESA 1KTVA 1IBMI 4JV5E 1WUUA 2HKJA 1Z5CA 1Z0BA 2Z5BA 4YHHE 4OO1F 5LMUI 4LCFA 4DR2E 4FW5A 2E5LI 2UXCI 3GMEA 4HXZA 5JEAF 1ZM2A 4JI0E
chains in the Genus database with same CATH topology
3J80Q 4GKJI 1PIEA 4DV3E 1ZM3A 4IZJB 3H4LA 3OTOE 1XHKA 1HR0E 4X62E 4X65I 4NXMI 3Q6MA 1N0UA 2CG9A 1XMOI 3LNUA 2V2VA 2V2ZA 5FWKA 4JI4E 4JI6E 1ZM2A 4DR6E 3J80C 5FLXQ 4FW9A 4WUBA 4LFAE 3LTOA 1RREA 1MU5A 1HNXE 4IZKA 2Z5CB 4LF7I 1IBLI 1S16A 4M1KA 5BR8I 4DPYA 4I3HA 4WUDA 4LF4I 4ED4A 4HACA 4LFBI 2UU9E 2CGEA 4DR1E 1B63A 1H73A 3HJCA 4JI3I 4R1FA 1ELOA 1H7SA 4DV5I 3Q6NA 4X66I 2BM1A 4DPTA 4DR7E 2UUBI 1FJGE 2R3VA 1NHJA 4PU9A 2UUAI 2VQEI 2F4VI 2ZM6I 1KKHA 1NZ0A 3PYGA 4JI5I 2OI2A 4IZKB 4X64E 5IWAE 3V2UC 4YY3I 1HNWI 2VF3A 4LF5E 4B3RI 4GKKI 1KVKA 2R42A 4JYAI 4DR3I 2UUCI 1XMQE 3LPSA 4DV4I 5GMEA 2XEXA 4DUZI 4OX9E 2HFSA 5GMDA 2UXDE 1FNMA 1N32I 2ZBKB 4AQYE 1RR9A 2LJPA 3QT5A 1N36E 1FWKA 4DV4E 4LFCI 3K17A 3ZZ0A 1IBKE 4DR4E 4WUCA 1NHIA 3WU5A 2BV3A 5IT9C 1N36I 1DARA 4DUYE 3K1JA 2HHHE 1Y6ZA 1XNRI 1XNQE 4HY1A 2E1RA 1IBLE 4DUZE 2HK2A 2HFUA 2V34A 1Y4SA 2UUAE 1H7UA 4DR6I 1XNQI 4FWGA 4LF9E 4DUYI 1MG7A 4DV5E 1B62A 3J81C 5IWAI 1Z5AA 3B8HA 4DPXA 3PYFA 2PNMA 4LFCE 1J5EE 3WU3A 2ZM6E 1Y4UA 2F4VE 4OX9I 4JI2E 3T1HI 1J5EI 4IZJA 4HACB 4GKJE 3ZZTA 3J7AM 4B3SI 2CZ9A 4JI3E 2IOQA 2Z5EA 3QT7A 4DR4I 4LF9I 4GKKE 4LF5I 4B3RE 2O1WA 2Z5BB 4JI5E 1ZXMA 4B3SE 3JAMC 4AQYI 3D4JA 4IZJD 1N32E 3J7AG 1Z0TA 1XNRE 3T1HE 2HHHI 4X66E 4LFAI 4X62I 2PNLA 4JI2I 2X36A 3ZKBA 1FJGI 4JG4A 2UUBE 2UUCE 3WU4A 1Z0VA 1IBKI 1QZRA 4DR3E 5LL6R 2HK3A 4P7AA 4URLA 4USMA 2AJ4A 2BM0A 4LF4E 3PYEA 4P52A 2UU9I 1I94I 4X64I 3ZZUA 3JAMQ 4X65E 2NPFA 1Z5BA 2O1VA 1HNXI 4FWHA 2WW4A 4DU7A 4JYAE 1EA6A 1PKPA 4DV0I 1KIJA 3PRYA 4YY3E 1N34I 4DR1I 4JI4I 1A6FA 4DPWA 3PYDA 1Z0CA 4DV2I 2GQ0A 1XMOE 1HR0I 4PRVA 5BR8E 4DR7I 3V5RA 2UXDI 2UXBE 4B3MI 2A2CA 4MYUA 1NHHA 1Z0GA 1XMQI 4DV3I 2J7KA 1ZM9A 4JI1I 1EI1A 4LF6I 1N33E 2VQFE 5A2QQ 4DV7I 1HNZE 3B78A 3HULA 1HNWE 4KQVA 4YHHI 3CWVA 2UXCE 4DR2I 4UTGA 4LF7E 2EFGA 3QT6A 4JI8I 4DPUA 3T1YI 2VQEE 1FI4A 2IOPA 4PRXA 1IBME 2O1UA 2DEIA 1VISA 4XTJA 4Z7YA 5LMNE 2X7IA 1HK7A 4JI7E 2V2QA 4USKA 3GONA 4ZVIA 1OJ4A 4LFBE 1S4EA 2E5LE 4MYTA 4FN5A 3M6AA 1Z0EA 4HYMA 4DV6I 4K0KI 2Q2EB 3OTOI 1MX0A 3Q1QA 3WU6A 1Z59A 4JV5I 1Z0WA 3ZKDA 4KHPE 1FWLA 1UEKA 4LF8E 4B3TE 4RPFA 4DXLA 1N34E 2V8PA 4DV1E 4JI7I 2HKEA 3K85A 4UT4A 3J81Q 5A2QC 4JI6I 4N3OA 1K47A 4LF8I 4KHPI 5FLXC 2A2DA 1ZXNA 4JI1E 5IT9Q 1N0VC 1USVA 4B3TI 3B82A 3T1YE 4EMDA 2O1TA 4NXME 1D6TA 2UXBI 1H74A 1BKNA 4DU8A 1FKAE 4DR5I 2GS8A 1I94E 4NXNE 4DV6E 4K0KE 3P06A 4Z7CA 3ZM7A 3F0NA 4DV7E 1HNZI 4DV2E 2VQFI 1N33I 4LF6E 4JI0I 1H72C 2ZITA 1USUA 3QT8A 5LMNI 1PVGA 4DV1I 4NXNI 1U2RA 4DR5E 4B3ME 2DEJA 4FWDA 2Z5CA 4JI8E 1ZM4A 4DV0E 5LMUE 1KTVA 1IBMI 4JV5E 1WUUA 2HKJA 1Z5CA 1Z0BA 2Z5BA 4YHHE 5LMUI 4DR2E 2E5LI 2UXCI 4HXZA 5L3JA 4JI0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J80 Q;  4GKJ I;  1PIE A;  4DV3 E;  1ZM3 A;  3H4L A;  3OTO E;  1XHK A;  1HR0 E;  4X62 E;  4X65 I;  4NXM I;  1N0U A;  1XMO I;  3LNU A;  2V2V A;  2V2Z A;  4JI4 E;  4JI6 E;  1ZM2 A;  4DR6 E;  3J80 C;  5FLX Q;  4FW9 A;  4WUB A;  4LFA E;  3LTO A;  1RRE A;  1MU5 A;  1HNX E;  4LF7 I;  1IBL I;  1S16 A;  4M1K A;  5BR8 I;  4DPY A;  4I3H A;  4WUD A;  4LF4 I;  4ED4 A;  4HAC A;  4LFB I;  2UU9 E;  4DR1 E;  1B63 A;  1H73 A;  4JI3 I;  4R1F A;  1ELO A;  1H7S A;  4DV5 I;  4X66 I;  2BM1 A;  4DPT A;  4DR7 E;  2UUB I;  1FJG E;  2R3V A;  1NHJ A;  4PU9 A;  2UUA I;  2VQE I;  2F4V I;  2ZM6 I;  1KKH A;  1NZ0 A;  3PYG A;  4JI5 I;  2OI2 A;  4X64 E;  5IWA E;  3V2U C;  4YY3 I;  1HNW I;  2VF3 A;  4LF5 E;  4B3R I;  4GKK I;  1KVK A;  2R42 A;  4JYA I;  4DR3 I;  2UUC I;  1XMQ E;  3LPS A;  4DV4 I;  5GME A;  2XEX A;  4DUZ I;  4OX9 E;  2HFS A;  5GMD A;  2UXD E;  1FNM A;  1N32 I;  2ZBK B;  4AQY E;  1RR9 A;  2LJP A;  3QT5 A;  1N36 E;  1FWK A;  4DV4 E;  4LFC I;  3K17 A;  3ZZ0 A;  1IBK E;  4DR4 E;  4WUC A;  1NHI A;  3WU5 A;  2BV3 A;  5IT9 C;  1N36 I;  1DAR A;  4DUY E;  3K1J A;  2HHH E;  1XNR I;  1XNQ E;  4HY1 A;  2E1R A;  1IBL E;  4DUZ E;  2HK2 A;  2HFU A;  2V34 A;  2UUA E;  1H7U A;  4DR6 I;  1XNQ I;  4FWG A;  4LF9 E;  4DUY I;  1MG7 A;  4DV5 E;  1B62 A;  3J81 C;  5IWA I;  1Z5A A;  3B8H A;  4DPX A;  3PYF A;  4LFC E;  1J5E E;  3WU3 A;  2ZM6 E;  2F4V E;  4OX9 I;  4JI2 E;  3T1H I;  1J5E I;  4HAC B;  4GKJ E;  3ZZT A;  3J7A M;  4B3S I;  2CZ9 A;  4JI3 E;  3QT7 A;  4DR4 I;  4LF9 I;  4GKK E;  4LF5 I;  4B3R E;  4JI5 E;  1ZXM A;  4B3S E;  3JAM C;  4AQY I;  3D4J A;  1N32 E;  3J7A G;  1Z0T A;  1XNR E;  3T1H E;  2HHH I;  4X66 E;  4LFA I;  4X62 I;  4JI2 I;  2X36 A;  3ZKB A;  1FJG I;  4JG4 A;  2UUB E;  2UUC E;  3WU4 A;  1Z0V A;  1IBK I;  1QZR A;  4DR3 E;  5LL6 R;  2HK3 A;  4P7A A;  4URL A;  4USM A;  2AJ4 A;  2BM0 A;  4LF4 E;  3PYE A;  4P52 A;  2UU9 I;  1I94 I;  4X64 I;  3ZZU A;  3JAM Q;  4X65 E;  2NPF A;  1Z5B A;  1HNX I;  4FWH A;  2WW4 A;  4DU7 A;  4JYA E;  1EA6 A;  1PKP A;  4DV0 I;  1KIJ A;  4YY3 E;  1N34 I;  4DR1 I;  4JI4 I;  1A6F A;  4DPW A;  3PYD A;  1Z0C A;  4DV2 I;  1XMO E;  1HR0 I;  4PRV A;  5BR8 E;  4DR7 I;  3V5R A;  2UXD I;  2UXB E;  4B3M I;  2A2C A;  4MYU A;  1NHH A;  1Z0G A;  1XMQ I;  4DV3 I;  2J7K A;  1ZM9 A;  4JI1 I;  1EI1 A;  4LF6 I;  1N33 E;  2VQF E;  5A2Q Q;  1HNZ E;  4DV7 I;  3B78 A;  3HUL A;  1HNW E;  4KQV A;  4YHH I;  3CWV A;  2UXC E;  4DR2 I;  4UTG A;  4LF7 E;  2EFG A;  3QT6 A;  4JI8 I;  4DPU A;  3T1Y I;  2VQE E;  1FI4 A;  4PRX A;  1IBM E;  2DEI A;  1VIS A;  4XTJ A;  4Z7Y A;  5LMN E;  2X7I A;  4JI7 E;  2V2Q A;  4USK A;  3GON A;  4ZVI A;  1OJ4 A;  4LFB E;  1S4E A;  2E5L E;  4MYT A;  4FN5 A;  3M6A A;  1Z0E A;  4HYM A;  4DV6 I;  4K0K I;  2Q2E B;  3OTO I;  1MX0 A;  3Q1Q A;  3WU6 A;  1Z59 A;  4JV5 I;  1Z0W A;  3ZKD A;  4KHP E;  1FWL A;  1UEK A;  4LF8 E;  4B3T E;  4RPF A;  4DXL A;  1N34 E;  2V8P A;  4DV1 E;  4JI7 I;  2HKE A;  4UT4 A;  3J81 Q;  5A2Q C;  4JI6 I;  1K47 A;  4LF8 I;  4KHP I;  5FLX C;  2A2D A;  1ZXN A;  4JI1 E;  5IT9 Q;  1N0V C;  4B3T I;  3B82 A;  3T1Y E;  4EMD A;  4NXM E;  1D6T A;  2UXB I;  1H74 A;  1BKN A;  4DU8 A;  1FKA E;  4DR5 I;  2GS8 A;  1I94 E;  4NXN E;  4DV6 E;  4K0K E;  4Z7C A;  3ZM7 A;  3F0N A;  4DV7 E;  1HNZ I;  4DV2 E;  2VQF I;  1N33 I;  4LF6 E;  4JI0 I;  1H72 C;  2ZIT A;  3QT8 A;  5LMN I;  1PVG A;  4DV1 I;  4NXN I;  1U2R A;  4DR5 E;  4B3M E;  2DEJ A;  4FWD A;  4JI8 E;  1ZM4 A;  4DV0 E;  5LMU E;  1KTV A;  1IBM I;  4JV5 E;  1WUU A;  2HKJ A;  1Z5C A;  1Z0B A;  4YHH E;  5LMU I;  4DR2 E;  2E5L I;  2UXC I;  4HXZ A;  5L3J A;  4JI0 E; 
#chains in the Genus database with same CATH topology
 3J80 Q;  1OYR A;  1Y5Y A;  4GKJ I;  1PIE A;  3M7N D;  4DV3 E;  1ZM3 A;  4IZJ B;  2CVE A;  4LOM A;  3H4L A;  3OTO E;  1XHK A;  1RHY A;  1HR0 E;  4X62 E;  4X65 I;  4NXM I;  3Q6M A;  1N0U A;  5DRQ A;  2CG9 A;  1XMO I;  3LNU A;  2V2V A;  4IFD F;  4IFD D;  2V2Z A;  5FWK A;  4JI4 E;  4JI6 E;  2BR2 B;  5JEA E;  5JEA D;  4DR6 E;  3J80 C;  5FLX Q;  3KRN A;  4FW9 A;  4WUB A;  4LFA E;  3LTO A;  1RRE A;  1MU5 A;  1HNX E;  4IZK A;  4BA2 B;  2Z5C B;  4LF7 I;  4AID A;  1IBL I;  1S16 A;  4M1K A;  3B4T A;  5BR8 I;  4MU1 A;  4DPY A;  4I3H A;  4WUD A;  2PO0 A;  4LF4 I;  4ED4 A;  2JEB B;  4HAC A;  4LFB I;  5C0X E;  2UU9 E;  2CGE A;  4DR1 E;  5C0X F;  1B63 A;  1H73 A;  5K36 C;  3HJC A;  4JI3 I;  4R1F A;  1ELO A;  1Y60 A;  1H7S A;  4DV5 I;  3Q6N A;  3P3G A;  4X66 I;  2BM1 A;  4DPT A;  4DR7 E;  4MDT A;  2UUB I;  1FJG E;  2R3V A;  1NHJ A;  4PU9 A;  2UUA I;  2VQE I;  2F4V I;  2ZM6 I;  1KKH A;  1NZ0 A;  1P42 A;  3PYG A;  2BA0 G;  2WNR A;  4JI5 I;  4OO1 C;  2OI2 A;  4BA1 A;  4IZK B;  4BA2 A;  4X64 E;  5IWA E;  3V2U C;  4YY3 I;  5C0X C;  1HNW I;  4IFD E;  4IFD A;  2VF3 A;  4LF5 E;  4B3R I;  4GKK I;  5C0X D;  1KVK A;  2BR2 A;  2R42 A;  5L3J A;  4JYA I;  4DR3 I;  2UUC I;  1XMQ E;  3LPS A;  4DV4 I;  5GME A;  4FW3 A;  2XEX A;  3U1K A;  4DUZ I;  4OX9 E;  2HFS A;  2NN6 C;  2C38 B;  5GMD A;  2UXD E;  3UHM A;  1FNM A;  4QNJ A;  1N32 I;  3L7Z A;  2ZBK B;  4AQY E;  1RR9 A;  2LJP A;  3QT5 A;  1N36 E;  1FWK A;  4DV4 E;  4LFC I;  3M85 G;  3K17 A;  1UDS A;  3ZZ0 A;  1IBK E;  1OYS A;  4DR4 E;  4WUC A;  1NHI A;  3WU5 A;  2BV3 A;  5IT9 C;  1N36 I;  1DAR A;  4DUY E;  3K1J A;  3M7N G;  2HHH E;  4IFD B;  1Y6Z A;  1XNR I;  1XNQ E;  2PO2 A;  1UDQ A;  2JEA A;  1OYP A;  2NN6 A;  4HY1 A;  2E1R A;  1IBL E;  4DUZ E;  2HK2 A;  2HFU A;  2V34 A;  1Y4S A;  2UUA E;  3GCM A;  1H7U A;  4DR6 I;  1XNQ I;  2WNR B;  4FWG A;  5DRR A;  4LF9 E;  4OO1 A;  4DUY I;  1MG7 A;  1E3P A;  4DV5 E;  1B62 A;  1YH8 A;  3J81 C;  2PO1 A;  5K36 F;  5IWA I;  1Z5A A;  3B8H A;  4DPX A;  3PYF A;  2O3Z A;  4IFD C;  3H1C A;  2PNM A;  4LFC E;  4U3B A;  1J5E E;  3WU3 A;  4ISA A;  2ZM6 E;  1Y4U A;  2F4V E;  4OX9 I;  4JI2 E;  3L7Z B;  5ELW A;  3T1H I;  1J5E I;  2C38 A;  4IZJ A;  4HAC B;  4GKJ E;  3ZZT A;  2PO1 B;  3M85 D;  4LCH A;  1R6L A;  1VI7 A;  4LPF A;  3J7A M;  4B3S I;  2CZ9 A;  4JI3 E;  2WP8 B;  2IOQ A;  2Z5E A;  3QT7 A;  4DR4 I;  4LF9 I;  4BA1 B;  4GKK E;  4NBQ A;  4MU3 A;  4LF5 I;  4B3R E;  2O1W A;  3NZK A;  2Z5B B;  4JI5 E;  1ZXM A;  4MQY A;  4MU4 A;  4OZE A;  2BA1 G;  2NN6 B;  3P3E A;  4B3S E;  2NN6 E;  3JAM C;  4AQY I;  3D4J A;  4IZJ D;  1N32 E;  3J7A G;  2NN6 F;  1Z0T A;  1XNR E;  3T1H E;  2HHH I;  4X66 E;  4LFA I;  4X62 I;  2PNL A;  5DRO A;  4JI2 I;  2X36 A;  3ZKB A;  4AM3 A;  1FJG I;  4JG4 A;  2UUB E;  2UUC E;  5C0X B;  3WU4 A;  1XXE A;  1Z0V A;  1IBK I;  1QZR A;  4DR3 E;  4QNK A;  2J65 A;  5LL6 R;  4U3D A;  2PO0 B;  2HK3 A;  4P7A A;  4URL A;  4USM A;  2AJ4 A;  2BM0 A;  4LF4 E;  3PYE A;  4P52 A;  1E3H A;  2UU9 I;  1I94 I;  4OO1 D;  4X64 I;  3ZZU A;  3JAM Q;  4X65 E;  2NPF A;  1Z5B A;  2O1V A;  2PNZ B;  4AIM A;  1HNX I;  4FWH A;  2WW4 A;  2F1D A;  4DU7 A;  2NN6 D;  4JYA E;  5EKW A;  5K36 B;  3DD6 A;  4J3D A;  1EA6 A;  1PKP A;  4DV0 I;  2BA0 D;  2C37 B;  5K36 A;  5K36 E;  1KIJ A;  3PRY A;  2C37 A;  2WP8 A;  4YY3 E;  1N34 I;  2PNZ A;  4DR1 I;  4JI4 I;  5DRP A;  1A6F A;  4DPW A;  3PYD A;  1Z0C A;  4DV2 I;  1R6M A;  2GQ0 A;  1XMO E;  1HR0 I;  1UDO A;  4PRV A;  5BR8 E;  4DR7 I;  3V5R A;  2UXD I;  2UXB E;  4MU0 A;  4B3M I;  2A2C A;  4MYU A;  1NHH A;  1Z0G A;  1XMQ I;  1YHC A;  2J7K A;  5JEA C;  4DV3 I;  1ZM9 A;  5C0X A;  4JI1 I;  1EI1 A;  4LF6 I;  1N33 E;  2JEB A;  5A2Q Q;  2VQF E;  4DV7 I;  1HNZ E;  3B78 A;  3HUL A;  1HNW E;  3CDI A;  4KQV A;  5JEA B;  4YHH I;  3CWV A;  2UXC E;  5DNX A;  4DR2 I;  4FW4 A;  3PS2 A;  4UTG A;  4LF7 E;  2EFG A;  3QT6 A;  4JI8 I;  4DPU A;  3T1Y I;  2VQE E;  1FI4 A;  2IOP A;  4PRX A;  1IBM E;  2O1U A;  2JEA B;  2DEI A;  1VIS A;  3CDJ A;  4XTJ A;  2C39 B;  4Z7Y A;  5LMN E;  4FW7 A;  2X7I A;  1HK7 A;  4JI7 E;  2V2Q A;  3HKM A;  4USK A;  3GLL A;  3GON A;  4ZVI A;  1OJ4 A;  4LFB E;  1S4E A;  2JE6 A;  2E5L E;  5DNL A;  4MYT A;  2IER A;  4FN5 A;  3M6A A;  1Z0E A;  2C39 A;  4HYM A;  4DV6 I;  4K0K I;  2Q2E B;  3OTO I;  1MX0 A;  3Q1Q A;  4OO1 E;  3WU6 A;  1Z59 A;  4JV5 I;  1Z0W A;  2IES A;  3ZKD A;  4KHP E;  1FWL A;  1UEK A;  4LF8 E;  4B3T E;  4RPF A;  4DXL A;  1N34 E;  2V8P A;  2PO2 B;  4DV1 E;  4JI7 I;  2HKE A;  3K85 A;  5JEA A;  4UT4 A;  3J81 Q;  5A2Q C;  4JI6 I;  4IS9 A;  4N3O A;  1K47 A;  5K36 D;  4LF8 I;  4KHP I;  5FLX C;  2A2D A;  1ZXN A;  4JI1 E;  5IT9 Q;  1N0V C;  1USV A;  5EL9 A;  2BA1 D;  4B3T I;  3B82 A;  3T1Y E;  4EMD A;  2O1T A;  4NXM E;  1D6T A;  4LCG A;  2UXB I;  1H74 A;  1BKN A;  4DU8 A;  1FKA E;  4DR5 I;  2GS8 A;  4OKG A;  1I94 E;  3PS1 A;  4NXN E;  4DV6 E;  4K0K E;  3P06 A;  4Z7C A;  3P76 A;  3ZM7 A;  2GO3 A;  3P3C A;  3F0N A;  4DV7 E;  1HNZ I;  4FW6 A;  2VQF I;  4DV2 E;  1N33 I;  4LF6 E;  4GQU A;  4JI0 I;  1H72 C;  2ZIT A;  1USU A;  3PS3 A;  3QT8 A;  2JE6 B;  2JT2 A;  5LMN I;  4OO1 B;  1PVG A;  3U1Y A;  4DV1 I;  4NXN I;  1U2R A;  1UDN A;  4DR5 E;  4B3M E;  2DEJ A;  2GO4 A;  4FWD A;  2Z5C A;  4JI8 E;  2AE8 A;  1ZM4 A;  4DV0 E;  5LMU E;  2VES A;  1KTV A;  1IBM I;  4JV5 E;  1WUU A;  2HKJ A;  1Z5C A;  1Z0B A;  2Z5B A;  4YHH E;  4OO1 F;  5LMU I;  4LCF A;  4DR2 E;  4FW5 A;  2E5L I;  2UXC I;  3GME A;  4HXZ A;  5JEA F;  1ZM2 A;  4JI0 E; 
#chains in the Genus database with same CATH homology
 3J80 Q;  4GKJ I;  1PIE A;  4DV3 E;  1ZM3 A;  4IZJ B;  3H4L A;  3OTO E;  1XHK A;  1HR0 E;  4X62 E;  4X65 I;  4NXM I;  3Q6M A;  1N0U A;  2CG9 A;  1XMO I;  3LNU A;  2V2V A;  2V2Z A;  5FWK A;  4JI4 E;  4JI6 E;  1ZM2 A;  4DR6 E;  3J80 C;  5FLX Q;  4FW9 A;  4WUB A;  4LFA E;  3LTO A;  1RRE A;  1MU5 A;  1HNX E;  4IZK A;  2Z5C B;  4LF7 I;  1IBL I;  1S16 A;  4M1K A;  5BR8 I;  4DPY A;  4I3H A;  4WUD A;  4LF4 I;  4ED4 A;  4HAC A;  4LFB I;  2UU9 E;  2CGE A;  4DR1 E;  1B63 A;  1H73 A;  3HJC A;  4JI3 I;  4R1F A;  1ELO A;  1H7S A;  4DV5 I;  3Q6N A;  4X66 I;  2BM1 A;  4DPT A;  4DR7 E;  2UUB I;  1FJG E;  2R3V A;  1NHJ A;  4PU9 A;  2UUA I;  2VQE I;  2F4V I;  2ZM6 I;  1KKH A;  1NZ0 A;  3PYG A;  4JI5 I;  2OI2 A;  4IZK B;  4X64 E;  5IWA E;  3V2U C;  4YY3 I;  1HNW I;  2VF3 A;  4LF5 E;  4B3R I;  4GKK I;  1KVK A;  2R42 A;  4JYA I;  4DR3 I;  2UUC I;  1XMQ E;  3LPS A;  4DV4 I;  5GME A;  2XEX A;  4DUZ I;  4OX9 E;  2HFS A;  5GMD A;  2UXD E;  1FNM A;  1N32 I;  2ZBK B;  4AQY E;  1RR9 A;  2LJP A;  3QT5 A;  1N36 E;  1FWK A;  4DV4 E;  4LFC I;  3K17 A;  3ZZ0 A;  1IBK E;  4DR4 E;  4WUC A;  1NHI A;  3WU5 A;  2BV3 A;  5IT9 C;  1N36 I;  1DAR A;  4DUY E;  3K1J A;  2HHH E;  1Y6Z A;  1XNR I;  1XNQ E;  4HY1 A;  2E1R A;  1IBL E;  4DUZ E;  2HK2 A;  2HFU A;  2V34 A;  1Y4S A;  2UUA E;  1H7U A;  4DR6 I;  1XNQ I;  4FWG A;  4LF9 E;  4DUY I;  1MG7 A;  4DV5 E;  1B62 A;  3J81 C;  5IWA I;  1Z5A A;  3B8H A;  4DPX A;  3PYF A;  2PNM A;  4LFC E;  1J5E E;  3WU3 A;  2ZM6 E;  1Y4U A;  2F4V E;  4OX9 I;  4JI2 E;  3T1H I;  1J5E I;  4IZJ A;  4HAC B;  4GKJ E;  3ZZT A;  3J7A M;  4B3S I;  2CZ9 A;  4JI3 E;  2IOQ A;  2Z5E A;  3QT7 A;  4DR4 I;  4LF9 I;  4GKK E;  4LF5 I;  4B3R E;  2O1W A;  2Z5B B;  4JI5 E;  1ZXM A;  4B3S E;  3JAM C;  4AQY I;  3D4J A;  4IZJ D;  1N32 E;  3J7A G;  1Z0T A;  1XNR E;  3T1H E;  2HHH I;  4X66 E;  4LFA I;  4X62 I;  2PNL A;  4JI2 I;  2X36 A;  3ZKB A;  1FJG I;  4JG4 A;  2UUB E;  2UUC E;  3WU4 A;  1Z0V A;  1IBK I;  1QZR A;  4DR3 E;  5LL6 R;  2HK3 A;  4P7A A;  4URL A;  4USM A;  2AJ4 A;  2BM0 A;  4LF4 E;  3PYE A;  4P52 A;  2UU9 I;  1I94 I;  4X64 I;  3ZZU A;  3JAM Q;  4X65 E;  2NPF A;  1Z5B A;  2O1V A;  1HNX I;  4FWH A;  2WW4 A;  4DU7 A;  4JYA E;  1EA6 A;  1PKP A;  4DV0 I;  1KIJ A;  3PRY A;  4YY3 E;  1N34 I;  4DR1 I;  4JI4 I;  1A6F A;  4DPW A;  3PYD A;  1Z0C A;  4DV2 I;  2GQ0 A;  1XMO E;  1HR0 I;  4PRV A;  5BR8 E;  4DR7 I;  3V5R A;  2UXD I;  2UXB E;  4B3M I;  2A2C A;  4MYU A;  1NHH A;  1Z0G A;  1XMQ I;  4DV3 I;  2J7K A;  1ZM9 A;  4JI1 I;  1EI1 A;  4LF6 I;  1N33 E;  2VQF E;  5A2Q Q;  4DV7 I;  1HNZ E;  3B78 A;  3HUL A;  1HNW E;  4KQV A;  4YHH I;  3CWV A;  2UXC E;  4DR2 I;  4UTG A;  4LF7 E;  2EFG A;  3QT6 A;  4JI8 I;  4DPU A;  3T1Y I;  2VQE E;  1FI4 A;  2IOP A;  4PRX A;  1IBM E;  2O1U A;  2DEI A;  1VIS A;  4XTJ A;  4Z7Y A;  5LMN E;  2X7I A;  1HK7 A;  4JI7 E;  2V2Q A;  4USK A;  3GON A;  4ZVI A;  1OJ4 A;  4LFB E;  1S4E A;  2E5L E;  4MYT A;  4FN5 A;  3M6A A;  1Z0E A;  4HYM A;  4DV6 I;  4K0K I;  2Q2E B;  3OTO I;  1MX0 A;  3Q1Q A;  3WU6 A;  1Z59 A;  4JV5 I;  1Z0W A;  3ZKD A;  4KHP E;  1FWL A;  1UEK A;  4LF8 E;  4B3T E;  4RPF A;  4DXL A;  1N34 E;  2V8P A;  4DV1 E;  4JI7 I;  2HKE A;  3K85 A;  4UT4 A;  3J81 Q;  5A2Q C;  4JI6 I;  4N3O A;  1K47 A;  4LF8 I;  4KHP I;  5FLX C;  2A2D A;  1ZXN A;  4JI1 E;  5IT9 Q;  1N0V C;  1USV A;  4B3T I;  3B82 A;  3T1Y E;  4EMD A;  2O1T A;  4NXM E;  1D6T A;  2UXB I;  1H74 A;  1BKN A;  4DU8 A;  1FKA E;  4DR5 I;  2GS8 A;  1I94 E;  4NXN E;  4DV6 E;  4K0K E;  3P06 A;  4Z7C A;  3ZM7 A;  3F0N A;  4DV7 E;  1HNZ I;  4DV2 E;  2VQF I;  1N33 I;  4LF6 E;  4JI0 I;  1H72 C;  2ZIT A;  1USU A;  3QT8 A;  5LMN I;  1PVG A;  4DV1 I;  4NXN I;  1U2R A;  4DR5 E;  4B3M E;  2DEJ A;  4FWD A;  2Z5C A;  4JI8 E;  1ZM4 A;  4DV0 E;  5LMU E;  1KTV A;  1IBM I;  4JV5 E;  1WUU A;  2HKJ A;  1Z5C A;  1Z0B A;  2Z5B A;  4YHH E;  5LMU I;  4DR2 E;  2E5L I;  2UXC I;  4HXZ A;  5L3J A;  4JI0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...