4X66I

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 24
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4x66I00
4USMA 3ZZTA 2Q2EB 1XMQE 1S4EA 2EFGA 4FN5A 2UXBE 1H7UA 1U2RA 4DR6E 2HKJA 4K0KE 1EA6A 4HXZA 4X64E 4DXLA 2V2ZA 1N36I 4JV5I 4DU7A 1N32E 3QT5A 1UEKA 4B3SI 1FJGI 5BR8I 2UXCE 3ZKDA 4LF5I 5FLXC 1Z5CA 4JI0I 3D4JA 4DPWA 4DV2E 4LF9E 4EMDA 5LMUE 4DUYI 1HNZI 1KKHA 4DR3I 4JG4A 2UXDI 4X66I 4DPTA 4DV1E 4DV5I 3T1YE 4X62E 1J5EE 4Z7YA 2A2DA 3LNUA 1Z59A 4GKJI 4JYAI 1QZRA 2VQEE 1NHHA 4DU8A 1WUUA 2R42A 4JI1E 2V2VA 4MYTA 1BKNA 1PKPA 1VISA 5IWAE 2UU9E 4DV6I 2ZM6I 4DV3I 4MYUA 4DPXA 4B3ME 4DV7I 4KHPI 1HNXI 2OI2A 4DV4I 3OTOE 1KVKA 2XEXA 1A6FA 2HK2A 4RPFA 4AQYE 1HNWE 5A2QQ 5A2QC 4DPUA 2NPFA 4LF7E 4HACA 4JI7I 4WUBA 1IBME 1XMOE 4FWHA 4JI2I 4LF8E 2DEJA 3ZKBA 4YY3E 4DR5I 4LFCE 4NXNE 1XNRE 3PYEA 2VQFI 3T1HI 1N33I 4USKA 3CWVA 1XNQE 1ZM2A 2E1RA 3V2UC 4JI4I 1IBLE 1Z5BA 4DUZI 1NHIA 1XMQI 4FWDA 3QT7A 2HFUA 3J81Q 4YHHE 3PYFA 2HHHE 2UXBI 4XTJA 1Z0GA 4DR6I 4LF6E 1EI1A 4K0KI 3B82A 3ZZ0A 1D6TA 4ZVIA 4HY1A 1ZXNA 4PU9A 3ZM7A 2E5LE 1KTVA 1N32I 3K1JA 2UXCI 1MX0A 4URLA 4LFBE 4NXMI 5L3JA 4DV2I 3F0NA 4LF9I 5LMUI 1MG7A 1OJ4A 3WU4A 1K47A 1H72C 4UTGA 4UT4A 1MU5A 4HACB 1NHJA 4B3TE 4M1KA 2V8PA 3H4LA 4B3RI 4X62I 2X36A 2V34A 1I94E 4GKKI 4DR7I 4OX9E 1N36E 4JV5E 4JI1I 4JI6E 1H7SA 4FWGA 3J7AG 5BR8E 5IWAI 2UU9I 2UUCE 2HFSA 2CZ9A 3ZZUA 1S16A 1Z0CA 4B3MI 1Z0EA 3J80Q 1N34I 4LF4E 3J80C 4DUYE 4LFAE 4DR3E 3OTOI 4DR4E 3B8HA 3WU3A 2GS8A 4I3HA 4Z7CA 1ZM9A 1HNWI 4GKJE 2ZBKB 4JI5I 5GMDA 1IBKE 4JI3I 2F4VE 1XMOI 4X65E 1KIJA 1HR0E 4YY3I 1FKAE 1N0VC 4DV3E 4WUDA 4LFCI 4DV7E 4KHPE 1N0UA 4DR1E 1XNQI 2UUAE 2V2QA 1Z0TA 4DR2E 1ZM4A 3J7AM 4JI8E 2BV3A 2HHHI 3LPSA 2BM0A 4JI7E 4LF6I 3J81C 3PYDA 1Z0VA 4JI2E 2E5LI 3WU6A 3B78A 3QT6A 4DV0E 2UUBE 3HULA 1ELOA 4X64I 5LMNE 2HK3A 1Z5AA 2VF3A 1DARA 4PRVA 2BM1A 3LTOA 3JAMQ 4JI4E 4LFBI 3JAMC 4DUZE 4KQVA 2X7IA 2ZITA 4WUCA 1FWKA 4B3TI 1I94I 4DV1I 1ZXMA 3T1YI 4OX9I 1J5EI 4JI6I 1PVGA 2VQEI 5IT9Q 5IT9C 5FLXQ 2UUCI 4B3SE 1FJGE 4NXME 1RR9A 4LF4I 4LF5E 1H74A 4JI0E 4LFAI 3K17A 2WW4A 1XHKA 4DR4I 1RREA 1Z0BA 1HNZE 4B3RE 2UXDE 4X66E 4GKKE 4DR7E 4DV5E 4AQYI 2J7KA 1IBKI 2AJ4A 2F4VI 4JYAE 4X65I 1H73A 1ZM3A 3WU5A 1HR0I 4LF7I 3Q1QA 1IBMI 4ED4A 2LJPA 4DV6E 4LF8I 1N34E 4DR1I 2UUAI 2ZM6E 2DEIA 4NXNI 4PRXA 1XNRI 4DR2I 4FW9A 3QT8A 2R3VA 1HNXE 4DV4E 4JI8I 1FWLA 1FNMA 2A2CA 1IBLI 3V5RA 5GMEA 4P52A 4JI5E 4JI3E 4HYMA 1B62A 3GONA 4YHHI 1NZ0A 1FI4A 4P7AA 1B63A 4DV0I 2UUBI 2HKEA 5LMNI 1PIEA 3M6AA 3PYGA 5LL6R 4R1FA 4DR5E 1Z0WA 4DPYA 2VQFE 3T1HE 1N33E
chains in the Genus database with same CATH superfamily
4USMA 1YHCA 2BA1D 3ZZTA 2GO3A 2Q2EB 4MU3A 4LCHA 1XMQE 1S4EA 2GO4A 3CDJA 2EFGA 4OO1D 3H1CA 5K36F 4FN5A 2UXBE 2VESA 1H7UA 5C0XD 1U2RA 4DR6E 2HKJA 4K0KE 4FW5A 1EA6A 4HXZA 4X64E 4DXLA 1Y6ZA 2CG9A 2IERA 4AM3A 2V2ZA 1N36I 4JV5I 4DU7A 1N32E 3QT5A 4MDTA 1UEKA 4B3SI 1FJGI 4GQUA 2IOQA 5BR8I 2UXCE 5JEAE 3ZKDA 4LF5I 2NN6D 5FLXC 1Z5CA 4JI0I 1UDOA 2BR2A 3D4JA 4DPWA 4DV2E 3UHMA 4LF9E 5K36A 4EMDA 5LMUE 2F1DA 5DNXA 3P3CA 4DUYI 1HNZI 1KKHA 2O3ZA 4IZKA 4DR3I 4JG4A 2UXDI 3P06A 4X66I 4DPTA 4DV1E 3PS3A 4DV5I 4J3DA 3T1YE 4X62E 1J5EE 4Z7YA 2A2DA 3LNUA 1Z59A 4GKJI 4IFDE 2C39B 4JYAI 1QZRA 2VQEE 1NHHA 4QNKA 4DU8A 1WUUA 2R42A 2AE8A 4JI1E 2JEAB 2V2VA 4MYTA 1BKNA 1PKPA 1VISA 1YH8A 4BA2A 5IWAE 2UU9E 4DV6I 2ZM6I 4DV3I 4MYUA 5K36C 3M85G 4LCFA 4DPXA 1VI7A 4B3ME 4DV7I 4KHPI 1HNXI 2OI2A 4DV4I 2BA0D 3M7NG 3OTOE 4FW6A 3U1KA 1KVKA 2XEXA 1A6FA 2HK2A 4RPFA 4AQYE 1HNWE 5A2QQ 4OO1E 5A2QC 4DPUA 2NPFA 4LF7E 4HACA 4JI7I 4WUBA 1IBME 1XMOE 2Z5BA 4FWHA 2J65A 5EKWA 4JI2I 4LF8E 2DEJA 3ZKBA 4YY3E 2BR2B 4U3BA 4DR5I 3GMEA 4LFCE 4NXNE 1XNRE 3PYEA 2VQFI 3HJCA 3T1HI 1N33I 1R6MA 2JE6A 3CWVA 4USKA 1XNQE 2NN6E 4IZKB 1ZM2A 2E1RA 3V2UC 3CDIA 4JI4I 3GLLA 5ELWA 1IBLE 1Z5BA 3K85A 1NHIA 4DUZI 4IZJA 5FWKA 1XMQI 4FWDA 3QT7A 2HFUA 2PNLA 3J81Q 4MQYA 4YHHE 3PYFA 2BA0G 2HHHE 2UXBI 4XTJA 1Z0GA 2JEBA 4DR6I 4LF6E 1EI1A 4ISAA 4K0KI 4BA2B 3B82A 3ZZ0A 1D6TA 4ZVIA 4HY1A 1ZXNA 4PU9A 3ZM7A 2E5LE 3U1YA 1KTVA 1N32I 4N3OA 3K1JA 4LCGA 1UDNA 2IESA 2PNZB 2UXCI 1MX0A 1P42A 4URLA 5DRPA 4MU4A 1XXEA 4LFBE 2JT2A 4NXMI 5L3JA 4DV2I 3F0NA 4LF9I 5LMUI 1MG7A 1OJ4A 3WU4A 1K47A 1OYSA 2GQ0A 3GCMA 4BA1A 1H72C 4UTGA 2PO2A 2C37B 4UT4A 1MU5A 4HACB 1NHJA 2CGEA 4M1KA 4B3TE 2V8PA 3H4LA 4B3RI 4X62I 2Z5BB 5C0XA 2BA1G 2X36A 2V34A 1I94E 4GKKI 4DR7I 5DRQA 4OX9E 1N36E 4JV5E 4JI1I 4JI6E 1H7SA 4FWGA 3PS1A 2JE6B 3J7AG 5BR8E 5IWAI 2UU9I 2UUCE 2HFSA 2CZ9A 3ZZUA 1S16A 1Z0CA 4B3MI 4IZJB 1Z0EA 3J80Q 1N34I 4AIDA 4LF4E 3J80C 4DUYE 4LFAE 4DR3E 3OTOI 4DR4E 3B8HA 2JEBB 5JEAF 2PO0A 3WU3A 2GS8A 3NZKA 4I3HA 4Z7CA 1ZM9A 1HNWI 4GKJE 1OYPA 3P3EA 2ZBKB 4JI5I 2PO1A 5GMDA 1IBKE 3L7ZA 4JI3I 2F4VE 1XMOI 4X65E 1KIJA 4OKGA 1HR0E 4YY3I 1FKAE 1N0VC 1Y5YA 4DV3E 4WUDA 4LFCI 4IFDF 4DV7E 2CVEA 1N0UA 4DR1E 4KHPE 5JEAA 1XNQI 2UUAE 4BA1B 2V2QA 2PO2B 1Z0TA 5K36B 2C38A 4DR2E 5K36E 4IZJD 1R6LA 1ZM4A 1Y4UA 3J7AM 4JI8E 2BV3A 2WNRA 2HHHI 3LPSA 2Z5EA 2BM0A 4JI7E 4LF6I 4IFDA 3J81C 3PYDA 1Z0VA 4JI2E 5DROA 2O1TA 2E5LI 3WU6A 3B78A 2PNMA 3QT6A 3KRNA 4DV0E 2UUBE 3HULA 3Q6MA 1ELOA 2IOPA 4X64I 2O1UA 5JEAC 5LMNE 2HK3A 4OO1F 1Z5AA 2VF3A 4OZEA 4FW4A 1DARA 4PRVA 5C0XF 2BM1A 3LTOA 3JAMQ 4JI4E 4LFBI 3JAMC 2PO0B 2O1WA 4KQVA 4DUZE 4MU0A 2X7IA 2ZITA 4WUCA 5K36D 2PO1B 4IFDC 1FWKA 4QNJA 3L7ZB 4B3TI 4MU1A 2NN6F 4OO1A 1I94I 4DV1I 1ZXMA 4FW3A 3M85D 3T1YI 4OX9I 2O1VA 1UDSA 1J5EI 4JI6I 3Q6NA 1PVGA 2WP8A 2VQEI 3DD6A 5JEAB 5IT9Q 5IT9C 4LOMA 3M7ND 5FLXQ 2UUCI 2Z5CA 3B4TA 2C38B 4B3SE 1FJGE 4NXME 1RR9A 4LF4I 4LF5E 1H74A 1OYRA 2NN6A 4JI0E 4LFAI 5EL9A 4U3DA 3K17A 2WW4A 4NBQA 1XHKA 2WNRB 4DR4I 1RREA 1Z0BA 3P76A 4OO1C 1HNZE 4IFDB 4B3RE 5C0XC 2UXDE 4X66E 4GKKE 4DR7E 4DV5E 4AQYI 2J7KA 1IBKI 2AJ4A 3PS2A 1USUA 2F4VI 4JYAE 4X65I 1H73A 1ZM3A 1Y60A 3WU5A 1HR0I 4LF7I 3Q1QA 3HKMA 1IBMI 1UDQA 2NN6C 4ED4A 2LJPA 4DV6E 4AIMA 4LF8I 5JEAD 4DR1I 1N34E 2UUAI 3P3GA 2ZM6E 2PNZA 2DEIA 4NXNI 4PRXA 1XNRI 5DRRA 1E3HA 4DR2I 4FW9A 5DNLA 4IS9A 1Y4SA 4LPFA 3QT8A 2R3VA 1HNXE 4DV4E 4OO1B 4JI8I 1FWLA 1FNMA 2A2CA 4FW7A 1IBLI 3V5RA 5GMEA 5C0XB 4P52A 2C37A 4JI5E 5C0XE 4JI3E 2WP8B 4HYMA 4IFDD 1B62A 3GONA 4YHHI 1NZ0A 1FI4A 2Z5CB 3PRYA 4P7AA 1B63A 1USVA 4DV0I 2UUBI 2HKEA 5LMNI 1PIEA 2C39A 1RHYA 3M6AA 2NN6B 3PYGA 1HK7A 5LL6R 4R1FA 4DR5E 1Z0WA 2JEAA 4DPYA 2VQFE 3T1HE 1N33E 1E3PA
chains in the Genus database with same CATH topology
4USMA 3ZZTA 2Q2EB 1XMQE 1S4EA 2EFGA 4FN5A 2UXBE 1H7UA 1U2RA 4DR6E 2HKJA 4K0KE 1EA6A 4HXZA 4X64E 4DXLA 1Y6ZA 2CG9A 2V2ZA 1N36I 4JV5I 4DU7A 1N32E 3QT5A 1UEKA 4B3SI 1FJGI 2IOQA 5BR8I 2UXCE 3ZKDA 4LF5I 5FLXC 1Z5CA 4JI0I 3D4JA 4DPWA 4DV2E 4LF9E 4EMDA 5LMUE 4DUYI 1HNZI 1KKHA 4IZKA 4DR3I 4JG4A 2UXDI 3P06A 4X66I 4DPTA 4DV1E 4DV5I 3T1YE 4X62E 1J5EE 4Z7YA 2A2DA 3LNUA 1Z59A 4GKJI 4JYAI 1QZRA 2VQEE 1NHHA 4DU8A 1WUUA 2R42A 4JI1E 2V2VA 4MYTA 1BKNA 1PKPA 1VISA 5IWAE 2UU9E 4DV6I 2ZM6I 4DV3I 4MYUA 4DPXA 4B3ME 4DV7I 4KHPI 1HNXI 2OI2A 4DV4I 3OTOE 1KVKA 2XEXA 1A6FA 2HK2A 4RPFA 4AQYE 1HNWE 5A2QQ 5A2QC 4DPUA 2NPFA 4LF7E 4HACA 4JI7I 4WUBA 1IBME 1XMOE 2Z5BA 4FWHA 4JI2I 4LF8E 2DEJA 3ZKBA 4YY3E 4DR5I 4LFCE 4NXNE 1XNRE 3PYEA 2VQFI 3HJCA 3T1HI 1N33I 4USKA 3CWVA 1XNQE 4IZKB 1ZM2A 2E1RA 3V2UC 4JI4I 1IBLE 1Z5BA 3K85A 1NHIA 4DUZI 4IZJA 5FWKA 1XMQI 4FWDA 3QT7A 2HFUA 2PNLA 3J81Q 4YHHE 3PYFA 2HHHE 2UXBI 4XTJA 1Z0GA 4DR6I 4LF6E 1EI1A 4K0KI 3B82A 3ZZ0A 1D6TA 4ZVIA 4HY1A 1ZXNA 4PU9A 3ZM7A 2E5LE 1KTVA 1N32I 4N3OA 3K1JA 2UXCI 1MX0A 4URLA 4LFBE 4NXMI 5L3JA 4DV2I 3F0NA 4LF9I 5LMUI 1MG7A 1OJ4A 3WU4A 1K47A 2GQ0A 1H72C 4UTGA 4UT4A 1MU5A 4HACB 1NHJA 2CGEA 4M1KA 4B3TE 2V8PA 3H4LA 4B3RI 4X62I 2Z5BB 2X36A 2V34A 1I94E 4GKKI 4DR7I 4OX9E 1N36E 4JV5E 4JI1I 4JI6E 1H7SA 4FWGA 3J7AG 5BR8E 5IWAI 2UU9I 2UUCE 2HFSA 2CZ9A 3ZZUA 1S16A 1Z0CA 4B3MI 4IZJB 1Z0EA 3J80Q 1N34I 4LF4E 3J80C 4DUYE 4LFAE 4DR3E 3OTOI 4DR4E 3B8HA 3WU3A 2GS8A 4I3HA 4Z7CA 1ZM9A 1HNWI 4GKJE 2ZBKB 4JI5I 5GMDA 1IBKE 4JI3I 2F4VE 1XMOI 4X65E 1KIJA 1HR0E 4YY3I 1FKAE 1N0VC 4DV3E 4WUDA 4LFCI 4DV7E 4KHPE 1N0UA 4DR1E 1XNQI 2UUAE 2V2QA 1Z0TA 4DR2E 4IZJD 1ZM4A 1Y4UA 3J7AM 4JI8E 2BV3A 2HHHI 3LPSA 2Z5EA 2BM0A 4JI7E 4LF6I 3J81C 3PYDA 1Z0VA 4JI2E 2O1TA 2E5LI 3WU6A 3B78A 2PNMA 3QT6A 4DV0E 2UUBE 3HULA 3Q6MA 1ELOA 2IOPA 4X64I 2O1UA 5LMNE 2HK3A 1Z5AA 2VF3A 1DARA 4PRVA 2BM1A 3LTOA 3JAMQ 4JI4E 4LFBI 3JAMC 2O1WA 4KQVA 4DUZE 2X7IA 2ZITA 4WUCA 1FWKA 4B3TI 1I94I 4DV1I 1ZXMA 3T1YI 4OX9I 2O1VA 1J5EI 4JI6I 3Q6NA 1PVGA 2VQEI 5IT9Q 5IT9C 5FLXQ 2UUCI 2Z5CA 4B3SE 1FJGE 4NXME 1RR9A 4LF4I 4LF5E 1H74A 4JI0E 4LFAI 3K17A 2WW4A 1XHKA 4DR4I 1RREA 1Z0BA 1HNZE 4B3RE 2UXDE 4X66E 4GKKE 4DR7E 4DV5E 4AQYI 2J7KA 1IBKI 2AJ4A 1USUA 2F4VI 4JYAE 4X65I 1H73A 1ZM3A 3WU5A 1HR0I 4LF7I 3Q1QA 1IBMI 4ED4A 2LJPA 4DV6E 4LF8I 1N34E 4DR1I 2UUAI 2ZM6E 2DEIA 4NXNI 4PRXA 1XNRI 4DR2I 4FW9A 1Y4SA 3QT8A 2R3VA 1HNXE 4DV4E 4JI8I 1FWLA 1FNMA 2A2CA 1IBLI 3V5RA 5GMEA 4P52A 4JI5E 4JI3E 4HYMA 1B62A 3GONA 4YHHI 1NZ0A 1FI4A 2Z5CB 3PRYA 4P7AA 1B63A 1USVA 4DV0I 2UUBI 2HKEA 5LMNI 1PIEA 3M6AA 3PYGA 1HK7A 5LL6R 4R1FA 4DR5E 1Z0WA 4DPYA 2VQFE 3T1HE 1N33E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USM A;  3ZZT A;  2Q2E B;  1XMQ E;  1S4E A;  2EFG A;  4FN5 A;  2UXB E;  1H7U A;  1U2R A;  4DR6 E;  2HKJ A;  4K0K E;  1EA6 A;  4HXZ A;  4X64 E;  4DXL A;  2V2Z A;  1N36 I;  4JV5 I;  4DU7 A;  1N32 E;  3QT5 A;  1UEK A;  4B3S I;  1FJG I;  5BR8 I;  2UXC E;  3ZKD A;  4LF5 I;  5FLX C;  1Z5C A;  4JI0 I;  3D4J A;  4DPW A;  4DV2 E;  4LF9 E;  4EMD A;  5LMU E;  4DUY I;  1HNZ I;  1KKH A;  4DR3 I;  4JG4 A;  2UXD I;  4X66 I;  4DPT A;  4DV1 E;  4DV5 I;  3T1Y E;  4X62 E;  1J5E E;  4Z7Y A;  2A2D A;  3LNU A;  1Z59 A;  4GKJ I;  4JYA I;  1QZR A;  2VQE E;  1NHH A;  4DU8 A;  1WUU A;  2R42 A;  4JI1 E;  2V2V A;  4MYT A;  1BKN A;  1PKP A;  1VIS A;  5IWA E;  2UU9 E;  4DV6 I;  2ZM6 I;  4DV3 I;  4MYU A;  4DPX A;  4B3M E;  4DV7 I;  4KHP I;  1HNX I;  2OI2 A;  4DV4 I;  3OTO E;  1KVK A;  2XEX A;  1A6F A;  2HK2 A;  4RPF A;  4AQY E;  1HNW E;  5A2Q Q;  5A2Q C;  4DPU A;  2NPF A;  4LF7 E;  4HAC A;  4JI7 I;  4WUB A;  1IBM E;  1XMO E;  4FWH A;  4JI2 I;  4LF8 E;  2DEJ A;  3ZKB A;  4YY3 E;  4DR5 I;  4LFC E;  4NXN E;  1XNR E;  3PYE A;  2VQF I;  3T1H I;  1N33 I;  4USK A;  3CWV A;  1XNQ E;  1ZM2 A;  2E1R A;  3V2U C;  4JI4 I;  1IBL E;  1Z5B A;  4DUZ I;  1NHI A;  1XMQ I;  4FWD A;  3QT7 A;  2HFU A;  3J81 Q;  4YHH E;  3PYF A;  2HHH E;  2UXB I;  4XTJ A;  1Z0G A;  4DR6 I;  4LF6 E;  1EI1 A;  4K0K I;  3B82 A;  3ZZ0 A;  1D6T A;  4ZVI A;  4HY1 A;  1ZXN A;  4PU9 A;  3ZM7 A;  2E5L E;  1KTV A;  1N32 I;  3K1J A;  2UXC I;  1MX0 A;  4URL A;  4LFB E;  4NXM I;  5L3J A;  4DV2 I;  3F0N A;  4LF9 I;  5LMU I;  1MG7 A;  1OJ4 A;  3WU4 A;  1K47 A;  1H72 C;  4UTG A;  4UT4 A;  1MU5 A;  4HAC B;  1NHJ A;  4B3T E;  4M1K A;  2V8P A;  3H4L A;  4B3R I;  4X62 I;  2X36 A;  2V34 A;  1I94 E;  4GKK I;  4DR7 I;  4OX9 E;  1N36 E;  4JV5 E;  4JI1 I;  4JI6 E;  1H7S A;  4FWG A;  3J7A G;  5BR8 E;  5IWA I;  2UU9 I;  2UUC E;  2HFS A;  2CZ9 A;  3ZZU A;  1S16 A;  1Z0C A;  4B3M I;  1Z0E A;  3J80 Q;  1N34 I;  4LF4 E;  3J80 C;  4DUY E;  4LFA E;  4DR3 E;  3OTO I;  4DR4 E;  3B8H A;  3WU3 A;  2GS8 A;  4I3H A;  4Z7C A;  1ZM9 A;  1HNW I;  4GKJ E;  2ZBK B;  4JI5 I;  5GMD A;  1IBK E;  4JI3 I;  2F4V E;  1XMO I;  4X65 E;  1KIJ A;  1HR0 E;  4YY3 I;  1FKA E;  1N0V C;  4DV3 E;  4WUD A;  4LFC I;  4DV7 E;  4KHP E;  1N0U A;  4DR1 E;  1XNQ I;  2UUA E;  2V2Q A;  1Z0T A;  4DR2 E;  1ZM4 A;  3J7A M;  4JI8 E;  2BV3 A;  2HHH I;  3LPS A;  2BM0 A;  4JI7 E;  4LF6 I;  3J81 C;  3PYD A;  1Z0V A;  4JI2 E;  2E5L I;  3WU6 A;  3B78 A;  3QT6 A;  4DV0 E;  2UUB E;  3HUL A;  1ELO A;  4X64 I;  5LMN E;  2HK3 A;  1Z5A A;  2VF3 A;  1DAR A;  4PRV A;  2BM1 A;  3LTO A;  3JAM Q;  4JI4 E;  4LFB I;  3JAM C;  4DUZ E;  4KQV A;  2X7I A;  2ZIT A;  4WUC A;  1FWK A;  4B3T I;  1I94 I;  4DV1 I;  1ZXM A;  3T1Y I;  4OX9 I;  1J5E I;  4JI6 I;  1PVG A;  2VQE I;  5IT9 Q;  5IT9 C;  5FLX Q;  2UUC I;  4B3S E;  1FJG E;  4NXM E;  1RR9 A;  4LF4 I;  4LF5 E;  1H74 A;  4JI0 E;  4LFA I;  3K17 A;  2WW4 A;  1XHK A;  4DR4 I;  1RRE A;  1Z0B A;  1HNZ E;  4B3R E;  2UXD E;  4X66 E;  4GKK E;  4DR7 E;  4DV5 E;  4AQY I;  2J7K A;  1IBK I;  2AJ4 A;  2F4V I;  4JYA E;  4X65 I;  1H73 A;  1ZM3 A;  3WU5 A;  1HR0 I;  4LF7 I;  3Q1Q A;  1IBM I;  4ED4 A;  2LJP A;  4DV6 E;  4LF8 I;  1N34 E;  4DR1 I;  2UUA I;  2ZM6 E;  2DEI A;  4NXN I;  4PRX A;  1XNR I;  4DR2 I;  4FW9 A;  3QT8 A;  2R3V A;  1HNX E;  4DV4 E;  4JI8 I;  1FWL A;  1FNM A;  2A2C A;  1IBL I;  3V5R A;  5GME A;  4P52 A;  4JI5 E;  4JI3 E;  4HYM A;  1B62 A;  3GON A;  4YHH I;  1NZ0 A;  1FI4 A;  4P7A A;  1B63 A;  4DV0 I;  2UUB I;  2HKE A;  5LMN I;  1PIE A;  3M6A A;  3PYG A;  5LL6 R;  4R1F A;  4DR5 E;  1Z0W A;  4DPY A;  2VQF E;  3T1H E;  1N33 E; 
#chains in the Genus database with same CATH topology
 4USM A;  1YHC A;  2BA1 D;  3ZZT A;  2GO3 A;  2Q2E B;  4MU3 A;  4LCH A;  1XMQ E;  1S4E A;  2GO4 A;  3CDJ A;  2EFG A;  4OO1 D;  3H1C A;  5K36 F;  4FN5 A;  2UXB E;  2VES A;  1H7U A;  5C0X D;  1U2R A;  4DR6 E;  2HKJ A;  4K0K E;  4FW5 A;  1EA6 A;  4HXZ A;  4X64 E;  4DXL A;  1Y6Z A;  2CG9 A;  2IER A;  4AM3 A;  2V2Z A;  1N36 I;  4JV5 I;  4DU7 A;  1N32 E;  3QT5 A;  4MDT A;  1UEK A;  4B3S I;  1FJG I;  4GQU A;  2IOQ A;  5BR8 I;  2UXC E;  5JEA E;  3ZKD A;  4LF5 I;  2NN6 D;  5FLX C;  1Z5C A;  4JI0 I;  1UDO A;  2BR2 A;  3D4J A;  4DPW A;  4DV2 E;  3UHM A;  4LF9 E;  5K36 A;  4EMD A;  5LMU E;  2F1D A;  5DNX A;  3P3C A;  4DUY I;  1HNZ I;  1KKH A;  2O3Z A;  4IZK A;  4DR3 I;  4JG4 A;  2UXD I;  3P06 A;  4X66 I;  4DPT A;  4DV1 E;  3PS3 A;  4DV5 I;  4J3D A;  3T1Y E;  4X62 E;  1J5E E;  4Z7Y A;  2A2D A;  3LNU A;  1Z59 A;  4GKJ I;  4IFD E;  2C39 B;  4JYA I;  1QZR A;  2VQE E;  1NHH A;  4QNK A;  4DU8 A;  1WUU A;  2R42 A;  2AE8 A;  4JI1 E;  2JEA B;  2V2V A;  4MYT A;  1BKN A;  1PKP A;  1VIS A;  1YH8 A;  4BA2 A;  5IWA E;  2UU9 E;  4DV6 I;  2ZM6 I;  4DV3 I;  4MYU A;  5K36 C;  3M85 G;  4LCF A;  4DPX A;  1VI7 A;  4B3M E;  4DV7 I;  4KHP I;  1HNX I;  2OI2 A;  4DV4 I;  2BA0 D;  3M7N G;  3OTO E;  4FW6 A;  3U1K A;  1KVK A;  2XEX A;  1A6F A;  2HK2 A;  4RPF A;  4AQY E;  1HNW E;  5A2Q Q;  4OO1 E;  5A2Q C;  4DPU A;  2NPF A;  4LF7 E;  4HAC A;  4JI7 I;  4WUB A;  1IBM E;  1XMO E;  2Z5B A;  4FWH A;  2J65 A;  5EKW A;  4JI2 I;  4LF8 E;  2DEJ A;  3ZKB A;  4YY3 E;  2BR2 B;  4U3B A;  4DR5 I;  3GME A;  4LFC E;  4NXN E;  1XNR E;  3PYE A;  2VQF I;  3HJC A;  3T1H I;  1N33 I;  1R6M A;  2JE6 A;  3CWV A;  4USK A;  1XNQ E;  2NN6 E;  4IZK B;  1ZM2 A;  2E1R A;  3V2U C;  3CDI A;  4JI4 I;  3GLL A;  5ELW A;  1IBL E;  1Z5B A;  3K85 A;  1NHI A;  4DUZ I;  4IZJ A;  5FWK A;  1XMQ I;  4FWD A;  3QT7 A;  2HFU A;  2PNL A;  3J81 Q;  4MQY A;  4YHH E;  3PYF A;  2BA0 G;  2HHH E;  2UXB I;  4XTJ A;  1Z0G A;  2JEB A;  4DR6 I;  4LF6 E;  1EI1 A;  4ISA A;  4K0K I;  4BA2 B;  3B82 A;  3ZZ0 A;  1D6T A;  4ZVI A;  4HY1 A;  1ZXN A;  4PU9 A;  3ZM7 A;  2E5L E;  3U1Y A;  1KTV A;  1N32 I;  4N3O A;  3K1J A;  4LCG A;  1UDN A;  2IES A;  2PNZ B;  2UXC I;  1MX0 A;  1P42 A;  4URL A;  5DRP A;  4MU4 A;  1XXE A;  4LFB E;  2JT2 A;  4NXM I;  5L3J A;  4DV2 I;  3F0N A;  4LF9 I;  5LMU I;  1MG7 A;  1OJ4 A;  3WU4 A;  1K47 A;  1OYS A;  2GQ0 A;  3GCM A;  4BA1 A;  1H72 C;  4UTG A;  2PO2 A;  2C37 B;  4UT4 A;  1MU5 A;  4HAC B;  1NHJ A;  2CGE A;  4M1K A;  4B3T E;  2V8P A;  3H4L A;  4B3R I;  4X62 I;  2Z5B B;  5C0X A;  2BA1 G;  2X36 A;  2V34 A;  1I94 E;  4GKK I;  4DR7 I;  5DRQ A;  4OX9 E;  1N36 E;  4JV5 E;  4JI1 I;  4JI6 E;  1H7S A;  4FWG A;  3PS1 A;  2JE6 B;  3J7A G;  5BR8 E;  5IWA I;  2UU9 I;  2UUC E;  2HFS A;  2CZ9 A;  3ZZU A;  1S16 A;  1Z0C A;  4B3M I;  4IZJ B;  1Z0E A;  3J80 Q;  1N34 I;  4AID A;  4LF4 E;  3J80 C;  4DUY E;  4LFA E;  4DR3 E;  3OTO I;  4DR4 E;  3B8H A;  2JEB B;  5JEA F;  2PO0 A;  3WU3 A;  2GS8 A;  3NZK A;  4I3H A;  4Z7C A;  1ZM9 A;  1HNW I;  4GKJ E;  1OYP A;  3P3E A;  2ZBK B;  4JI5 I;  2PO1 A;  5GMD A;  1IBK E;  3L7Z A;  4JI3 I;  2F4V E;  1XMO I;  4X65 E;  1KIJ A;  4OKG A;  1HR0 E;  4YY3 I;  1FKA E;  1N0V C;  1Y5Y A;  4DV3 E;  4WUD A;  4LFC I;  4IFD F;  4DV7 E;  2CVE A;  1N0U A;  4DR1 E;  4KHP E;  5JEA A;  1XNQ I;  2UUA E;  4BA1 B;  2V2Q A;  2PO2 B;  1Z0T A;  5K36 B;  2C38 A;  4DR2 E;  5K36 E;  4IZJ D;  1R6L A;  1ZM4 A;  1Y4U A;  3J7A M;  4JI8 E;  2BV3 A;  2WNR A;  2HHH I;  3LPS A;  2Z5E A;  2BM0 A;  4JI7 E;  4LF6 I;  4IFD A;  3J81 C;  3PYD A;  1Z0V A;  4JI2 E;  5DRO A;  2O1T A;  2E5L I;  3WU6 A;  3B78 A;  2PNM A;  3QT6 A;  3KRN A;  4DV0 E;  2UUB E;  3HUL A;  3Q6M A;  1ELO A;  2IOP A;  4X64 I;  2O1U A;  5JEA C;  5LMN E;  2HK3 A;  4OO1 F;  1Z5A A;  2VF3 A;  4OZE A;  4FW4 A;  1DAR A;  4PRV A;  5C0X F;  2BM1 A;  3LTO A;  3JAM Q;  4JI4 E;  4LFB I;  3JAM C;  2PO0 B;  2O1W A;  4KQV A;  4DUZ E;  4MU0 A;  2X7I A;  2ZIT A;  4WUC A;  5K36 D;  2PO1 B;  4IFD C;  1FWK A;  4QNJ A;  3L7Z B;  4B3T I;  4MU1 A;  2NN6 F;  4OO1 A;  1I94 I;  4DV1 I;  1ZXM A;  4FW3 A;  3M85 D;  3T1Y I;  4OX9 I;  2O1V A;  1UDS A;  1J5E I;  4JI6 I;  3Q6N A;  1PVG A;  2WP8 A;  2VQE I;  3DD6 A;  5JEA B;  5IT9 Q;  5IT9 C;  4LOM A;  3M7N D;  5FLX Q;  2UUC I;  2Z5C A;  3B4T A;  2C38 B;  4B3S E;  1FJG E;  4NXM E;  1RR9 A;  4LF4 I;  4LF5 E;  1H74 A;  1OYR A;  2NN6 A;  4JI0 E;  4LFA I;  5EL9 A;  4U3D A;  3K17 A;  2WW4 A;  4NBQ A;  1XHK A;  2WNR B;  4DR4 I;  1RRE A;  1Z0B A;  3P76 A;  4OO1 C;  1HNZ E;  4IFD B;  4B3R E;  5C0X C;  2UXD E;  4X66 E;  4GKK E;  4DR7 E;  4DV5 E;  4AQY I;  2J7K A;  1IBK I;  2AJ4 A;  3PS2 A;  1USU A;  2F4V I;  4JYA E;  4X65 I;  1H73 A;  1ZM3 A;  1Y60 A;  3WU5 A;  1HR0 I;  4LF7 I;  3Q1Q A;  3HKM A;  1IBM I;  1UDQ A;  2NN6 C;  4ED4 A;  2LJP A;  4DV6 E;  4AIM A;  4LF8 I;  5JEA D;  4DR1 I;  1N34 E;  2UUA I;  3P3G A;  2ZM6 E;  2PNZ A;  2DEI A;  4NXN I;  4PRX A;  1XNR I;  5DRR A;  1E3H A;  4DR2 I;  4FW9 A;  5DNL A;  4IS9 A;  1Y4S A;  4LPF A;  3QT8 A;  2R3V A;  1HNX E;  4DV4 E;  4OO1 B;  4JI8 I;  1FWL A;  1FNM A;  2A2C A;  4FW7 A;  1IBL I;  3V5R A;  5GME A;  5C0X B;  4P52 A;  2C37 A;  4JI5 E;  5C0X E;  4JI3 E;  2WP8 B;  4HYM A;  4IFD D;  1B62 A;  3GON A;  4YHH I;  1NZ0 A;  1FI4 A;  2Z5C B;  3PRY A;  4P7A A;  1B63 A;  1USV A;  4DV0 I;  2UUB I;  2HKE A;  5LMN I;  1PIE A;  2C39 A;  1RHY A;  3M6A A;  2NN6 B;  3PYG A;  1HK7 A;  5LL6 R;  4R1F A;  4DR5 E;  1Z0W A;  2JEA A;  4DPY A;  2VQF E;  3T1H E;  1N33 E;  1E3P A; 
#chains in the Genus database with same CATH homology
 4USM A;  3ZZT A;  2Q2E B;  1XMQ E;  1S4E A;  2EFG A;  4FN5 A;  2UXB E;  1H7U A;  1U2R A;  4DR6 E;  2HKJ A;  4K0K E;  1EA6 A;  4HXZ A;  4X64 E;  4DXL A;  1Y6Z A;  2CG9 A;  2V2Z A;  1N36 I;  4JV5 I;  4DU7 A;  1N32 E;  3QT5 A;  1UEK A;  4B3S I;  1FJG I;  2IOQ A;  5BR8 I;  2UXC E;  3ZKD A;  4LF5 I;  5FLX C;  1Z5C A;  4JI0 I;  3D4J A;  4DPW A;  4DV2 E;  4LF9 E;  4EMD A;  5LMU E;  4DUY I;  1HNZ I;  1KKH A;  4IZK A;  4DR3 I;  4JG4 A;  2UXD I;  3P06 A;  4X66 I;  4DPT A;  4DV1 E;  4DV5 I;  3T1Y E;  4X62 E;  1J5E E;  4Z7Y A;  2A2D A;  3LNU A;  1Z59 A;  4GKJ I;  4JYA I;  1QZR A;  2VQE E;  1NHH A;  4DU8 A;  1WUU A;  2R42 A;  4JI1 E;  2V2V A;  4MYT A;  1BKN A;  1PKP A;  1VIS A;  5IWA E;  2UU9 E;  4DV6 I;  2ZM6 I;  4DV3 I;  4MYU A;  4DPX A;  4B3M E;  4DV7 I;  4KHP I;  1HNX I;  2OI2 A;  4DV4 I;  3OTO E;  1KVK A;  2XEX A;  1A6F A;  2HK2 A;  4RPF A;  4AQY E;  1HNW E;  5A2Q Q;  5A2Q C;  4DPU A;  2NPF A;  4LF7 E;  4HAC A;  4JI7 I;  4WUB A;  1IBM E;  1XMO E;  2Z5B A;  4FWH A;  4JI2 I;  4LF8 E;  2DEJ A;  3ZKB A;  4YY3 E;  4DR5 I;  4LFC E;  4NXN E;  1XNR E;  3PYE A;  2VQF I;  3HJC A;  3T1H I;  1N33 I;  4USK A;  3CWV A;  1XNQ E;  4IZK B;  1ZM2 A;  2E1R A;  3V2U C;  4JI4 I;  1IBL E;  1Z5B A;  3K85 A;  1NHI A;  4DUZ I;  4IZJ A;  5FWK A;  1XMQ I;  4FWD A;  3QT7 A;  2HFU A;  2PNL A;  3J81 Q;  4YHH E;  3PYF A;  2HHH E;  2UXB I;  4XTJ A;  1Z0G A;  4DR6 I;  4LF6 E;  1EI1 A;  4K0K I;  3B82 A;  3ZZ0 A;  1D6T A;  4ZVI A;  4HY1 A;  1ZXN A;  4PU9 A;  3ZM7 A;  2E5L E;  1KTV A;  1N32 I;  4N3O A;  3K1J A;  2UXC I;  1MX0 A;  4URL A;  4LFB E;  4NXM I;  5L3J A;  4DV2 I;  3F0N A;  4LF9 I;  5LMU I;  1MG7 A;  1OJ4 A;  3WU4 A;  1K47 A;  2GQ0 A;  1H72 C;  4UTG A;  4UT4 A;  1MU5 A;  4HAC B;  1NHJ A;  2CGE A;  4M1K A;  4B3T E;  2V8P A;  3H4L A;  4B3R I;  4X62 I;  2Z5B B;  2X36 A;  2V34 A;  1I94 E;  4GKK I;  4DR7 I;  4OX9 E;  1N36 E;  4JV5 E;  4JI1 I;  4JI6 E;  1H7S A;  4FWG A;  3J7A G;  5BR8 E;  5IWA I;  2UU9 I;  2UUC E;  2HFS A;  2CZ9 A;  3ZZU A;  1S16 A;  1Z0C A;  4B3M I;  4IZJ B;  1Z0E A;  3J80 Q;  1N34 I;  4LF4 E;  3J80 C;  4DUY E;  4LFA E;  4DR3 E;  3OTO I;  4DR4 E;  3B8H A;  3WU3 A;  2GS8 A;  4I3H A;  4Z7C A;  1ZM9 A;  1HNW I;  4GKJ E;  2ZBK B;  4JI5 I;  5GMD A;  1IBK E;  4JI3 I;  2F4V E;  1XMO I;  4X65 E;  1KIJ A;  1HR0 E;  4YY3 I;  1FKA E;  1N0V C;  4DV3 E;  4WUD A;  4LFC I;  4DV7 E;  4KHP E;  1N0U A;  4DR1 E;  1XNQ I;  2UUA E;  2V2Q A;  1Z0T A;  4DR2 E;  4IZJ D;  1ZM4 A;  1Y4U A;  3J7A M;  4JI8 E;  2BV3 A;  2HHH I;  3LPS A;  2Z5E A;  2BM0 A;  4JI7 E;  4LF6 I;  3J81 C;  3PYD A;  1Z0V A;  4JI2 E;  2O1T A;  2E5L I;  3WU6 A;  3B78 A;  2PNM A;  3QT6 A;  4DV0 E;  2UUB E;  3HUL A;  3Q6M A;  1ELO A;  2IOP A;  4X64 I;  2O1U A;  5LMN E;  2HK3 A;  1Z5A A;  2VF3 A;  1DAR A;  4PRV A;  2BM1 A;  3LTO A;  3JAM Q;  4JI4 E;  4LFB I;  3JAM C;  2O1W A;  4KQV A;  4DUZ E;  2X7I A;  2ZIT A;  4WUC A;  1FWK A;  4B3T I;  1I94 I;  4DV1 I;  1ZXM A;  3T1Y I;  4OX9 I;  2O1V A;  1J5E I;  4JI6 I;  3Q6N A;  1PVG A;  2VQE I;  5IT9 Q;  5IT9 C;  5FLX Q;  2UUC I;  2Z5C A;  4B3S E;  1FJG E;  4NXM E;  1RR9 A;  4LF4 I;  4LF5 E;  1H74 A;  4JI0 E;  4LFA I;  3K17 A;  2WW4 A;  1XHK A;  4DR4 I;  1RRE A;  1Z0B A;  1HNZ E;  4B3R E;  2UXD E;  4X66 E;  4GKK E;  4DR7 E;  4DV5 E;  4AQY I;  2J7K A;  1IBK I;  2AJ4 A;  1USU A;  2F4V I;  4JYA E;  4X65 I;  1H73 A;  1ZM3 A;  3WU5 A;  1HR0 I;  4LF7 I;  3Q1Q A;  1IBM I;  4ED4 A;  2LJP A;  4DV6 E;  4LF8 I;  1N34 E;  4DR1 I;  2UUA I;  2ZM6 E;  2DEI A;  4NXN I;  4PRX A;  1XNR I;  4DR2 I;  4FW9 A;  1Y4S A;  3QT8 A;  2R3V A;  1HNX E;  4DV4 E;  4JI8 I;  1FWL A;  1FNM A;  2A2C A;  1IBL I;  3V5R A;  5GME A;  4P52 A;  4JI5 E;  4JI3 E;  4HYM A;  1B62 A;  3GON A;  4YHH I;  1NZ0 A;  1FI4 A;  2Z5C B;  3PRY A;  4P7A A;  1B63 A;  1USV A;  4DV0 I;  2UUB I;  2HKE A;  5LMN I;  1PIE A;  3M6A A;  3PYG A;  1HK7 A;  5LL6 R;  4R1F A;  4DR5 E;  1Z0W A;  4DPY A;  2VQF E;  3T1H E;  1N33 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...